5L4QA

Crystal structure of adaptor protein 2 associated kinase 1 (aak1) in complex with lkb1 (aak1 dual inhibitor)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
303
structure length
293
Chain Sequence
GYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP2-associated protein kinase 1
publication title Crystal Structure of Adaptor Protein 2 Associated Kinase 1 (AAK1) in Complex with LKB1 (AAK1 Dual Inhibitor)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 293
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l4qA00
2JAMA 3JXWA 3EMGA 4GT3A 4K18A 4BHNA 4FV3A 3TZMA 5HORA 4MAOA 2VUWA 3FZOA 3F69A 3Q6WA 3RI1A 2BMCA 4BDFA 1MP8A 4HYHA 3IW4A 5H8GA 5JGBA 2PY3A 3UG2A 3C4ZA 3N9XA 4KRDA 3REPA 4RIWA 2C3IB 3AMAA 4XOYA 1XH5A 3F5GA 4FKGA 4ANQA 4USDA 3PVGA 3QHWA 3RPOA 3IQ7A 4FT3A 4ASEA 5IUIA 1UU3A 2FSOX 3W33A 3VNTA 3UIUA 4HYIA 3DV3A 1KWPA 2IW6A 2J4ZA 4A9TA 3EQFA 3TT0A 3U9NA 4BI0A 2XNMA 5HO7A 4Q5EA 4FTIA 3FXZA 4W8EA 2XZSA 3UJGA 4U3YA 4USEA 3NZ0A 5HE0A 4Y85A 5AUWA 1CSNA 2WMWA 2C5NA 4RIOA 3BYUA 2R3MA 4MHAA 3IGOA 4ANNA 2YM6A 2BAKA 5HG7A 4C38A 4JX7A 3FQEA 4FL3A 5AP7A 3HZTA 5FP5A 2IW9A 4E4XA 3GCPA 4XRLA 4KIKB 5IISA 4CQEA 2BRGA 3ZLSA 2UZBA 2XEZA 3P9JA 3F9NA 1P14A 5HLWA 2NRYA 2B52A 2R5TA 5EW8A 3UQGA 5LVMA 2W1DA 4O21A 4D5HA 5FD2A 4JG8A 4Q9ZA 4M69B 2IJMA 4BCQA 1IEPA 4ZY4A 3QUEA 5HU3A 3CTQA 4E4NA 3R7UA 4F7JA 4WSQA 4BB4A 3NDMA 5C8NA 5AR5A 5HD4A 2I1MA 3QTQA 3OOGA 4I0TA 1VR2A 5TR6A 3EQRA 5J79A 2RG5A 1GIJA 2JKOA 2V62A 5D9HA 4S34A 4J99A 5FBNC 2UZEA 4C7TA 5LVPA 2QC6A 2VTTA 2VTLA 3WF9A 2XRUA 4FKPA 3DA6A 3ZDIA 1MUOA 5E8WA 4IXPA 4X3FB 2OFVA 5HX8A 2J0MB 3P86A 5HG8A 4ZLZA 4XBUA 3GU6A 4D4VA 5CF6A 3EFLA 4TYHA 5DWRA 2H96A 1OITA 2VWUA 3QGYA 3PPKA 3R1NA 5CEPA 3UYSA 2WO6A 3KKVA 3UNJA 1DM2A 3DKFA 2WTDA 3QQLA 3JY9A 3EN7A 3OT3A 5HE3A 1IA8A 2W1GA 4NCTC 3AD5A 2EU9A 2PVKA 4IAYA 3F3ZA 2LGCA 4X2GA 4F9AA 4S33A 3V3VA 1JSUA 3IK3A 4CV8A 4BVUA 3MVLA 3K5VA 4KSQA 4IADA 3Q9WA 3DKGA 3QQFA 5E1SA 4G17A 5BVKA 4CMTA 4JXFA 4CRSA 3VS2A 4FT7A 4LRKA 4YZDA 2XJ1A 5KHWA 2ZB1A 2HZNA 3PVWA 4FV0A 3FC2A 4M67A 4O0VA 2HW6A 3C7QA 2BDWA 5CU0A 5KNJA 5I9WA 4AFJA 1H26A 3RNYA 4RLLA 3GFWA 2W06A 2GHLA 5ITAA 3BV3A 4FT9A 1NVRA 1XH8A 5EM5A 2PZRA 2QURA 3RBWA 4EOQA 3DK3A 4JR3A 5KKRC 4HZRA 5D41A 4TYIA 4B8MA 2HELA 1Y57A 3UPZA 2YIRA 3PXFA 3Q3BA 2X7GA 3OHTA 4FKOA 5AUYA 3SHEA 3E92A 4L44A 3QZIA 4TL0A 4EEVA 4M3QA 2P0CA 3PG1A 4UY9A 3QQGA 1Q8YA 4HPTE 4EWHA 4FG7A 2OBJA 3V6SA 4RBLA 5GNKA 3FMHA 2V5QA 3AMYA 2G15A 2OGVA 4JDHA 3AC2A 4JDIA 2I0HA 4PWNA 3A7GA 4AA0A 5CXZA 2B9FA 4OBPA 1W7HA 4QP7A 5C03A 2EWAA 5HIEA 3EQIA 3QQUA 4YNOA 5GJGA 4TY1A 2W96B 2V0DA 1FMKA 1ZYDA 4BDCA 2Q0NA 2OJIA 4JG7A 5JT2A 4YBJA 3DAJA 3E93A 3GI3A 4ITJA 3R8PA 3D0EA 4WKQA 3F2AA 2UZTA 4XP3A 2YM3A 3QKKA 3PY1A 4XX9A 3SC1A 4CYJA 2QHNA 4M12A 4E5WA 1M7QA 3DT1A 4CEGA 4WBOA 3P7AA 3UODA 3R28A 5BMSA 4QMQA 5FGKA 3SKCA 1V1KA 4ACCA 4F70A 5HTCA 3C4XA 4RQVA 2IVVA 3E87A 2UW6A 4CT2A 5HX6A 3ZHPC 2SRCA 5CVFA 1TQMA 1YWNA 1VJYA 4C0TA 3EQHA 3COHA 2E9OA 1G3NA 4BCPA 4RA5A 4BBEA 1OPJA 2ZM4A 3UGCA 3QFVA 3FY0A 1A9UA 1PXIA 3LFFA 4AZFA 3FKLA 3NIZA 3OEZA 2VTQA 5IA4A 3S00A 3D5WA 3HUCA 4FODA 4U42A 2ZV9A 3D7TA 3DKCA 3GU5A 4RIXB 5LCKA 3KGAA 3LVPA 1MRVA 4UALA 4NM3A 3HLLA 4D28A 3I0QA 3EN4A 2ZAZA 3QRJA 2VTJA 4KKEA 3EQPA 4PMMA 2QCSA 3R7VA 2PZIA 2Q0BA 3V5WA 5JK3A 2X7FA 5TT7A 3CE3A 5D10A 3RKBA 5EG3A 3TNPC 4HJOA 3TTIA 3BWFA 3LM0A 2A1AB 4GG7A 5E1EA 2ETRA 3QD0A 3VS0A 4BDGA 5IH6A 1ZMVA 3BIZA 4CMOA 4QYEA 3V5TA 1FINA 1JSVA 3F88A 3MV5A 4RX5A 5I3RA 2W9FB 4EC9A 2R3PA 2UV2A 2H34A 2DS1A 2C5YA 2YN8A 2XIYA 5HOAA 4DFYA 3ORLA 4KINA 3U4WA 3VBXA 4BWKA 1U5QA 2YEXA 4AT5A 2RF9A 4UXLA 3OP5A 3W10A 2G2FA 4BGQA 3ZOSA 3GCVA 3F82A 4QQ5A 3R2BA 3BGQA 3KK9A 4M66A 3E62A 1ZYJA 4ITIA 4QQJA 3EFKA 4XG8A 4ZAUA 1Q4LA 4R6VA 4I6QA 2XJ0A 4I3ZA 5M4CA 3ZXTA 3OF0A 4O22A 3QU0A 2YITA 3OUKA 4O6LA 4TYEA 2W5HA 2BRMA 4FNXA 4K33A 1YRPA 2AC5A 4U41A 3NUSA 4C33A 3IOKA 3FLQA 3FMMA 4XUFA 3P4KA 4ID7A 5G1XA 4OTPA 4EH8A 2F9GA 3W2QA 3ENMA 3ZU7A 4EH3A 4WT6A 4ACGA 3UQFA 1UKHA 1JNKA 4C4JA 5AUTA 3BYMA 2JFLA 5FP6A 5C8MA 4AA5A 4IJ9A 2OJGA 2CJMA 2PMIA 3KCKA 3ZRKA 3AT4A 4TKSA 4L3PA 4U44A 2X9FA 4L45A 4EL9A 4L67A 3FV8A 3C1XA 2CN5A 1H1SA 3O17A 4YHJA 2YAAA 3R21A 2HWOA 5KMJA 5L2IA 1STCE 2VV9A 4GVAA 2YIQA 3EFWA 3TN8A 5KMKA 4IE9A 3QD4A 2QOOA 3NEWA 3ZEPA 4NIFA 3I6UA 2UZNA 2VZ6A 4BCKA 3UIBA 1H1QA 4R5YA 4G3EA 3V5PA 3ZEWA 4I20A 3IONA 1PYEA 5FDPA 5K3YA 2XMYA 3R9OA 2AYPA 2XKFA 1HCLA 3HYHA 5E8YA 4BBMA 3H3CA 4FVRA 3M1SA 3ORMA 4OTIA 3U6HA 2X1NA 3WF5A 4CZUA 5EI8A 4AFEA 4K9YA 3ORTA 4H3QA 3GENA 1ZMUA 3NX8A 4M69A 3AC5A 3NNXA 3V01A 2WMSA 1QL6A 1LUFA 1J1CA 2XVDA 3RCDA 3CPCA 5I5ZA 2ONLA 2WQEA 3NR9A 4KKHA 4KSPA 5FWKK 4CXAA 5AV4A 2RFDA 3PTGA 2R3FA 5AP5A 2PMNX 4FSRA 4IB1A 4QO9A 4ZSEA 5I9UA 2YAKA 3FKOA 4Z3VA 2RSVA 2W4KA 1CTPE 3Q9ZA 5JH6A 3GEQA 2ZV2A 2OICA 4LOQA 4W4XA 4D1XA 4GYIA 4B4LA 4Y46A 3FJQE 4BZNA 2ZV7A 3CJGA 1F0QA 3A8XA 3DBFA 4IHPA 2UZOA 3DBEA 3GQLA 4MKCA 2XM8A 3FI3A 3NCGA 3BQRA 1DS5A 2PVLA 5JEBA 4FL1A 3EIDA 4A7CA 4AGWA 1PMUA 2PZ5A 3FLZA 5A9UA 1JKLA 4GFOA 3KN6A 3PPJA 5EYMA 