5L4QA

Crystal structure of adaptor protein 2 associated kinase 1 (aak1) in complex with lkb1 (aak1 dual inhibitor)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
303
structure length
293
Chain Sequence
GYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AP2-associated protein kinase 1
publication title Crystal Structure of Adaptor Protein 2 Associated Kinase 1 (AAK1) in Complex with LKB1 (AAK1 Dual Inhibitor)
rcsb
source organism Homo sapiens
total genus 81
structure length 293
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l4qA00
1ZAOA 4FIFA 5EW8A 4S33A 5D11A 3GQIA 4JDJA 3ZUTA 4H1MA 4XG2A 2Y0AA 4UB7A 2XUUA 3NLBA 1OPKA 2VO6A 4HCVA 5AR3A 3U6IA 4CRLA 3R71A 4MD9E 4C4FA 5K9IA 3QX2A 2AC3A 4EC9A 4D0XA 2WD1A 4L01A 5CXHA 1Y91A 2I40A 4AN2A 4AZFA 5C8NA 4E4LA 3FE3A 5BNJA 1ZYCA 2XP2A 4D1ZA 3UZPA 3NGAA 4ITIA 1T46A 5FP6A 1STCE 4HZSA 4AQCA 2QOLA 5IA1A 3ZHPC 3GC9A 4EK3A 4F7SA 4FV0A 5IDPA 4USDA 4FNZA 5CSXA 1P14A 3VUGA 4JBQA 1ZMVA 4G3FA 4TZRA 5EK7A 4AW1A 2YIWA 4WT6A 4O91A 1URWA 3QQFA 3ZEPA 4IHPA 3CY3A 3OVVA 3QCXA 4GIIA 4BDCA 1REKA 2VRXA 4HCUA 2R3FA 1Q8YA 4OT5A 2OH4A 2O0UA 2VWIA 4FKOA 2WXVA 3FLWA 5FEEA 1QPCA 3DKGA 4GVJA 1OL6A 1H01A 4IB0A 2ZM3A 4X2GA 4X7QA 3DK6A 2XKEA 4YO6A 4BDHA 3ZO3A 4RJ6A 1ZY4A 3O7LD 5HLNA 4NKSA 1Y57A 3FZTA 1A06A 2CGUA 4FIJA 3ZXTA 4FKUA 5TOZA 1XH5A 4XUFA 2CSNA 4MK0A 4FICA 3GU6A 3CE3A 3S00A 3FBVA 4EWHA 2JDOA 1YWRA 2QOFA 3R1SA 3U4UA 2ZDUA 4FV7A 3KN5A 4M13A 4JIKA 5ANGA 2PUUA 5IH4A 5AADA 3TUDA 3A7JA 4MNEA 5IA0A 3E64A 4M66A 3VWAA 5BUEA 1MRUA 2QOKA 3BIZA 1GAGA 4MXAA 2NPQA 3QUPA 5H8BA 4AU8A 2VTPA 4FI1A 3BLRA 4LOOA 5BX0A 5CT0A 5KNJA 4OT6A 3VIDA 3A7FA 4MD7E 1UU3A 1P4FA 2VWYA 3KC3A 3R1NA 4K33A 3G2FA 3QTQA 5EI6A 3EH9A 5HE2A 3QUDA 3HV5A 5CU3A 5FD2A 4BZOA 4UZDA 4EZ5A 3RK9A 3NAXA 5BMSA 3QRKA 2Y4IB 3PY0A 3R6XA 4IFGA 3ET7A 2O2UA 5TR6A 1UV5A 3KEXA 5F95A 5H3QA 2WNTA 5BVEA 3AC4A 4OR5A 2B7AA 4ZY4A 4C62A 1OPJA 2J7TA 4OAUC 3BYSA 4U3YA 3U4WA 3VBWA 3UNZA 3HV4A 2A1AB 3R0TA 2OIDA 1XR1A 2GS7A 2VZ6A 3BEAA 4F6WA 2R3RA 3FMNA 2WO6A 5A6OA 4FG8A 5DOSA 4FZAB 1RJBA 4L9IA 4QP9A 5DI1A 3RZFA 3IK3A 4Y95A 5H8EA 5CENA 1ZY5A 3ZDIA 4ZTQA 3FLSA 3VS5A 4JLCA 5M44A 2PWLA 3H3CA 3Q5ZA 5CSHA 5AR8A 5FM2A 4OTGA 3V5QA 4QTCA 1IR3A 3JYAA 4FTOA 3P86A 3RAKA 4G2FA 1JOWB 3MA3A 4EBWA 2X2LA 3QD0A 3W8LA 4FVRA 4X3FB 2ESMA 4D5HA 5EW3A 3OWLA 4CMOA 2FO0A 2YM7A 5HEZA 5HICA 3TT0A 5BUJA 3GU7A 2OBJA 4YZMA 5ACKA 4FNWA 4MD8E 2VTSA 2PZRA 4I41A 5FLFA 3PFQA 4A9YA 5CASA 4KSPA 4HZRA 5L2TA 2JIVA 3F2NA 3KN6A 4BDGA 3A62A 4O2ZA 3RHKA 5A4EA 4GS6A 3TUCA 2R0IA 3JS2A 4YUQA 2VTTA 2AC5A 4BICA 2C6MA 3D9VA 5HX6A 1AGWA 3KRXA 4XV2A 5AUTA 3OY1A 4FTRA 4J96A 3WARA 3OP5A 3LW0A 3QRIA 3QLFA 1MQBA 4OLIA 4QYFA 5JK3A 4CT1A 3SW4A 3OOMA 3UVQA 3VS3A 2IVSA 1NVSA 4CKJA 3HL7A 3PA4A 3QZGA 3KRRA 1YVJA 2ITQA 4FT0A 2LGCA 3G6HA 2OJGA 2GHGA 4FTUA 3C0IA 3QHRA 3HV6A 2YM5A 2C6LA 4GSBA 2ONLC 5BYYA 1Z9XA 3W2RA 2WOTA 4MBLA 3UMWA 4IB5A 4P4CA 4IANA 4U7ZA 4BDJA 2RFNA 3FJQE 1Y8YA 4DYMA 3VULA 3DGKA 3KCFA 4YNEA 4E20A 4F1MA 1YOJA 4PRJA 4QP2A 3L9NA 4BBEA 3ORKA 1R78A 1XBCA 5ANEA 3C51A 3NIZA 1X8BA 3UIBA 3O51A 3KA0A 4G6LA 4RIXA 5M51A 4RLLA 1OB3A 3EQPA 1W8CA 1KE7A 4RFZA 3S2PA 3AD4A 3PXYA 1PXPA 3R1YA 4N6YA 4XG3A 3TL8A 3C5UA 3ENHA 4O1OA 4QP6A 4Y73A 5M4FA 5EYDA 2F9GA 3A8WA 5EHYA 1YXVA 3Q96A 3R8UA 3PA5A 3RPSA 3CQEA 4XJ0A 5K0XA 4ZK5A 4RQVA 5HGIA 3HEGA 4UWCA 2VWWA 3VUIA 1WMKA 4N0SA 5AIKA 1W0XC 4QQJA 3A7GA 3RBWA 1SM2A 2PMOX 5IF1A 3RNYA 4GG7A 3PG3A 3RHXA 3R01A 3ZSGA 2BRMA 3QCYA 1H00A 4D2PA 1PXMA 3RAIA 3R7UA 3PUPA 4I0TA 4AT5A 3AGLA 3BWFA 4R1VA 4LGGA 4IZ7A 1FPUA 3MIYA 5IU2A 4UMPA 4FSMA 2PK9A 3KXXA 4GMYA 3HECA 3VHKA 2VAGA 3ZUUA 2QR7A 4W9WA 5AM7A 5KKRC 5HTBA 3A61A 3L8XA 3GI3A 2DUVA 3TV6A 4EQCA 3DAKA 4EL9A 4A9UA 4FSYA 4D2TA 4FYOA 3TNHA 4UWBA 5CAPA 4HYHA 3KKVA 5E8SA 1SZMA 2VTLA 2F7EE 2R0UA 4FIIA 4QMWA 5CEOA 4UZHA 3R8PA 4BWXA 2QG5A 4X2KA 3ORNA 3NX8A 1Q99A 3MBLA 4QMOA 4RIYB 3SDJA 3E8DA 4PMPA 5EYMA 4ZTNA 3SQQA 2GHMA 4DFNA 4E6AA 3Q53A 5J95A 3V5PA 3G33A 2I0VA 4RIWB 2YACA 1WBWA 4FC0A 4ZJIA 3N9XA 2EXEA 4P5ZA 4CMUA 1GZKA 2IZRA 5D10A 2WPAA 1J3HA 3KXNA 4KS7A 5LVLA 3R8VA 1ZMWA 1OUKA 3A4OX 2UZNA 2WTCA 3I5ZA 4FSTA 2X2MA 1Z5MA 5CI7A 1REJA 4LQMA 2RL5A 3W2SA 5GZAA 3U8WA 1OIQA 5L6OA 4IM2A 4FTTA 1FMOE 2JD5A 5FWKK 4G34A 3W33A 1XBBA 3ZMMA 5G6VA 3KXZA 2PHKA 3BHYA 3OEFX 4PL5A 2UW4A 4CFUA 2XF0A 3WE8A 3CD8A 1BI7A 3B2WA 1XHAA 4ZIMA 4U9AA 4NIFB 3V3VA 3D5WA 4JBOA 2HAKA 1ZWSA 5CAOA 3QZIA 4PNIA 4QTAA 3UPZA 2X7OA 4BZNA 5LWNA 3JY0A 1JSVA 2BAQA 5AX3A 3TJDA 2VWUA 4IAKA 3LFQA 3ZLXA 5C8KA 1PF8A 5E91A 2IZUA 2C0TA 2XEYA 1JKLA 4QYGA 2B55A 4WUNA 5KUPA 4JXFA 2UVXA 4MVFA 2YCFA 4WSQA 4D58A 2VUWA 4M68A 4X3JA 3JUHA 4AZSA 4ZTMA 1M2QA 4G3DA 3COMA 2W1ZA 4L68A 3F3VA 4NT4A 4XEYA 3R83A 4E5WA 2C0OA 4JAIA 3VNTA 3DOGA 4ZY5A 4ACGA 4IX4A 4FOCA 3VBTA 4QNYA 5J7HA 4EHEA 3QXOA 4YJQA 3E87A 3WIGA 4WA9A 1YXTA 3C9WA 1PKGA 1VYWA 2OICA 3GU4A 5CTPA 1FGKA 3I79A 2UW3A 2B52A 3KB7A 4EK8A 3DBQA 2ZMDA 3QKLA 5AUXA 3A4PA 4GVAA 5HO8A 2ZOQA 4TYHB 3TNWA 3IQ7A 2YDIA 3HUCA 3LE6A 1ZYDA 3E88A 4C3RA 4YBKA 1OIYA 4CNHA 5IEVA 5DN3A 1UNHA 