3ZDUA

Crystal structure of the human cdkl3 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
309
structure length
297
Chain Sequence
MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTDIYDDEVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELKAKLLQEAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE-LIKE 3
publication title Crystal Structure of the Human Cdkl3 Kinase Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 297
sequence length 309
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zduA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zduA01
4ZSGA 3WBLA 2IVVA 2ZB1A 4PV0A 3Q9XA 3OD6X 2UV2A 2V62A 2QURA 2WIHA 2ZB0A 3UNZA 3R01A 4FT5A 5ANDA 5KKRB 3R0TA 3G9NA 3F7WA 5CU3A 3ULZA 3H0YA 2QOQA 3OT8A 3GQLA 1E9HA 4YZDA 3VUGA 4DITA 2A2AA 4I3ZA 3ANQA 3ZFYA 1WVXA 2R3KA 2PZRA 3F9NA 4E4LA 3FKLA 2OJIA 4ERKA 5EKNA 4Y83A 2VTQA 3W8QA 3PP1A 2OK1A 4D0WA 4YZBA 4F9WA 3FMNA 5CZIA 5F9EA 4V05A 4CG8A 3O2MA 5HBEA 3TV7A 2UW4A 3UNJA 3E8DA 4LGGA 2GS2A 5HCZA 3HRFA 2WTCA 3VS2A 3HL7A 4EOKA 5IZFA 1NW1A 5HIEA 4NZWB 1ZYLA 3GP0A 4XP2A 3QTRA 4LUDA 4MF0A 3UYTA 3Q5IA 1ZOEA 1JKLA 4FZ6A 3RTPA 3ZONA 5AR2A 5JFSA 2GFCA 2P2HA 4FSQA 4F0IA 4Z7HA 4U0IA 3LPBA 3W2PA 4PMTA 2WAJA 3FXWA 4FEQA 4Q5EA 4L7FA 4QMLA 5CI7A 4MD7E 3TI1A 3FZSA 4M14A 4IJPA 3FMDA 5IH4A 4P5QA 3I1AA 1YHSA 5BYLA 3K5UA 1ZY4A 1HCLA 4IZAA 1Q8YA 4FKJA 3OG7A 3BI6A 1VEBA 2C6DA 2FGIA 1JKSA 3ROYA 2G15A 4XHKB 4CFMA 3KRRA 5LXMA 1J7LA 5HVKA 3F61A 3HGKA 1OPKA 3AG9A 4QMPA 4DLIA 4ZSLA 3CSVA 2I40A 4GVJA 3HP5A 3TM0A 4I41A 2VTTA 5FXRA 1CKIA 4WHZA 5JGDA 1M2RA 4EJ7A 4ZS0A 2C0TA 4ARKA 4J99A 4BIDA 4C34A 3D83A 3RAHA 4EH4A 1OL6A 2XUUA 4FEUA 4I5HA 3OEFX 3IOPA 3UYSA 4FTQA 1I09A 3ALNA 3VUMA 5L2QA 5A4QA 1JBPE 4YO4A 4XG6A 4C0TA 3IQ7A 4DFLA 4FOBA 3MWUA 4OLIA 5IEYA 2ITYA 1Q61A 2W1GA 3FQSA 3ZUUA 1GIJA 2G2HA 3COHA 2XBJA 1M17A 3PJ8A 3CC6A 2CKQA 3G0FA 5BMMA 3SXRA 3BHTA 4QYFA 2F7ZE 4W4WA 2PVRA 4IMYA 2OKRA 1W98A 4J96A 1TQIA 4NIFA 1Y8YA 2GNHA 4PPCA 4RLLA 2WMXA 4XRJA 3DPKA 5HNBA 4M66A 3AT4A 3GT8A 3E63A 1GJOA 4OUCA 4BBMA 1WBTA 4NFNA 1L8TA 2R7BA 4IH8A 3MVLA 5FBOA 4I24A 4YJNA 3FY0A 1FOTA 5DN3A 3DBFA 4W4VA 2ITUA 3HV3A 3KVXA 4IAAA 4MCVA 5DR2A 3LVPA 3WYYA 4TYGA 2PVFA 4ENXA 3UOJA 2WOTA 4KSPA 2NNWB 4O0WA 1FINA 1WAKA 5FTOA 5C8KA 3S95A 4AGUA 1WVYA 2PSQA 2PZYA 2VTSA 3FI4A 2R3QA 3FYJX 3QHWA 5M4IA 4O0YA 4EOLA 1LUFA 1Q8WA 2I6LA 4D28A 3BYUA 3FLSA 2CMWA 5HICA 4DBNA 2WGJA 3IECA 4X7QA 5J7BA 4RC2A 1TKIA 4MF1A 1Z5MA 2Z7RA 3Q4CA 4QMXA 5IA4A 4OBPA 1XBBA 2GQGA 1V0BA 2BUJA 4F7NA 5HD7A 2Z02A 2XCHA 5AV2A 3K3IA 5GINE 3JY0A 4ALWA 1ZRZA 4FZAB 5BVEA 4O84A 1W7HA 4BIBA 5HBJA 1H25A 3HKOA 4FV9A 3FWQA 3BIZA 4H39A 3AGMA 3CQWA 5AMNA 4I22A 5IUHA 3A7IA 4IWOA 2FUMA 2UZEA 2R3HA 2ZM4A 2NRYA 2W1IA 3NUSA 2XNPA 3MY0A 1FMOE 4FKUA 4FTLA 2YIWA 4WOVA 4XV3A 4RX9A 4U9AA 4RWLA 3FMKA 1YWRA 3ODYX 5L2SA 4DGLC 2GHLA 1JOWB 2IVSA 5EK7A 4EEVA 3LOKA 5CVGA 4O7TA 3PE1A 2Q0BA 3I6UA 4IFGA 4IM3A 2CLXA 4KIQA 4YPSA 3U4UA 4CRLA 3SA0A 2X8IA 4O82A 2GS6A 2OIQA 3LXPA 3E5AA 4BL1A 5E4HA 2WZJA 1MRUA 3QUDA 3ZUTA 2WQMA 3GNIB 2BAJA 3L9PA 4ITJA 5ETFA 5A9UA 2XCKA 3FI8A 2YN8A 3KMUA 3QQJA 5AJQA 4GS6A 3I5ZA 4U5JA 4GEOA 5DG5A 4M0ZA 1XO2B 5FLFA 4I92A 2CCIA 3BHHA 4G3FA 4EUUA 2PVYA 4CTCA 3PY0A 2BAKA 5IH6A 3ALOA 3RWPA 5HLPA 3TKIA 4IM2A 3ORIA 2BHEA 3TJDA 3ZLXA 1ATPE 1OBGA 4NU1A 4BC6A 5IKWA 4D2VA 1QL6A 5E92A 2QOLA 3NUYA 4WIHA 4FYOA 4G9RA 4XG9A 2PTKA 4O83A 2JEDA 4TY1A 5HGIA 2I7QA 2AUHA 4I4FA 4NM7A 3VQHA 5L8KA 2XM9A 2DQ7X 2G2FA 4UXLA 4EQCA 1BYGA 5DIAA 2B9IA 2YAAA 4FTKA 5DFPA 4ENYA 4FSYA 5GZ8A 2HZNA 3TKUA 3BQCA 3ZLYA 2H9VA 5CX9A 4BYIA 3KL8A 2QR8A 3D15A 4LOPA 2XK4A 3BEAA 4FC0A 3FL5A 4BWPA 1H0WA 3EIDA 4XG4A 1GZOA 3PRIA 3KN6A 4HYSA 3UVPA 5EYMA 2B52A 3FXZA 3DU8A 4E6AA 4G31A 3S4QA 4UALA 4X0MA 4XH6A 4CFNA 5J5SA 3PA4A 2W5AA 3FI3A 5EQPA 5IA5A 3DTWA 4HGSA 5CQUA 3KKVA 4WT6A 2UZLA 3A7HA 3ACKA 3OFMA 5CQWA 3NWWA 4XEYA 5HX8A 2CSNA 3EZVA 4Y46A 4JNWA 4ALUA 4C62A 4R7HA 4RQVA 2YJRA 4O81A 3RPSA 1XH9A 4RC3A 3G0EA 4ZZNA 3HECA 5KMMA 4I6HA 4OTQA 2UW7A 4QP9A 4GRBA 4WG5A 4FNXA 1SZMA 2VWZA 2X6DA 3QUEA 3ZO2A 5CAPA 5JEBA 4RJ7A 1YI3A 4AZVA 2WMTA 2C5YA 1PMNA 4JBQA 4FNWA 2OSCA 3G51A 4RJ3A 4E1ZA 2W1HA 3GOKA 3OXIA 3D0EA 4FTTA 3WZUA 4C4GA 4AXAA 4LMNA 3VS6A 4B0GA 4OGRA 5FP6A 4YUQA 4KD1A 3RHKA 3VS7A 4FV0A 4XBUA 4LM5A 5B2LA 4IIRA 3C0HA 5J5TA 1JKKA 3PVUA 4KWPA 5E8WA 3F5XA 5AAFA 1BKXA 3ZH8A 5HTCA 2H34A 3SX9A 5I3OA 4CG9A 4G16A 5JSMA 3LXKA 4OTPA 2OWBA 3LCKA 4B4LA 3DT1A 3FZ1A 3LFFA 3MBLA 1H08A 3HV6A 1NVSA 4MXYA 4QYEA 4DGGA 1U59A 5A4EA 4PDYA 3R04A 4IACA 2G2IA 4C2WA 4FIGA 4NEUA 1P2AA 2CNVA 4MXXA 3PLAE 5H2UA 2O0UA 5K5XA 5AUZA 4AWIA 2YEXA 2JFMA 3R9NA 5BYYA 4V0GA 3DBDA 2F2UA 2QU6A 2VZ6A 3GOPA 3Q6UA 2V7AA 2HZ0A 3PXKA 3F2NA 3AMAA 1RE8A 1YWNA 4Z3VA 4CXAA 2J0MB 5AAEA 3R9DA 2X8EA 2XNNA 4GV1A 4V0GB 3LFEA 3M11A 4F64A 2UZVA 3FMHA 4EYJA 4HVDA 3ODZX 3OMVA 5CF6A 3WF5A 1XKKA 3EQHA 3LJ1A 5LVOA 4F65A 