4AW2A 4QPSA 4IX6A 4ZLOA 3BWJA 3ZUUA 3KCFA 4GSBA 4WUNA 2UW5A 4CYIA 3R00A 4NKAA 1GZ8A 4EZ5A 4YLJA 3S1HA 3H9OA 4EHGA 4AAAA 4XMOA 2R3QA 3CKWA 5HG5A 3KU2A 3UMWA 2UW8A 3GOKA 3MTLA 1BI7A 3KXNA 4EK5A 3VHKA 4IM2A 4KBCA 2ITNA 1AQ1A 3ZFYA 5J95A 5IPJA 5I3OA 3TWJA 3F5PA 4TPTA 4J71A 3BRBA 3QQJA 3ZUVA 2XS0A 5LOHA 4GT4A 4IX4A 1PMEA 3DJ7A 3UE4A 5M4IA 1Q5KA 4QYHA 1RE8A 4OT6A 4EORA 2HXLA 2J51A 4N6ZA 4OGRA 3RP9A 4JIKA 2OKRA 3OWKA 3MSSA 4UMTA 3KMMA 3FZ1A 4A9SA 3ZO2A 1FPUA 2NO3A 3DOGA 3D14A 3I7BA 4L3JA 3BYSA 4BKJA 4C61A 2BZIB 2R7BA 3DDPA 3NYVA 4FSYA 5CALA 3GFEA 3OY1A 5L2QA 3AGMA 4BCIA 4PV0A 4IH8A 4DHFA 4BCNA 4BDHA 3FQHA 2XBAA 3Q5ZA 3UP2A 2XIRA 4UXQA 4EOLA 5CNOA 1WZYA 3Q4TA 4FI1A 2HZIA 2YIYA 2C47A 5E8SA 5CAUA 2UW7A 3MYGA 4IEBA 5AIRA 4FK3A 3A7IA 4ZTQA 3RAWA 3ANQA 3FL4A 5B2MA 4GS6A 2AUHA 2WTIA 2XNOA 2XYNA 3MFRA 5KKRB 2BFXA 2BRNA 4EH6A 3LFEA 2WEIA 1U5RA 4I4EA 2VTIA 3QAME 3MVMA 4D1ZA 3QZHA 5AR3A 3K5UA 4V04A 2OIBA 3VVHA 2EVAA 1O9UA 3OFMA 4AZVA 5J5SA 1XH6A 2WMBA 3IDPA 2IN6A 3KXZA 3LFSA 4PUZA 3RK5A 2YM8A 1YHVA 5EYDA 4UMPA 5IDNA 2B54A 2XNGA 2GS2A 2QOIA 5CAQA 5ETIA 3FDNA 4NW5A 3G0FA 3K54A 4WIHA 5JQ8A 3KVWA 3VN9A 3NYXA 4GK3A 2XNEA 4OAVB 5AP0A 3TNIA 3F3TA 4JLCA 1B39A 4PPBA 5DT3A 2C0IA 2WMTA 3D5UA 4LL0A 3VUTA 4EC8A 3MFSA 2YA9A 4RGJA 3Q2MA 4FTOA 2FSLX 4CKJA 5D12A 3AOXA 3Q4UA 4S31A 5CAPA 3ZSGA 1Q61A 3ZLYA 4QP4A 4ZTSA 2C0TA 3UZPA 4PX6A 2YJSA 4XEYA 5HLNA 3H30A 3LFAA 2VX1A 3R0TA 2XNPA 3P79A 4FZ7A 4N6YA 4RJ6A 2XBJA 2QNJA 3G90X 4FV1A 4MQ2A 3LJ1A 5EW3A 4YMJA 4WG3A 2OXYA 3R01A 4DGNA 2ZMCA 3LXNA 5CQWA 4QMXA 1M7NA 2QR7A 3QTWA 3LOKA 2YWPA 3OWJA 5DIAA 4U9AA 1APME 2JIIA 5AV0A 3SRVB 3ZUTA 4RIXA 4RX7A 4C34A 5JGAA 1QPEA 2R3LA 5LVNA 3PIZA 1PXPA 4QP8A 5AP4A 2W1CA 4IC7A 4MX9A 4OAUC 4B99A 5GJDA 4FZAB 4FTAA 1PF8A 5FXQA 3VJOA 1HCKA 2CKEA 4K2RA 3HEGA 5AUVA 2OO8X 5EOLA 5BVFA 5LMKA 4OR5A 3VS1A 4DG0E 5AADA 5HCYA 2C68A 5FRIA 4RJ4A 5A4TA 3O51A 3WE8A 3ROCA 2WMUA 3GU4A 4IB3A 4P90A 4C4EA 5JGDA 4JQ8A 4HZSA 4QYFA 5I4NA 5DFPA 3KRWA 3SW7A 4Z16A 3FPMA 2XK3A 4I5CA 3KN5A 3ZMMA 4PPCA 5FM3A 5AP2A 1NXKA 1ZWSA 5A4CA 1OUKA 4YJRA 2C5XA 2ITOA 4WHZA 2JAVA 4AN9A 4YU2A 3C50A 5CY3A 4QP1A 3IPHA 5I0BA 5CSPA 5HVKA 4RFYA 2PVMA 3GOPA 4G16A 5DT0A 3HRFA 3JUHA 2V7OA 3UC4A 3R1YA 4Z7HA 3RAIA 5BUIA 3PA3A 4MBLA 4GH2A 2BPMA 4ZS0A 1E1VA 2C6DA 2A27A 4ALVA 1ZYCA 5K0XA 1FOTA 3FMLA 3UOJA 2PMOX 4PDOA 3MGYA 1OECA 4R7IA 2Y6MA 3HV6A 3K3JA 4IX5A 2XCHA 3E8CA 3A7JA 2RKUA 1R39A 2QOBA 4C8BA 3OROA 4L00A 2J2IB 4GIIA 2OF4A 2YIXA 4B0GA 1XWSA 4GG5A 1J3HA 5EHYA 2OSCA 3L8PA 3R7GA 1XR1A 3HDNA 1KE8A 3OS3A 4CFUA 1H00A 5KBRA 2ZYBA 1YOJA 2UZWE 3W2RA 5EDPA 2F2CB 4PTGA 3PJ8A 3QTXA 2BRBA 2W5AA 2OW3A 5AA8A 3VRZA 3OXZA 2W1IA 4FT0A 4UYAA 2J50A 3KA0A 3LXLA 1RDQE 2RL5A 2XRWA 3ORPA 2NRUA 3S2PA 3QQKA 4FIGA 4I0SA 2HZ0A 1WVYA 2QOFA 3EQGA 3VO3A 4OTDA 5HCZA 5AMNA 3OEFX 2JLDA 3IECA 3W32A 4FF8A 4EH7A 2RIOA 4C58A 3SQQA 4XNEA 5H9BA 4FICA 2HXQA 1A06A 1H8FA 4CKRA 4RC2A 1J91A 4GCJA 5AP1A 3FMEA 1L3RE 2CMWA 2ZOQA 4E5BA 5HBJA 1SZMA 1TQPA 2OFUA 3Q52A 4QNAA 3VF9A 3A99A 4IVBA 2YIWA 3A4PA 4NK9A 3U87A 5ETFA 1Q62A 4U8ZA 3VS3A 2X8EA 3R2YA 4WA9A 3L8VA 3V8SA 3DTWA 3PPZA 2J0IA 2C3JA 3LCDA 4DFZE 2ESMA 2C6TA 3NAYA 5GJFA 4RC4A 4BGHA 1ZY4A 5M56A 1F5QA 2XJ2A 3ULIA 4FYOA 3T3VA 4GYGA 1URCA 4O2ZA 5HO8A 4JBOA 4X21A 4C3PA 5JMSA 3AQVA 4WOVA 5D7VA 1GNGA 3W8LA 3HMOA 4O0TA 4UEUA 3QWJA 3TKHA 3UBDA 1K2PA 4CTCA 4MH7A 3LFDA 4WO5A 1XO2B 4FX3A 4G2FA 1BI8A 3CY2A 4YZMA 3V5LA 3P7CA 4HVSA 3JS2A 3Q5IA 5LVOA 2R3GA 4RLKA 3QA8A 4ZXTA 5A6OA 4IWDA 1GZOA 3TJCA 1ZRZA 2R7IA 3VBVA 5HO6A 3PWYA 3OCTA 1H25A 5E8VA 2OZAB 4CZTA 1U59A 2GNIA 1OI9A 4TWOA 3SW4A 3MJ1A 2UVZA 5LVLA 2UZVA 4KD1A 3TKIA 5HNGA 1W0XC 4IAZA 5IH4A 3CKXA 4FV2A 3VW8A 2WELA 3C4CA 3G5DA 4GW8A 2C4GA 5D11A 1V0BA 4BTJA 2WAJA 3UIMA 3WARA 5KUPA 3RPRA 4DH7A 2JIUA 1JAMA 4G6NA 4TYGA 4DEDA 5BNJA 1I09A 2C5OA 4GJ2A 5ANOA 4N4SA 2O3PA 3ITZA 3FLWA 4W8DA 2I0YA 4IZ7A 4EH2A 3C0IA 3IKAA 3RK7A 3PLSA 2R3JA 3MA6A 4ZTNA 4F08A 3CP9A 5A4LA 2RG6A 4V01A 2E2BA 5AIKA 4ONAA 3S0OA 1PHKA 4QMSA 4Y8DA 3MH3A 4LGDA 3I60A 3QRKA 4R1YA 5DGZA 5IF1A 3RPSA 3VS7A 3QXPA 2UZUE 1ZMWA 3F3VA 3K3IA 2KTYA 3VULA 2C6IA 3RTPA 2XNBA 3OOMA 4WUAA 4DG2E 3UOHA 3AG9A 4AS0A 4RWKA 2HK5A 3D94A 3PJ2A 2YACA 3QCQA 1FVVA 3FL5A 5EK7A 5HTBA 2IVSA 4DEBA 3FZPA 4FSMA 4F6SA 5L4QA 1WBTA 1OKWA 3FMJA 5AAFA 4MXXA 4B6LA 3EOCA 4U6RA 5CVGA 2H9VA 2QO9A 4FC0A 1B6CB 4CTBA 4F1TA 4F1OA 3R1QA 1P4FA 4FTTA 3ZO3A 4O6EA 4E8AA 2C3LA 2ZDTA 2QU5A 2X7OA 4BL1A 1FVTA 5DI1A 3ZFMA 3EN9A 5AP6A 3MFTA 4JQ7A 4YTCA 1XBAA 4RZVA 4BIEA 3R7YA 4DFXE 2JFMA 4O1OA 3FHRA 3TCPA 3O7LD 3F2NA 4RIYB 4OTRA 1OL7A 4XV9A 2O0UA 3G33A 2VX3A 1XJDA 3FI4A 1S9IA 3CBLA 2EXMA 1PJKA 4FTQA 2GNHA 1O6LA 2BHHA 1YWRA 3W2OA 3R6XA 4AE9A 3BQCA 3CQWA 4ASZA 3U9CA 1QPJA 3A4OX 5EDRA 3S4QA 3D2IA 5EM6A 5KMNA 4FL2A 4CV9A 4O38A 5ETCA 4EUUA 3DFCB 3AT3A 3FZTA 3OD6X 4LRMA 3UVRA 2VTNA 4M7IA 5DRBA 1Q99A 3QTIA 2XNNA 3IDCA 3EKNA 3NW6A 5JKGA 3SRVA 4TN6A 4U81A 4U3ZA 2QU6A 4OBQA 4HVHA 2ITWA 1W82A 3KF7A 3GC0A 5IDPA 5JRQA 4JI9A 1E9HA 3KMWA 4F7LA 3EN5A 3PFQA 4RVMA 5L8JA 2YZAA 4H1MA 4KS7A 4IAFA 4PDSA 5C9CA 2EB3A 