4K1BA 3MY1A 3MW1A 3D7ZA 3M1SA 3LOKA 4EUUA 2C69A 3UQGA 4BCMA 4LGDA 3GC0A 3UBDA 2W1CA 3NUPA 1NXKA 4DFXE 5KMNA 1JSUA 2XM8A 2XNEA 3MPTA 3GEQA 4EUTA 3UYSA 2W05A 2VX3A 2ITXA 3MTFA 5HIEA 1HCLA 4GFMA 3R63A 3O8PA 4L00A 5LMKC 4JG8A 4QP4A 2H8HA 4BHNA 3K2LA 4YU2A 1Q8ZA 5CEMA 3F6XA 1PMVA 4YZDA 3TG1A 3UG2A 5E90A 4AW2A 4IWOA 5DT3A 4ZXTA 3QX4A 2C3IB 1S9IA 3QD4A 5ANIA 2DS1A 3AMAA 3NRMA 4HGLA 3QTWA 2XYUA 4I94A 2GHLA 4AA0A 4RT7A 4K11A 4Z7HA 1XWSA 5LQFA 2WQBA 1MUOA 2R3GA 5DEWA 5LARA 3RCJA 2XCHA 4C4HA 2YAAA 3O0GA 2XKDA 4DG2E 5J7BA 3QZHA 2P2IA 4FK6A 2G01A 2OU7A 4D4SA 1RE8A 3WBLA 4FSZA 3RPYA 5BMMA 3EB0A 1OGUA 4RVMA 3PY3A 1SNUA 1JKSA 2RF9A 3AD5A 3H30A 5LWMA 3FY0A 3PIXA 2VNYA 4J97A 4PV0A 5ANDA 2PVLA 5AP5A 5GHVA 4MEDA 4PDSA 3BGQA 1J1BA 1MP8A 1Q8TA 3NZ0A 1UVRA 2I1MA 5AM6A 4IVCA 4UV0A 4ZTRA 3FPMA 3PWYA 2H9VA 2VTJA 4BIDA 3ZM4A 1XH7A 3DU8A 3IPHA 4I6QA 5B2KA 3R2YA 4IFCA 4YURA 3AT4A 4DN5A 3COHA 2PSQA 1H1SA 2W1GA 3V8SA 4A4XA 4NCTC 5EKOA 3G90X 3ZS5A 4CFWA 2EVAA 3DK3A 3GU5A 5E8VA 3VRZA 5CNNA 3HRFA 5AP1A 4UMQA 2OFUA 3TWJA 3FUPA 1CTPE 1DI8A 1TQMA 4J8MA 2VGPA 3ZSHA 1PXIA 4IWDA 3TNIA 1FMKA 3VO3A 4NW6A 2R3JA 4C57A 3C7QA 4OTRA 4WHZA 3MGYA 3FLZA 2XVDA 2BIYA 3PZEA 5IDNA 1JQHA 3PVGA 4K18A 2B9JA 2JDVA 5KMIA 2OXDA 2XNOA 3W32A 3W2CA 3FI3A 3FQSA 4I5CA 3H9RA 2EUFB 4FK3A 4UN0C 4JAJA 4NM0A 2JITA 3BZ3A 4O27B 4BDDA 1YXUA 4XP2A 3HA8A 3KFAA 3QD3A 3LJ2A 2GCDA 4IMYA 4J7BA 3HDMA 4EOIA 3C4XA 4JG7A 3W16A 4YTHA 4CSVA 4RZWA 3EYHA 2J2IB 1B38A 1DI9A 2JEDA 3CPBA 3L9PA 2C6KA 4MF1A 4F0FA 3OHTA 3AD6A 5HNBA 3HUBA 4BHZA 3FZ1A 4AE6A 2C5OA 3FLQA 2PVYA 4Y72A 2W0JA 5IKWA 2ITOA 5JH6A 3DAJA 3FI2A 3RNIA 4ALUA 1WBTA 2WELA 4YZCA 4EH5A 5HIBA 4UMRA 3KXHA 1PXLA 3T9IA 3I5NA 1JSTA 4QNAA 4FV8A 2Z60A 4NKAA 3LMGA 3ZO4A 1BX6A 2X9EA 1KSWA 4IVDA 4Z9LA 5HTCA 1JVPP 4BF2A 4FKGA 4KBCA 4EH6A 1Y6BA 4OTQA 4M12A 3UVPA 5BVNA 2VD5A 4A07A 4K2RA 4CD0A 3BKBA 5DR6A 2WQOA 4TWCA 3R8LA 1B6CB 2UVYA 5DT4A 4F64A 3VUDA 4EOLA 4LRKA 2O5KA 4ZSEA 2GNJA 2W4KA 1YI6A 3D7TB 2HW6A 3Q32A 4QPSA 4TL0A 5HVKA 3CTHA 2B54A 3BU6A 2ITPA 4R7IA 4XOZA 2JFLA 2NRUA 4FUYA 4OBQA 3R9HA 4E6CA 1LEZA 3TZMA 2YIXA 4HGTA 4ASXA 1RQQA 3E3BX 3SW7A 5CLPA 2QONA 4AG8A 3UPXA 4IZ5A 4PUZA 3IGOA 4CYJA 3MS9A 4ITJA 3QGYA 4U42A 3F69A 3PZHA 4DG3E 3GP0A 3JPVA 3R1QA 5EM7A 3VBVA 3P7CA 3CS9A 3PJCA 4DLJA 4CV9A 5L3AA 3Q4TA 1YHVA 3TZ8A 5IUHA 4CYIA 2RFSA 3F3ZA 4AS0A 4OAVB 2PE1A 4M8TA 3HNGA 5AP6A 3VJNA 2HK5A 4QMNA 2CN8A 5LCKA 4UMTA 5FP5A 2C3KA 3VN9A 3R7OA 3EYGA 3D5XA 4CLIA 4BBMA 3O23A 5JFXA 5IEXA 4YMJA 1H8FA 3DBCA 4C59A 4ZLOA 4WBBB 2W4OA 3EQHA 3FWQA 3BX5A 4MBJA 3D94A 2JKMA 3VW6A 3R28A 3EFJA 3BELA 3UO4A 3UNJA 2HXLA 3I1AA 2O8YA 3BYUA 1SVEA 3IW5A 3KXGA 3DJ6A 4R3RA 4TNBA 4WBOA 3L8SA 5T3QA 4RX7A 4GT5A 5KMMA 2HYYA 3OCBA 5B7VA 2CPKE 4GL9A 3VAPA 3QF9A 4H36A 4IAYA 1MRVA 3A7HA 4YTCA 5AP3A 4QMQA 2VWZA 3L8VA 4GJ2A 1JPAA 3R00A 3HP5A 4ZSJA 4O1PA 1ZOEA 2YAKA 5TF9A 2JBOA 3I0QA 4YGAA 3HV7A 4KIKB 3RPOA 4ANSA 4FUXA 4LOQA 5AA9A 4D4RA 1G5SA 4BTJA 4XBUA 2VGOA 3E93A 3DFAA 3ENMA 4IVAA 3UQCA 2OJIA 3OOGA 4MTAA 1URCA 3R7VA 3V8TA 1HOWA 4BCNA 4L46A 3OT8A 4XX9A 4A9RA 1T45A 5HD4A 3G6GA 5DEYA 1LEWA 3ZRKA 2XA4A 5M4IA 5IA5A 5KO1A 5FM3A 3QCQA 4DGMA 4HPUE 5JEBA 4R1YA 1UU7A 4EYMA 3W10A 2F49A 2IZTA 4IWPA 5EH0A 4RWLA 4PP9A 3NW7A 2OG8A 3VS1A 4PMTA 3KY2A 2RKUA 2CHLA 1V0PA 1KE6A 2UZTA 4GT4A 4J52A 2XK4A 2ITNA 3ZH8A 2FSLX 4IZAA 3R9DA 1W7HA 3COKA 5CS6A 2BDJA 4GUEA 4MWHA 4PWNA 4BVUA 5ETAA 3TXOA 3C0HA 3FYKX 1PXOA 4R3CA 4ANBA 5GJFA 3LAUA 4ZAUA 2QO9A 4GYGA 5KMKA 3ORPA 1PMNA 2QLQA 4MXYA 2ZV2A 3QKKA 4ANMA 3IECA 4AAAA 4I93A 1E1VA 1PW2A 1LP4A 2OK1A 4LL5A 2ONLA 3ROCA 3LQ5A 4JDIA 4BWPA 4II5A 4Y85A 3UZTA 3BGZA 2VV9A 2ITYA 3B8QA 3DAEA 2C5YA 1OIRA 2GNHA 3E63A 1U46A 4BCQA 3HVCA 3H0ZA 3FMLA 4OW8A 1XH9A 3EKKA 4F0GA 1UU9A 4QYYA 2OJ9A 4MF0A 4AF3A 1GIIA 4KS8A 1S9JA 3ORZA 4AP7A 3PA3A 3IDBA 2UW8A 3LQ8A 3DKCA 2BR1A 2DYLA 5M55A 3NIEA 3WF8A 4YJSA 3QHWA 4TWOA 3FMMA 3Q4UA 4J8NA 2IWIA 1H27A 2C6DA 2YN8A 3DBDA 4MX9A 4H3QA 4FF8A 5IUIA 5CF8A 5CU0A 3RINA 2JFMA 5F20A 1F5QA 4GH2A 4C3PA 5F1ZA 4USFA 5E8XA 5EM5A 5CAVA 1XJDA 2X1NA 1OKWA 4C36A 4IW0A 5J8IA 1H1PA 3LFBA 4KD1A 4ALVA 4BCPA 4Y5QA 4FTKA 5ETIA 4ZOGA 3ZFYA 1ZARA 4DFLA 4RWJA 3Q9YA 3KGAA 3C4EA 4L67A 5EYKA 4DG0E 3O8UA 3QL8A 4U3ZA 5CF4A 1R0EA 2P2HA 4IADA 4IAAA 4JBVA 4R5YA 4KKHA 2VTQA 3TKHA 3L9MA 1J91A 4N4SA 3PYYA 2JKQA 3PP0A 2EWAA 4U44A 4AT3A 2YIYA 2JBPA 5I9WA 4EOMA 3C13A 3MJ2A 3I6WA 3AC3A 3M2WA 3TTIA 3WZEA 1H0WA 1PYEA 4QP3A 5F4NA 5ACBC 1GZOA 4ANQA 5EDQA 4L42A 2IVTA 4OTIA 4XRLA 4E93A 4EH3A 4NZWB 3FV8A 4BRXA 4JT3A 4RJ4A 5M4CA 2B9FA 4UXLA 1BUHA 3RMFA 5I9VA 3MI9A 2YLFA 5A14A 3BE2A 3SRVB 5IUGA 4CZUA 2P3GX 1K2PA 2E9OA 3GFEA 1J1CA 4MXZA 1SYKA 3FXXA 5KZIA 1WAKA 4RJ5A 4QMVA 3QQJA 2FSTX 2XIZA 3F5UA 3D0EA 3VUTA 2OKRA 4YJRA 2XK6A 3V8WA 1JKTA 4N70A 5EI2A 5HBEA 3I0OA 3P7BA 2YJRA 3BQCA 3EMGA 4J99A 4QQCA 3FLYA 5AAGA 2RG6A 4O96A 5I9UA 1M7NA 4ENYA 2CCHA 4XHKB 3ANQA 3H4JA 2OZAA 4B4LA 4BCGA 4C2WA 3AQVA 4H1JA 2J90A 2QLUA 4F4PA 1ZXEA 4IDVA 3EKNA 2HZ0A 4I4FA 3EL8A 2XIYA 5A3XA 2BVAA 2QOQA 4QPAA 3DZOA 3W2OA 3W8QA 3ZSIA 1JLUE 5L4QA 3PPZA 4F65A 