3DOGA 2Z60A 4RT7A 3NVMB 3TUBA 3NRMA 3FLQA 2V55A 5AP7A 1O6YA 3HUCA 4LL5A 1UU7A 5FP5A 3Q9ZA 2OBJA 4MXCA 3W2SA 4O7ZA 4BKYA 4AZSA 2Y4IB 4ZSAA 4QT1A 2PUIA 3DFCB 1J91A 4KSQA 5AM6A 5ETAA 3ZTXA 4O7YA 5BVOA 2A0CX 4FSRA 1LEZA 3V5LA 4FYNA 5HOAA 4DEIA 5DMZA 5EH0A 4ANQA 1FGKA 4XLVA 1YXUA 4O0TA 3VS1A 2VWWA 3RJCA 3RK5A 4GU9A 3NMUF 1RJBA 4BDGA 3EN4A 1YOLA 3TZMA 4PP9A 4MXAA 4BVUA 5DRDA 2F7EE 3HMIA 1KV1A 3DB8A 2QR7A 3F88A 3FV8A 3PWYA 4OW8A 5BVNA 1IA9A 4E4NA 4TYJA 4FIIA 1OVEA 2W4JA 4ANLA 3HAMA 2E2BA 3FUPA 4J8NA 2C30A 4F0FA 5IQGA 4ZY5A 1IA8A 4C3RA 3TNWA 3FLNC 2B55A 2R64A 3PSBA 4L00A 4ACMA 5A4CA 5IA2A 3V5TA 3BGPA 4UXQA 5IH5A 3EZRA 2XK7A 3OWLA 3OCSA 3HYHA 1MQ4A 4KAOA 5C4KA 3GQIA 4TWOA 4P2KA 5CAOA 4L68A 2IPXA 1UU3A 1OIRA 3QFVA 3T3VA 3UPXA 4DG2E 4TRLA 3LCDA 3EFWA 5M53A 4IADA 2C47A 3GFEA 3E7OA 3OROA 3ZEWA 3G6HA 1U54A 1M2QA 5E91A 2YM6A 4A4LA 2RL5A 2W17A 3IDBA 3UMXA 3GU5A 1H4LA 3P7CA 3RAKA 1W0XC 4RIYB 4YNOA 4EZ3A 5AP5A 4X3JA 2FH9A 4FSWA 2PUNA 1XHAA 3KXXA 2ONLC 2RGPA 4B8LA 4M97A 1TQMA 1U54B 3Q2MA 2YISA 4FVPA 3LJ2A 1BUHA 3SXFA 3UQCA 4G2FA 4PDPA 1YW2A 2G9XA 2V5QA 4TYIA 1YXSA 1MP8A 2JDSA 2VO6A 4X2KA 3QD4A 5CEKA 3AC1A 4BCGA 2F49A 4RX8A 4K8AA 4D4SA 4LL0A 3T3UA 3LXNA 4FSNA 5CALA 1KE9A 4JIAA 3RNIA 2E9VA 2C1BA 4S33A 2XMYA 4FKVA 3PPZA 4IBMA 4J8MA 3ZLSA 2QD9A 4JQ7A 2Q0NA 4O0RA 5BYZA 2OW3A 4TYHB 3E62A 4LV8A 2CNQA 3ORNA 2XKDA 4FK3A 4MKCA 2XIZA 3MJ2A 3BU3A 3EYHA 2R7IA 4E4MA 4L01A 2H6DA 1IAHA 5GIPE 5E8ZA 4L45A 2HELA 3OZ6A 3IK3A 2EXCX 2R2PA 3LFQA 3PJCA 4E20A 3OXTA 3SLSA 5DR6A 4ZJIA 3KVWA 5EKOA 1B38A 5M08A 3PVBA 4D0XA 2C6MA 4RWKA 3WARA 3EN5A 4IAKA 3EFKA 3C5IA 4C61A 3GU4A 4AT3A 4TW9A 3DAKA 2J7TA 3FKNA 5CT7A 3MYGA 4BCHA 3IGGA 4XOYA 4BTKA 4M12A 4JL9A 4IVAA 2WTVA 4QP1A 3NCZA 4FOCA 3R8PA 3V5PA 2CKOA 3RCDA 3TXOA 2GDOA 4CYIA 4MBIA 5EYCA 1FPUA 2X2LA 5IU2A 4GH2A 4U41A 5K3YA 4CZTA 3LM5A 2HZ4A 4QQJA 4O7NA 5C1QB 4IM0A 5LOHA 2WPAA 4BWKA 4F1OA 3G9LX 1Z9XA 5CYIA 3DB6A 5DVRA 4S2ZA 5EHOA 4YURA 5AP1A 3KFAA 4X2GA 5EM5A 3QTSA 4YJQA 1PF8A 2YFXA 4AACA 3EN6A 5CF8A 2W1CA 3P4KA 4UX9A 1SMHA 3Q4UA 4M67A 4TNBA 2ITTA 3NGAA 2QOCA 2OF4A 4JBVA 4UV0A 1R39A 4L43A 3Q52A 4ZP5A 4CFUA 5CSPA 3UG2A 4FKWA 2AC3A 3RAWA 4CFXA 4CMUA 4PWNA 3WILA 5D41A 2IW9A 4AN9A 4AZTA 4F6WA 3AC4A 1FGIA 4I0TA 3SAYA 1SVHA 4IE9A 3VO3A 3EL7A 2XA4A 2FSTX 3VN9A 3VS5A 2X7FA 4M8TA 4A4XA 1JSTA 4KIKB 3UO6A 3VW6A 3S0OA 3TUCA 1J7IA 3WZKA 2PHKA 4QMVA 2PULA 1KSWA 4BB4A 5IQDA 2W06A 3MGYA 4DE4A 1KE8A 1TVOA 1YI6A 2B9FA 3CP9A 3FQHA 1UKHA 1ZARA 4KKEA 4FIJA 4XP3A 5CENA 4BHZA 3S1HA 2JIIA 1QPDA 1G3NA 2QKWB 3LCTA 3E8NA 4LYNA 3F5GA 5DWRA 3S3IA 3F3UA 1JLUE 3MI9A 5BVWA 3WZDA 5JKGA 5FXSA 3D5XA 2C6OA 1Y6BA 4XBRA 3V3VA 2IVTA 3EQDA 3P08A 3TZ8A 4UWCA 2J90A 4Y73A 4CFVA 4K6ZA 4HVGA 3O50A 4IVCA 3R1NA 4QMZA 4IC7A 4L7SA 2JLDA 5J9YA 3BV3A 3UMWA 5FEQA 3TV6A 3C13A 5DH3A 2YWPA 1F5QA 4O96A 3ZSIA 3LJ0A 4L6QA 1IG1A 3PY1A 3V5JA 4O7RA 4EH8A 2HW6A 3FJQE 4FODA 3Q3BA 3R8ZA 2C69A 4BZOA 3V6RA 2JDOA 2UVXA 3LAUA 2VO7A 2XP2A 5EG3A 5A14A 2EB3A 5FEDA 3DY7A 3TDWA 3D7TB 4E93A 2NP8A 2I0VA 2B53A 3ZU7A 3HMPA 4L42A 2RF9A 4E26A 1ZYJA 4Z9LA 3OTVA 2ITQA 2JBPA 4A4OA 3DKFA 3HRCA 3D14A 3GENA 4RQKA 3V8WA 4EOSA 3NUAA 4FTJA 4ZK5A 1NXKA 3R71A 3CKWA 3RINA 2C5XA 3QQUA 2VWIA 2FVDA 4W8DA 1GZ8A 5CXHA 3R7YA 5L6PA 2I0EA 3KMWA 1H0VA 1H1QA 4O2ZA 4YJSA 3T9TA 4GIHA 2GNFA 3KXNA 3TCPA 5IPJA 5IQHA 3MPTA 4QYGA 3QTZA 3ZRMA 2VTIA 2B1PA 3WIKA 5HNIX 4J53A 4FX3A 3T8OA 3NW5A 5LMAA 4PMPA 2WMRA 3CBLA 3UZTA 4MNEA 4ZLOA 3FMJA 3UP2A 3FLZA 3O96A 3DAEA 3PXRA 3F3TA 2IG7A 3C0IA 3FQEA 4KIPA 2YM5A 2QOFA 3DLSA 3C1XA 4DT8A 4XRLA 3EJ1A 4RIXA 3ETAA 4MNEB 3SV0A 2OO8X 3MIYA 4IX6A 5CWZA 1PY5A 1XH6A 3MA3A 2CN5A 3Q53A 4EL9A 5EI8A 1H8FA 4JQ8A 4K33A 1VYZA 4LOQA 4IWDA 3KREA 3GU7A 2GHMA 5CEIA 3UQFA 3OUKA 2YIYA 2BMCA 3QKKA 4NM5A 1OKVA 4DBXA 1LEWA 3UIUA 5AV1A 3AC2A 4AQCA 4GUBA 2XNMA 3ZLWA 3WF6A 4KIOA 3ROCA 4RIWA 3QQKA 2VRXA 4FIFA 4FZDB 4F09A 2WB8A 4Z7GA 3P86A 3R2BA 5L6WL 1GZNA 4UMQA 4DH5A 2XVDA 4YZNA 3UTOA 2CKPA 4O0XA 3P0MA 1ERKA 5HEZA 2QODA 3N4VA 3ZO1A 5KCVA 3TUDA 1OB3A 2UZOA 3QWJA 4HGTA 2QLQA 5T6KA 1OIUA 2VTPA 3FZRA 4MHAA 3EQPA 3SOCA 4Y5HA 4NJ3A 2WO6A 3CJFA 3AC3A 4QPAA 2IZRA 5C27A 3C4CA 1ND4A 4RZWA 1KOBA 2HOGA 4L3LA 4OR5A 5CY3A 1KWPA 3QRUA 4GMYA 2DUVA 1GAGA 2IO6A 2YA9A 2YDKA 4A07A 3PG3A 4FA2A 2WQOA 2B54A 4H3QA 3ZM9A 3QD2B 4IX4A 4LOOA 3OF0A 4MD8E 3TNHA 2VAGA 4WSQA 2A27A 3A4PA 5LWNA 1B6CB 1L3RE 4RVLA 4X3FB 4ZAUA 3LQ3A 4ZEGA 2FYSA 3PPJA 5E8VA 2OFUA 3V8TA 5T68A 3CY3A 2NO3A 1O6LA 4MQ1A 4I21A 4MYGA 3UIXA 4LFIA 4TWCA 4U7ZA 2IZSA 3AOXA 4X2FA 4M7IA 5IA0A 4HCUA 3WZJA 2ZJWA 4HGLA 3NSZA 4FV5A 3ZBXA 5I3RA 4N57A 3CCNA 1WFCA 2FO0A 2PK9A 3N51A 5FQDC 5JN2A 1ZWSA 2RG5A 3ANRA 2X7OA 3QHRA 4BGGA 2Y9QA 3ZDIA 3PA3A 2UZBA 1YHWA 2HY0A 2X9FA 2ZM3A 4ACGA 4BCJA 3WIGA 3VNTA 4HYHA 4F7LA 2FSMX 2VWBA 2GSFA 2FSOX 3PJ1A 1PMEA 3O8UA 4QO9A 5FTGA 4I1ZA 4FTIA 4GFMA 3BEGA 4JDHA 2JC6A 3CLYA 5J9ZA 2C68A 5DYJA 