2YLEA 2GPHA 4YJOA 3ZRMA 5C26A 3E5AA 1WFCA 3T9IA 4HCTA 4QTDA 3OZ6A 1R3CA 4QP2A 4AZEA 2O63A 4XV2A 5M4UA 2VWBA 2F49A 3RALA 4CZYB 1YDRE 4FG8A 1DAWA 1H0VA 2HW7A 2VTPA 3A7FA 1M2PA 4AUAA 4IDTA 3QX2A 4QT1A 3MY5A 5HESA 3UOLA 3UPXA 4DAWA 5DMZA 1U4DA 4EHVA 1YXSA 4IVAA 3UO5A 2O5KA 1MQBA 2XKDA 4E3CA 3G2FA 3VUKA 4YJVA 2QOHA 4NWMA 5IEXA 2W7XA 3MVHA 3DPKA 4LL5A 2WQBA 2IW8A 3R8MA 2EXEA 4DN5A 3DAKA 4QMPA 3JYAA 4X2NA 3EN6A 3V51A 4QMNA 4M84A 2YCRA 4GIHA 4FKLA 4QP9A 5ANIA 4F09A 2PVRA 4C4GA 4BDDA 4W4WA 3ZYAA 1IRKA 2P4IA 1XH9A 3GGFA 5AAEA 4QMOA 3NLBA 2XK6A 3BX5A 2QQ7A 2HENA 4FZFB 3CC6A 4XCUA 4A07A 2WXVA 3C51A 3F3WA 4GFGA 1PW2A 4YZCA 4FKVA 4BN1A 1PXJA 2YHVA 4DC2A 3R7OA 3W8QA 3ALOA 3EYGA 4KS8A 5HICA 5F1ZA 3L1SA 4FV7A 4QPMA 3ZDUA 4DH1A 3A8WA 2ETKA 3RCJA 2G2IA 1YKRA 3ZFXA 2OWBA 5AR2A 1TKIA 1SYKA 4BZOA 3L9PA 4D9UA 3OCGA 1S9JA 1URWA 3KMUA 2ITXA 3NUXA 2VWWA 5H8EA 3UMXA 3NRMA 2Z2WA 4IX3A 4EHZA 4ZSLA 4FIIA 2UUEA 5CXHA 1M2RA 3GP0A 1GIHA 3KK8A 4MQ1A 5M44A 3IW7A 2ITTA 2VO6A 4HGTA 5L2SA 3R71A 2HZ4A 2J0JA 3E64A 4JS8A 4YPDA 4XP2A 2Z8CA 3SX9A 2FSMX 2OF2A 4ERKA 2QKRA 3OT8A 4L46A 4L3LA 4AOTA 4IJPA 4F7NA 3QRIA 4O0SA 2WPAA 4QTBA 5EM8A 3ERKA 2XP2A 3EZRA 2W9ZB 3BKBA 4MF1A 3VC4A 3F5UA 3KQ7A 1SVHA 2BDJA 3FSKA 4D4RA 5H8BA 5DBXA 3R02A 2YCQA 3EKKA 4QQTA 5CYIA 4CFNA 3L8SA 4WNMA 5AUUA 4E26A 4WG5A 3E7OA 4YLKA 5ICPA 4TZRA 5IUGA 2G01A 5HHWA 5CT0A 4FNZA 1OGUA 3P5KA 4DGGA 1OMWA 3E88A 4D2TA 2W5BA 3E8NA 3DU8A 2PVJA 3I79A 3P0MA 3R22A 4K0YA 2OJ9A 1XBCA 3ORKA 2Z60A 4QNYA 2OIDA 4EQCA 2RGPA 3BV2A 2R4BA 4BDJA 4APPA 3AGLA 3LFCA 4NUSA 3FSFA 5DR2A 4IC8A 4AA4A 4CCBA 5AEPA 4AQCA 4XBRA 4J1RA 3MJ2A 3KXXA 4I4FA 4L9IA 4A4LA 5IA0A 5L6OA 4FSUA 4FTUA 3MPAA 1AD5A 3Q53A 4L52A 3VUIA 3MPTA 4V0GB 4JRNA 4EQMA 4M15A 4IAAA 4I94A 2XIXA 2ZV8A 3HRBA 3PP1A 4I5MA 3FYKX 3Q04A 4WNKA 5B7VA 4J96A 4LGGA 4L8MA 3U4UA 2OZAA 4F9CA 3SD0A 3OC1A 5HI2A 2A4LA 4YZNA 3TV7A 2Y4IC 2R9SA 1R78A 3EL8A 2W1FA 1IR3A 2VTMA 3EQCA 5E8UA 4ZK5A 5KCVA 3G6HA 2CCIA 2F4JA 2XH5A 4L43A 3FC1X 4XG4A 5CSVA 4YNEA 1WBVA 3JVRA 3W55A 4E4MA 1JOWB 4JBVA 2PE0A 5BYZA 3AMBA 4UWYA 3WIKA 4HCUA 5HVJA 4KBKA 2OU7A 4GU6A 4PF4A 2EB2A 2VO3A 2VX0A 2C3KA 3HMNA 1CKPA 3LXPA 4PDPA 4ANOA 1AGWA 4G6LA 4AWIA 4C59A 2BFYA 5CU3A 3WF8A 2XKCA 5KO1A 4HCVA 1ZOHA 2QR8A 3LQ5A 3RPVA 2XIKA 4B8LA 4CKIA 3BZ3A 3PY3A 2VAGA 4R1VA 1H08A 5DLSA 3QC9A 3KEXA 4QP6A 2C69A 3FMKA 3HMPA 2W4JA 4XV3A 3FYJX 4HVIA 3RVGA 2VWZA 5TE0A 1T46A 4UMRA 1P4OA 2PK9A 4HGEA 4ZY5A 4O1PA 3TKUA 1G5SA 3DXNA 3DB8A 4R7HA 3RAHA 4F0IA 5AM6A 3UDBA 4MD9E 3RZFA 4D2PA 3FI2A 3BE9A 2FH9A 4FNWA 3CCNA 3PRIA 1SMHA 3QQHA 3QTUA 4L01A 4L6QA 4NKSA 3SOAA 3DDQA 4ANSA 3RGFA 3HX4A 3O7LB 4R3PA 3T9TA 4DEAA 3QTRA 2WZJA 3B8RA 3R83A 3F7ZA 2BILB 4BYIA 3ORIA 5J7BA 4KIKA 2OJJA 2R2PA 4IM3A 3NAXA 4R3RA 4F99A 5C27A 1WBNA 4AGCA 3NNVA 3C4FA 4YTHA 2KULA 2QHMA 2WEVA 3CQUA 3MN3A 4JQEA 4RIYA 4YJQA 4MNFA 4WNOA 5DOSA 2JKQA 4QMMA 3PXZA 3UZTA 4GUBA 3VW6A 3DQWA 2QD9A 2W1HA 4FTKA 3OW3A 3QUPA 2BRHA 1JKTA 1GZNA 4NM0A 2WTKC 4D9TA 2Y6OA 4ZSAA 5HD7A 5JFWA 3HV7A 5CSWA 4H39A 4XP0A 4F65A 4ZTMA 3FPQA 3WI6A 3FY2A 3H10A 4XLIA 1UNLA 4U97A 3G9LX 4FMQA 4FUYA 4OTHA 3SXSA 3A62A 4UN0C 4TNDA 1F3MC 3HP5A 4X3FA 2VTAA 5EHLA 2C6LA 1WCCA 3F3UA 3PSCA 4FVQA 4JG6A 3RNIA 5IA2A 2WNTA 3BHUA 3BYOA 3GQIA 1JPAA 3DS6A 3R8VA 5IH5A 4BYJA 4FVPA 4ZSJA 3ZC6A 2UW0A 4PQNA 3JVSA 1K3AA 1TVOA 4CFMA 3DY7A 3H4JA 3PVBA 3IGGA 3TTJA 5KMLA 2CGXA 2ITPA 3DLZA 4GU9A 1R0PA 4Y95A 1YI4A 3MFUA 4M14A 3PZEA 4EHEA 5L8KA 1O6KA 2GMXA 2OG8A 3II5A 4E20A 1W84A 3GBZA 1PXKA 5E8XA 4Y5HA 2XYUA 1GZKA 3R63A 3R1SA 3QX4A 5FLFA 4F4PA 4J97A 4TWPA 3OTVA 5DE2A 2GQGA 5I9XA 3HRCA 1YI6A 1EH4A 2OJFE 4NTSA 4PNKA 4OW8A 3PXKA 4AZWA 1OKZA 3QKMA 3ZO1A 4II5A 4FSWA 5GHVA 3E8EA 3AT2A 4BDAA 4Y73A 4ANBA 4FR4A 2VNYA 4HGLA 2F7XE 3ZLWA 4EOIA 4LV5A 5L6WL 1BX6A 4MWHA 2DUVA 2C30A 4YP8A 4RJ3A 3CPBA 4UMUA 3EB0A 4M0ZA 4DG3E 4TW9A 3QTZA 3MPMA 3TV4A 2HOGA 4UB7A 3EL7A 3RK9A 4BCGA 2ACXA 2C1BA 3MH1A 5A6NA 4BDKA 4G9RA 3FXXA 5EM7A 3V04A 4PRJA 4PNIA 2PVYA 3LJ0A 4QYGA 4S2ZA 4AZSA 3BBWA 4IMYA 4K11A 4O91A 2VTOA 5F9EA 1Y8YA 4BBFA 3QF9A 1KOAA 4RIWB 4FTCA 3TZ7A 4F1MA 3NGAA 2C6MA 3HV5A 5CEOA 2QG5A 2JBPA 5FBOA 4YR8A 5K5XA 2WMRA 3LZBA 4D0XA 4RVTA 1Q3WA 3O8PA 4CD0A 5HEZA 2YM5A 3HGKA 4IWPA 5M51A 3RM7A 4GFMA 3EHAA 1H27A 4F7SA 1Q8TA 4JDKA 3D7ZA 4HOKA 3HA6A 4MWIA 3Q6UA 5GZ8A 1SNUA 2OK1A 4QMYA 5DH3A 4GV1A 4MCVA 4FKWA 2HAKA 2G2HA 3B2TA 3RHKA 3MB7A 4P7EA 2EUFB 4W9WA 1U54B 1B38A 3UTOA 3R8LA 4R5SA 2P3GX 3KXHA 3PSDA 3E3PA 4FZDB 5AUZA 1OL6A 3UP7A 4H3PA 3QWKA 3ANRA 5BVOA 1ZZLA 2E9UA 4I93A 4YGAA 2J0LA 3SXFA 2ONLC 3G6GA 3UOKA 3HP2A 1YHSA 4P4CA 1OKYA 4F6WA 4CNHA 4O0UA 3OCSA 2WU6A 2OIQA 1VEBA 5GZ9A 2QODA 4FSZA 1GIIA 3ZXZA 4E73A 4PP9A 4C4FA 2XEYA 3S3IA 5CSXA 4NFMA 3POOA 5CF4A 3I1AA 3LMGA 5FM2A 3KULB 3GCUA 1DI9A 5LCJA 4IFGA 3R8UA 3BBTB 2GNFA 3QHRA 5FDXA 3E8DA 2HCKA 4WBBB 5D1JA 5HKMA 3A7HA 4J8MA 3F7WA 1PXNA 3CLYA 2VRXA 4C62A 4Z55A 4YTIA 2B9HA 3ULZA 3QALE 2DYLA 4CLJA 4PL5A 3HV3A 4UX9A 4I6HA 2PZYA 3WE4A 4BDIA 4BZDA 2C5VA 2J5EA 3FE3A 4U43A 1YXTA 2BUJA 3DK6A 3AC1A 4N0SA 4ALWA 1R1WA 5DVRA 2O2UA 4NFNA 4JOAA 