4U0IA 1M2RA 3UP7A 4X2JA 4PL4A 4XV3A 1VR2A 2OSCA 3A8XA 1H28A 1RDQE 2C6OA 4R3PA 2VO3A 2VO7A 4YSMA 4E7WA 2UZEA 2ZV9A 3ETAA 4FSRA 4H39A 3DDQA 3Q2MA 2J6MA 4EZ7A 4HVDA 4G16A 2J5FA 3HZTA 3U87A 3R2BA 3ULZA 4BTKA 4ZSLA 3VS6A 1VEBA 2JLDA 4W4XA 4F7NA 4U81A 5I3RA 3PJ3A 2P33A 3BE9A 4DGGA 5HO6A 2ZB0A 2YJSA 4YC6A 4RA4A 3MVJA 5D7AA 2C47A 2XYNA 2RFEA 1KV2A 2BDFA 4IZYA 3ORXA 3I7CA 3GGFA 3LJ1A 4F08A 4FSUA 5DR2A 3SHEA 3IW6A 4LRJA 4A4OA 4DEHA 3JVRA 3OWJA 3LIJA 3ELJA 2BILB 3KL8A 2E9VA 4BZDA 3W2QA 2YHVA 2PZPA 4RZVA 2C0IA 4CT2A 1CKPA 2XKCA 5HCZA 4XMOA 4I0SA 1OI9A 4G31A 1FVTA 4QMXA 5E1SA 4ACDA 4L3PA 5KHXA 5AR4A 1F0QA 3OG7A 3PWDA 1Z57A 4G9RA 1OL7A 3F88A 3MYGA 3Q4ZA 3G9NA 3NCGA 2C4GA 2ETRA 3KK9A 3LCTA 2OXXA 5BVKA 5J5TA 3FYJX 3WYXA 4U5JA 4EC8A 2C5NA 1R0PA 2OGVA 2OO8X 3NYOA 5BYZA 3WE4A 5C8MA 4YC3A 5M4UA 3VQHA 2UZVA 3LZBA 2WGJA 2GNFA 5EOBA 3LJ0A 3Q9WA 5CSVA 2VTOA 2IW9A 2WHBA 3DY7A 5ITAA 4D1XA 2WTWA 5CEIA 2BRBA 3A60A 4A4LA 3UNKA 1OUYA 1GNGA 1H25A 4FSWA 2HZNA 4XCUA 2UZDA 3DLSA 4J71A 2VU3A 3MH3A 3FSKA 3QTZA 5T68A 3UVRA 4XYFA 2PTKA 3OW3A 1Q8WA 1XQZA 4V05A 1YDRE 4NWMA 2ERKA 1IRKA 4P5QA 5CAUA 2QOHA 2YIQA 4Z16A 3QUEA 5DFPA 2EB2A 3QC9A 3QC4A 2J0IA 3BU3A 3CGOA 5LMAA 4FTMA 4K9YA 4WG4A 5L6PA 1O9UA 4FNXA 2WTJA 2QOIA 3IDPA 4FSNA 1Y6AA 4S30A 4QRCA 2R3OA 3NDMA 3CD3A 4QMLA 1WBPA 4UY9A 4APPA 2GS2A 3FL4A 1LR4A 4WKQA 2CGXA 3UO6A 2F4JA 3MDYA 5C1QB 2QOBA 3BLHA 5DLSA 5HG5A 4FSQA 4HCTA 3UQFA 1SVGA 3MVLA 3HX4A 2QNJA 4FZDB 4YNOA 2V55A 4IB3A 2G1TA 1FQ1B 4FBXA 4QTBA 4D9UA 5AV4A 3NR9A 1UU8A 2QKWB 3FC1X 4G17A 3CJGA 4AOJA 3RJCA 1M14A 4FL2A 2HZ4A 3EZVA 1YXXA 4QMTA 2W1IA 4F9AA 5JKGA 1DS5A 1QMZA 2A27A 4JVGA 5HIDA 3QRTA 4GK3A 5AA8A 3BLQA 5JGAA 1ATPE 1NA7A 4DCEA 4NEUA 5HZNA 4PDPA 3SV0A 3KCKA 3LXPA 4FX3A 5D7VA 3V6RA 4FV4A 1SNXA 3C4ZA 3ZDUA 4B8MA 3SC1A 5BQ0A 1OKZA 2P55A 2W1HA 2BRGA 5DA3A 3IOPA 3GC7A 3DV3A 3GENA 1BL7A 3OZ6A 3BYVA 2HXQA 4IXPA 4ANLA 4X3FA 4O0YA 4D1SA 4W8DA 4I3ZA 5DIAA 4FZ6A 5DT0A 4C38A 4QTEA 5L8KA 4C4JA 5F94A 5E92A 1IG1A 1KE8A 1OZ1A 3GU8A 2OW3A 3C50A 1ZZLA 2FVDA 2A19B 3CP9A 3PRIA 4NTSA 3OT3A 3ZRMA 4F7JA 4M69B 1DAYA 2O65A 4AGWA 5HLWA 4D9TA 5IA4A 4BGGA 2F7ZE 2O64A 4BYIA 1U5QA 4ANOA 4C33A 3LCDA 5KHWA 2YM4A 3EJ1A 4DHFA 5ANOA 2ZDTA 4XG6A 3NPCA 3B2TA 4ZTLA 3MVHA 2OXYA 3ZUVA 1WBOA 2G2FA 3MN3A 4B7TA 1OMWA 3IW7A 4RPVA 1ZMUA 3R8MA 4BCFA 4V0GB 3IONA 3QQHA 1V0OA 4LYNA 1B39A 1DM2A 5J1VA 3T3UA 1Q61A 3MB7A 4X6QC 2ZVAA 3DTCA 4YSJA 3C0GA 3UIMA 2YEXA 1Q3DA 2QR8A 3AXWA 3F7WA 4FR4A 4NTTA 3TNPC 2XS0A 4Z55A 4CFXA 4I1ZA 2W1EA 3WZDA 2IW6A 4I0RA 2GPHA 4L52A 4U41A 3IO7A 2C6IA 4KA3A 3Q6WA 4U97A 2XBAA 1OM1A 5BUIA 4H3BA 2VN9A 4N6ZA 3UOKA 4YJVA 1XO2B 3BHVA 2ITTA 2ZM4A 4JS8A 3MPAA 5J1WA 3CBLA 5CVHA 2BFYA 4TXCA 5JQ5A 3FHRA 2XKFA 4FOBA 2C5VA 4D4YA 2I0HA 4JL9A 1OIUA 2JDSA 1FVVA 2UZBA 3QRUA 5KMJA 4EOJA 2AUHA 3FY2A 3KVXA 1M7QA 2OH0E 1Q97A 1QCFA 4P2KA 2XNGA 3DA6A 4FNYA 2CDZA 4I5HA 4W9XA 3E7VA 5CF6A 1YWNA 4LUEA 2I6LA 3ZLYA 3U9CA 4PX6A 4FV5A 2FYSA 4YJNA 5LVMA 2IJMA 4FKQA 1PMUA 2PZ5A 4FL1A 3MSSA 2W7XA 4HOKA 3Q04A 3QA0A 4ITHA 3TEIA 2BRHA 5HHWA 4EZ3A 3HRCA 1O6YA 1PXJA 2QKRA 4IM0A 4PTGA 3EFKA 4Z7GA 1O6LA 3KULB 3VBYA 4ZY6A 4L8MA 1BYGA 3PXZA 4TYJA 5EM6A 4BL1A 2UW5A 2XNPA 5C26A 5LXMA 3HMOA 3OEZA 5EM8A 4I21A 2RGPA 4YZ9A 1FINA 2XIXA 3E62A 3MV5A 4O38A 2C1AA 4PY1A 2WQMA 5ETCA 3UDBA 4DGLC 4FVQA 4EOSA 3P23A 2X8DA 4UMUA 4FIGA 4F0IA 1WBSA 4NUSA 4C34A 3P4KA 2UV2A 2I0YA 4GEOA 4JOAA 4MKCA 4S2ZA 4BGQA 4HVIA 2FH9A 2YM8A 3EN5A 4L53A 3QTRA 3Q3BA 3RVGA 4IC8A 3OMVA 4R6VA 3NEWA 4DC2A 3LLTA 4JIAA 2REIA 2JIUA 3F5XA 2C5XA 3DZQA 5FEQA 3EQDA 1OL2A 2WMBA 3QQKA 3GCQA 3ZBFA 3FXZA 1M52A 2OZOA 2W17A 3TKUA 4G1WA 2GFSA 1YI4A 4BN1A 5BVFA 2X7FA 4S34A 2WMUA 2W06A 2W96B 2Z7LA 1H07A 2UW0A 1U54B 1PKDA 4HYUA 4C37A 1YDTE 5M57A 4PL3A 1SMHA 4RIYA 3RM7A 3RPRA 5DWRA 4FKVA 5DRBA 4LMNA 5HORA 1NVRA 3G5DA 2QHMA 4EH7A 3FMDA 3FKNA 2QOCA 2Y9QA 3PIZA 2J0KA 3FL5A 3UODA 3CJFA 5CQUA 4RIWA 3R7EA 2QU5A 4RSSA 1R1WA 2CGWA 1KV1A 3DNDA 4LL0A 3V5TA 4AGUA 4Q2AA 4O0UA 5KMOA 3WF6A 3OXTA 4DTKA 4BKZA 4EH8A 5A4TA 4O22A 2WEVA 2PVNA 3QLGA 4Q9SA 4QOXA 5K3YA 3HLLA 4G5PA 5HI2A 3RCDA 2VTIA 2XK3A 5FGKA 4NIFA 2WEIA 5J9YA 4D4VA 2XJ1A 5HU9A 4QPMA 3NUUA 1Q41A 1H1QA 3D2IA 3F9NA 3AT2A 3CQUA 3I7BA 3IW8A 3NNXA 5DBXA 3CLYA 5EOLA 4FT7A 4U8ZA 3CC6A 4DITA 2V7OA 2HENA 2WTKB 4DINA 4OTWA 2R4BA 4FT5A 4IQ6A 3F7ZA 4GU6A 4U45A 2ZM1A 3G51A 3ULIA 3ORMA 4AUAA 2W1FA 4EOPA 3KVWA 3VHEA 2WIPA 3D5VA 3OCTA 3AMYA 3P9JA 4QP1A 2CLQA 3H9OA 4ARKA 3FHIA 4CVAA 2OWBA 4FKPA 4JR7A 4GK2A 5FQDC 3QA8A 2X6DA 5DG5A 4RC4A 3CKWA 4JQ8A 4Y46A 3T8OA 2X4ZA 1I44A 1ZRZA 5HD7A 3BQRA 4FKIA 3NNVA 4I22A 2QQ7A 1MQ4A 4G3CA 2UZUE 4LOPA 3SX9A 3KRLA 3WIKA 4U43A 5ANKA 5G1XA 4DH1A 2G2HA 5LCJA 5K4JA 3W55A 4D2RA 4UALA 4PQNA 1PJKA 4XP0A 2Y4PA 3BBWA 3AG9A 4IH8A 4TYHA 3L1SA 3SD0A 5H8GA 3DTWA 2UZLA 4FZ7A 4CFVA 4BCJA 3OFMA 4YBJA 4PMSA 4FV3A 2OF2A 1GOLA 2XRWA 3LCSA 4BDIA 5JT2A 4MNFA 3OF0A 4UYNA 4FMQA 1OL1A 3U9NA 4A9SA 4WO5A 1YQJA 2WMXA 3AOXA 3PJ1A 3DDPA 4QTDA 4YHFA 4H3PA 5CZIA 4B6LA 4HNFA 2C6TA 2BTSA 4MHAA 4WG3A 4XOYA 1Q5KA 2A4LA 2BMCA 4EHVA 4MQ1A 2CN5A 3R22A 3WOWA 