4EOIA 3AT2A 3MESA 5BPYA 4IC8A 3SD0A 2XKCA 2ETKA 3NZ0A 4DEEA 2BVAA 2CGVA 4YJUA 4DC2A 1BX6A 3NUXA 3OWPA 2QO2A 3DJ7A 2WFYA 2VNYA 4GIIA 1MQBA 3NNVA 4NK9A 5FDPA 3A7FA 4C3FA 5GZ9A 3BHUA 2OXDA 4RIOA 3C0GA 3BRBA 3PXZA 3WF9A 4FE2A 2VN9A 3OTUA 4MXOA 3GI3A 4LMUA 5DEWA 2A4LA 4FL3A 3F3ZA 1OM1A 2BROA 1BI7A 3TNPC 4B6LA 5LWMA 4X6QC 4FKLA 3VS3A 4E6QA 5HORA 4G1WA 4CSVA 4GW8A 4JDKA 5JFWA 4QQTA 3UOHA 4E8AA 1B39A 4PTGA 4N6ZA 3A99A 2WQEA 3UIBA 4PL3A 2UZWE 4IB1A 3FI2A 3TL8A 3KRLA 4LGHA 4O1OA 3GC7A 4TKSA 4CFFA 4FSTA 4G17A 4IB3A 4AW0A 2CLQA 1FMKA 1CM8A 2WNTA 4CCBA 4AW1A 3ZC6A 2XNEA 3CD8A 5EM7A 3QLGA 3D94A 3ZO4A 2XZSA 4YR8A 4R77A 3W2QA 3KF7A 3A2CA 3ZXTA 2UZUE 4PTEA 3SC1A 5LVNA 1YI4A 3VRZA 1F0QA 5E1EA 5CEPA 4J95A 4D5KA 3TNQB 2HYYA 2BR1A 4WNOA 5GNKA 4RVTA 3KXGA 3FEGA 3BX5A 3QQGA 3QA8A 3PWDA 3GCPA 3SG8A 5GHVA 3QX2A 5ANGA 1YOMA 5LARA 2B9JA 2JDVA 2PVHA 4BI2A 3DNDA 4HJOA 4U44A 4PP7A 5IDPA 4U3ZA 4EOOA 5KNJA 2DWBA 4QQ5A 1O9UA 2XK8A 5G6VA 3NPCA 3QBNA 1G8SA 2R3RA 2VX1A 4FVQA 3BQRA 4RBLA 3C4EA 3SG9A 3QD0A 4NT4A 3ZZWA 4UWYA 3TT0A 1U46A 2CGWA 3EHAA 5TF9A 2O63A 1XQZA 3MPAA 4EJNA 4NIFB 3FZTA 5E8SA 4F9YA 4ZMEA 3LQ8A 3IW4A 2XKFA 3CY2A 2WMQA 1Q99A 3M2WA 4FKIA 5CTPA 5E8UA 2PMOX 2PZIA 5H9BA 3BYOA 5ANEA 2QOHA 1S9IA 3OEZA 4HNFA 3MPMA 5HO7A 2EWAA 2XNOA 5JT2A 1WVWA 4YJPA 5I9VA 2QHMA 4RVMA 3SXSA 3POZA 4FNZA 4GUEA 1DI9A 3HMNA 2YLFA 3PZHA 4FG8A 4Z55A 3NEWA 4U40A 4EH5A 5HHWA 2VTRA 1PXIA 4F0GA 4F9CA 4FEWA 4NUSA 3FPMA 4PX6A 3EFLA 4EYMA 3QRIA 3PIXA 4NKSA 4DA5A 3AXWA 5FTQA 3IOKA 1P14A 2OH0E 2WTKB 4RFYA 1R0PA 4S31A 2YDJA 3TIYA 5HX6A 1ZZ2A 3SHEA 3GGFA 4ZTNA 3PIYA 5JGAA 3AD5A 4RA5A 4YZ9A 2VU3A 5AX9A 3IDPA 2NPQA 4GK3A 5DGZA 5HU3A 3G90X 4WBOA 4GKHA 2XIYA 2R9SA 2O5KA 3PJ2A 2BFYA 5K0KA 4EH9A 3U9NA 4AOJA 3ATTA 5KZIA 4EH6A 2YIQA 5HLWA 3QRKA 2VTOA 2RFNA 2PUUA 2P0CA 4II5A 4R8QA 4UMRA 2YCQA 3KA0A 2J9MA 5D11A 2CKEA 2REIA 5DA3A 4DEBA 2BAQA 3CEKA 4DLJA 3R7GA 1UNGA 4CTBA 3OWKA 3VC4A 3HRBA 2VGOA 4QMUA 5BMSA 4I6BA 4IAZA 4CMTA 3BLHA 2IZTA 3CS9A 2VO0A 2CN8A 4PF4A 1PJKA 4KINA 4QMMA 1U5QA 2XK9A 4PPAA 3LFDA 3R83A 4F6SA 2GMXA 1WBOA 3GBZA 1OMWA 2EU9A 4UB7A 4L44A 4YZCA 5IMEA 3GFWA 3I7CA 4HYIA 3TWJA 2IVUA 3Q04A 4L46A 1CKJA 2UVYA 2QO7A 5EI6A 1H00A 4PDSA 2YDIA 2LGCA 3OVVA 3UVQA 3E8CA 4YJVA 4EOMA 5KKRC 5HZNA 4BDEA 5EOBA 3K54A 4FEVA 4ZIMA 1Q8ZA 4YU2A 3CPCA 3ORLA 4M15A 4DT9A 1FQ1B 3A8WA 2IWIA 2BFXA 5AV4A 4FBXA 5C8MA 3O51A 2R3GA 4HVIA 3QCXA 3UVRA 4A06A 4ERWA 3CPBA 3KC3A 1SVGA 1OL1A 2OI4X 5LMKC 3RGFA 2DYLA 1TQPA 2CCHA 3M1SA 3FY2A 2QVSE 1H27A 3MH0A 5IQAA 3ZDUA 3DKOA 3R73A 2Y8OA 2QNJA 4PL5A 2OXYA 5BQ0A 3IW8A 3HP2A 4RPVA 4YO6A 4EHZA 4IX3A 2GNJA 4FF8A 4NCTC 5EW8A 3OCBA 4QTAA 2UW5A 3VAPA 5A3XA 4BDDA 1ZYCA 4E6DA 1H26A 4M3QA 5BVKA 5IA1A 2XYUA 5FM2A 3TTJA 2YM7A 5CU0A 2XRUA 2OZAA 1FVVA 4K0YA 1GY3A 4EBWA 4W4XA 5HI2A 4FGBA 4IX5A 4L3JA 3PP0A 3RWQA 3PE2A 4MK0A 4MVFA 3U6HA 3ZSHA 5CXZA 3MTLA 2PMNX 3MDYA 4BRXA 4NTSA 3D4QA 2OZAB 3GB2A 4M0YA 1ZMWA 3ENHA 2YZLA 3PPKA 4D55A 3BBTB 4E5BA 2AYPA 4D1XA 2GHGA 4FL2A 4O1PA 4G3GA 4B7TA 3BV2A 3D2KA 3GCUA 4J1RA 5EDPA 1UU9A 4QOXA 5M55A 3MV5A 4WSYA 2J5EA 4BN1A 3I5NA 2W4KA 5HO6A 3BPRA 5IUIA 2V0DA 4FZFB 3GU6A 3QU0A 3QTQA 2PL0A 4NH1A 2OJJA 4FUXA 3EMGA 3RNYA 4AGDA 1ZMUA 2VTNA 5ETCA 1V0PA 4FIHA 5KMNA 5EQEA 3FHRA 3AD6A 5L3AA 3R7OA 3RZFA 2UUEA 4AUAA 5DLSA 4AT5A 1OKYA 4WNKA 4LI5A 2OJGA 4ZS4A 2JD5A 3NVKI 4DTAA 4ACDA 2BKZA 4O7VA 4KB8A 4I23A 4JAJA 5IDNA 4BYJA 1YDSE 3ORTA 3P78A 5CAQA 3GC0A 3UBDA 3RM7A 2XJ1A 4TWPA 4PPBA 2QG5A 3R8MA 5B2KA 3RCJA 2YLEA 4PDOA 4D2TA 3FC1X 4RJ5A 5B0XA 3PA5A 4AZEA 4MQ2A 4CZUA 4M13A 4FVRA 2BZJA 4HCVA 3ORMA 3BWJA 3E87A 5CSHA 5CF4A 4QMOA 3UO5A 4K77A 3HNGA 4QTDA 1BL6A 2JFLA 1AD5A 3DQWA 3P79A 1H28A 2Z7LA 3W18A 4RZVA 5CI6A 1YVJA 3DJ5A 2A19B 3JPVA 3PRFA 2JIUA 5AR8A 5HG7A 4C38A 4DAWA 4DG3E 2BDFA 3V01A 1APME 4XJ0A 3MA6A 3QC9A 2W1DA 4FUYA 2YIXA 4C36A 3ORXA 5AA8A 2I0YA 1PKDA 2GPHA 4IEBA 5FRIA 4AW5A 4AAAA 4I0SA 3QYWA 4O22A 5D1JA 3TIZA 1H1PA 4BGHA 3QAME 4YHTA 4ZJJA 2RSVA 4U80A 3QUPA 4QMNA 3LFSA 3RKBA 3R1QA 5AUTA 1SM2A 2XF0A 5EOLA 4ZTRA 3KULA 4IWQA 3UG1A 4ORKA 3ITZA 5HE3A 3QYZA 4EHEA 3A61A 3P9JA 4CZYB 4E7WA 3GCSA 4ACHA 2VNWA 3LFCA 1G5SA 4ZTMA 1PYXA 3RP9A 4CLJA 2PZPA 3I6WA 2V7OA 5ANJA 3DGKA 3QRTA 4EUTA 4WA9A 3NYXA 4JRNA 4FL1A 4XP0A 2ZV2A 1KUTA 2X0GA 1YDTE 3AD4A 5G1XA 3ZM4A 2OH4A 4RJ6A 2W99B 4USDA 3LKMA 3EQRA 3PDTA 2VTJA 2W9FB 3RHXA 3TNIA 1ZOHA 5E8YA 4AGCA 4EH2A 4F99A 5KMOA 1Q97A 2P4IA 2Y6MA 2QOKA 3KF4A 2B0QA 4IW0A 2X6EA 3GUBA 1ZZLA 2OFVA 5AAGA 4KRDA 4AF3A 2BRGA 5C01A 4ZMFA 5D7VA 5CZHA 3SOAA 1URWA 4WG4A 4F1MA 4A9UA 4QMWA 4A9YA 5IQCA 3F69A 3AMYA 3KQ7A 4IAFA 4X21A 4EOJA 2WTWA 5LMBA 3GC8A 5L8LA 3VUHA 3OUNB 3FZPA 3R8UA 2R3IA 3MH1A 5AP0A 2KULA 3HUBA 5E8TA 2X81A 3TZ7A 2J0JA 5H3QA 3TACA 3FMEA 3SW7A 1GOLA 3FSFA 2ITZA 3EL8A 4YC8A 2QOOA 4D2PA 3U8WA 1JNKA 5DBXA 4RFMA 3MIAA 1K3AA 5CEOA 3EQGA 2X7GA 3H10A 4FTNA 4UYNA 3SW4A 2WMVA 4F63A 3LMIA 4JDIA 