4LMUA 3OW4A 2I0EA 4WRSA 3POZA 2X8DA 4ERWA 4G3FA 3MVJA 4FEQA 4FSNA 1Y8GA 2X4FA 1H1RA 2JD5A 1UU7A 3W1FA 1XQZA 4BDEA 4C02A 3MDYA 4YPSA 3ENHA 3G51A 4XG6A 4ZTLA 2VWVA 4I92A 4RMZA 2Y4IB 3I81A 4QMWA 2V22A 5HIBA 4H58A 3AC3A 3ZC5A 3P1AA 3NW5A 3WYXA 2Z7RA 2ERZE 4HVGA 2BZJA 2OXXA 3B2WA 4YURA 4RG0A 1YW2A 4YO6A 3NCZA 4NH1A 4OTWA 1FVRA 3R9DA 4DLJA 1H4LA 4PTCA 3NSZA 4G6OA 1KV1A 2JKKA 4KKGA 3BCEA 4H3BA 4AACA 2B4SB 1UU9A 3D83A 4O0XA 4E6AA 2OI4X 3MH0A 1H07A 1IG1A 3RZBA 3FWQA 4USFA 4AN3A 4BCJA 5A54A 1KE5A 3THBA 1K9AA 3OG7A 2QONA 3KRRA 5FXRA 3GC7A 3BGZA 3RHXA 3ROYA 4YO4A 2E9PA 1BMKA 5EYKA 2P55A 3DKOA 2ZM1A 3Q96A 2X2MA 1ZXEA 3OMVA 4JX3A 5I9ZA 5BVDA 3KL8A 4L53A 4MBIA 4EH5A 5B0XA 4BTFA 4FA2A 3H9FA 5J7HA 1FGKA 5CLPA 4G3CA 5BUJA 1H01A 2V7AA 3H0ZA 4HVDA 4MXOA 3OY3A 3TZ8A 3TUDA 3DGKA 3IOPA 3WIGA 4D4SA 3F61A 4EOOA 3QA0A 1SM2A 1CKIA 4J7BA 1T45A 4L42A 4XV1A 5DR9A 4EK8A 4ZIMA 4RWLA 4C4HA 5KMOA 1QMZA 3GB2A 4IB0A 4IB5A 4FKJA 4DFNA 3U6JA 3TEIA 3GU8A 4KIPA 5ANEA 4TWNA 1BUHA 4FYNA 2HYYA 5A4QA 3LFQA 5F95A 2B55A 3D2KA 4MD8E 4EK3A 1CKJA 3FZRA 3WZUA 4OTQA 4UV0A 1RJBA 2QO2A 4FV6A 5AJQA 2QLUA 4ACMA 5BYYA 1BL6A 5CASA 4IIRA 4U7ZA 5HCXA 3EJ1A 4IAIA 5CF5A 4FIHA 3HKOA 4KIQA 1WBPA 4FZ6A 5J9YA 1YVJA 5DNRA 4KA3A 4GK4A 3DTCA 3U8WA 4O0WA 3UIXA 4APCA 4XOZA 2R3OA 3VRYA 5L2TA 3IW8A 3LLTA 4AX8A 4RVKA 2H6DA 1JBPE 4ENXA 2X4ZA 4G3DA 2IVTA 4F0GA 4LV8A 2QLQA 2WTVA 5HZNA 1SNXA 5E8ZA 2GCDA 3GCQA 2PUUA 3CTJA 3CIKA 3NUUA 1ZARA 3GCSA 3D7TB 4O27B 5HBHA 4D0WA 2W17A 5LMKC 4YBKA 5LARA 2QVSE 4I22A 2WD1A 2BROA 2UZLA 4MTAA 3LE6A 2JKMA 4BIBA 3AD4A 4IQ6A 2BIKB 3TXOA 5KMIA 4JRVA 2GDOA 2P33A 3COMA 5HE2A 4Y83A 5H3QA 5JFXA 1JWHA 4KIOA 3BELA 4EWQA 3FLYA 4FGBA 3LXKA 5KZ0A 4NCTA 4G5PA 1WBOA 5EDQA 5DRDA 3KY2A 2WFYA 4FTNA 3JY0A 4FIFA 3QLGA 1LEWA 3LIJA 4BWXA 3PE2A 2CPKE 3HDMA 4QOXA 4C2WA 3VAPA 3CD3A 3QRTA 3E7VA 1XBBA 5EKOA 5M55A 2R0IA 3FMNA 3V8WA 4D5KA 2PE1A 4RQKA 3VJNA 5KHXA 3GU7A 3VS5A 4EJNA 5J1VA 1W83A 2WIHA 3HVCA 4YC3A 2JITA 3MI9A 4OLIA 2BTSA 4GUEA 2FSTX 5FTQA 4FG9A 4RJ5A 4KRCA 4G34A 4X6QC 2WB8A 3FZSA 5M4FA 1NY3A 4XH6A 3MA3A 4AGDA 4CQGA 2GFCA 4LM5A 1LEZA 3F6XA 4RRVA 4I6FA 2A0CX 3KB7A 3PIYA 4U5JA 2O64A 4WSYA 3KRJA 3UG1A 4GL9A 3AXWA 2UW4A 4JL9A 2ITZA 3TJDA 1OIYA 1QPDA 5CSHA 3LHJA 3R8ZA 4EUTA 4EOMA 3OBJA 4BRXA 1MQ4A 2ZJWA 3RPYA 2Y8OA 3Q60A 4A4XA 2VTRA 1UNHA 3VUDA 2YDIA 4FOBA 4BKYA 4BI1A 2BTRA 2WGJA 1PMVA 4HGSA 5CTPA 3OCBA 4NW6A 4QMTA 2X39A 1PYXA 3MY0A 3MWUA 3DNEA 3GC8A 3HL7A 4UWBA 3CR0A 5B2LA 1UV5A 4AXAA 4CT1A 2CDZA 3ZSHA 3VBTA 2WIPA 2PMLX 4XG3A 5K0KA 4EBWA 3FMDA 4E7WA 5JRSA 4E4LA 4L7SA 4E6CA 5HU9A 1TQIA 2WQNA 5A46A 5AP3A 4Z9LA 3QGWA 4RX8A 3O96A 4S30A 4MVFA 2ZM3A 3E3BX 4U40A 4XHKB 4FIEA 1U54A 5JZNA 3C4WA 4Y72A 4BTKA 3LFBA 3I5ZA 4BWPA 2JDTA 4NIFB 5AR8A 1MRUA 5FEDA 2BR1A 3ZH8A 5CS6A 3Q32A 3ORNA 3C0HA 5TKDA 5C8KA 1P5EA 2YM4A 3OWPA 1PXLA 2WQOA 4QMUA 2X0GA 1Q97A 3R7IA 1Q8UA 3B8QA 4UBAA 4KB8A 4EZ3A 4XG9A 3BLQA 5CEMA 1UU8A 4I23A 1ATPE 3NW7A 3NYNA 3PRFA 5IKWA 2R3IA 4Y5QA 3NUNA 2AC3A 5DR6A 2ERKA 3D9VA 2R64A 3OWLA 2WOUA 2W1ZA 3HUBA 3N51A 2IO6A 3S95A 4NM7A 4BIDA 3OBGA 3KULA 3FKNA 2QKWB 4O2PA 5IA3A 3WF6A 4DINA 4AP7A 1OUYA 4A9YA 1U46A 5CWZA 2NP8A 4C35A 4ZY6A 2PVFA 4CSVA 1LR4A 4A4OA 4RWIA 2YCFA 3MTFA 5BVEA 3KF4A 1YHWA 3LQ8A 5DHJA 1VYWA 5T3QA 4D2RA 1REKA 1SVEA 3GVUA 4KWPA 4AOIA 3PZHA 1GOLA 2WQMA 1JSTA 3FHIA 4AW5A 1Q24A 1VYZA 2VD5A 5KZIA 4RVLA 4F9BA 5BVWA 3R9HA 1YXXA 3QZGA 4PP7A 2NPQA 2W99B 2YDJA 4E93A 1ZZ2A 3PSBA 4JJRA 4TWCA 2I0VA 4ASXA 4M68A 5HIDA 3C0GA 5DG5A 5E92A 3VBQA 4CFFA 4O0RA 2W1EA 4D2WA 1YDSE 2QOKA 4KAOA 3T3UA 3VIDA 4P5QA 2IWIA 4B9DA 5JN2A 4LFIA 2X2LA 3PJCA 1OIUA 3SAYA 3T8OA 2PSQA 4FTLA 3CD8A 5LMAA 4C3RA 3ZS5A 3K2LA 3LCTA 5ETAA 3FLNC 4YJNA 3HA8A 1PXMA 4LYNA 4Q9SA 4K1BA 2YCSA 2ZMDA 4CMUA 2GNJA 3GNIB 1HOWA 2J5FA 2VO7A 3UQCA 4FBXA 1LPUA 3LCSA 5CU2A 3DZQA 5FQDC 4X2KA 4BKZA 5HQ0A 3UC3A 5K4IA 2Y7JA 4YJUA 2BKZA 4D2VA 4ANLA 5LJJA 1REJA 3L9MA 4DH5A 3DCVA 3SVVA 1V0PA 5AR7A 3W2CA 5T6KA 4NSTA 3PYYA 4UZDA 4EYMA 4L68A 3LCOA 4CRLA 2XIZA 3BI6A 5EOBA 2GHGA 3F66A 2Y0AA 3TZ9A 2FA2A 2C0OA 3NNUA 3ZO4A 4BGGA 4CLIA 4E6QA 3D15A 4YC6A 4K6ZA 3MW1A 5E90A 5HTIA 5L8LA 1YQJA 2VO0A 3IW6A 4DTKA 2GU8A 2R3NA 3DFAA 5HE1A 5ANKA 3DQXA 3QXOA 2IZUA 4NJDA 5C01A 4HNIA 1J1BA 2BVAA 5HVYA 4MNEB 2IZSA 4NZWB 3O8TA 2FYSA 5DEWA 2QO7A 4AG8A 3UYTA 4C57A 5A4EA 4AT4A 3BLRA 3V8TA 2WMXA 5CU4A 3M42A 2QI8A 2GS7A 5BVNA 3P08A 3IS5A 2J90A 3MIYA 4ZSGA 4W4YA 4EK6A 2JDRA 1GY3A 1ZLTA 4FV9A 1OPLA 1FMOE 2WTCA 2B1PA 3G9NA 1CMKE 2W05A 1ZY5A 3ZM4A 4AF3A 4E1ZA 3M11A 4TTHB 2VTHA 1PY5A 3Q4ZA 5M57A 2GNGA 4Q5HA 3PY0A 3FLSA 4MXAA 5DT4A 4JAJA 4F9YA 1V0OA 4CCUA 3BHYA 3DJ5A 1OIQA 4HYSA 3COIA 5ACKA 3I4BA 5FTOA 3WBLA 4LGHA 3I0OA 3BPRA 4GJ3A 2X81A 1OZ1A 5CVHA 4IANA 3AC4A 5LWMA 5EH0A 2WMQA 1YOLA 5CEKA 1BLXA 4FV5A 5DN3A 3SV0A 3UO4A 2O65A 4EONA 5KBQA 5LWNA 4EH4A 4RSSA 4P2KA 1OL2A 3OUNB 3GT8A 3O23A 1PKGA 2C6EA 1Q3DA 5T68A 2OXDA 1IASA 4M97A 2A2AA 3RMFA 1ZAOA 3DBDA 4PY1A 4EYJA 2W4OA 3BEGA 4JDJA 3SXRA 2VWIA 4HYUA 3I5NA 5KX8A 3ELJA 2C1AA 3AC8A 3QD3A 3LAUA 1PKDA 4MYGA 4YC8A 4JNWA 3ZBXA 4MK0A 4G5JA 3E63A 