4ACHA 2HY81 4M97A 3VW8A 4BYJA 2W5BA 4FIEA 2BAKA 5L2SA 1LPUA 3EN4A 5HG7A 3MB6A 3CTJA 3RM6A 4EKKA 3LFNA 2BCJA 2YCSA 3BV2A 3SOAA 5CALA 2C30A 1WCCA 2XIRA 4WIHA 4OTHA 2BROA 5K5NA 3UE4A 3IGGA 3TIZA 5E8WA 2HY0A 4XV1A 3MY5A 4GG5A 4O6EA 2B4SB 2XB7A 3F5GA 4O0WA 1OL5A 4RWIA 5AUWA 5I4NA 3MH1A 3JXWA 3A7IA 4YTIA 3OTUA 4RFYA 3E8NA 4C4EA 2Z7QA 4QMPA 4L7SA 3VQUA 3O7LB 5AP0A 4L3JA 4WNOA 3VUHA 4RLKA 4OBOA 3QZFA 4JDHA 1OITA 4FTNA 2BAJA 3FXWA 3TV7A 4NU1A 1K9AA 3SLSA 2B1PA 3FKOA 4GU9A 3GQLA 3MIAA 1GIJA 3K54A 4KIQA 2R3NA 3PRFA 4BBFA 3D5UA 2A2AA 4CFMA 2YCQA 4Q5EA 3TUBA 3UOJA 4IDTA 5EYCA 3AT3A 4AZVA 4PP7A 4DGOA 3WI6A 2YA9A 1XKKA 3DJ5A 3OCSA 5AAFA 2XJ0A 5AP7A 3I6UA 2ERZE 1Q3WA 4K8AA 2B53A 2OJFE 3VVHA 3ZLWA 3HMMA 3AC8A 2O63A 1BL6A 3UOLA 2JDTA 3MVMA 4KBAA 3CTQA 3ODYX 2VX1A 4EORA 4DEEA 3BU5A 4EH4A 4LUDA 5DPVA 2WAJA 2Z2WA 3P7AA 4O0SA 5HOAA 2E2BA 3ZU7A 1NVQA 4E8AA 4I4EA 3TTJA 4D0WA 3Q52A 4HGEA 3HKOA 4FV1A 5E8ZA 4NFNA 2ETKA 3ODZX 3CPCA 4QQTA 4IIRA 3PLSA 3BCEA 5IEYA 4DBNA 4FTQA 3QQLA 4XV9A 2LAVA 2YIRA 4NJDA 3CIKA 4YHTA 3LFDA 3WYYA 2GTMA 2J0LA 3MFSA 4U6RA 5TO8A 4L6QA 4YP8A 1DAWA 2HELA 2H34A 2V22A 3BHHA 3R9OA 4DH7A 4TWNA 2B9HA 3UIUA 3V01A 4IAZA 2HIWA 3PIYA 4ALWA 4EI4A 5AV2A 3BWJA 3TACA 1A9UA 3VRYA 5CAQA 3Q9XA 2HWOA 4TTHB 1GIHA 4AACA 3GC8A 3PTGA 3O8TA 1LUFA 2E9UA 2FUMA 4RVLA 3U6JA 3TIYA 3CKXA 4TNDA 1H24A 1XH6A 3S95A 3E8CA 4X6RA 5CSWA 3H0YA 1NY3A 4IACA 5CU4A 4BWKA 4RA5A 2OIQA 4EK6A 4HYIA 2W5HA 1WFCA 3PP1A 4IX3A 4CZTA 2X4FA 1PXNA 3P79A 3TV4A 4W4WA 5E8TA 3DBEA 4MNEB 3OD6X 5BVWA 4DH8A 4EQUA 3TKIA 2F57A 3MH2A 2GMXA 2NRYA 2WQEA 3WZUA 4IJPA 2EB3A 5D9HA 3O71A 4GYIA 2FGIA 4YZBA 1YXSA 3DB6A 4O0TA 3VBXA 4RX5A 2HCKA 2XEZA 4KSQA 3MPMA 1AD5A 2X8IA 1Y8GA 1ZYSA 3NCZA 4LG4A 2YLEA 2WIHA 3NUYA 4ASEA 3EIDA 2FSMX 4DFYA 5DNRA 4EOQA 2A0CX 3FSFA 5CNOA 5I3OA 4YPDA 5ICPA 2R64A 4QYHA 1UKIA 2RIOA 3ZXZA 2R3HA 5A46A 2J4ZA 4FV9A 4RGJA 3S0OA 3V5JA 5CQWA 3AC2A 3VF8A 1YI3A 4F7LA 4ZZNA 1UWJA 5IG1A 1APME 4IC7A 4QMZA 5I9XA 2UW6A 3R04A 4QO9A 3PVUA 2GFCA 2E9PA 4OUCA 1W84A 5AP4A 5HBHA 2UZOA 3ACJA 4UXQA 5FBNC 3RP9A 3RK7A 3LFSA 5GNKA 2CMWA 5CF5A 5K5XA 4QMSA 4ERKA 2QURA 3KU2A 5AWMA 2YERA 3H10A 3ZYAA 1PY5A 2OFVA 5FXRA 1R39A 3LFCA 1PYXA 3ZC5A 3COIA 5IPJA 3EQFA 2YDJA 3TCPA 4CQGA 2YISA 4EHZA 2UW7A 4WSYA 3O50A 2GQGA 5I9ZA 3DBFA 5L6WL 4DEIA 4I92A 4D2SA 2W4JA 3ZO2A 2GS6A 4QYEA 3SAYA 3QQGA 5ANJA 4L7FA 3QTSA 2CKEA 3AC1A 2BKZA 4O0XA 5CX9A 2VWXA 3CR0A 4PPAA 1PHKA 1ZOGA 2JDRA 5GJDA 4AZTA 1XBAA 3PXRA 2X6EA 4I5MA 4LRMA 4QT1A 4U79A 2XMYA 3EQGA 2YWPA 4PTCA 1UNGA 4D5KA 2QD9A 3SVVA 3VJOA 3MJ1A 2H6DA 4WG5A 5M53A 4YHJA 5AR2A 3H9FA 5A9UA 2ZYBA 3FI4A 3QYWA 1VZOA 4AZEA 3ITZA 4IM3A 2VTHA 3GNIB 4BIBA 4ZLYA 2W99B 3VS0A 4MXXA 4FKWA 4KIKA 3RAWA 4K0YA 3K3JA 4GW8A 4ACCA 3RZBA 5KZ0A 3BPRA 1KWPA 4GIHA 4AWIA 4RMZA 3IS5A 4M15A 4PNKA 3U6HA 5TT7A 3R02A 1W98A 2ACXA 2WMRA 1MRYA 4HNIA 4XG8A 5AJQA 4FV6A 2WFYA 4NH1A 4Y8DA 5L2IA 4DEDA 1RW8A 2W1DA 3BHUA 4WRGA 5CYIA 3ZFXA 2J5EA 2XRUA 3QAME 4X0MA 2G15A 5L8LA 1YHWA 2Y7JA 5DR9A 2PVKA 3UJGA 4QMMA 3UP2A 2WTKC 4WRSA 5EDRA 2H96A 3EL7A 4JBPA 4IAIA 3SKCA 4JJRA 4BCIA 4KRDA 3EZRA 2C68A 4KB8A 4BDAA 1CDKA 4ID7A 4C61A 1UKHA 2OJJA 1BI8A 4NM7A 2X2KA 3IW4A 4ASDA 5AV1A 2Q0NA 3EQCA 4ZJJA 4AZWA 1GZ8A 1WVXA 4RIXB 5HTIA 2HWPA 2BUJA 4TT7A 3KRWA 2UVZA 3PXQA 2RG5A 4GJ3A 2WTDA 4BKYA 4KBKA 3EN9A 4I24A 4PPCA 3UIXA 3EQRA 3IOKA 3LXKA 4IBMA 3KK8A 4QP7A 4FTAA 2ZV7A 1TQIA 3OBJA 4FKRA 3DLZA 4K6ZA 4CTBA 5E7RA 4IX6A 4TYGA 4V04A 4ZTSA 4E73A 1P2AA 2PE0A 3ZZWA 3ACKA 1P4OA 2CGVA 4LV5A 1IEPA 1JWHA 2VWBA 3DK7A 4RWKA 2NP8A 1YKRA 4K77A 1H08A 3BHTA 5I5ZA 5HVJA 5T6KA 4RJ8A 2R7IA 4Q5HA 2VTNA 3G9LX 4YJPA 1WVYA 1IA8A 3DS6A 5H9BA 5F9EA 2NO3A 3GCVA 3QWJA 5KBQA 3UOHA 3QTUA 4AE9A 3HMIA 2B9IA 3QKMA 5FBOA 4EBVA 5AUUA 5HO7A 5JMSA 3M11A 3PE2A 4C4GA 3PJ2A 3NYVA 2R7BA 3GCSA 1E1XA 2Z8CA 1W83A 4G9CA 3ZLSA 4DH5A 3HDNA 3OY3A 1AQ1A 2WU7A 2ZV8A 4JRNA 3P0MA 4BDEA 2VTRA 3BBTB 3NS9A 3MFRA 1PMEA 3ALNA 4YLJA 5JFVA 4M14A 5JGDA 4TY1A 3L8PA 3N51A 4GRBA 3NUNA 4F9BA 4F6SA 2IVVA 2OF4A 3E5AA 2XM9A 3AC5A 4ENXA 4MQ2A 2QU6A 2V62A 4MBIA 3MWUA 4RJ3A 4BCHA 5HU3A 3NAYA 2BDWA 5DH3A 3D14A 4M84A 4PDOA 3HA6A 3KF7A 3V6SA 4FYNA 2VX0A 5DHJA 3E3PA 4HJOA 4IJ9A 2W9FB 2ZJWA 1SVHA 4F9CA 4ZLZA 1H1RA 1OVEA 2GDOA 4HPTE 2PY3A 4OGRA 2KULA 4CKRA 1E9HA 4KKGA 4EHGA 1ZOHA 4ZSAA 3A99A 3LM5A 1YRPA 3RK5A 4BIEA 2EU9A 2J9MA 3QQUA 1BLXA 2FA2A 4OBPA 1U59A 2G2IA 2XBJA 2JGZA 3MA6A 2PVMA 3QU0A 2Z7SA 4RC3A 5HCXA 3U51A 5JFSA 5KX8A 4AGDA 3PXFA 4FVPA 4RC2A 3CEKA 2YABA 4KABA 3SRVA 2JKOA 4YLLA 3DNEA 4PF4A 4FKLA 4I6BA 4ZEGA 5LMKA 4BI1A 3RI1A 4GT3A 3ZBXA 2PVHA 2XCKA 4EOOA 4ZSGA 5AUVA 4BKJA 4I6HA 5C9CA 4RBLA 3GB2A 3OXIA 1FVRA 4LV8A 3ZTXA 1OECA 5IMXA 5J5SA 5CXZA 1QPDA 4EONA 5E8UA 4AW5A 5FDXA 2VTMA 3OC1A 4EEVA 3S3IA 3V04A 4EK4A 4RJ7A 4Q9ZA 5JZNA 4KNBA 4C3FA 5EI8A 3EFWA 4C35A 3FPQA 4BI0A 4QD6A 4UEUA 5AUZA 5JZJA 4CFFA 3EWHA 4XG7A 3W18A 5LVNA 1UA2A 2J0JA 1KOAA 5DVRA 2JKKA 2C1BA 4OTDA 5FXQA 2BZHB 3QYZA 5AV0A 4Y5HA 5A4CA 2JAMA 3ANRA 3Q9ZA 4CTCA 3HRBA 3R7GA 5EHOA 5AUYA 4FTJA 4ZZOA 4E26A 5HE3A 2QVSE 4R7HA 5FEDA 3C1XA 2GNGA 3PE1A 