2UVZA 5CU6A 4G5JA 5BVFA 2YM4A 1WBWA 2J2IB 3UE4A 5IEVA 5JQ5A 2I0HA 4LUEA 3ZZEA 5A54A 3UDBA 4JVGA 2XNGA 1WBVA 4BR3A 5AUVA 4P4CA 5BX0A 2ZAZA 4NYEA 3ZRLA 3NNWA 4ZTQA 3BGZA 4OBOA 5K4IA 1KE6A 4O7LA 4LRKA 2BTRA 3B2TA 4IAYA 4OTDA 4DGNA 5L2WA 1WCCA 2Y7JA 2HENA 1UNLA 3KU2A 4K11A 3U6JA 4O6LA 1IAJA 5AR5A 3HV5A 3F7ZA 4BDHA 2FB8A 5L6OA 3EQBA 4K9YA 3DDPA 3I4BA 4USEA 5ANOA 5HCYA 4XG7A 1BMKA 3NCGA 4ZZMA 1JAMA 4IXPA 3E8EA 4KS8A 4QPSA 5AV0A 3UNKA 5DT4A 5H8BA 2R3LA 2WXVA 3GCVA 4IQ6A 4DFYA 2XB7A 4FV2A 4RSSA 1Y91A 4XG8A 5HD4A 4BTFA 3HV7A 4MD9E 4D4RA 1URCA 2JKMA 2WMBA 3JVSA 4GFOA 1R1WA 2R4BA 2VX0A 4CGAA 3R8VA 3IS5A 3SVVA 1YXXA 5HG5A 4X2NA 3NUUA 3C50A 3PY3A 4HVSA 1KOAA 3R2YA 4A9TA 5EFQA 1UKIA 1MUOA 3RI1A 4TXCA 1A06A 2XEZA 3DCVA 3KB7A 2W0JA 4QP6A 4IZYA 2JDRA 2Y6OA 3CGOA 4AU8A 3DKCA 5E9EA 1PYEA 3CTHA 4WKQA 3VJOA 2C6TA 3LW0A 4YSMA 5AP4A 5ACBC 3ZO3A 3OHTA 2XYNA 2B7AA 2J0IA 4MBLA 3EKKA 3W8LA 1ZMVA 1T45A 2WQNA 4C02A 4ZTLA 4IAIA 1K2PA 1OITA 2HXQA 1E1XA 2J0LA 3B8QA 3UP7A 2X8DA 4FV1A 4FTMA 3EQFA 3R1SA 4RMZA 4CT1A 5M4UA 4R6VA 3DZOA 3D9VA 4H58A 5EDQA 4ACCA 1UA2A 4RX7A 4FTRA 4O21A 2GTNA 4UY9A 3JVRA 1ZXEA 4Y85A 1GIHA 5ANKA 3ZMMA 3LFAA 3IDCA 3P1AA 4ASXA 1OBDA 4FIEA 4U43A 2BDWA 1V0OA 4AE9A 3TV4A 2R3MA 4EWQA 3QCYA 5C8NA 5M09A 2JITA 3MY5A 4PL4A 3PSDA 4F70A 5JZJA 5EYDA 4ZLZA 2R5TA 4UZDA 4J52A 1PXKA 5CS6A 4ANOA 1PW2A 3EFJA 3HDNA 4XCUA 3VS4A 3ZC5A 3FLYA 3AC8A 2EB2A 2Y0AA 3WYXA 4BDCA 3AC5A 4DGMA 3VWAA 1GNGA 3NX8A 4I5MA 4XYFA 5I9UA 4DINA 3QTXA 2BIKB 3NNXA 5K5NA 5LVLA 5AUWA 2E9OA 2YM3A 2H96A 4GT4A 2WMAA 3GCQA 3ZXZA 3COMA 1QMZA 3RMFA 5DPVA 3THBA 1YKRA 5FGKA 2ITPA 3WF7A 4GG5A 5JFVA 2ZDTA 3QZIA 4YTFA 5EI2A 2EUFB 4UEUA 5DR9A 4FR4A 3EYGA 5GZAA 3VBXA 2Y4IC 2ZMDA 1JSUA 4YJRA 4NM3A 3QQLA 3W55A 3VBTA 2VTMA 2VX3A 4R5YA 3PFQA 4WO5A 4BDJA 2VD5A 1DS5A 2X4ZA 3NAXA 4NWMA 3WF8A 3CTQA 5H8EA 4XNEA 2O64A 3VBQA 3CJGA 4C2VA 4YSJA 5I9XA 4D4YA 3DA6A 3N4UA 4HZSA 5CLPA 4P90A 2CGXA 1KE7A 2PE1A 4O2PA 3QX4A 1YOJA 3KCKA 4HOKA 2WTIA 3IW6A 3B8RA 4JBPA 2QONA 3BYMA 3HDMA 3N9XA 4KBCA 3QTIA 5HE2A 5A6OA 5GIOE 2ZV9A 1WZYA 1R3CA 2XK3A 5FXQA 3K3JA 2C6LA 4W9XA 4YNEA 3V04A 5C9CA 4L53A 3A4OX 3U51A 4BI1A 3PIZA 2X1NA 1EH4A 5M56A 2Z8CA 3AGLA 4O6EA 4RJ8A 3R6XA 2O2UA 2JIVA 1V1KA 1Q62A 2E9UA 4WBBB 1UV5A 5AR7A 5BUEA 3F3WA 3QTUA 4G6NA 1P4OA 2KTYA 3L8XA 4BDIA 5A4LA 4I94A 2WIPA 3EOCA 5CNNA 2BZHB 3QCQA 4FV4A 3O7LD 4YBKA 5JZNA 4AW2A 4CKJA 3H9FA 1J3HA 3C4XA 3EWHA 4RIXB 5LVMA 4JG7A 3DXNA 3R7UA 4F9BA 2C6KA 2WD1A 1J7UA 4IFCA 4WG3A 5J87A 4AFEA 3VF9A 2QCSA 2OXXA 2RFEA 4BCOA 4KS7A 4YTHA 4V04A 4RRVA 2OJ9A 2ITVA 3R7EA 1H07A 5HE0A 2X39A 1ZYSA 3CD3A 4PUZA 1PXOA 4FSZA 4IDTA 5DT0A 5KBQA 1H01A 1M14A 5TR6A 4RIWB 5BVDA 4W8EA 3DFAA 2ZMCA 3I0OA 3NIEA 3L8VA 1UNHA 4FTUA 1MRVA 3L8PA 4ANMA 3E92A 1ZYDA 1OL5A 2PMLX 3C51A 3E3PA 4QRCA 3VUDA 3VQUA 1R78A 5E90A 4HVHA 4C4FA 5AX3A 1F3MC 3QTWA 2R3JA 3DTCA 4O91A 3PLSA 5I5ZA 5CSWA 4UZHA 1NA7A 3FAAA 4HCTA 2C6IA 4L9IA 4N6YA 4QQCA 4R5SA 5M51A 3A62A 1Q3WA 4JR7A 4MWIA 3H30A 4NSTA 4TN6A 4ZY6A 4C7TA 4CFWA 2V22A 1YWVA 3ORKA 2OF2A 3MY1A 3RK9A 2QOIA 2C3KA 3VRYA 4BI0A 1XBCA 4ZTSA 2GU8A 4XMOA 3PTGA 3RZBA 3C9WA 3EQCA 3M42A 3POOA 4G6LA 2VWUA 3AT3A 4IJ9A 2W1EA 2BKKA 4JJRA 4AOIA 4IANA 2W1ZA 2HY81 4U3YA 4J98A 3H9OA 3IW7A 2QHNA 4FKGA 4EONA 5CEMA 2UW9A 4N0SA 3TG1A 3OCTA 3PXYA 4AGWA 2WELA 4M84A 4F1TA 4G34A 3SDJA 3VBVA 5KBRA 1PXJA 5T3QA 3BHVA 1IASA 3QGYA 1CDKA 1P4FA 1T46A 2ERKA 2X9EA 4JOAA 4DN5A 5ITAA 5ANIA 3HZTA 2W5BA 4QP8A 3FYKX 4EOQA 3CKXA 4QTEA 1PXLA 3KK8A 3LE6A 3R22A 3ORZA 5LQFA 5C26A 2HZIA 5BUJA 4R1YA 4FTOA 3DLZA 3RBWA 1J1BA 2PY3A 2YACA 4OTRA 5DT3A 4WNMA 3W10A 3BGQA 5DRBA 5IF1A 3ZSGA 2Z7QA 5IQFA 2PWLA 4IZ7A 4BDFA 1XH4A 2VTLA 4ZY4A 2CPKE 2W9ZB 5A46A 4OAUC 4TTHB 3E7VA 3C4WA 1M7NA 5LMKA 3FMLA 3COKA 1VZOA 1IEPA 3BYVA 4CV9A 2F7XE 2P3GX 4FT7A 2IZUA 3IKAA 4QMTA 3BZ3A 4DCEA 4ZZOA 1FBNA 1KV2A 3DXQA 3DAJA 3D5WA 1OL2A 4U79A 3QA0A 1X8BA 4YLLA 1SNXA 4NCTA 3ATSA 3JY9A 4FKQA 4O7SA 2OJFE 3NR9A 4KNBA 4OAVB 5M07A 4YJOA 5IG1A 4D2SA 4QMYA 5HIBA 4AA0A 5ACKA 4DFUA 3SGCA 3BYSA 4HNIA 4YBJA 5CSVA 3GVUA 4I20A 2J51A 4IB5A 2RIOA 1PKGA 3LIJA 4XOZA 4BWXA 4GL9A 3PXFA 5ICPA 5IA3A 5KMIA 4ANBA 2GFSA 2JKKA 2JAVA 4GJ2A 5TKDA 1OIQA 1H1SA 4M68A 4YTCA 3TJCA 1LPUA 4FSUA 4ZOGA 4GFGA 4EK4A 2ITXA 3LFNA 4MH7A 3FDNA 2YCSA 3VVHA 4O86A 5IISA 4HW7A 4WNPA 4FKTA 3D5VA 3R00A 1JQHA 2JKQA 3C4FA 2EVAA 3O8PA 3LCOA 3BLRA 4OTGA 5F20A 3N4TA 1H24A 3UC3A 3OY3A 4QD6A 1YXTA 4A7CA 4O27B 4EC8A 5AR3A 2BDJA 4KKHA 3VW8A 1VJYA 3DNEA 4XS2A 3FMMA 3P23A 5GJGA 3COIA 3CIKA 3W1FA 1NVRA 1XH8A 3OT3A 3UPZA 3TZ9A 1PHKA 3UOKA 2F9GA 5TE0A 3R7IA 5AV3A 2WU7A 3DKGA 3C4ZA 5EYKA 2B9HA 2ITNA 2BCJA 3HA6A 1JSVA 2Y4PA 2VWYA 3NLBA 4H1MA 4X2JA 3ZHPC 4KUJA 4KABA 2PVMA 1H1WA 5CAUA 3JYAA 4FG9A 4AA5A 1WBSA 5HBHA 4C4IA 4F9AA 4CNHA 2E9PA 2WMWA 4AG8A 4BDKA 3WE8A 5FG8A 3HAVA 4E5AX 5HLNA 2XEYA 4BY9E 2BZIB 3PYYA 5LVPA 2BALA 1PXMA 3DJ6A 4CD0A 1GZKA 