2J9MA 4JT3A 5CI7A 5CT7A 5IMXA 1PXOA 1M52A 3H9RA 1W98A 3MBLA 3QRUA 2J7TA 3QLFA 4C2VA 4DITA 4F9WA 4ACDA 2YABA 4FIJA 3RINA 5J5TA 3C5UA 5J8IA 4FV8A 4BC6A 4LI5A 4EH9A 2C6KA 3F5XA 5HNIX 2E9VA 2CGUA 3RAKA 2I6LA 4PMSA 4QP3A 1KE6A 3O71A 4GVJA 3TUBA 3Q9XA 4N70A 3WZEA 3TI1A 2XB7A 3ODZX 4ZOGA 4C36A 2Y4PA 3TNQB 2CHLA 2GNLA 3FQSA 3LCKA 3NS9A 4YZ9A 3C4EA 2RFNA 4FK6A 4GK2A 4RC3A 4RPVA 1QPCA 4QRCA 4AZTA 3NYOA 5E7RA 4FKIA 3VQUA 3ZZEA 4DCEA 3TL8A 1H24A 2P2HA 3EH9A 2GS6A 3I7CA 3UVQA 4YJPA 1PMNA 2B53A 4YUQA 4FV4A 3SA0A 3QKLA 3NUYA 3OVVA 1YI3A 2CCHA 2UZDA 2YLFA 5AX3A 4QTCA 5JFSA 4NT4A 5ANDA 2E9NA 2JDVA 4J95A 4F63A 5BUEA 2XUUA 2GTNA 3P23A 4MEDA 3DJ6A 4G1WA 4D58A 5LXMA 4X6RA 4I21A 3VS6A 2YJRA 4UZHA 2BAJA 4IDVA 5CENA 4CFXA 2XF0A 4MD7E 5FXSA 3A61A 5B2KA 4ENYA 5F4NA 3ALNA 2VWYA 4H1JA 3OTUA 2VWXA 4CFVA 1DI8A 4Q2AA 5HG9A 4LOPA 4XG7A 2OH0E 3WZDA 3QC4A 4QTAA 2QOQA 3HMMA 3QYWA 3BHHA 3R04A 5AWMA 3DLSA 5K5NA 4AT3A 1OB3A 3OXIA 3FXWA 5CI6A 5FG8A 3CJFA 3ACKA 4ASDA 5IU2A 3D5XA 2Y9QA 4JIAA 3PE1A 2ZB0A 3L8XA 1KE9A 2CN8A 3CS9A 4L7FA 3WOWA 4U80A 4PL3A 2XK9A 2UW9A 4NJ3A 5CEIA 3VF8A 4C3FA 4AE6A 4GEOA 5TO8A 4DBNA 2B9IA 2P2IA 2VNWA 4OTGA 4K77A 4EKLA 1WVXA 4PMPA 4XYFA 4KNBA 4I5PA 3LJ2A 1NVSA 4BDBA 4DEEA 1H1WA 1Q8ZA 1XKKA 4UWCA 4EOKA 4U45A 5AR4A 1KOBA 1E1XA 3C9WA 4DH3A 1M17A 2Z7LA 4FT5A 2RFSA 4QPAA 2F7ZE 1P2AA 2Z7QA 4IVDA 3VWAA 5IZFA 2B7AA 5EYCA 2ZDUA 4YJSA 4FOCA 3GXLA 3VBYA 3AD6A 4F64A 2QOLA 4TT7A 3D4QA 1Z57A 1RW8A 3DK7A 5F94A 2FUMA 3M2WA 4RZWA 4WD5A 2IVUA 5KE0A 1YXUA 3EZVA 2YERA 5IA5A 1CM8A 2XM9A 3TNHA 4B7TA 4U0IA 5JQ5A 3R30A 2J6MA 3QD2B 4DGMA 5IG1A 4LRJA 1NVQA 2WMVA 2ETMA 3CTHA 5A14A 3ODYX 1O6YA 4EOJA 1MRYA 4ZEGA 5J9ZA 4ZZOA 1W8CA 4IACA 3BGPA 3TACA 4WG4A 3ET7A 4R8QA 3W16A 5A3XA 4EZ7A 1UVRA 2W0JA 4BCMA 2IZRA 1WAKA 1JVPP 1UNGA 4HW7A 5AUXA 3KC3A 4O96A 2LAVA 4DEIA 4IAKA 3V5QA 3CEKA 3MS9A 5BPYA 5K4JA 3BEAA 4ZLYA 4DGLC 5J87A 4QQCA 4E5AX 4ALUA 3PXRA 4NU1A 4UMQA 3FBVA 2CGVA 4M13A 3DAEA 3UNKA 3R9NA 4V05A 5DA3A 4FUXA 2WOTA 4ZTHA 2WU7A 4BFMA 1KV2A 4YHTA 1ZYLA 2B9JA 3ZONA 3IDBA 1YXVA 1UKIA 3A60A 2PE2A 2R3KA 3QBNA 4XG2A 5CEQA 3HMIA 3GUBA 2UVXA 2WHBA 4RX9A 4S32A 5FEEA 5IUHA 2WMAA 4XLVA 2DQ7X 3QTSA 4H36A 4WNPA 4EQUA 4C4IA 3EQBA 3PJ3A 3RWQA 1BYGA 3UO6A 5L6PA 1I44A 4OBOA 3KRXA 4PPAA 4XS2A 3IW5A 3W2PA 4KABA 4AW0A 3U6IA 2UW3A 3FAAA 2C6OA 3KXMA 5L2WA 1OL1A 1UWJA 3H0YA 3P7BA 3ZZWA 4IFCA 4EBVA 1LP4A 3ORZA 3HNGA 4EOPA 3QUDA 4ZJJA 4PL4A 1BL7A 4PMTA 4IWQA 2F2UA 3O50A 5CAVA 2JDOA 2CGWA 4BTMA 3D5VA 4FSTA 5AAGA 4GMYA 4MXZA 4HNFA 3PVUA 5BMMA 1XHAA 5JFVA 4FKRA 5G6VA 2HY0A 2X2KA 3A2CA 4ARKA 2WTWA 3ORXA 2BCJA 4DYMA 3FUPA 5JSMA 1Y6AA 5ACBC 1JKKA 1NA7A 3PXYA 4MBJA 5AM7A 4MNEA 3TIZA 1ZYSA 4M8TA 4D4YA 3WZJA 4I41A 4LMNA 2BHEA 4PTEA 5ANJA 3DB6A 3ZSIA 2YM7A 5J1WA 4YJTA 4X0MA 2F57A 3SLSA 3VUHA 4G31A 2YISA 4JAIA 4I24A 4IM0A 5ANGA 2WKMA 4TRLA 5CZHA 4OUCA 4AU8A 4FTRA 3IG7A 4O0YA 5KMMA 3LM5A 3WF7A 3WYYA 4YHFA 4BCHA 4AOJA 3BHVA 1QCFA 2GHMA 3SDJA 4XJ0A 1R0EA 3CGFA 5J9LA 1Z9XA 4IBMA 1VZOA 4J52A 2XK8A 2VN9A 2VGOA 4FKSA 3MY1A 5TOZA 5CZIA 3PA4A 2X6EA 3PA5A 4TXCA 2G1TA 2ITQA 3COKA 5AV3A 3ETAA 3TV6A 1DAYA 2V55A 2X9EA 4X3FC 3NWWA 4WRGA 3BLHA 3L9NA 2GSFA 3O2MA 4FTJA 4W4VA 4EOSA 4D55A 1FGIA 4CVAA 1M2QA 5IA1A 4X2JA 2O8YA 3LW0A 5E8TA 2XA4A 2GFSA 1OVEA 1X8BA 3PXQA 3R73A 3ACJA 2BZHB 1OPKA 2JGZA 4E6DA 5EI6A 5FEQA 3PUPA 5AV1A 4V0GA 4C37A 1H0WA 3TG1A 4YSJA 4BCFA 2PTKA 4MXCA 3QZFA 5CQUA 3ZRLA 5BX0A 5I9VA 4BCOA 2XKEA 3ZLXA 4QMLA 4TYHB 4GRBA 3U51A 3P78A 3UNZA 1ZOEA 3DNDA 3I6WA 3PJ1A 4LOOA 3SOCA 4YTFA 3MH2A 3V6RA 3NUPA 3QL8A 4RA4A 2R0UA 2CSNA 2RFEA 3OXTA 3PG3A 3WILA 5CAOA 5GZAA 4FKUA 3RJCA 5HLPA 4LUEA 4AGUA 1UWHA 4J53A 2FO0A 2PL0A 2A19B 3CY3A 3JPVA 2FGIA 4LG4A 4RT7A 1Q41A 1OL5A 3MIAA 1WVWA 3QYZA 4ZTRA 4NEUA 4JBPA 2VTSA 4AW1A 3EQDA 2BAQA 5EFQA 2ITVA 3BU5A 4I0RA 3CGOA 4IW0A 3EWHA 4GT5A 1GAGA 2YFXA 3RWPA 4HPUE 3PWDA 4G9CA 4P5ZA 4A06A 3GC9A 3BU3A 1KE7A 4X3JA 3EFJA 3EYHA 3O0GA 1XH4A 2JIVA 3KXGA 1JQHA 4K8AA 1ERKA 2BZKB 1YOMA 2IZTA 5EI2A 3ZCLA 4RJ7A 3VBWA 2X8IA 5LMBA 3Q9YA 3ZBFA 3PP0A 2EXCX 4RFMA 3LPBA 4LUDA 4NTTA 4A9UA 4IWOA 1RQQA 1BKXA 5EKNA 1H1PA 4DFLA 3LFNA 4OTFA 4ANMA 2ZVAA 4XRJA 4FNYA 2FB8A 4LQMA 5DEYA 5F20A 2PZPA 4FKQA 4ZZMA 5CNNA 3NIEA 5HGIA 3VHEA 4W9XA 4I6BA 2OZOA 4D1SA 4UYNA 4RFZA 4ZJIA 5CF8A 4FSQA 5M53A 4JVGA 3W2SA 4BI2A 1GJOA 2I40A 5H2UA 4EI4A 5K9IA 3BYVA 4JBQA 4JR7A 3KVXA 2ITYA 2X6DA 3BU6A 2J0KA 4AN2A 1UA2A 4D2SA 2JBOA 5IMEA 2DWBA 3R7EA 2BIYA 3IO7A 3PIXA 5C1QB 4F0FA 2XCKA 4EK4A 3DZOA 3G0EA 4FTMA 3HECA 3W18A 4BHZA 2QOCA 5HBEA 4TYJA 5HNBA 3DBCA 1OKVA 4X7QA 4IZAA 1Y6BA 4I1ZA 3RM6A 4QMVA 2Z7SA 4ZZNA 5CANA 2CLQA 4MXYA 2XK4A 4RWJA 1YDTE 2HY81 4KBAA 2BALA 4YLLA 1Q8WA 2G9XA 4DGOA 3VUGA 3VUMA 2VU3A 1ZOGA 1FQ1B 1YWVA 1WBSA 1XH7A 4M0YA 2R3HA 3DBQA 5L3AA 3VQHA 2HIWA 3BE2A 4FKTA 5AX9A 2REIA 3TIYA 4QTEA 4Z7GA 5AA9A 4F6UA 2WTKB 3C13A 2F7EE 4OT5A 2YDKA 5D7AA 1KSWA 4YZBA 2JEDA 1H28A 1WBWA 4U79A 4RJ8A 1CDKA 4DEGA 5CX9A 4R3CA 5AV2A 1WMKA 3UVPA 3CQEA 3NPCA 2JC6A 2GTMA 4NM5A 5I9YA 2PWLA 1JKSA 2WTJA 4DEHA 1SVGA 2JDSA 1OM1A 4ZP5A 3CXWA 4TNBA 5JZJA 5IEYA 4IZYA 3QCSA 2PVNA 3Q4CA 3VS4A 3WZKA 2PVHA 4MF0A 2VGPA 4DH8A 2BDFA 5IEVA 4QD6A 3KRLA 2XK7A 3QCXA 2FVDA 4J8NA 4ITHA 3ZTXA 4J98A 5LQFA 3TUCA 4IVCA 4X2FA 4ZJVA 2HWPA 3L9LA 4IZ5A 3O8UA 5CU6A 3TNWA 4CFWA 1OIRA 5E91A 5BQ0A 4BF2A 5EHOA 4DLIA 4EKKA 3HV4A 4ACHA 3KFAA 2PHKA 2OH4A 3QCYA 2UVYA 1Z5MA 3V5JA 2H8HA 2ITUA 4G3GA 3MB6A 2CLXA 4QYYA 4A9RA 4BICA 4QMZA 1Y91A 5DPVA 2R3RA 1JLUE 3BHTA 4YSMA 1M14A 3NNWA 4I5HA 5TF9A 5EW9A