3D2KA 4CEGA 4C2VA 5L2WA 2IZSA 2IW8A 4EQMA 1FGIA 3NYNA 3PVWA 1CMKE 3WF9A 2F2CB 3T9TA 3OBGA 1KOBA 3HMPA 2YM6A 3F3WA 4L3LA 4L45A 5A4LA 4GFGA 3ZO1A 1QL6A 3VUKA 2F7XE 3R21A 3DQXA 2GNIA 3DFCB 5KE0A 4E5AX 4YO4A 1BKXA 2VNWA 4LGHA 4IAFA 5CVFA 4B0GA 4FKTA 3O96A 2R3QA 4XS2A 2R3MA 3HMNA 4HYSA 3EN7A 4MYGA 2UZWE 2QODA 2YITA 4RQKA 4NCTA 1V0BA 3OWPA 4F1OA 2R5TA 4KWPA 4UBAA 2HOGA 2WTIA 4DFZE 3V51A 4FA2A 2Y6OA 4X21A 3GFWA 3EOCA 3SXFA 1JKKA 1R3CA 2G9XA 2JC6A 5FG8A 3EHAA 4F1TA 3QWKA 3OS3A 4NFMA 4WNKA 1Q62A 3P5KA 4BCKA 3E8EA 5GZ8A 3QTXA 1TQPA 3POZA 4HVSA 3WF7A 2EXCX 3FMJA 4AFJA 4C8BA 3Q6UA 4IX5A 3UTOA 5LVOA 1ZLTA 3LPBA 4RX9A 3UGCA 2XIKA 3PXKA 1H4LA 4GCJA 3FAAA 3QBNA 4PPBA 3QALE 3GT8A 1CKIA 4EKLA 2DWBA 2BHHA 4RIOA 5JGBA 2R3IA 2F2UA 2UUEA 3VF9A 3C4WA 5KMLA 4DGNA 4XP3A 2WQNA 4PTEA 1Q24A 3ALOA 3UMXA 4CLJA 4XNEA 2XK8A 3Q5IA 4HGSA 2PL0A 2YZAA 4MWIA 5EHLA 3K3IA 3NNWA 3NUXA 3PG1A 4WNMA 4ERWA 2BPMA 4F63A 3MFUA 4AN9A 4EJNA 5A4QA 4RRVA 3DXNA 2ITZA 3PY1A 2P0CA 3RAHA 4BTFA 5CWZA 1UWHA 3G0EA 4F99A 2ITVA 3FMHA 4A06A 4D55A 5IH6A 5AAEA 5HKMA 2PMNX 3Q60A 4J95A 3E92A 4YJOA 5FTOA 3PJ8A 3HYHA 1M17A 2X0GA 3FZRA 4FT9A 4WOVA 3MFTA 4GV1A 3LCKA 3THBA 5CY3A 3ERKA 4KIOA 3UG1A 4C0TA 2VWVA 1Q8UA 4EH9A 1Q4LA 2O3PA 4M3QA 3FQHA 3JY9A 1PXKA 3BEGA 3HV3A 3M42A 5D12A 3RKBA 4MXCA 2I0EA 4C58A 4KINA 1JNKA 1XH4A 3FC2A 4PMMA 2FSOX 2J50A 4NK9A 4DLIA 4KIPA 3L9LA 3P08A 4HW7A 3RGFA 3DPKA 2Y6MA 4U40A 3OUNB 4E3CA 2R9SA 4E4XA 3T3VA 1WBVA 2C6EA 5CEPA 2J0MB 4MH7A 3F3TA 4EYJA 3BYMA 4FG7A 2FB8A 4LI5A 3SOCA 3MH0A 4G6OA 2GNLA 5HNGA 3GCUA 4XBRA 3VS7A 3OWKA 5K4IA 5FRIA 5JRSA 5LMBA 2IVUA 4XG9A 4BTMA 2WMQA 2X7GA 5J87A 2QOOA 3R30A 3BRBA 2VTAA 5HE0A 2XNNA 4MXOA 4QP8A 3ZEWA 3NUSA 4M69A 3DT1A 4J98A 3NNUA 3WF5A 3ORTA 1OKYA 5M56A 2C3JA 4JDKA 4XLVA 1YW2A 2E9NA 4J1RA 4RX8A 5GZ9A 3TZ9A 4ANNA 4CV8A 5BVDA 3UYTA 5IA2A 4A7CA 1EH4A 3OROA 5DGZA 2X81A 3UC3A 3ZC6A 2XNMA 3RWPA 3FMEA 3FZSA 4AX8A 3GUBA 2WOUA 1TKIA 4FKJA 4KAOA 4NJ3A 4S31A 4RFMA 3MY0A 4V0GA 4G3EA 4X2NA 2WMVA 3S4QA 3ZONA 4AOIA 2WB8A 3EFLA 4I5PA 4BDFA 4D2VA 4EK5A 4USEA 4F09A 1QPEA 5IA3A 2Y4IC 3RPVA 4E4NA 4LMUA 4FT3A 1YHSA 4RVKA 3KMMA 2PVFA 5AV3A 2ZB1A 1YOLA 3S1HA 3P1AA 2YFXA 4GUBA 3SA0A 1ZYJA 4DH3A 5I9YA 4JX7A 4C4IA 4O21A 5HBJA 2BRNA 5TKDA 2R3PA 2PZYA 2YCRA 2ZMCA 4R5SA 2XZSA 3R8ZA 4AN3A 3HGKA 3TN8A 5B2LA 4P7EA 4E4MA 2XJ2A 3GOKA 4M0ZA 5E8YA 1WZYA 3GOPA 1U5RA 1BMKA 4D2WA 5FXSA 1YWVA 4EOKA 4ZP5A 3D83A 5EW9A 5K0KA 3OUKA 4UYAA 4CCUA 4I23A 3VS2A 1IASA 3PVBA 4MCVA 1K3AA 1P5EA 3P78A 4E1ZA 5KCVA 1G3NA 4E6QA 3B8RA 3IKAA 3F5PA 3AMBA 3VUMA 5HQ0A 3R7YA 4CXAA 4CQEA 4F70A 5DRDA 4YLKA 3D15A 2YDKA 2BTRA 4GFOA 2PVJA 4ZTHA 2XH5A 4IWQA 5JSMA 4KRCA 4CCBA 2IN6A 4X3FC 2WU6A 3F61A 5IZFA 3CGFA 4TYIA 4L43A 2GSFA 2QHNA 3HP2A 4YZNA 4O2PA 5HVYA 2P4IA 5EDPA 2V5QA 5HLPA 5HG9A 3BYOA 3OCGA 5CVGA 5KBRA 2X9FA 1CKJA 4NSTA 2V0DA 3Q4CA 4TWPA 3KULA 3I4BA 3LVPA 3DKFA 3KXMA 2PMIA 3QGWA 1VYZA 4ZZMA 3VBQA 4EH2A 5AP2A 3ZCLA 5IMEA 2W9ZB 4FGBA 4Z3VA 2WMAA 3QFVA 4J53A 5TE0A 3ZOSA 2WZJA 3DKOA 3CXWA 3PPJA 1OPLA 4O6LA 5CI6A 5L8JA 3OW4A 4H58A 4LFIA 5JFWA 5LOHA 3LXNA 2YM3A 3F3UA 5GJGA 4G5JA 4E5BA 1H0VA 2RFDA 2ITUA 4M0YA 5B0XA 3PSDA 2BHEA 4AXAA 3F66A 5L2QA 3QTIA 2JIIA 4UX9A 4NM5A 3V5WA 5BPYA 2R3LA 2PMLX 2BIKB 5A54A 3TJCA 3KMWA 3RWQA 5CEKA 1U4DA 1KE9A 4CKIA 4BDKA 4YTFA 5AIRA 2XK7A 4JQ7A 5A6NA 2X39A 2QI8A 3C4FA 3NW6A 4FZFB 2DQ7X 4C7TA 2QC6A 1U54A 4AGCA 4HVHA 5E1EA 3LM0A 5HX8A 1QPJA 4CMTA 3SXRA 1GZNA 4F9YA 3W1FA 4I20A 5LJJA 4YPSA 4AW0A 3NSZA 4QMYA 3ZZEA 2ZAZA 5IH5A 3O17A 4IB1A 5DE2A 5B2MA 4M67A 3ZFMA 2C3LA 3NWWA 4ONAA 1O6KA 5C03A 3IDCA 1GY3A 1L3RE 4JRVA 3DJ7A 2Q0BA 5JRQA 2HW7A 4KKEA 4JNWA 2Z7RA 1W82A 4V01A 4O0VA 4P90A 5CANA 3WILA 5EG3A 4A9TA 4AOTA 3TNQB 2PVRA 3KF4A 3EQBA 4TYEA 1V1KA 3GCPA 4JG6A 4FTIA 1XH8A 3II5A 3AGMA 3BV3A 5H2UA 4FL3A 2OI4X 2QO7A 4O0RA 4TRLA 4BC6A 2CCIA 4QQ5A 4AA5A 2RSVA 5CU6A 1FOTA 2WMWA 3LFAA 4AFEA 3W2PA 3LCOA 3E7OA 3EN6A 5AMNA 5HCYA 4C02A 3ORLA 3V5LA 3LFFA 1OKVA 4BCOA 2WMSA 3GBZA 4DEBA 3LFEA 5ETFA 4B8LA 3KQ7A 4BGHA 2ETMA 4MAOA 4IVBA 4U80A 5D41A 3NYXA 4L44A 4UWYA 4OTFA 5J9ZA 2OIBA 4LM5A 3ROYA 3DB8A 4ASZA 4WUAA 4X2FA 4ZS0A 3LHJA 5CU2A 3A2CA 2X8EA 3FZPA 2WKMA 2WMTA 4JI9A 2WTVA 4W4YA 5HE1A 3QXPA 4CFNA 5J79A 2R3KA 2GTNA 3TZ7A 3PPKA 4TPTA 3IG7A 3KMUA 4IEBA 3R9NA 2GU8A 4DEGA 3QRJA 1WBNA 4TW9A 2XNBA 4FG9A 3UC4A 4D28A 4NM3A 4YC8A 5FDPA 4S32A 1UNLA 2CJMA 3UO5A 4G6NA 5JN2A 4RVTA 5AEPA 1H26A 1ZZ2A 4FV2A 5HESA 3CCNA 4XH6A 4FTCA 3WZJA 2BALA 2J51A 2R2PA 4AA4A 4DAWA 5CSPA 5JQ8A 5J9LA 1KE5A 4XRJA 3K5UA 4OTPA 5HG8A 1TVOA 5C01A 2QCSA 4B99A 2JAVA 2EXMA 3MTLA 4TKSA 2BZKB 3I60A 4Y83A 2ITWA 2VO0A 3ZRLA 4FTLA 1CM8A 4APCA 3QD2B 5AR7A 3OXZA 4AT4A 3TI1A 3PSCA 3F2AA 4YJUA 5AX9A 3FLNC 3R7IA 3SXSA 4I6FA 1YDSE 2UW9A 4YR8A 3DQWA 3EQIA 4NW5A 4IE9A 1JBPE 1H1WA 4M7IA 1I09A 3I81A 4CRSA 5IISA 5FTQA 4R8QA 1VJYA 4FEQA 4FODA 4QMUA 1HCKA 2W5AA 5AR5A 5DMZA 5I0BA 5C27A 2CLXA 5KKRB 3POOA 3G0FA 3K5VA 1WVWA 3FDNA 3O2MA 1M2PA 4W8EA 3RTPA 4FKSA 2BFXA 4DEAA 2QO2A 3KRJA 3VC4A 3F82A 3JVSA 3D4QA 3LXLA 5EKNA 1JAMA 2Y8OA 4F6UA 4XLIA 3BGPA 2IO6A 3FMKA 2BZJA 1CSNA 4YJTA 4F9WA 4ZJVA 2BZIB 4WD5A 5D1JA 4RG0A 4E6DA 3QCSA 4JX3A 2PE2A 4ACMA 4GK4A 4BFMA 4HVGA 3ORIA 3OTVA 3FKLA 3WZKA 2XK9A 4BI2A 3REPA 4W4VA 1ERKA 2AYPA 5HNIX 4JQEA 4G3GA 3BI6A 3D7TA 2PZIA 4B9DA 3VS4A 2SRCA 4EWQA 2OZAB 4CZYB 1GJOA 1ZYLA 1F3MC 3R73A 4BDBA 3C4CA 4XG4A 5EFQA 3RALA 5LVPA 5CT7A 5CZHA 5CEQA 3PSBA 2HZIA 3FZOA 4BB4A 4FIHA 2KTYA 1YOMA 2V7AA 3GXLA 4WNPA 3CQWA 3GVUA 3CY2A 3FQEA 3DCVA 4TN6A 4JR3A 5BVOA 3NW5A