3A7JA 3R30A 4AX8A 5CVHA 4CVAA 4YP8A 4IWPA 2JGZA 3NS9A 4J97A 4JDJA 3OWJA 5CANA 5KO1A 3PSCA 4FEXA 4BKJA 2R0UA 3Q96A 5I9ZA 3F5PA 2ETRA 2HK5A 4GT3A 4JG6A 4XLIA 2QC6A 4F6UA 3I79A 4MTAA 2RKUA 4D4VA 4QTCA 4CQGA 4RFZA 4JR3A 1Q4LA 1YQJA 3A8XA 1DI8A 3DBEA 5EM8A 4JX7A 3NUNA 3SKCA 3FPQA 2WU6A 4O0UA 4YHJA 4WRGA 2YZAA 3BELA 3RPVA 5AA9A 3G15A 3UOLA 3NAYA 3UGCA 1WMKA 4ASDA 3NDMA 1ZY5A 5HNGA 3R02A 4XV9A 5CVFA 3SQQA 2YAKA 3HVCA 3OY1A 4OBQA 4YTIA 3RPRA 1SNUA 4FI1A 2ZOQA 3P7AA 1R0EA 4G3CA 4ZSJA 1U5RA 1OGUA 4P5ZA 2OGVA 3ERKA 3NW7A 5CU2A 2XS0A 3E93A 4RLKA 2O65A 2UW3A 4I4EA 4Q9SA 4UBAA 2C5NA 3R9OA 4Q2AA 3HMOA 4BCPA 5KUPA 4FTCA 2OICA 1PXPA 3CGFA 3DBQA 5E8XA 3R7VA 4EHGA 4YZMA 2XRWA 2PE0A 4WRSA 4X6RA 3U9CA 4F7SA 4DF3A 4E73A 1CTPE 3FHIA 1WBPA 3KEXA 1QCFA 4GJ3A 3ZFMA 3ID6C 2C0OA 2C3JA 4X3FC 2J50A 3WOWA 1RQQA 2HXLA 2XNBA 1UVRA 4W9WA 5HG8A 2HWOA 5KX8A 1YXVA 3EB0A 4BCIA 3HMMA 4GU6A 1VR2A 3ZEPA 5KMKA 5A4TA 3EKNA 5CU4A 4UYAA 3VF8A 1RW8A 2WTJA 4QPMA 1FVRA 5HKMA 4YJTA 1W83A 3NW6A 2P55A 4FMQA 1Q3DA 3TN8A 3JUHA 3ULIA 1W8CA 4I6FA 3DS6A 2W5HA 2CHLA 3QQFA 4GYGA 4BCMA 2F57A 2ONLA 2YM8A 3L9NA 3OCGA 3BLQA 3F5UA 4FICA 4TZRA 4AFJA 4BICA 1UU8A 3G5DA 3NNUA 4ALVA 4DEHA 4C3PA 1OKZA 4AE6A 5HVJA 3KN5A 5J7HA 5EQYA 3KCFA 1JKTA 5EW3A 4MBJA 3VUIA 4EWHA 4WUAA 2XJ0A 4NW5A 5CF5A 1G8AA 4QTBA 4B8MA 1QPCA 5KZ0A 3OXZA 3OBGA 1PRYA 4KBAA 4G6OA 1QPEA 1W82A 4YLKA 4AS0A 4D2RA 4E5WA 3G2FA 5AP2A 5F4NA 4AZWA 3GXLA 4OT5A 4QP2A 4EHVA 4Z16A 1PXNA 2OG8A 3EH9A 4MXZA 4XV1A 4JT3A 5IMXA 2HIWA 2ZVAA 4NFMA 3O7LB 3D7ZA 4D2WA 2PPQA 3RALA 3HX4A 3H4JA 2R3FA 4JS8A 4C35A 2DS1A 5K4JA 4XUFA 2R3NA 2O3PA 3GC9A 1Y57A 3MH2A 4QNAA 4RWJA 3Q6WA 4QP3A 3VHEA 4R1VA 1DAWA 3TKHA 2G1TA 3MTFA 2C3LA 1LP4A 3VS0A 4APCA 3EN7A 3PG1A 2WKMA 4YLJA 5DEYA 5AUYA 2PVJA 4FKPA 5AUXA 4U97A 2C5VA 2QG7A 3BCEA 4KBKA 1NY3A 4FKOA 4GT5A 3UZRA 1YDRE 4MX9A 3WE4A 5HG9A 4APPA 3TDVA 2NRUA 4JG8A 2ACXA 3R9HA 2WQBA 5AIKA 3UQGA 1O6KA 4EZ7A 4QMSA 4BFMA 4R7IA 4MWHA 4F08A 2XM8A 3KXHA 3BWFA 2PU8A 2PVKA 3QF9A 5HO8A 2J6MA 2BRNA 1CKPA 3Q9WA 5FDXA 5DHJA 4RWIA 5JMSA 3VUKA 4G9CA 3TTIA 3S00A 4R7BA 2C0IA 3RM6A 3Q60A 5B2MA 3L8SA 4Q5HA 2OU7A 4FV6A 2HAKA 4UMUA 1QPJA 3Q2JA 3U87A 3QQHA 5LJJA 4D9TA 3F2RA 2BRMA 1NVQA 4C4JA 2RFSA 1P5EA 5J9LA 4WD5A 2YIRA 3DDQA 5ETIA 2EXEA 4J71A 1ZLTA 4H3PA 4BTJA 4TPTA 4DFXE 3FKOA 4FG7A 1K9AA 3UC4A 2PYWA 2RG6A 3UIMA 4Q9ZA 3DK6A 5HCXA 2YABA 1JPAA 4LV5A 3O0GA 2QQ7A 3QWKA 4UMPA 4PRJA 4FKSA 3L9LA 2GNLA 4PNKA 4H05A 3FL4A 2XK6A 3FSKA 1OI9A 5E7RA 4YMJA 1OUYA 4EQUA 5FEEA 4BZDA 2QKRA 2B4SB 3G6GA 3KRJA 4KKGA 2YITA 4EK3A 3PUPA 4ZTHA 4FGRA 1FVTA 2C5OA 1Q5KA 3RK7A 1GIIA 3LLTA 5JH6A 3I81A 4B9DA 1BI8A 4LGDA 1LR4A 1YRPA 5EM6A 4DTKA 1A48A 3ENMA 1XH5A 5E1SA 5TOZA 4O38A 4R3RA 3UO4A 2YWVA 4BCQA 4GVAA 2XBAA 4IDVA 4D9UA 1NT2A 2XIKA 1XBAA 3G33A 2VV9A 3BU5A 2IN6A 5KMJA 4RVKA 3BKBA 1OUKA 1PMVA 2VWXA 3O8TA 2JAMA 5HVYA 3KK9A 2X2KA 5GJFA 5AADA 1S9JA 3BHYA 3S2PA 3MFTA 4NM0A 3KULB 4BDAA 2SRCA 3MB7A 4UWBA 3VUTA 4FSMA 4P7EA 5L8JA 5AUUA 1Q8TA 3R9RA 2BRBA 4CQEA 1HOWA 2WTKC 4EI4A 5AR4A 3GU8A 3OC1A 2QI8A 4HPUE 4N70A 2PMIA 3LZBA 4ZXTA 5JK3A 1XH7A 2R3OA 3DXPA 4O0VA 4RJ4A 4ZSEA 4TL0A 4XX9A 3LMGA 1OL7A 3HA8A 3C5UA 3O17A 3FZOA 4BF2A 4DEGA 3MB6A 5C03A 5C4LA 4A9RA 1Q8UA 2OIBA 3NYVA 4BBFA 4EK8A 4E6CA 4GSBA 4PQNA 1U4DA 4AN3A 4IZ5A 3ZRKA 4DGOA 3PZEA 1STCE 1YHVA 3PXQA 4FT0A 2VTAA 3ZFXA 3KY2A 3DZQA 5DOSA 4BCKA 4JI9A 3LMHA 1Q41A 4YC6A 5AP3A 4XV2A 1IRKA 3IW5A 3W2RA 2CJMA 1PMUA 3MSSA 1M52A 2Z7SA 4IHPA 4CLIA 4BCNA 3F82A 2CDZA 2ZV7A 3LQ5A 4U81A 4FTAA 4DEAA 3MVHA 5D10A 4N4SA 1SYKA 4BTMA 4EH3A 2FA2A 2UW8A 3CR0A 3VHKA 5K9IA 5J1VA 4QYYA 4D58A 1JWHA 3CXWA 5CT0A 5M57A 3FLWA 3H0ZA 4ONAA 3BBWA 3ET7A 3KRWA 1OPJA 3OBJA 1REKA 3QGWA 4RA4A 4Y5QA 4AOTA 4FNYA 5I9YA 3R21A 1Y6AA 4RG0A 4K2RA 4RIYA 4EK6A 3VIDA 2BZKB 5M06A 4QMQA 4DFNA 3U55A 2W05A 3MFSA 2BILB 3O23A 4ITIA 4BKZA 4OTFA 1OKWA 3PVGA 5IQBA 3F2AA 1A9UA 2WOUA 4Y95A 5JRSA 4DFBA 3RPOA 3F3VA 3Q9YA 2F2CB 4ASZA 3QZHA 1IR3A 1AQ1A 2YERA 1OECA 4USFA 3QZFA 5JFXA 4ZJVA 1JVPP 3WI6A 5JRQA 3ORPA 4IVDA 4F4PA 3MJ1A 4DEDA 3DBCA 5F95A 4ITHA 5EHLA 3V8SA 3VBYA 3TEIA 4C59A 5HQ0A 5CEQA 4EBVA 3QLFA 3GEQA 4C57A 2ZV8A 4G3DA 4U45A 4R3PA 3IG7A 3R8LA 4UN0C 4FT9A 3FE3A 3A60A 4HZRA 4JRVA 3W33A 3ZYAA 4QNYA 4D1SA 3P7BA 4TNDA 2BPMA 2P2IA 4PY1A 3DK3A 4TYHA 4ASEA 2OIDA 1RDQE 3NYNA 5HU9A 3JR1A 4ZLYA 4L8MA 3V51A 1KE5A 5F94A 4I5CA 2OLCA 3RVGA 2C1AA 4C4EA 2GNIA 4YHFA 4AZFA 4OTIA 2W4OA 1HCKA 4EC9A 3ZUVA 2GQSA 4O7WA 4NW6A 3FXXA 4E3CA 2OZOA 2W96B 4I6QA 2Z2WA 4W4YA 2R0IA 4JLCA 2HWPA 2VUWA 2GS7A 3BE9A 4FKRA 4DCAA 4EKKA 5L2IA 5DE2A 3QL8A 2PUPA 2GTMA 5BUIA 4J7BA 5J79A 3Q5ZA 3CQEA 4HGEA 3VBWA 4IVBA 2ESMA 3IO7A 2ZYBA 4CYJA 5CSXA 1ZAOA 1BLXA 4NTTA 3U54A 4GG7A 2E9NA 5KE0A 4PNIA 4AT4A 4BBEA 4D5HA 3BE2A 2YCFA 5H8GA 1M7QA 4U6RA 2WTDA 4FK6A 2AC5A 2YCRA 3C7QA 4UMTA 3E64A 3LXLA 3DK7A 4H1JA 2W7XA 2BIYA 2XIXA 1SVEA 4I5PA 4K18A 5DNRA 4FT3A 2VTHA 