chains in the Genus database with same CATH superfamily
2JAMA 3JXWA 3EMGA 4GT3A 4K18A 4BHNA 4FV3A 3TZMA 5HORA 4MAOA 2VUWA 3FZOA 3F69A 3Q6WA 3RI1A 2BMCA 4BDFA 1MP8A 4HYHA 3IW4A 5H8GA 5JGBA 2PY3A 3UG2A 3C4ZA 3N9XA 4KRDA 3REPA 4RIWA 2C3IB 3AMAA 4XOYA 1XH5A 3F5GA 4FKGA 4ANQA 4USDA 3PVGA 3QHWA 3RPOA 3IQ7A 4FT3A 4ASEA 5IUIA 1UU3A 2FSOX 3W33A 3VNTA 3UIUA 4HYIA 3DV3A 1KWPA 2IW6A 2J4ZA 4A9TA 3EQFA 3TT0A 3U9NA 4BI0A 2XNMA 5HO7A 4Q5EA 4FTIA 3FXZA 4W8EA 2XZSA 3UJGA 4U3YA 4USEA 3NZ0A 5HE0A 4Y85A 5AUWA 1CSNA 2WMWA 2C5NA 4RIOA 3BYUA 2R3MA 4MHAA 3IGOA 4ANNA 2YM6A 2BAKA 5HG7A 4C38A 4JX7A 3FQEA 4FL3A 5AP7A 3HZTA 5FP5A 2IW9A 4E4XA 3GCPA 4XRLA 4KIKB 5IISA 4CQEA 2BRGA 3ZLSA 2UZBA 2XEZA 3P9JA 3F9NA 1P14A 5HLWA 2NRYA 2B52A 2R5TA 5EW8A 3UQGA 5LVMA 2W1DA 4O21A 4D5HA 5FD2A 4JG8A 4Q9ZA 4M69B 2IJMA 4BCQA 1IEPA 4ZY4A 3QUEA 5HU3A 3CTQA 4E4NA 3R7UA 4F7JA 4WSQA 4BB4A 3NDMA 5C8NA 5AR5A 5HD4A 2I1MA 3QTQA 3OOGA 4I0TA 1VR2A 5TR6A 3EQRA 5J79A 2RG5A 1GIJA 2JKOA 2V62A 5D9HA 4S34A 4J99A 5FBNC 2UZEA 4C7TA 5LVPA 2QC6A 2VTTA 2VTLA 3WF9A 2XRUA 4FKPA 3DA6A 3ZDIA 1MUOA 5E8WA 4IXPA 4X3FB 2OFVA 5HX8A 2J0MB 3P86A 5HG8A 4ZLZA 4XBUA 3GU6A 4D4VA 5CF6A 3EFLA 4TYHA 5DWRA 2H96A 1OITA 2VWUA 3QGYA 3PPKA 3R1NA 5CEPA 3UYSA 2WO6A 3KKVA 3UNJA 1DM2A 3DKFA 2WTDA 3QQLA 3JY9A 3EN7A 3OT3A 5HE3A 1IA8A 2W1GA 4NCTC 3AD5A 2EU9A 2PVKA 4IAYA 3F3ZA 2LGCA 4X2GA 4F9AA 4S33A 3V3VA 1JSUA 3IK3A 4CV8A 4BVUA 3MVLA 3K5VA 4KSQA 4IADA 3Q9WA 3DKGA 3QQFA 5E1SA 4G17A 5BVKA 4CMTA 4JXFA 4CRSA 3VS2A 4FT7A 4LRKA 4YZDA 2XJ1A 5KHWA 2ZB1A 2HZNA 3PVWA 4FV0A 3FC2A 4M67A 4O0VA 2HW6A 3C7QA 2BDWA 5CU0A 5KNJA 5I9WA 4AFJA 1H26A 3RNYA 4RLLA 3GFWA 2W06A 2GHLA 5ITAA 3BV3A 4FT9A 1NVRA 1XH8A 5EM5A 2PZRA 2QURA 3RBWA 4EOQA 3DK3A 4JR3A 5KKRC 4HZRA 5D41A 4TYIA 4B8MA 2HELA 1Y57A 3UPZA 2YIRA 3PXFA 3Q3BA 2X7GA 3OHTA 4FKOA 5AUYA 3SHEA 3E92A 4L44A 3QZIA 4TL0A 4EEVA 4M3QA 2P0CA 3PG1A 4UY9A 3QQGA 1Q8YA 4HPTE 4EWHA 4FG7A 2OBJA 3V6SA 4RBLA 5GNKA 3FMHA 2V5QA 3AMYA 2G15A 2OGVA 4JDHA 3AC2A 4JDIA 2I0HA 4PWNA 3A7GA 4AA0A 5CXZA 2B9FA 4OBPA 1W7HA 4QP7A 5C03A 2EWAA 5HIEA 3EQIA 3QQUA 4YNOA 5GJGA 4TY1A 2W96B 2V0DA 1FMKA 1ZYDA 4BDCA 2Q0NA 2OJIA 4JG7A 5JT2A 4YBJA 3DAJA 3E93A 3GI3A 4ITJA 4O4FA 3D0EA 4WKQA 3F2AA 2UZTA 4XP3A 2YM3A 3QKKA 3PY1A 4XX9A 3SC1A 4CYJA 2QHNA 4M12A 4E5WA 1M7QA 3DT1A 4CEGA 4WBOA 3P7AA 3UODA 3R28A 5BMSA 4QMQA 5FGKA 3SKCA 1V1KA 4ACCA 4F70A 5HTCA 3C4XA 4RQVA 2IVVA 3E87A 2UW6A 4CT2A 5HX6A 3ZHPC 2SRCA 5CVFA 1TQMA 1YWNA 1VJYA 4C0TA 3EQHA 3COHA 2E9OA 1G3NA 4BCPA 4RA5A 4BBEA 1OPJA 2ZM4A 3UGCA 3QFVA 3FY0A 1A9UA 1PXIA 3LFFA 4AZFA 3FKLA 3NIZA 3OEZA 2VTQA 5IA4A 3S00A 3D5WA 3HUCA 4FODA 4U42A 2ZV9A 3D7TA 3DKCA 3GU5A 4RIXB 5LCKA 3KGAA 3LVPA 1MRVA 4UALA 4NM3A 3HLLA 4D28A 3I0QA 3EN4A 2ZAZA 3QRJA 2VTJA 4KKEA 3EQPA 4PMMA 2QCSA 3R7VA 2PZIA 2Q0BA 3V5WA 5JK3A 2X7FA 5TT7A 3CE3A 5D10A 3RKBA 5EG3A 3TNPC 4HJOA 3TTIA 3BWFA 3LM0A 2A1AB 4GG7A 5E1EA 2ETRA 3QD0A 3VS0A 4BDGA 5IH6A 1ZMVA 3BIZA 4CMOA 4QYEA 3V5TA 1FINA 1JSVA 3F88A 3MV5A 4RX5A 5I3RA 2W9FB 4EC9A 2R3PA 2UV2A 2H34A 2DS1A 2C5YA 2YN8A 2XIYA 5HOAA 4DFYA 3ORLA 4KINA 3U4WA 3VBXA 4BWKA 1U5QA 2YEXA 4AT5A 2RF9A 4UXLA 3OP5A 3W10A 2G2FA 4BGQA 3ZOSA 3GCVA 3F82A 4QQ5A 3R2BA 3BGQA 3KK9A 4M66A 3E62A 1ZYJA 4ITIA 4QQJA 3EFKA 4XG8A 4ZAUA 1Q4LA 4R6VA 4I6QA 2XJ0A 4I3ZA 5M4CA 3ZXTA 3OF0A 4O22A 3QU0A 2YITA 3OUKA 4O6LA 4TYEA 2W5HA 2BRMA 4FNXA 4K33A 1YRPA 2AC5A 4U41A 3NUSA 4C33A 3IOKA 3FLQA 3FMMA 4XUFA 3P4KA 4ID7A 5G1XA 4OTPA 4EH8A 2F9GA 3W2QA 3ENMA 3ZU7A 4EH3A 4WT6A 4ACGA 3UQFA 1UKHA 1JNKA 4C4JA 5AUTA 3BYMA 2JFLA 5FP6A 5C8MA 4AA5A 4IJ9A 2OJGA 2CJMA 2PMIA 3KCKA 3ZRKA 3AT4A 4TKSA 4L3PA 4U44A 2X9FA 4L45A 4EL9A 4L67A 3FV8A 3C1XA 2CN5A 1H1SA 3O17A 4YHJA 2YAAA 3R21A 2HWOA 5KMJA 5L2IA 1STCE 2VV9A 4GVAA 2YIQA 3EFWA 3TN8A 5KMKA 4IE9A 3QD4A 2QOOA 3NEWA 3ZEPA 4NIFA 3I6UA 2UZNA 2VZ6A 4BCKA 3UIBA 1H1QA 4R5YA 4G3EA 3V5PA 3ZEWA 4I20A 3IONA 1PYEA 5FDPA 5K3YA 2XMYA 3R9OA 2AYPA 2XKFA 1HCLA 3HYHA 5E8YA 4BBMA 3H3CA 4FVRA 3M1SA 3ORMA 4OTIA 3U6HA 2X1NA 3WF5A 4CZUA 5EI8A 4AFEA 4K9YA 3ORTA 4H3QA 3GENA 1ZMUA 3NX8A 4M69A 3AC5A 3NNXA 3V01A 2WMSA 1QL6A 1LUFA 1J1CA 2XVDA 3RCDA 3CPCA 5I5ZA 2ONLA 2WQEA 3NR9A 4KKHA 4KSPA 5FWKK 4CXAA 5AV4A 2RFDA 3PTGA 2R3FA 5AP5A 2PMNX 4FSRA 4IB1A 4QO9A 4ZSEA 5I9UA 2YAKA 3FKOA 4Z3VA 2RSVA 2W4KA 1CTPE 3Q9ZA 5JH6A 3GEQA 2ZV2A 2OICA 4LOQA 4W4XA 4D1XA 4GYIA 4B4LA 4Y46A 3FJQE 4BZNA 2ZV7A 3CJGA 1F0QA 3A8XA 3DBFA 4IHPA 2UZOA 3DBEA 3GQLA 4MKCA 2XM8A 3FI3A 3NCGA 3BQRA 4FRFA 1DS5A 2PVLA 5JEBA 4FL1A 3EIDA 4A7CA 4AGWA 1PMUA 2PZ5A 3FLZA 5A9UA 1JKLA 4GFOA 3KN6A 3PPJA 5EYMA 4AW2A 4QPSA 4IX6A 4ZLOA 3BWJA 3ZUUA 3KCFA 4GSBA 4WUNA 2UW5A 