chains in the Genus database with same CATH superfamily
1ZAOA 4FIFA 5EW8A 4S33A 5D11A 3GQIA 4JDJA 3ZUTA 4H1MA 4XG2A 2Y0AA 4UB7A 2XUUA 3NLBA 1OPKA 2VO6A 4HCVA 5AR3A 3U6IA 4CRLA 3R71A 4MD9E 4C4FA 5K9IA 3QX2A 2AC3A 4EC9A 4D0XA 2WD1A 4L01A 5CXHA 1Y91A 2I40A 4AN2A 4AZFA 5C8NA 4E4LA 3FE3A 5BNJA 1ZYCA 2XP2A 4D1ZA 3UZPA 3NGAA 4ITIA 1T46A 5FP6A 1STCE 4HZSA 4AQCA 2QOLA 5IA1A 3ZHPC 3GC9A 4EK3A 4F7SA 4FV0A 5IDPA 4USDA 4FNZA 5CSXA 1P14A 3VUGA 4JBQA 1ZMVA 4G3FA 4TZRA 5EK7A 4AW1A 2YIWA 4WT6A 4O91A 1URWA 3QQFA 3ZEPA 4IHPA 3CY3A 3OVVA 3QCXA 4GIIA 4BDCA 1REKA 2VRXA 4HCUA 2R3FA 1Q8YA 4OT5A 2OH4A 2O0UA 2VWIA 4FKOA 2WXVA 3FLWA 5FEEA 1QPCA 3DKGA 4GVJA 1OL6A 1H01A 4IB0A 2ZM3A 4X2GA 4X7QA 3DK6A 2XKEA 4YO6A 4BDHA 3ZO3A 4RJ6A 1ZY4A 3O7LD 5HLNA 4NKSA 1Y57A 2IEWA 1A06A 3FZTA 2CGUA 4FIJA 3ZXTA 4FKUA 5TOZA 1XH5A 4XUFA 2CSNA 4MK0A 4FICA 3GU6A 3CE3A 3S00A 3FBVA 4EWHA 2JDOA 1YWRA 2QOFA 3R1SA 3U4UA 2ZDUA 4FV7A 3KN5A 4M13A 4JIKA 5ANGA 2PUUA 5IH4A 5AADA 3TUDA 3A7JA 4MNEA 5IA0A 3E64A 4M66A 3VWAA 5BUEA 1MRUA 2QOKA 3BIZA 1GAGA 4MXAA 2NPQA 3QUPA 5H8BA 4AU8A 2VTPA 4FI1A 3BLRA 4LOOA 5BX0A 5CT0A 5KNJA 4OT6A 3VIDA 3A7FA 4MD7E 4O4DA 1UU3A 1P4FA 2VWYA 3KC3A 3R1NA 4K33A 3G2FA 3QTQA 5EI6A 3EH9A 5HE2A 3QUDA 3HV5A 5CU3A 5FD2A 4BZOA 4UZDA 4EZ5A 3RK9A 3NAXA 5BMSA 3QRKA 2Y4IB 3PY0A 3R6XA 4IFGA 3ET7A 2O2UA 5TR6A 1UV5A 3KEXA 5F95A 5H3QA 2WNTA 5BVEA 3AC4A 4OR5A 2B7AA 4ZY4A 4C62A 1OPJA 2J7TA 4OAUC 3BYSA 4U3YA 3U4WA 3VBWA 3UNZA 3HV4A 2A1AB 3R0TA 2OIDA 1XR1A 2GS7A 2VZ6A 3BEAA 4F6WA 2R3RA 3FMNA 2WO6A 5A6OA 4FG8A 5DOSA 4FZAB 1RJBA 4L9IA 4QP9A 5DI1A 3RZFA 3IK3A 4Y95A 5H8EA 5CENA 1ZY5A 3ZDIA 4ZTQA 3FLSA 3VS5A 4JLCA 5M44A 2PWLA 3H3CA 3Q5ZA 5CSHA 5AR8A 5FM2A 4OTGA 3V5QA 4QTCA 1IR3A 3JYAA 4FTOA 3P86A 3RAKA 4G2FA 1JOWB 3MA3A 4EBWA 2X2LA 3QD0A 3W8LA 4FVRA 4X3FB 2ESMA 4D5HA 5EW3A 3OWLA 4CMOA 2FO0A 2YM7A 5HEZA 5HICA 3TT0A 5BUJA 3GU7A 2OBJA 4YZMA 5ACKA 4FNWA 4MD8E 2VTSA 2PZRA 4I41A 5FLFA 3PFQA 4A9YA 2AQXA 5CASA 4KSPA 4HZRA 5L2TA 2JIVA 3F2NA 3KN6A 4BDGA 3A62A 4O2ZA 3RHKA 5A4EA 4GS6A 3TUCA 2R0IA 3JS2A 4YUQA 2VTTA 2AC5A 4BICA 2C6MA 3D9VA 5HX6A 1AGWA 3KRXA 4XV2A 5AUTA 3OY1A 4FTRA 4J96A 3WARA 3OP5A 3LW0A 3QRIA 3QLFA 1MQBA 4OLIA 4QYFA 5JK3A 4CT1A 3SW4A 3OOMA 3UVQA 3VS3A 2IVSA 1NVSA 4CKJA 3HL7A 3PA4A 3QZGA 3KRRA 1YVJA 2ITQA 4FT0A 2LGCA 3G6HA 2OJGA 2GHGA 4FTUA 3C0IA 3QHRA 3HV6A 2YM5A 2C6LA 4GSBA 2ONLC 5BYYA 1Z9XA 3W2RA 2WOTA 4MBLA 3UMWA 4IB5A 4P4CA 4IANA 4U7ZA 4BDJA 2RFNA 3FJQE 1Y8YA 4DYMA 3VULA 3DGKA 3KCFA 4YNEA 4E20A 4F1MA 1YOJA 4PRJA 4QP2A 3L9NA 4BBEA 3ORKA 1R78A 1XBCA 5ANEA 3C51A 3NIZA 1X8BA 3UIBA 3O51A 3KA0A 4G6LA 4RIXA 5M51A 4RLLA 1OB3A 3EQPA 1W8CA 1KE7A 4RFZA 3S2PA 3AD4A 3PXYA 1PXPA 3R1YA 4N6YA 4XG3A 3TL8A 3C5UA 3ENHA 4O1OA 4QP6A 4Y73A 5M4FA 5EYDA 2F9GA 3A8WA 5EHYA 1YXVA 3Q96A 3R8UA 3PA5A 3RPSA 3CQEA 4XJ0A 5K0XA 4ZK5A 4RQVA 5HGIA 3HEGA 4UWCA 2VWWA 3VUIA 1WMKA 4N0SA 5AIKA 1W0XC 4QQJA 3A7GA 3RBWA 1SM2A 2PMOX 5IF1A 3RNYA 4GG7A 3PG3A 3RHXA 3R01A 3ZSGA 2BRMA 3QCYA 1H00A 4D2PA 1PXMA 3RAIA 3R7UA 3PUPA 4I0TA 4AT5A 3AGLA 3BWFA 4R1VA 4LGGA 4IZ7A 1FPUA 3MIYA 5IU2A 4UMPA 4FSMA 2PK9A 3KXXA 4GMYA 3HECA 3VHKA 2VAGA 3ZUUA 2QR7A 4W9WA 5AM7A 5KKRC 5HTBA 3A61A 3L8XA 3GI3A 2DUVA 3TV6A 4EQCA 3DAKA 4EL9A 4A9UA 4FSYA 4D2TA 4FYOA 3TNHA 4UWBA 5CAPA 4HYHA 3KKVA 5E8SA 1SZMA 2VTLA 2F7EE 2R0UA 4FIIA 4QMWA 5CEOA 4UZHA 3R8PA 4BWXA 2QG5A 4X2KA 3ORNA 3NX8A 1Q99A 3MBLA 4QMOA 4RIYB 3SDJA 3E8DA 4PMPA 5EYMA 4ZTNA 3SQQA 2GHMA 4DFNA 4E6AA 3Q53A 5J95A 3V5PA 3G33A 2I0VA 4RIWB 2YACA 1WBWA 4FC0A 4ZJIA 3N9XA 2EXEA 4P5ZA 4CMUA 1GZKA 2IZRA 5D10A 2WPAA 1J3HA 3KXNA 4KS7A 5LVLA 3R8VA 1ZMWA 1OUKA 3A4OX 2UZNA 2WTCA 3I5ZA 4FSTA 2X2MA 1Z5MA 5CI7A 1REJA 4LQMA 2RL5A 3W2SA 5GZAA 3U8WA 1OIQA 5L6OA 4IM2A 4FTTA 1FMOE 2JD5A 5FWKK 4G34A 3W33A 1XBBA 3ZMMA 5G6VA 3KXZA 2PHKA 3BHYA 3OEFX 4PL5A 2UW4A 4CFUA 2XF0A 3WE8A 3CD8A 1BI7A 3B2WA 1XHAA 4ZIMA 4U9AA 4NIFB 3V3VA 3D5WA 4JBOA 2HAKA 1ZWSA 5CAOA 3QZIA 4PNIA 4QTAA 3UPZA 2X7OA 2X0OA 4BZNA 5LWNA 3JY0A 1JSVA 2BAQA 5AX3A 3TJDA 2VWUA 4IAKA 3LFQA 3ZLXA 5C8KA 1PF8A 5E91A 2IZUA 2C0TA 2XEYA 1JKLA 4QYGA 2B55A 4WUNA 5KUPA 4JXFA 2UVXA 4MVFA 2YCFA 4WSQA 4D58A 2VUWA 4M68A 4X3JA 3JUHA 4AZSA 4ZTMA 1M2QA 4G3DA 3COMA 2W1ZA 4L68A 3F3VA 4NT4A 4XEYA 3R83A 4E5WA 2C0OA 4JAIA 3VNTA 3DOGA 4ZY5A 4ACGA 4IX4A 4FOCA 3VBTA 4QNYA 5J7HA 4EHEA 3QXOA 4YJQA 3E87A 3WIGA 4WA9A 1YXTA 3C9WA 1PKGA 1VYWA 2OICA 3GU4A 5CTPA 1FGKA 3I79A 2UW3A 2B52A 3KB7A 4EK8A 3DBQA 2ZMDA 3QKLA 5AUXA 3A4PA 4GVAA 5HO8A 2ZOQA 4TYHB 3TNWA 3IQ7A 2YDIA 3HUCA 3LE6A 1ZYDA 3E88A 4C3RA 4YBKA 1OIYA 4CNHA 5IEVA 5DN3A 1UNHA 4K1BA 3MY1A 3MW1A 3D7ZA 3M1SA 3LOKA 4EUUA 2C69A 