3PVWA 5FWKK 4BHNA 3MFRA 3KRXA 3II5A 3ACJA 3OW4A 4CEGA 4CCUA 2UZDA 4DG0E 3HV4A 3KXMA 3OOMA 5CASA 4AP7A 3ZS5A 5HIDA 2YHVA 3ZCLA 2XJ2A 3H9RA 3RAIA 2X4FA 3F66A 4TWNA 5AIRA 4R78A 4EH7A 3F6XA 3QALE 5A6NA 3KGAA 1Z57A 2HW7A 5IEXA 4Y72A 3IPHA 4HPTE 4MNFA 4B99A 4CT2A 2C4GA 2H8HA 4ANNA 4C33A 4AN2A 1REJA 3D5UA 4KIKA 2WEIA 4OTHA 3LM0A 3W2OA 4ANSA 1XJDA 4E4XA 2UZNA 4WUNA 3R1YA 3P5KA 2ITWA 4TT7A 4BZNA 3I60A 3R28A 5EHYA 4YPDA 4QYHA 3H3CA 3KXZA 3MVJA 5I0BA 5FUTA 4QP7A 5D7AA 5IUGA 2QO9A 3HEGA 4C58A 4DFZE 1J1CA 5J1WA 4C8BA 3VJNA 4F7JA 3QXPA 2Q83A 3MN3A 5HESA 3BU6A 3IONA 1OIYA 3NUPA 4JX3A 5DI1A 2PVNA 3ZOSA 3OS3A 3LLAA 3SRVA 5AP6A 4G3EA 3B2WA 4DH7A 5LCJA 3CQUA 3EN9A 2ZDUA 4K1BA 2IW8A 2RFDA 3DV3A 1AGWA 2HCKA 5BNJA 5GJDA 4KA3A 4BIEA 1CSNA 3SRVB 1MRYA 3I0QA 4EKLA 5F1ZA 4EOPA 3CTJA 2LAVA 4NL0A 1OPLA 2VWVA 1BL7A 5AM7A 4EQMA 5CNOA 4G5PA 5EDRA 4DH3A 3W2CA 3OW3A 5D9HA 5EW9A 3D7TA 4FV7A 3QC4A 4GYIA 2ITOA 4EZ5A 2C3IB 3K2LA 5HE1A 5AEPA 2FSLX 4GKIA 5L4QA 3KMMA 3QCSA 3QKLA 4PMMA 3DQXA 2JBOA 4S30A 4GK4A 4S34A 2ZM1A 2CGUA 2IJMA 3EQIA 3QKMA 4JBOA 3HLLA 3Q4ZA 3MFUA 4C4HA 2QOBA 5J95A 4L67A 4LRMA 2WEVA 4A9SA 1Q24A 2BHHA 1DAYA 3FC2A 3MVMA 4I93A 1UWJA 4LQMA 4H3BA 4PTCA 4FZ7A 3ELJA 4XG3A 3T9IA 5I4NA 3QZGA 3U4WA 1CMKE 4Y8DA 3V5QA 4XG2A 1XWSA 4GK2A 4PMSA 2J4ZA 2JKOA 4H36A 2G01A 3NIZA 3QXOA 4U42A 3UODA 1ZOGA 3NYOA 3WZEA 4CKRA 4BDBA 2W1FA 4U8ZA 2VO3A 5KMLA 2IW6A 4M69A 2BRHA 4R3CA 3CE3A 3OOGA 4DH8A 5JGBA 5AWMA 4CMOA 5M44A 1VYWA 1DM2A 4FV8A 2UW6A 2J0KA 2C6EA 3R63A 3U6IA 3K5VA 4V01A 4IB0A 5J8IA 3Q32A 4ID7A 3E88A 4JXFA 4M69B 3QRJA 3E3BX 4HYUA 3UZPA 2A1AB 2JDTA 3MS9A 2PVLA 2X2MA 4JQEA 3W32A 5I9WA 3PJ3A 2UZTA 5HTBA 3I7BA 4D1ZA 4KRCA 4O0SA 5KHWA 4I0RA 3JXWA 2F4JA 3REPA 5AFVA 2QLUA 3MH3A 5M4FA 3LCSA 4DHFA 5FD2A 4RGJA 4L3PA 4GCJA 5D12A 3AQVA 3V5WA 2GQRA 5TT7A 4CRSA 2YJSA 4EORA 2J5FA 2R3PA 2XH5A 2P33A 5KHXA 4FV3A 4BCFA 3A7GA 3UJGA 4EK5A 4OT6A 4YC3A 3MW1A 1H1RA 4OTWA 4DTBA 3ZBFA 3IGOA 5TO8A 4RC4A 1M2PA 2WHBA 2UW0A 1E1VA 4CV8A 5M4CA 2EXMA 1OZ1A 3V6SA 4DH1A 4YGAA 1Y8GA 2BTSA 2PE2A 2XIRA 4TYEA 2XKEA 3L9MA 1WBNA 5IQEA 5FM3A 4AA4A 2QU5A 4NKAA 2GCDA 4X3FA 5JQ8A 1XR1A 2ERZE 2WMUA 3JS2A 4DYMA 4JAIA 4LG4A 2GNGA 5CAVA 5FBNC 5K0XA 2I1MA 4CKIA 2ETMA 4L52A 5B7VA 4JIKA 5HTIA 3Q4TA 3W16A 4RX5A 4NJDA 3LFBA 4MEDA 3LHJA 2O8YA 2PZ5A 2VGPA 2WMSA 5L2TA 1W84A 3D2IA 4LRJA 4MAOA 4QP4A 4S32A 3O71A 4BGQA 4C37A 3RPYA 3L1SA 1I44A 3OP5A 5LCKA 3VULA 1UWHA 3AMBA 5IQIA 3QD3A 3FBVA 2CNUA
chains in the Genus database with same CATH superfamily
4ZSGA 3WBLA 2IVVA 2ZB1A 4PV0A 3Q9XA 3OD6X 2UV2A 2V62A 2QURA 2WIHA 2ZB0A 3UNZA 3R01A 4FT5A 5ANDA 5KKRB 3TMOA 3R0TA 3G9NA 3F7WA 5CU3A 3ULZA 3H0YA 2QOQA 3OT8A 3GQLA 1E9HA 4YZDA 3VUGA 4DITA 2A2AA 4I3ZA 3ANQA 3ZFYA 1WVXA 2R3KA 2PZRA 3F9NA 4E4LA 3FKLA 2OJIA 4ERKA 5EKNA 4Y83A 4DDIA 2VTQA 3W8QA 3PP1A 2OK1A 4D0WA 4YZBA 4F9WA 3FMNA 5CZIA 5F9EA 4V05A 4CG8A 3O2MA 5HBEA 3TV7A 2UW4A 3UNJA 3E8DA 4LGGA 2GS2A 5HCZA 3HRFA 2WTCA 3VS2A 3HL7A 4EOKA 5IZFA 1NW1A 5HIEA 4NZWB 1ZYLA 3GP0A 4XP2A 3QTRA 4LUDA 4MF0A 3UYTA 3Q5IA 1ZOEA 1JKLA 4FZ6A 3RTPA 3ZONA 5AR2A 5JFSA 2GFCA 2P2HA 4FSQA 4F0IA 4Z7HA 4U0IA 3LPBA 3W2PA 4PMTA 2WAJA 3FXWA 4FEQA 4Q5EA 4L7FA 4QMLA 5CI7A 4MD7E 3TI1A 3FZSA 4M14A 4IJPA 3FMDA 5IH4A 4P5QA 3I1AA 1YHSA 5BYLA 3K5UA 1ZY4A 1HCLA 4IZAA 2X0OA 3NFGB 1Q8YA 4FKJA 3OG7A 3BI6A 1VEBA 2C6DA 2FGIA 1JKSA 3ROYA 2G15A 4XHKB 4CFMA 3KRRA 5LXMA 1J7LA 5HVKA 3F61A 3HGKA 1OPKA 3AG9A 4QMPA 4DLIA 4ZSLA 3CSVA 2I40A 4GVJA 3HP5A 3TM0A 4I41A 2VTTA 5FXRA 1CKIA 4WHZA 5JGDA 1M2RA 4EJ7A 3W0SA 4ZS0A 2C0TA 4ARKA 4J99A 4BIDA 4C34A 3D83A 3RAHA 4EH4A 1OL6A 2XUUA 4FEUA 4I5HA 3OEFX 3IOPA 3UYSA 4FTQA 1I09A 3ALNA 3VUMA 5L2QA 5A4QA 1JBPE 4YO4A 4XG6A 4C0TA 3IQ7A 4DFLA 4FOBA 3MWUA 4OLIA 5IEYA 2ITYA 1Q61A 2W1GA 3FQSA 3ZUUA 1GIJA 2G2HA 3COHA 2XBJA 1M17A 3PJ8A 3CC6A 2CKQA 3G0FA 5BMMA 3SXRA 3BHTA 4QYFA 2F7ZE 4W4WA 2PVRA 4IMYA 5BV3A 2OKRA 1W98A 4J96A 1TQIA 4NIFA 1Y8YA 2GNHA 4PPCA 4RLLA 2WMXA 4XRJA 3DPKA 5HNBA 4M66A 3AT4A 3GT8A 3E63A 1GJOA 4OUCA 4BBMA 1WBTA 4NFNA 1L8TA 2R7BA 4IH8A 3BLAA 3MVLA 5FBOA 4I24A 4YJNA 3FY0A 1FOTA 5DN3A 3DBFA 4W4VA 2ITUA 3HV3A 3KVXA 4IAAA 4MCVA 5DR2A 3LVPA 3WYYA 4TYGA 2PVFA 4ENXA 3UOJA 2WOTA 4KSPA 2NNWB 4O0WA 1FINA 1WAKA 5FTOA 5C8KA 3S95A 4AGUA 1WVYA 2PSQA 2PZYA 2VTSA 3FI4A 3UDZA 2R3QA 3FYJX 3QHWA 5M4IA 4O0YA 4EOLA 1LUFA 1Q8WA 2I6LA 4D28A 3BYUA 3FLSA 2CMWA 5HICA 4DBNA 2WGJA 3IECA 4X7QA 5J7BA 4RC2A 1TKIA 4MF1A 1Z5MA 2Z7RA 3Q4CA 4QMXA 5IA4A 4OBPA 1XBBA 2GQGA 1V0BA 2BUJA 4F7NA 5HD7A 2Z02A 2XCHA 5AV2A 3K3IA 5GINE 3JY0A 4ALWA 1ZRZA 4FZAB 5BVEA 4O84A 1W7HA 4BIBA 5HBJA 1H25A 3HKOA 4FV9A 3FWQA 3BIZA 4H39A 3AGMA 3CQWA 5AMNA 4I22A 5IUHA 3A7IA 4IWOA 2FUMA 2UZEA 2R3HA 2ZM4A 2NRYA 2W1IA 3NUSA 2A98A 2XNPA 1FMOE 3MY0A 4FKUA 4FTLA 2YIWA 4WOVA 4XV3A 4RX9A 4U9AA 4RWLA 3FMKA 1YWRA 3ODYX 5L2SA 4DGLC 2GHLA 1JOWB 2IVSA 5EK7A 4EEVA 3LOKA 5CVGA 4O7TA 3PE1A 2Q0BA 