4CYIA 3R00A 4NKAA 1GZ8A 4EZ5A 4YLJA 3S1HA 3H9OA 4EHGA 4AAAA 4XMOA 2R3QA 3CKWA 5HG5A 3KU2A 3UMWA 2UW8A 3GOKA 3MTLA 1BI7A 3KXNA 4EK5A 3VHKA 4IM2A 4KBCA 2ITNA 1AQ1A 3ZFYA 5J95A 5IPJA 5I3OA 3TWJA 3F5PA 4TPTA 4J71A 3BRBA 3QQJA 3ZUVA 2XS0A 5LOHA 4GT4A 4IX4A 1PMEA 3DJ7A 3UE4A 5M4IA 1Q5KA 4QYHA 1RE8A 4OT6A 4EORA 2HXLA 2J51A 4N6ZA 4OGRA 3RP9A 4JIKA 2OKRA 3OWKA 3MSSA 4UMTA 3KMMA 3FZ1A 4A9SA 3ZO2A 1FPUA 2NO3A 3DOGA 3D14A 3I7BA 4L3JA 3BYSA 4BKJA 4C61A 2BZIB 2R7BA 3DDPA 3NYVA 4FSYA 5CALA 3GFEA 3OY1A 5L2QA 3AGMA 4BCIA 4PV0A 4IH8A 4DHFA 4BCNA 4BDHA 3FQHA 2XBAA 3Q5ZA 3UP2A 2XIRA 4UXQA 4EOLA 5CNOA 1WZYA 3Q4TA 4FI1A 2HZIA 2YIYA 2C47A 5E8SA 5CAUA 2UW7A 3MYGA 4IEBA 5AIRA 4FK3A 3A7IA 4ZTQA 3RAWA 3ANQA 3FL4A 5B2MA 4GS6A 2AUHA 2WTIA 2XNOA 2XYNA 3MFRA 5KKRB 2BFXA 2BRNA 4EH6A 3LFEA 2WEIA 1U5RA 4I4EA 2VTIA 3QAME 3MVMA 4D1ZA 3QZHA 5AR3A 3K5UA 4V04A 2OIBA 3VVHA 2EVAA 1O9UA 3OFMA 4AZVA 5J5SA 1XH6A 2WMBA 3IDPA 2IN6A 3KXZA 3LFSA 4PUZA 3RK5A 2YM8A 1YHVA 5EYDA 4UMPA 5IDNA 2B54A 2XNGA 2GS2A 2QOIA 5CAQA 5ETIA 3FDNA 4NW5A 3G0FA 3K54A 4WIHA 5JQ8A 3KVWA 3VN9A 3NYXA 4GK3A 2XNEA 4OAVB 5AP0A 3TNIA 3F3TA 4JLCA 1B39A 4PPBA 5DT3A 2C0IA 2WMTA 3D5UA 4LL0A 3VUTA 4EC8A 3MFSA 2YA9A 4RGJA 3Q2MA 4FTOA 2FSLX 4CKJA 5D12A 3AOXA 3Q4UA 4S31A 5CAPA 3ZSGA 1Q61A 3ZLYA 4QP4A 4ZTSA 2C0TA 3UZPA 4PX6A 2YJSA 4XEYA 5HLNA 3H30A 3LFAA 2VX1A 3R0TA 2XNPA 3P79A 4FZ7A 4N6YA 4RJ6A 2XBJA 2QNJA 3G90X 4FV1A 4MQ2A 3LJ1A 5EW3A 4YMJA 4WG3A 2OXYA 3R01A 4DGNA 2ZMCA 3LXNA 5CQWA 4QMXA 1M7NA 2QR7A 3QTWA 3LOKA 2YWPA 3OWJA 5DIAA 4U9AA 1APME 2JIIA 5AV0A 3SRVB 3ZUTA 4RIXA 4RX7A 4C34A 5JGAA 1QPEA 2R3LA 5LVNA 3PIZA 1PXPA 4QP8A 5AP4A 2W1CA 4IC7A 4MX9A 4OAUC 4B99A 5GJDA 4FZAB 4FTAA 1PF8A 5FXQA 3VJOA 1HCKA 2CKEA 4K2RA 3HEGA 5AUVA 2OO8X 5EOLA 5BVFA 5LMKA 4OR5A 3VS1A 4DG0E 5AADA 5HCYA 2C68A 5FRIA 4RJ4A 5A4TA 3O51A 3WE8A 3ROCA 2WMUA 3GU4A 4IB3A 4P90A 4C4EA 5JGDA 4JQ8A 4HZSA 4QYFA 5I4NA 5DFPA 3KRWA 3SW7A 4Z16A 3FPMA 2XK3A 4I5CA 3KN5A 3ZMMA 4PPCA 5FM3A 5AP2A 1NXKA 1ZWSA 5A4CA 1OUKA 4YJRA 2C5XA 2ITOA 4WHZA 2JAVA 4AN9A 4YU2A 3C50A 5CY3A 4QP1A 3IPHA 5I0BA 5CSPA 5HVKA 4RFYA 2PVMA 3GOPA 4G16A 5DT0A 3HRFA 3JUHA 2V7OA 3UC4A 3R1YA 4Z7HA 3RAIA 5BUIA 3PA3A 4MBLA 4GH2A 2BPMA 4ZS0A 1E1VA 2C6DA 2A27A 4ALVA 1ZYCA 5K0XA 1FOTA 3FMLA 3UOJA 2PMOX 4PDOA 3MGYA 1OECA 4R7IA 2Y6MA 3HV6A 3K3JA 4IX5A 2XCHA 3E8CA 3A7JA 2RKUA 1R39A 2QOBA 4C8BA 3OROA 4L00A 2J2IB 4GIIA 2OF4A 2YIXA 4B0GA 1XWSA 4GG5A 1J3HA 5EHYA 2OSCA 3L8PA 3R7GA 1XR1A 3HDNA 1KE8A 3OS3A 4CFUA 1H00A 5KBRA 2ZYBA 1YOJA 2UZWE 3W2RA 5EDPA 2F2CB 4PTGA 3PJ8A 3QTXA 2BRBA 2W5AA 2OW3A 5AA8A 3VRZA 3OXZA 2W1IA 4FT0A 4UYAA 2J50A 3KA0A 3LXLA 1RDQE 2RL5A 2XRWA 3ORPA 2NRUA 3S2PA 3QQKA 4FIGA 4I0SA 2HZ0A 1WVYA 2QOFA 3EQGA 3VO3A 4OTDA 5HCZA 5AMNA 3OEFX 2JLDA 3IECA 3W32A 4FF8A 4EH7A 2RIOA 4C58A 3SQQA 4XNEA 5H9BA 4FICA 2HXQA 1A06A 1H8FA 4CKRA 4RC2A 1J91A 4GCJA 5AP1A 3FMEA 1L3RE 2CMWA 2ZOQA 4E5BA 5HBJA 1SZMA 1TQPA 2OFUA 3Q52A 4QNAA 3VF9A 3A99A 4IVBA 2YIWA 3A4PA 4NK9A 3U87A 5ETFA 1Q62A 4U8ZA 3VS3A 2X8EA 3R2YA 4WA9A 3L8VA 3V8SA 3DTWA 3PPZA 2J0IA 2C3JA 3LCDA 4DFZE 2ESMA 2C6TA 3NAYA 5GJFA 4RC4A 4BGHA 1ZY4A 5M56A 1F5QA 2XJ2A 3ULIA 4FYOA 3T3VA 4GYGA 1URCA 4O2ZA 5HO8A 4JBOA 4X21A 4C3PA 5JMSA 3AQVA 4WOVA 5D7VA 1GNGA 3W8LA 3HMOA 4O0TA 4UEUA 3QWJA 3TKHA 3UBDA 1K2PA 4CTCA 4MH7A 3LFDA 4WO5A 1XO2B 4FX3A 4G2FA 1BI8A 3CY2A 4YZMA 3V5LA 3P7CA 4HVSA 3JS2A 3Q5IA 5LVOA 2R3GA 4RLKA 3QA8A 4ZXTA 5A6OA 4IWDA 1GZOA 3TJCA 1ZRZA 2R7IA 3VBVA 5HO6A 3PWYA 3OCTA 1H25A 5E8VA 2OZAB 4CZTA 1U59A 2GNIA 1OI9A 4TWOA 3SW4A 3MJ1A 2UVZA 5LVLA 2UZVA 4KD1A 3TKIA 5HNGA 1W0XC 4IAZA 5IH4A 3CKXA 4FV2A 3VW8A 2WELA 3C4CA 3G5DA 4GW8A 2C4GA 5D11A 1V0BA 4BTJA 2WAJA 3UIMA 3WARA 5KUPA 3RPRA 4DH7A 2JIUA 1JAMA 4G6NA 4TYGA 4DEDA 5BNJA 1I09A 2C5OA 4GJ2A 5ANOA 4N4SA 2O3PA 3ITZA 3FLWA 4W8DA 2I0YA 4IZ7A 4EH2A 3C0IA 3IKAA 3RK7A 3PLSA 2R3JA 3MA6A 4ZTNA 4F08A 3CP9A 5A4LA 2RG6A 4V01A 2E2BA 5AIKA 4ONAA 3S0OA 1PHKA 4QMSA 4Y8DA 3MH3A 4LGDA 3I60A 3QRKA 4R1YA 5DGZA 5IF1A 3RPSA 3VS7A 3QXPA 2UZUE 1ZMWA 3F3VA 3K3IA 2KTYA 3VULA 2C6IA 3RTPA 2XNBA 3OOMA 4WUAA 4DG2E 3UOHA 3AG9A 4AS0A 4RWKA 2HK5A 3D94A 3PJ2A 2YACA 3QCQA 1FVVA 3FL5A 5EK7A 5HTBA 2IVSA 4DEBA 3FZPA 4FSMA 4F6SA 5L4QA 1WBTA 1OKWA 3FMJA 5AAFA 4MXXA 4B6LA 3EOCA 4U6RA 5CVGA 2H9VA 2QO9A 4FC0A 1B6CB 4CTBA 4F1TA 4F1OA 3R1QA 1P4FA 4FTTA 3ZO3A 4O6EA 4E8AA 2C3LA 2ZDTA 2QU5A 2X7OA 4BL1A 1FVTA 5DI1A 3ZFMA 3EN9A 5AP6A 3MFTA 4JQ7A 4YTCA 1XBAA 4RZVA 4BIEA 3R7YA 4DFXE 2JFMA 4O1OA 3FHRA 3TCPA 3O7LD 3F2NA 4RIYB 4OTRA 1OL7A 4XV9A 2O0UA 3G33A 2VX3A 1XJDA 3FI4A 1S9IA 3CBLA 2EXMA 1PJKA 4FTQA 2GNHA 1O6LA 2BHHA 1YWRA 3W2OA 3R6XA 4AE9A 3BQCA 3CQWA 4ASZA 3U9CA 1QPJA 3A4OX 5EDRA 3S4QA 3D2IA 5EM6A 5KMNA 4FL2A 4CV9A 4O38A 5ETCA 4EUUA 3DFCB 3AT3A 3FZTA 3OD6X 4LRMA 3UVRA 2VTNA 4M7IA 5DRBA 1Q99A 3QTIA 2XNNA 3IDCA 3EKNA 3NW6A 5JKGA 3SRVA 4TN6A 4U81A 4U3ZA 2QU6A 4OBQA 4HVHA 2ITWA 1W82A 3KF7A 3GC0A 5IDPA 5JRQA 4JI9A 1E9HA 3KMWA 4F7LA 3EN5A 3PFQA 4RVMA 5L8JA 2YZAA 4H1MA 4KS7A 4IAFA 4PDSA 5C9CA 2EB3A 2YLEA 2GPHA 4YJOA 3ZRMA 5C26A 3E5AA 1WFCA 3T9IA 4HCTA 4QTDA 