3UQGA 4BCMA 4LGDA 3GC0A 3UBDA 2W1CA 3NUPA 1NXKA 4DFXE 5KMNA 1JSUA 2XM8A 2XNEA 3MPTA 3GEQA 4EUTA 3UYSA 2W05A 2VX3A 2ITXA 3MTFA 5HIEA 1HCLA 4GFMA 3R63A 3O8PA 4L00A 5LMKC 4JG8A 4QP4A 2H8HA 4BHNA 3K2LA 4YU2A 1Q8ZA 5CEMA 3F6XA 1PMVA 4YZDA 3TG1A 3UG2A 5E90A 4AW2A 4IWOA 5DT3A 4ZXTA 3QX4A 2C3IB 1S9IA 3QD4A 5ANIA 2DS1A 3AMAA 3NRMA 4HGLA 3QTWA 2XYUA 4I94A 2GHLA 4AA0A 4RT7A 4K11A 4Z7HA 1XWSA 5LQFA 2WQBA 1MUOA 2R3GA 5DEWA 5LARA 3RCJA 2XCHA 4C4HA 2YAAA 3O0GA 2XKDA 4DG2E 5J7BA 3QZHA 2P2IA 4FK6A 2G01A 2OU7A 4D4SA 1RE8A 3WBLA 4FSZA 3RPYA 5BMMA 3EB0A 1OGUA 4RVMA 3PY3A 1SNUA 1JKSA 2RF9A 3AD5A 3H30A 5LWMA 3FY0A 3PIXA 2VNYA 4J97A 4PV0A 5ANDA 2PVLA 5AP5A 5GHVA 4MEDA 4PDSA 3BGQA 1J1BA 1MP8A 1Q8TA 3NZ0A 1UVRA 2I1MA 5AM6A 4IVCA 4UV0A 4ZTRA 3FPMA 3PWYA 2H9VA 2VTJA 4BIDA 3ZM4A 1XH7A 3DU8A 3IPHA 4I6QA 5B2KA 3R2YA 4IFCA 4YURA 3AT4A 4DN5A 3COHA 2PSQA 1H1SA 2W1GA 3V8SA 4A4XA 4NCTC 5EKOA 3G90X 3ZS5A 4CFWA 2EVAA 3DK3A 3GU5A 5E8VA 3VRZA 5CNNA 3HRFA 5AP1A 4UMQA 2OFUA 3TWJA 3FUPA 1CTPE 1DI8A 1TQMA 4J8MA 2VGPA 3ZSHA 1PXIA 4IWDA 3TNIA 1FMKA 3VO3A 4NW6A 2R3JA 4C57A 3C7QA 4OTRA 1W2DA 4WHZA 3MGYA 3FLZA 2XVDA 2BIYA 3PZEA 5IDNA 1JQHA 3PVGA 4K18A 2B9JA 2JDVA 5KMIA 2OXDA 2XNOA 3W32A 3W2CA 3FI3A 3FQSA 4I5CA 3H9RA 2EUFB 4FK3A 4UN0C 4JAJA 4NM0A 2JITA 3BZ3A 4O27B 4BDDA 1YXUA 4XP2A 3HA8A 3KFAA 3QD3A 3LJ2A 2GCDA 4IMYA 4J7BA 3HDMA 4EOIA 3C4XA 4JG7A 3W16A 4YTHA 4CSVA 4RZWA 3EYHA 2J2IB 1B38A 1DI9A 2JEDA 3CPBA 3L9PA 2C6KA 4MF1A 4F0FA 3OHTA 3AD6A 5HNBA 3HUBA 4BHZA 3FZ1A 4AE6A 2C5OA 3FLQA 2PVYA 4Y72A 2W0JA 5IKWA 2ITOA 5JH6A 3DAJA 3FI2A 3RNIA 4ALUA 1WBTA 2WELA 4YZCA 4EH5A 5HIBA 4UMRA 3KXHA 1PXLA 3T9IA 3I5NA 1JSTA 4QNAA 2A98A 4FV8A 2Z60A 4NKAA 3LMGA 3ZO4A 1BX6A 2X9EA 1KSWA 4IVDA 4Z9LA 5HTCA 1TZDA 1JVPP 4BF2A 4FKGA 4KBCA 4EH6A 1Y6BA 4OTQA 4M12A 3UVPA 5BVNA 2VD5A 4A07A 4K2RA 4CD0A 3BKBA 5DR6A 2WQOA 4TWCA 3R8LA 1B6CB 2UVYA 5DT4A 4F64A 3VUDA 4EOLA 4LRKA 2O5KA 4ZSEA 2GNJA 2W4KA 1YI6A 3D7TB 2HW6A 3Q32A 4QPSA 4TL0A 5HVKA 3CTHA 2B54A 3BU6A 2ITPA 4R7IA 4XOZA 2JFLA 2NRUA 4FUYA 4OBQA 3R9HA 4E6CA 1LEZA 3TZMA 2YIXA 4HGTA 4ASXA 1RQQA 3E3BX 3SW7A 5CLPA 2QONA 4AG8A 3UPXA 4IZ5A 4PUZA 3IGOA 4CYJA 3MS9A 4ITJA 3QGYA 4U42A 3F69A 3PZHA 4DG3E 3GP0A 3JPVA 3R1QA 5EM7A 3VBVA 3P7CA 3CS9A 3PJCA 4DLJA 4CV9A 5L3AA 3Q4TA 1YHVA 3TZ8A 5IUHA 4CYIA 2RFSA 3F3ZA 4AS0A 4OAVB 2PE1A 4M8TA 3HNGA 5AP6A 3VJNA 2HK5A 4QMNA 2CN8A 5LCKA 4UMTA 5FP5A 2C3KA 3VN9A 3R7OA 3EYGA 3D5XA 4CLIA 4BBMA 3O23A 5JFXA 5IEXA 4YMJA 1H8FA 3DBCA 4C59A 4ZLOA 4WBBB 2W4OA 3EQHA 3FWQA 3BX5A 4MBJA 3D94A 2JKMA 3VW6A 3R28A 3EFJA 3BELA 3UO4A 3UNJA 2HXLA 3I1AA 2O8YA 3BYUA 1SVEA 3IW5A 3KXGA 3DJ6A 4R3RA 4TNBA 4WBOA 3L8SA 5T3QA 4RX7A 4GT5A 5KMMA 2HYYA 3OCBA 5B7VA 2CPKE 4GL9A 3VAPA 3QF9A 4H36A 4IAYA 1MRVA 3A7HA 4YTCA 5AP3A 4QMQA 2VWZA 3L8VA 1W2CA 1JPAA 4GJ2A 3R00A 3HP5A 4ZSJA 4O1PA 1ZOEA 2YAKA 5TF9A 2JBOA 3I0QA 4YGAA 3HV7A 4KIKB 3RPOA 4ANSA 4FUXA 4LOQA 5AA9A 4D4RA 1G5SA 4BTJA 4XBUA 2VGOA 3E93A 3DFAA 3ENMA 4IVAA 3UQCA 2OJIA 3OOGA 4MTAA 1URCA 3R7VA 3V8TA 1HOWA 4BCNA 4L46A 3OT8A 4XX9A 4A9RA 1T45A 5HD4A 3G6GA 5DEYA 1LEWA 3ZRKA 2XA4A 5M4IA 5IA5A 5KO1A 5FM3A 3QCQA 4DGMA 4HPUE 5JEBA 4R1YA 1UU7A 4EYMA 3W10A 2F49A 2IZTA 4IWPA 5EH0A 4RWLA 4PP9A 3NW7A 2OG8A 3VS1A 4PMTA 3KY2A 2RKUA 2CHLA 1V0PA 1KE6A 2UZTA 4GT4A 4J52A 2XK4A 2ITNA 3ZH8A 2FSLX 4IZAA 3R9DA 1W7HA 3COKA 5CS6A 2BDJA 4GUEA 4MWHA 4PWNA 4BVUA 5ETAA 3TXOA 3C0HA 4O4CA 3FYKX 1PXOA 4R3CA 4ANBA 5GJFA 3LAUA 4ZAUA 2QO9A 4GYGA 5KMKA 3ORPA 1PMNA 2QLQA 4MXYA 2ZV2A 3QKKA 4ANMA 3IECA 4AAAA 4I93A 1E1VA 1PW2A 1LP4A 2OK1A 4LL5A 2ONLA 3ROCA 3LQ5A 4JDIA 4BWPA 4II5A 4Y85A 3UZTA 3BGZA 2VV9A 2ITYA 3B8QA 3DAEA 2C5YA 1OIRA 2GNHA 3E63A 1U46A 4BCQA 3HVCA 3H0ZA 3FMLA 4OW8A 1XH9A 3EKKA 4F0GA 1UU9A 4QYYA 2OJ9A 4MF0A 4AF3A 1GIIA 4KS8A 1S9JA 3ORZA 4AP7A 3PA3A 3IDBA 2UW8A 3LQ8A 3DKCA 2BR1A 2DYLA 5M55A 3NIEA 3WF8A 4YJSA 3QHWA 4TWOA 3FMMA 3Q4UA 4J8NA 2IWIA 1H27A 2C6DA 2YN8A 3DBDA 4MX9A 4H3QA 4FF8A 5IUIA 5CF8A 5CU0A 3RINA 2JFMA 5F20A 1F5QA 4GH2A 4C3PA 5F1ZA 4USFA 5E8XA 5EM5A 5CAVA 1XJDA 2X1NA 1OKWA 4C36A 4IW0A 5J8IA 1H1PA 3LFBA 4KD1A 4ALVA 4BCPA 4Y5QA 4FTKA 5ETIA 4ZOGA 3ZFYA 1ZARA 4DFLA 4RWJA 3Q9YA 3KGAA 3C4EA 4L67A 5EYKA 4DG0E 3O8UA 3QL8A 4U3ZA 5CF4A 1R0EA 2P2HA 4IADA 4IAAA 4JBVA 4R5YA 4KKHA 2VTQA 3TKHA 3L9MA 1J91A 2IF8A 4N4SA 3PYYA 2JKQA 3PP0A 2EWAA 4U44A 4AT3A 2YIYA 2JBPA 5I9WA 4EOMA 3C13A 3MJ2A 3I6WA 3AC3A 3M2WA 3TTIA 3WZEA 1H0WA 1PYEA 4QP3A 5F4NA 5ACBC 1GZOA 4ANQA 5EDQA 4L42A 2IVTA 4OTIA 4XRLA 4E93A 4EH3A 4NZWB 3FV8A 4BRXA 4JT3A 4RJ4A 5M4CA 2B9FA 4UXLA 1BUHA 3RMFA 5I9VA 3MI9A 2YLFA 5A14A 3BE2A 3SRVB 5IUGA 4CZUA 2P3GX 1K2PA 2E9OA 3GFEA 1J1CA 4MXZA 1SYKA 3FXXA 5KZIA 1WAKA 4RJ5A 4QMVA 3QQJA 2FSTX 2XIZA 3F5UA 3D0EA 3VUTA 2OKRA 4YJRA 2XK6A 3V8WA 1JKTA 4N70A 5EI2A 5HBEA 3I0OA 3P7BA 2YJRA 3BQCA 3EMGA 4J99A 4QQCA 3FLYA 5AAGA 2RG6A 4O96A 5I9UA 1M7NA 4ENYA 2CCHA 4XHKB 3ANQA 3H4JA 2OZAA 4B4LA 4BCGA 4C2WA 3AQVA 4H1JA 2J90A 2QLUA 4F4PA 1ZXEA 4IDVA 3EKNA 2HZ0A 4I4FA 3EL8A 2XIYA 5A3XA 2BVAA 2QOQA 4QPAA 3DZOA 3W2OA 3W8QA 3ZSIA 1JLUE 5L4QA 3PPZA 4F65A 4U0IA 1M2RA 