3I6UA 4IFGA 4IM3A 2CLXA 4KIQA 4YPSA 3U4UA 4CRLA 3SA0A 2X8IA 4O82A 2GS6A 2OIQA 3LXPA 3E5AA 4BL1A 5E4HA 2WZJA 1MRUA 3QUDA 3ZUTA 2WQMA 3GNIB 2BAJA 3L9PA 4ITJA 5ETFA 5A9UA 2XCKA 3FI8A 2YN8A 3KMUA 3QQJA 5AJQA 4GS6A 3I5ZA 4U5JA 4GEOA 5DG5A 4M0ZA 1XO2B 5FLFA 4I92A 2CCIA 3BHHA 4G3FA 4EUUA 2PVYA 2IEWA 4CTCA 3PY0A 2BAKA 5IH6A 3ALOA 3RWPA 5HLPA 3TKIA 4IM2A 2X0QA 3ORIA 2BHEA 3TJDA 3ZLXA 1ATPE 1OBGA 4NU1A 4BC6A 5IKWA 4D2VA 1QL6A 5E92A 2QOLA 4BJJB 3NUYA 4WIHA 4FYOA 4G9RA 4XG9A 2PTKA 4O83A 2JEDA 4TY1A 5HGIA 2I7QA 2AUHA 4I4FA 4NM7A 3VQHA 2XAOA 5L8KA 2XM9A 2DQ7X 2G2FA 4UXLA 4EQCA 1BYGA 5DIAA 2B9IA 2AQXA 2YAAA 4FTKA 5DFPA 4ENYA 4FSYA 5GZ8A 1ST4A 2HZNA 3TKUA 3BQCA 3ZLYA 2H9VA 5CX9A 4BYIA 3KL8A 2QR8A 3D15A 4LOPA 2XK4A 3BEAA 4FC0A 3FL5A 4BWPA 1H0WA 3EIDA 4XG4A 1GZOA 3PRIA 3KN6A 4HYSA 3UVPA 5EYMA 2B52A 3FXZA 3DU8A 4E6AA 3UDTA 2ZFYA 4G31A 3S4QA 4UALA 4X0MA 4XH6A 4CFNA 5J5SA 3PA4A 2W5AA 3FI3A 5EQPA 5IA5A 3DTWA 4HGSA 5CQUA 3KKVA 4WT6A 2UZLA 3A7HA 3ACKA 3OFMA 5CQWA 3NWWA 4XEYA 5HX8A 2CSNA 3EZVA 4Y46A 4JNWA 4ALUA 4C62A 4R7HA 4RQVA 2YJRA 4O81A 3RPSA 1XH9A 4RC3A 3G0EA 4ZZNA 3HECA 5KMMA 4I6HA 4OTQA 2UW7A 4QP9A 4GRBA 4WG5A 4FNXA 1SZMA 2VWZA 2X6DA 3QUEA 3ZO2A 5CAPA 5JEBA 4RJ7A 1YI3A 4AZVA 2WMTA 2C5YA 1PMNA 4JBQA 4FNWA 2OSCA 3G51A 1W2CA 4RJ3A 4E1ZA 2W1HA 3GOKA 3OXIA 3D0EA 4FTTA 3WZUA 4C4GA 4AXAA 4LMNA 3VS6A 4B0GA 4OGRA 5FP6A 4YUQA 4KD1A 3RHKA 3VS7A 4FV0A 4XBUA 4LM5A 5B2LA 4IIRA 3W0MA 3C0HA 5J5TA 1JKKA 3PVUA 4KWPA 5E8WA 3F5XA 5AAFA 1BKXA 3ZH8A 5HTCA 2H34A 3SX9A 5I3OA 4CG9A 4G16A 5JSMA 3LXKA 4OTPA 2OWBA 3LCKA 4B4LA 3DT1A 3FZ1A 3LFFA 3MBLA 1H08A 3HV6A 1NVSA 4MXYA 4QYEA 4DGGA 1U59A 5A4EA 4PDYA 3R04A 4IACA 2G2IA 4C2WA 4FIGA 4NEUA 2XANA 1P2AA 2CNVA 4MXXA 3PLAE 5H2UA 2O0UA 5K5XA 5AUZA 4AWIA 2YEXA 2JFMA 3R9NA 5BYYA 4V0GA 3DBDA 2F2UA 2QU6A 2VZ6A 3GOPA 3Q6UA 3W0RA 2V7AA 2HZ0A 3PXKA 3F2NA 3AMAA 1RE8A 1YWNA 4Z3VA 4CXAA 2J0MB 5AAEA 3R9DA 2X8EA 2XNNA 4GV1A 4V0GB 3LFEA 3M11A 4F64A 2UZVA 3FMHA 4EYJA 4HVDA 3ODZX 3OMVA 5CF6A 3WF5A 1XKKA 3EQHA 3LJ1A 5LVOA 4F65A 3DOGA 2Z60A 4RT7A 3NVMB 3TUBA 3NRMA 3FLQA 2V55A 5AP7A 1O6YA 3HUCA 4LL5A 1UU7A 5FP5A 3Q9ZA 2OBJA 4MXCA 3W2SA 1XMLA 4BKYA 1G8JA 4O7ZA 4AZSA 2Y4IB 4ZSAA 4QT1A 2PUIA 3DFCB 1J91A 4KSQA 5AM6A 5ETAA 3ZTXA 4O7YA 5BVOA 2A0CX 4FSRA 1LEZA 3V5LA 4FYNA 3P5JC 5HOAA 4DEIA 5DMZA 5EH0A 4ANQA 1FGKA 4XLVA 1YXUA 1XMMA 4O0TA 3VS1A 2VWWA 3RJCA 3RK5A 4GU9A 3NMUF 1RJBA 4BDGA 3EN4A 1YOLA 3TZMA 4PP9A 4MXAA 4BVUA 5DRDA 2F7EE 3HMIA 1KV1A 3DB8A 2QR7A 3F88A 3FV8A 3PWYA 4OW8A 5BVNA 1IA9A 4E4NA 4TYJA 4FIIA 1OVEA 2W4JA 4ANLA 3HAMA 2E2BA 3FUPA 4J8NA 2C30A 4F0FA 5IQGA 4ZY5A 1IA8A 4C3RA 3TNWA 3FLNC 2B55A 2R64A 3PSBA 4L00A 4ACMA 5A4CA 5IA2A 3V5TA 3BGPA 4UXQA 5IH5A 3EZRA 2XK7A 3OWLA 3OCSA 3HYHA 1MQ4A 4KAOA 3AKKA 5C4KA 3GQIA 4TWOA 4P2KA 5CAOA 4L68A 2IPXA 1UU3A 1OIRA 3QFVA 3T3VA 3UPXA 4QDEA 4DG2E 4TRLA 3LCDA 3EFWA 3AKJA 5M53A 4IADA 2C47A 3GFEA 3E7OA 3OROA 3ZEWA 3G6HA 1U54A 1M2QA 5E91A 2YM6A 4A4LA 2RL5A 2W17A 3IDBA 3UMXA 3GU5A 1H4LA 3P7CA 3RAKA 1W0XC 4RIYB 4YNOA 4EZ3A 5AP5A 4X3JA 2FH9A 4FSWA 2PUNA 1XHAA 3KXXA 2ONLC 2RGPA 4B8LA 4M97A 1TQMA 1U54B 3Q2MA 2YISA 4FVPA 3LJ2A 1BUHA 3SXFA 3UQCA 4G2FA 4PDPA 1YW2A 2G9XA 2V5QA 4TYIA 1YXSA 1MP8A 2JDSA 2VO6A 4X2KA 3QD4A 5CEKA 3AC1A 4BCGA 2F49A 4RX8A 4K8AA 4D4SA 4LL0A 3T3UA 3LXNA 4FSNA 5CALA 1KE9A 4JIAA 3RNIA 2E9VA 2C1BA 4S33A 2XMYA 4FKVA 3PPZA 4IBMA 4J8MA 2XARA 3ZLSA 2QD9A 4JQ7A 2Q0NA 4O0RA 5BYZA 2OW3A 4TYHB 3E62A 4LV8A 2CNQA 3ORNA 3ML1A 1VLRA 2XKDA 4FK3A 4MKCA 2XIZA 4FRFA 3MJ2A 3BU3A 3EYHA 2R7IA 4E4MA 4L01A 2H6DA 1IAHA 5GIPE 5E8ZA 4L45A 3BL9A 2HELA 3OZ6A 3IK3A 2EXCX 2R2PA 3LFQA 3PJCA 4E20A 3OXTA 3SLSA 5DR6A 4ZJIA 3KVWA 5EKOA 1B38A 5M08A 3PVBA 4D0XA 2C6MA 4RWKA 3WARA 3EN5A 4IAKA 3EFKA 3C5IA 4C61A 3GU4A 4AT3A 4TW9A 3DAKA 2J7TA 3FKNA 5CT7A 3MYGA 4BCHA 3IGGA 4XOYA 4BTKA 4M12A 4JL9A 4IVAA 2WTVA 4QP1A 3NCZA 4FOCA 3R8PA 3V5PA 2CKOA 3RCDA 3TXOA 2GDOA 4CYIA 4MBIA 5EYCA 1FPUA 2X2LA 5IU2A 4GH2A 4U41A 5K3YA 4CZTA 3LM5A 2HZ4A 4QQJA 4O7NA 5C1QB 4IM0A 5LOHA 2WPAA 4BWKA 4F1OA 3G9LX 1Z9XA 5CYIA 3DB6A 5DVRA 4S2ZA 5EHOA 4YURA 5AP1A 3KFAA 4X2GA 5EM5A 3QTSA 4YJQA 1PF8A 2YFXA 4AACA 3EN6A 5CF8A 2W1CA 3P4KA 4UX9A 1SMHA 3Q4UA 4M67A 4TNBA 2ITTA 3NGAA 2QOCA 2OF4A 4JBVA 4UV0A 1R39A 4L43A 3Q52A 4ZP5A 4CFUA 5CSPA 3UG2A 4FKWA 2AC3A 3RAWA 4CFXA 4CMUA 4PWNA 3WILA 5D41A 2IW9A 4AN9A 4AZTA 4F6WA 4JMQA 3AC4A 1FGIA 4I0TA 3SAYA 1SVHA 4IE9A 3VO3A 3EL7A 2XA4A 2FSTX 3VN9A 3VS5A 2X7FA 4M8TA 4A4XA 1JSTA 4KIKB 3UO6A 3VW6A 3S0OA 3TUCA 1J7IA 3WZKA 2PHKA 4QMVA 2PULA 1KSWA 4BB4A 4FJVA 2W06A 3MGYA 5IQDA 4DE4A 1KE8A 1TVOA 1YI6A 2B9FA 3CP9A 3FQHA 1UKHA 1ZARA 4KKEA 4FIJA 4XP3A 5CENA 4BHZA 3S1HA 2JIIA 1QPDA 1G3NA 2QKWB 3LCTA 3E8NA 4LYNA 3F5GA 5DWRA 3S3IA 3F3UA 1JLUE 3MI9A 5BVWA 2XALA 3WZDA 5JKGA 5FXSA 3D5XA 2C6OA 1Y6BA 4XBRA 3V3VA 2IVTA 3EQDA 3P08A 3TZ8A 4UWCA 2J90A 4Y73A 4CFVA 4K6ZA 4HVGA 3O50A 4IVCA 