3OZ6A 1R3CA 4QP2A 4AZEA 2O63A 4XV2A 5M4UA 2VWBA 2F49A 3RALA 4CZYB 1YDRE 4FG8A 1DAWA 1H0VA 2HW7A 2VTPA 3A7FA 1M2PA 4AUAA 4IDTA 3QX2A 4QT1A 3MY5A 5HESA 3UOLA 3UPXA 4DAWA 5DMZA 1U4DA 4EHVA 1YXSA 4IVAA 3UO5A 2O5KA 1MQBA 2XKDA 4E3CA 3G2FA 3VUKA 4YJVA 2QOHA 4NWMA 5IEXA 2W7XA 3MVHA 3DPKA 4LL5A 2WQBA 2IW8A 3R8MA 2EXEA 4DN5A 3DAKA 4QMPA 3JYAA 4X2NA 3EN6A 3V51A 4QMNA 4M84A 2YCRA 4GIHA 4FKLA 4QP9A 5ANIA 4F09A 2PVRA 4C4GA 4BDDA 4W4WA 3ZYAA 1IRKA 2P4IA 1XH9A 3GGFA 5AAEA 4QMOA 3NLBA 2XK6A 3BX5A 2QQ7A 2HENA 4FZFB 3CC6A 4XCUA 4A07A 2WXVA 3C51A 3F3WA 4GFGA 1PW2A 4YZCA 4FKVA 4BN1A 1PXJA 2YHVA 4DC2A 3R7OA 3W8QA 3ALOA 3EYGA 4KS8A 5HICA 5F1ZA 3L1SA 4FV7A 4QPMA 3ZDUA 4DH1A 3A8WA 2ETKA 3RCJA 2G2IA 1YKRA 3ZFXA 2OWBA 5AR2A 1TKIA 1SYKA 4BZOA 3L9PA 4D9UA 3OCGA 1S9JA 1URWA 3KMUA 2ITXA 3NUXA 2VWWA 5H8EA 3UMXA 3NRMA 2Z2WA 4IX3A 4EHZA 4ZSLA 2IEWA 4FIIA 2UUEA 5CXHA 1M2RA 3GP0A 1GIHA 3KK8A 4MQ1A 5M44A 3IW7A 2ITTA 2VO6A 4HGTA 5L2SA 3R71A 2HZ4A 2J0JA 3E64A 4JS8A 4YPDA 4XP2A 2Z8CA 3SX9A 2FSMX 2OF2A 4ERKA 2QKRA 3OT8A 4L46A 4L3LA 4AOTA 4IJPA 4F7NA 3QRIA 4O0SA 2WPAA 4QTBA 5EM8A 3ERKA 2XP2A 3EZRA 2W9ZB 3BKBA 4MF1A 3VC4A 3F5UA 3KQ7A 1SVHA 2BDJA 3FSKA 4D4RA 5H8BA 5DBXA 3R02A 2YCQA 3EKKA 4QQTA 5CYIA 4CFNA 3L8SA 4WNMA 5AUUA 4E26A 4WG5A 3E7OA 4YLKA 5ICPA 4TZRA 5IUGA 2G01A 5HHWA 5CT0A 4FNZA 1OGUA 3P5KA 4DGGA 1OMWA 3E88A 4D2TA 2W5BA 3E8NA 3DU8A 2PVJA 3I79A 3P0MA 3R22A 4K0YA 2OJ9A 1XBCA 3ORKA 2Z60A 4QNYA 2OIDA 4EQCA 2RGPA 3BV2A 2R4BA 4BDJA 4APPA 3AGLA 3LFCA 4NUSA 3FSFA 5DR2A 4IC8A 4AA4A 4CCBA 5AEPA 4AQCA 4XBRA 4J1RA 3MJ2A 3KXXA 4I4FA 4L9IA 4A4LA 5IA0A 2X0PA 4FSUA 4FTUA 3MPAA 1AD5A 5L6OA 3Q53A 4L52A 3VUIA 3MPTA 4V0GB 4JRNA 4EQMA 4M15A 4IAAA 4I94A 2XIXA 2ZV8A 3HRBA 3PP1A 4I5MA 3FYKX 3Q04A 4WNKA 5B7VA 4J96A 4LGGA 4L8MA 3U4UA 2OZAA 4F9CA 3SD0A 3OC1A 5HI2A 2A4LA 4YZNA 3TV7A 2Y4IC 2R9SA 1R78A 3EL8A 2W1FA 1IR3A 2VTMA 3EQCA 5E8UA 4ZK5A 5KCVA 3G6HA 2CCIA 2F4JA 2XH5A 4L43A 3FC1X 4XG4A 5CSVA 4YNEA 1WBVA 3JVRA 3W55A 4E4MA 1JOWB 4JBVA 2PE0A 5BYZA 3AMBA 4UWYA 3WIKA 4HCUA 5HVJA 4KBKA 2OU7A 4GU6A 4PF4A 2EB2A 2VO3A 2VX0A 2C3KA 3HMNA 1CKPA 3LXPA 4PDPA 4ANOA 1AGWA 4G6LA 4AWIA 4C59A 2BFYA 5CU3A 3WF8A 2XKCA 5KO1A 4HCVA 1ZOHA 2QR8A 3LQ5A 3RPVA 2XIKA 4B8LA 4CKIA 3BZ3A 3PY3A 2VAGA 4R1VA 1H08A 5DLSA 3QC9A 3KEXA 4QP6A 2C69A 3FMKA 3HMPA 2W4JA 4XV3A 3FYJX 4HVIA 3RVGA 2VWZA 5TE0A 1T46A 4UMRA 1P4OA 2PK9A 4HGEA 4ZY5A 4O1PA 3TKUA 1G5SA 3DXNA 3DB8A 4R7HA 3RAHA 4F0IA 5AM6A 3UDBA 4MD9E 3RZFA 4D2PA 3FI2A 3BE9A 2FH9A 4FNWA 3CCNA 3PRIA 1SMHA 3QQHA 3QTUA 4L01A 4L6QA 4NKSA 3SOAA 3DDQA 4ANSA 3RGFA 3HX4A 3O7LB 4R3PA 3T9TA 4DEAA 3QTRA 2WZJA 3B8RA 3R83A 3F7ZA 2BILB 4BYIA 3ORIA 5J7BA 4KIKA 2OJJA 2R2PA 4IM3A 3NAXA 4R3RA 4F99A 5C27A 1WBNA 4AGCA 3NNVA 3C4FA 4YTHA 2KULA 2QHMA 2WEVA 3CQUA 3MN3A 4JQEA 4RIYA 4YJQA 4MNFA 4WNOA 5DOSA 2JKQA 4QMMA 3PXZA 3UZTA 4GUBA 3VW6A 3DQWA 2QD9A 2W1HA 4FTKA 3OW3A 3QUPA 2BRHA 1JKTA 1GZNA 4NM0A 2WTKC 4D9TA 2Y6OA 4ZSAA 5HD7A 5JFWA 3HV7A 5CSWA 4H39A 4XP0A 4F65A 4ZTMA 3FPQA 3WI6A 3FY2A 3H10A 4XLIA 1UNLA 4U97A 3G9LX 4FMQA 4FUYA 4OTHA 3SXSA 3A62A 4UN0C 4TNDA 1F3MC 3HP5A 4X3FA 2VTAA 5EHLA 2C6LA 1WCCA 3F3UA 3PSCA 4FVQA 4JG6A 3RNIA 5IA2A 2WNTA 3BHUA 3BYOA 3GQIA 1JPAA 3DS6A 3R8VA 5IH5A 4BYJA 4FVPA 4ZSJA 3ZC6A 2UW0A 4PQNA 3JVSA 1K3AA 1TVOA 4CFMA 3DY7A 3H4JA 3PVBA 3IGGA 3TTJA 5KMLA 2CGXA 2ITPA 3DLZA 4GU9A 1R0PA 4Y95A 1YI4A 3MFUA 4M14A 3PZEA 4EHEA 5L8KA 1O6KA 2GMXA 2OG8A 3II5A 4E20A 1W84A 3GBZA 1PXKA 5E8XA 4Y5HA 2XYUA 1GZKA 3R63A 3R1SA 1TZDA 3QX4A 5FLFA 4F4PA 4J97A 4TWPA 3OTVA 5DE2A 2GQGA 5I9XA 3HRCA 1YI6A 1EH4A 2OJFE 4NTSA 4PNKA 4OW8A 3PXKA 4AZWA 1OKZA 3QKMA 3ZO1A 4II5A 4FSWA 5GHVA 3E8EA 3AT2A 4BDAA 1W2FA 4Y73A 4ANBA 4FR4A 2VNYA 4HGLA 2F7XE 3ZLWA 4EOIA 4LV5A 5L6WL 1BX6A 4MWHA 2DUVA 2C30A 4YP8A 4RJ3A 3CPBA 4UMUA 3EB0A 4M0ZA 4DG3E 4TW9A 3QTZA 3MPMA 3TV4A 2HOGA 4UB7A 3EL7A 3RK9A 4BCGA 2ACXA 2C1BA 3MH1A 5A6NA 4BDKA 4G9RA 3FXXA 5EM7A 3V04A 4PRJA 4PNIA 2PVYA 3LJ0A 4QYGA 4S2ZA 4AZSA 3BBWA 4IMYA 4K11A 4O91A 2VTOA 5F9EA 1Y8YA 4BBFA 3QF9A 1KOAA 4RIWB 4FTCA 3TZ7A 4F1MA 3NGAA 2C6MA 3HV5A 5CEOA 2QG5A 2JBPA 5FBOA 4YR8A 5K5XA 2WMRA 3LZBA 4D0XA 4RVTA 1Q3WA 3O8PA 4CD0A 5HEZA 2YM5A 3HGKA 4IWPA 5M51A 3RM7A 4GFMA 3EHAA 1H27A 4F7SA 1Q8TA 4JDKA 3D7ZA 4HOKA 3HA6A 4MWIA 3Q6UA 5GZ8A 1SNUA 2OK1A 4QMYA 5DH3A 4GV1A 4MCVA 4FKWA 2HAKA 2G2HA 3B2TA 3RHKA 3MB7A 4P7EA 2EUFB 4W9WA 1U54B 1B38A 3UTOA 3R8LA 4R5SA 2P3GX 3KXHA 3PSDA 3E3PA 4FZDB 5AUZA 1OL6A 1W2CA 3UP7A 4H3PA 3QWKA 3ANRA 5BVOA 1ZZLA 2E9UA 4I93A 4YGAA 2J0LA 3SXFA 2ONLC 3G6GA 3UOKA 3HP2A 1YHSA 4P4CA 1OKYA 4F6WA 4CNHA 4O0UA 3OCSA 2WU6A 2OIQA 1VEBA 5GZ9A 2QODA 4FSZA 1GIIA 3ZXZA 4E73A 4PP9A 4C4FA 2XEYA 3S3IA 5CSXA 4NFMA 3POOA 5CF4A 3I1AA 3LMGA 5FM2A 3KULB 3GCUA 1DI9A 1W2DA 5LCJA 4IFGA 3R8UA 3BBTB 2GNFA 3QHRA 5FDXA 3E8DA 2HCKA 4WBBB 5D1JA 5HKMA 3A7HA 4J8MA 3F7WA 1PXNA 3CLYA 2VRXA 4C62A 4Z55A 4YTIA 2B9HA 3ULZA 3QALE 2DYLA 4CLJA 4PL5A 3HV3A 4UX9A 4I6HA 2PZYA 3WE4A 4BDIA 4BZDA 2C5VA 2J5EA 3FE3A 4U43A 1YXTA 2BUJA 3DK6A 3AC1A 4N0SA 4ALWA 1R1WA 5DVRA 2O2UA 4NFNA 4JOAA 4LMUA 3OW4A 2I0EA 4WRS