3UP7A 4X2JA 4PL4A 4XV3A 1VR2A 2OSCA 3A8XA 1H28A 1RDQE 2C6OA 4R3PA 2VO3A 2VO7A 4YSMA 4E7WA 2UZEA 2ZV9A 3ETAA 4FSRA 4H39A 3DDQA 3Q2MA 2J6MA 4EZ7A 4HVDA 4G16A 2J5FA 3HZTA 3U87A 3R2BA 3ULZA 4BTKA 4ZSLA 3VS6A 1VEBA 2JLDA 4W4XA 4F7NA 4U81A 5I3RA 3PJ3A 2P33A 3BE9A 4DGGA 5HO6A 2ZB0A 2YJSA 4YC6A 4RA4A 3MVJA 5D7AA 2C47A 2XYNA 2RFEA 1KV2A 2BDFA 4IZYA 3ORXA 3I7CA 3GGFA 3LJ1A 4F08A 4FSUA 5DR2A 3SHEA 3IW6A 4LRJA 4A4OA 4DEHA 3JVRA 3OWJA 3LIJA 3ELJA 2BILB 3KL8A 2E9VA 4BZDA 3W2QA 2YHVA 2PZPA 4RZVA 2C0IA 4CT2A 1CKPA 2XKCA 5HCZA 4XMOA 4I0SA 1OI9A 4G31A 1FVTA 4QMXA 5E1SA 4ACDA 4L3PA 5KHXA 5AR4A 1F0QA 4O4FA 3OG7A 3PWDA 1Z57A 4G9RA 1OL7A 3F88A 3MYGA 3Q4ZA 3G9NA 3NCGA 2C4GA 2ETRA 3KK9A 3LCTA 2OXXA 5BVKA 5J5TA 3FYJX 3WYXA 4U5JA 4EC8A 2C5NA 1R0PA 2OGVA 2OO8X 3NYOA 5BYZA 3WE4A 5C8MA 4YC3A 5M4UA 3VQHA 2UZVA 3LZBA 2WGJA 2GNFA 5EOBA 3LJ0A 3Q9WA 5CSVA 2VTOA 2IW9A 2WHBA 3DY7A 5ITAA 4D1XA 2WTWA 5CEIA 2BRBA 3A60A 4A4LA 3UNKA 1OUYA 1GNGA 1H25A 4FSWA 2HZNA 4XCUA 2UZDA 3DLSA 4J71A 2VU3A 3MH3A 3FSKA 3QTZA 5T68A 3UVRA 4XYFA 2PTKA 3OW3A 1Q8WA 1XQZA 4V05A 1YDRE 4NWMA 2ERKA 1IRKA 4P5QA 5CAUA 2QOHA 2YIQA 4Z16A 3QUEA 5DFPA 2EB2A 3QC9A 3QC4A 2J0IA 3BU3A 3CGOA 5LMAA 4FTMA 4K9YA 4WG4A 5L6PA 1O9UA 4FNXA 2WTJA 2QOIA 3IDPA 4FSNA 1Y6AA 4S30A 4QRCA 2R3OA 3NDMA 3CD3A 4QMLA 1WBPA 4UY9A 4APPA 2GS2A 3FL4A 1LR4A 4WKQA 1W2FA 2CGXA 3UO6A 2F4JA 3MDYA 5C1QB 2QOBA 3BLHA 5DLSA 5HG5A 4FSQA 4HCTA 3UQFA 1SVGA 3MVLA 3HX4A 2QNJA 4FZDB 4YNOA 2V55A 4IB3A 2G1TA 1FQ1B 4FBXA 4QTBA 4D9UA 5AV4A 3NR9A 1UU8A 2QKWB 3FC1X 4G17A 3CJGA 4AOJA 3RJCA 1M14A 4FL2A 2HZ4A 3EZVA 1YXXA 4QMTA 2W1IA 4F9AA 5JKGA 1DS5A 1QMZA 2A27A 4JVGA 5HIDA 3QRTA 4GK3A 5AA8A 3BLQA 5JGAA 1ATPE 1NA7A 4DCEA 4NEUA 5HZNA 4PDPA 3SV0A 3KCKA 3LXPA 4FX3A 5D7VA 3V6RA 4FV4A 1SNXA 3C4ZA 3ZDUA 4B8MA 3SC1A 5BQ0A 1OKZA 2P55A 2W1HA 2BRGA 5DA3A 3IOPA 3GC7A 3DV3A 3GENA 1BL7A 3OZ6A 3BYVA 2HXQA 4IXPA 4ANLA 4X3FA 4O0YA 4D1SA 4W8DA 4I3ZA 5DIAA 4FZ6A 5DT0A 4C38A 4QTEA 5L8KA 4C4JA 5F94A 5E92A 1IG1A 1KE8A 1OZ1A 3GU8A 2OW3A 3C50A 1ZZLA 2FVDA 2A19B 3CP9A 3PRIA 4NTSA 3OT3A 3ZRMA 4F7JA 4M69B 1DAYA 2O65A 4AGWA 5HLWA 4D9TA 5IA4A 4BGGA 2F7ZE 2O64A 4BYIA 1U5QA 4ANOA 4C33A 3LCDA 5KHWA 2YM4A 3EJ1A 4DHFA 5ANOA 2ZDTA 4XG6A 3NPCA 3B2TA 4ZTLA 3MVHA 2OXYA 3ZUVA 1WBOA 2G2FA 3MN3A 4B7TA 1OMWA 3IW7A 4RPVA 1ZMUA 3R8MA 4BCFA 4V0GB 3IONA 3QQHA 1V0OA 4LYNA 1B39A 1DM2A 5J1VA 3T3UA 1Q61A 3MB7A 4X6QC 2ZVAA 3DTCA 4YSJA 3C0GA 3UIMA 2YEXA 1Q3DA 2QR8A 3AXWA 3F7WA 4FR4A 4NTTA 3TNPC 2XS0A 4Z55A 4CFXA 4I1ZA 2W1EA 3WZDA 2IW6A 4I0RA 2GPHA 4L52A 4U41A 3IO7A 2C6IA 4KA3A 3Q6WA 4U97A 2XBAA 1OM1A 5BUIA 4H3BA 2VN9A 4N6ZA 3UOKA 4YJVA 1XO2B 3BHVA 2ITTA 2ZM4A 4JS8A 3MPAA 5J1WA 3CBLA 5CVHA 2BFYA 4TXCA 5JQ5A 3FHRA 2XKFA 4FOBA 2C5VA 4D4YA 2I0HA 4JL9A 1OIUA 2JDSA 1FVVA 2UZBA 3QRUA 5KMJA 4EOJA 2AUHA 3FY2A 3KVXA 1M7QA 2OH0E 1Q97A 1QCFA 4P2KA 2XNGA 3DA6A 4FNYA 2CDZA 4I5HA 4W9XA 3E7VA 5CF6A 1YWNA 4LUEA 2I6LA 3ZLYA 3U9CA 4PX6A 4FV5A 2FYSA 4YJNA 5LVMA 2IJMA 4FKQA 1PMUA 2PZ5A 4FL1A 3MSSA 2W7XA 4HOKA 3Q04A 3QA0A 4ITHA 3TEIA 2BRHA 5HHWA 4EZ3A 3HRCA 1O6YA 1PXJA 2QKRA 4IM0A 4PTGA 3EFKA 4Z7GA 1O6LA 3KULB 3VBYA 4ZY6A 4L8MA 1BYGA 3PXZA 4TYJA 5EM6A 4BL1A 2UW5A 2XNPA 5C26A 5LXMA 3HMOA 3OEZA 5EM8A 4I21A 2RGPA 4YZ9A 1FINA 2XIXA 3E62A 3MV5A 4O38A 2C1AA 4PY1A 2WQMA 5ETCA 3UDBA 4DGLC 4FVQA 4EOSA 3P23A 2X8DA 4UMUA 4FIGA 4F0IA 1WBSA 4NUSA 4C34A 3P4KA 2UV2A 2I0YA 4GEOA 4JOAA 4MKCA 4S2ZA 4BGQA 4HVIA 2FH9A 2YM8A 3EN5A 4L53A 3QTRA 3Q3BA 3RVGA 4IC8A 3OMVA 4R6VA 3NEWA 4DC2A 3LLTA 4JIAA 2REIA 2JIUA 3F5XA 2C5XA 3DZQA 5FEQA 3EQDA 1OL2A 2WMBA 3QQKA 3GCQA 3ZBFA 3FXZA 1M52A 2OZOA 2W17A 3TKUA 4G1WA 2GFSA 1YI4A 4BN1A 5BVFA 2X7FA 4S34A 2WMUA 2W06A 2W96B 2Z7LA 1H07A 2UW0A 1U54B 1PKDA 4HYUA 4C37A 1YDTE 5M57A 4PL3A 1SMHA 4RIYA 3RM7A 3RPRA 5DWRA 4FKVA 5DRBA 4LMNA 5HORA 1NVRA 3G5DA 2QHMA 4EH7A 3FMDA 3FKNA 2QOCA 2Y9QA 3PIZA 2J0KA 3FL5A 3UODA 3CJFA 5CQUA 4RIWA 3R7EA 2QU5A 4RSSA 1R1WA 2CGWA 1KV1A 3DNDA 4LL0A 3V5TA 4AGUA 4Q2AA 4O0UA 5KMOA 3WF6A 3OXTA 4DTKA 4BKZA 4EH8A 5A4TA 4O22A 2WEVA 2PVNA 3QLGA 4Q9SA 4QOXA 5K3YA 3HLLA 4G5PA 5HI2A 3RCDA 2VTIA 2XK3A 5FGKA 4NIFA 2WEIA 5J9YA 4D4VA 2XJ1A 5HU9A 4QPMA 3NUUA 1Q41A 1H1QA 3D2IA 3F9NA 3AT2A 3CQUA 3I7BA 3IW8A 3NNXA 5DBXA 3CLYA 5EOLA 4FT7A 4U8ZA 3CC6A 4DITA 2V7OA 2HENA 2WTKB 4DINA 4OTWA 2R4BA 4FT5A 4IQ6A 3F7ZA 4GU6A 4U45A 2ZM1A 3G51A 3ULIA 3ORMA 4AUAA 2W1FA 4EOPA 3KVWA 3VHEA 2WIPA 3D5VA 3OCTA 3AMYA 3P9JA 4QP1A 2CLQA 3H9OA 4ARKA 3FHIA 4CVAA 2OWBA 4FKPA 4JR7A 4GK2A 5FQDC 3QA8A 2X6DA 5DG5A 4RC4A 3CKWA 4JQ8A 4Y46A 3T8OA 2X4ZA 1I44A 1ZRZA 5HD7A 3BQRA 4FKIA 3NNVA 4I22A 2QQ7A 1MQ4A 4G3CA 2UZUE 4LOPA 3SX9A 3KRLA 3WIKA 4U43A 5ANKA 5G1XA 4DH1A 2G2HA 5LCJA 5K4JA 3W55A 4D2RA 4UALA 4PQNA 1PJKA 4XP0A 2Y4PA 3BBWA 3AG9A 4IH8A 4TYHA 3L1SA 3SD0A 5H8GA 3DTWA 2UZLA 4FZ7A 4CFVA 4BCJA 3OFMA 4YBJA 4PMSA 4FV3A 2OF2A 1GOLA 2XRWA 3LCSA 4BDIA 5JT2A 4MNFA 3OF0A 4UYNA 4FMQA 1OL1A 3U9NA 4A9SA 4WO5A 1YQJA 2WMXA 3AOXA 3PJ1A 3DDPA 4QTDA 4YHFA 4H3PA 5CZIA 4B6LA 4HNFA 2C6TA 2BTSA 4MHAA 4WG3A 4XOYA 1Q5KA 2A4LA 2BMCA 4EHVA 4MQ1A 2CN5A 3R22A 3WOWA