3R1NA 4QMZA 4IC7A 4L7SA 2JLDA 5J9YA 3BV3A 3UMWA 5FEQA 3TV6A 3C13A 5DH3A 2YWPA 1F5QA 4O96A 3ZSIA 3LJ0A 4L6QA 1IG1A 3PY1A 3V5JA 4O7RA 4EH8A 2HW6A 3FJQE 4FODA 3Q3BA 3R8ZA 2C69A 4AXDA 4BZOA 3V6RA 2JDOA 2UVXA 3LAUA 2VO7A 2XP2A 5EG3A 5A14A 2EB3A 5FEDA 3DY7A 3TDWA 3D7TB 4E93A 2NP8A 2I0VA 2B53A 3ZU7A 3HMPA 4L42A 2RF9A 4E26A 1ZYJA 4Z9LA 3OTVA 2ITQA 4QEBA 2JBPA 4A4OA 3DKFA 3HRCA 3D14A 3GENA 4RQKA 3V8WA 4EOSA 3NUAA 4FTJA 4ZK5A 1NXKA 3R71A 3CKWA 3RINA 2C5XA 3QQUA 2VWIA 2FVDA 4W8DA 1GZ8A 5CXHA 3R7YA 5L6PA 2I0EA 3KMWA 1H0VA 1H1QA 4O2ZA 4YJSA 3T9TA 4GIHA 2GNFA 3KXNA 3TCPA 5IPJA 5IQHA 3MPTA 4QYGA 3QTZA 3ZRMA 2VTIA 2B1PA 3WIKA 5HNIX 4J53A 4FX3A 3T8OA 3NW5A 5LMAA 4PMPA 2WMRA 3CBLA 3UZTA 4MNEA 4ZLOA 3FMJA 3UP2A 3FLZA 3O96A 3DAEA 3PXRA 3F3TA 2IG7A 3C0IA 3FQEA 4KIPA 2YM5A 2QOFA 3DLSA 3C1XA 4DT8A 4XRLA 3EJ1A 4RIXA 3ETAA 4MNEB 3SV0A 1ST0A 2OO8X 3MIYA 4IX6A 5CWZA 1PY5A 1XH6A 3MA3A 2CN5A 3Q53A 4EL9A 5EI8A 1H8FA 4JQ8A 4K33A 1VYZA 4LOQA 4IWDA 3KREA 3GU7A 2GHMA 5CEIA 3UQFA 3OUKA 2YIYA 2BMCA 3QKKA 4NM5A 1OKVA 4DBXA 1LEWA 3UIUA 5AV1A 3AC2A 4AQCA 4GUBA 2XNMA 3ZLWA 3WF6A 4KIOA 3ROCA 4RIWA 3QQKA 2VRXA 4FIFA 4FZDB 4F09A 2WB8A 4Z7GA 3P86A 3R2BA 5L6WL 1GZNA 4UMQA 4DH5A 2XVDA 4YZNA 3UTOA 2CKPA 4O0XA 3P0MA 1ERKA 5HEZA 2QODA 3N4VA 3ZO1A 5KCVA 3TUDA 1OB3A 2UZOA 3QWJA 4HGTA 2QLQA 5T6KA 1OIUA 2VTPA 3FZRA 4MHAA 3EQPA 3SOCA 4Y5HA 4NJ3A 2WO6A 3CJFA 3AC3A 4QPAA 2IZRA 5C27A 3C4CA 1ND4A 4RZWA 1KOBA 2HOGA 4L3LA 4OR5A 5CY3A 1KWPA 3QRUA 4GMYA 2DUVA 1GAGA 2IO6A 2YA9A 2YDKA 3W0OA 4A07A 3PG3A 4FA2A 2WQOA 2B54A 4H3QA 3ZM9A 3QD2B 4IX4A 4LOOA 3OF0A 4MD8E 3TNHA 2VAGA 4WSQA 3PFYA 2A27A 3A4PA 5LWNA 1B6CB 1L3RE 4RVLA 4X3FB 4ZAUA 3LQ3A 4ZEGA 2FYSA 3PPJA 4AXEA 5E8VA 2OFUA 3V8TA 5T68A 3CY3A 2NO3A 1O6LA 4MQ1A 4I21A 4MYGA 3UIXA 4LFIA 4TWCA 4U7ZA 2IZSA 3AOXA 4X2FA 4M7IA 5IA0A 4HCUA 3WZJA 2ZJWA 4HGLA 3NSZA 4FV5A 3ZBXA 5I3RA 4N57A 3CCNA 1WFCA 2FO0A 2PK9A 3N51A 5FQDC 5JN2A 1ZWSA 2RG5A 3ANRA 2X7OA 3QHRA 4BGGA 2Y9QA 3ZDIA 3PA3A 2UZBA 1YHWA 2HY0A 2NYAA 2X9FA 2ZM3A 4ACGA 4BCJA 3WIGA 3VNTA 4HYHA 4F7LA 2FSMX 2VWBA 2GSFA 2FSOX 3PJ1A 1PMEA 3O8UA 4QO9A 5FTGA 4I1ZA 4FTIA 4GFMA 3BEGA 4JDHA 2JC6A 3CLYA 5J9ZA 2C68A 5DYJA 4EOIA 3AT2A 3MESA 5BPYA 4IC8A 3SD0A 2XKCA 2ETKA 3NZ0A 4DEEA 2BVAA 2CGVA 4YJUA 4DC2A 1BX6A 3NUXA 3OWPA 2QO2A 4DHIB 3DJ7A 2WFYA 2VNYA 4GIIA 1MQBA 3NNVA 4NK9A 5FDPA 3A7FA 4C3FA 5GZ9A 3BHUA 2OXDA 2AEGA 4RIOA 3C0GA 3BRBA 3PXZA 3WF9A 4FE2A 2VN9A 3OTUA 4MXOA 3GI3A 4LMUA 5DEWA 2A4LA 4FL3A 3F3ZA 1OM1A 2BROA 1BI7A 3TNPC 4B6LA 5LWMA 4X6QC 4FKLA 3VS3A 4E6QA 5HORA 4G1WA 4CSVA 4GW8A 4JDKA 5JFWA 4QQTA 3UOHA 4E8AA 1B39A 4PTGA 4N6ZA 3A99A 2WQEA 3UIBA 4PL3A 2UZWE 4IB1A 3FI2A 3TL8A 3VONA 3KRLA 4LGHA 4O1OA 3GC7A 4TKSA 4CFFA 4FSTA 4G17A 4IB3A 1W2FA 4AW0A 2CLQA 1FMKA 1CM8A 2WNTA 4CCBA 4AW1A 3ZC6A 2XNEA 3CD8A 5EM7A 3QLGA 3D94A 3ZO4A 2XZSA 4YR8A 4R77A 3W2QA 3KF7A 3A2CA 3ZXTA 2UZUE 4PTEA 3SC1A 5LVNA 1YI4A 3VRZA 1F0QA 5E1EA 5CEPA 4J95A 4D5KA 3TNQB 2HYYA 2BR1A 4WNOA 5GNKA 4RVTA 3KXGA 3FEGA 3BX5A 2X0PA 3QQGA 3QA8A 3PWDA 3GCPA 3SG8A 5GHVA 3QX2A 5ANGA 1YOMA 5LARA 2B9JA 2JDVA 2PVHA 4BI2A 3DNDA 4HJOA 4U44A 4PP7A 5IDPA 4U3ZA 4EOOA 5KNJA 2DWBA 4QQ5A 1O9UA 2XK8A 5G6VA 3NPCA 3QBNA 1G8SA 2R3RA 2VX1A 4FVQA 3BQRA 4RBLA 3C4EA 3SG9A 3QD0A 4NT4A 3ZZWA 4UWYA 3TT0A 4DHJA 1U46A 2CGWA 3EHAA 5TF9A 2O63A 1XQZA 3MPAA 4EJNA 4NIFB 3FZTA 5E8SA 4F9YA 4ZMEA 3LQ8A 3IW4A 2XKFA 3CY2A 2WMQA 1Q99A 3M2WA 4FKIA 5CTPA 5E8UA 2PMOX 2PZIA 5H9BA 3BYOA 5ANEA 2QOHA 1S9IA 3OEZA 4HNFA 3MPMA 5HO7A 2EWAA 2XNOA 5JT2A 1WVWA 4YJPA 5I9VA 2QHMA 4RVMA 3SXSA 3POZA 4FNZA 4GUEA 1DI9A 3HMNA 2YLFA 3PZHA 4FG8A 4Z55A 3NEWA 4U40A 4EH5A 5HHWA 2VTRA 1PXIA 4F0GA 4F9CA 4FEWA 4NUSA 3FPMA 4PX6A 3EFLA 4EYMA 3QRIA 3PIXA 4NKSA 3TYKA 4DA5A 3AXWA 5FTQA 3IOKA 1P14A 2OH0E 2WTKB 4RFYA 1R0PA 4S31A 2YDJA 3TIYA 5HX6A 1ZZ2A 3SHEA 3GGFA 4ZTNA 3PIYA 5JGAA 3AD5A 4RA5A 4YZ9A 2VU3A 5AX9A 3IDPA 2NPQA 4GK3A 5DGZA 5HU3A 3G90X 4WBOA 4GKHA 2XIYA 2R9SA 2O5KA 3PJ2A 2BFYA 5K0KA 4EH9A 3U9NA 4AOJA 3ATTA 5KZIA 4EH6A 2YIQA 5HLWA 3QRKA 2VTOA 2RFNA 2PUUA 2P0CA 4II5A 4R8QA 4UMRA 2YCQA 3KA0A 2J9MA 5D11A 2CKEA 2REIA 5DA3A 4DEBA 2BAQA 3CEKA 4DLJA 3R7GA 1UNGA 4CTBA 3OWKA 3VC4A 3HRBA 2VGOA 4QMUA 5BMSA 4I6BA 4IAZA 4CMTA 3BLHA 2IZTA 3CS9A 2VO0A 2CN8A 4PF4A 1PJKA 4KINA 4QMMA 1U5QA 2XK9A 4PPAA 3LFDA 3R83A 4F6SA 2GMXA 1WBOA 3GBZA 1OMWA 2EU9A 4UB7A 4L44A 4YZCA 5IMEA 3GFWA 3I7CA 4HYIA 3TWJA 2IVUA 3Q04A 4L46A 1CKJA 2UVYA 2QO7A 5EI6A 1H00A 4PDSA 4AXFA 2YDIA 2LGCA 3OVVA 3UVQA 3E8CA 4YJVA 4EOMA 5KKRC 5HZNA 4BDEA 5EOBA 3K54A 4FEVA 4ZIMA 1Q8ZA 4YU2A 3CPCA 3ORLA 4AXCA 4M15A 4DT9A 1FQ1B 3A8WA 2IWIA 2BFXA 5AV4A 4FBXA 5C8MA 3O51A 2R3GA 4HVIA 3QCXA 3UVRA 4A06A 4ERWA 3CPBA 3KC3A 1SVGA 1OL1A 2OI4X 5LMKC 3RGFA 2DYLA 1TQPA 2CCHA 3M1SA 3FY2A 2QVSE 1H27A 3MH0A 5IQAA 3ZDUA 3DKOA 3R73A 2Y8OA 2QNJA 4PL5A 2OXYA 5BQ0A 3IW8A 3HP2A 4RPVA 4YO6A 4EHZA 4IX3A 2GNJA 4FF8A 4NCTC 5EW8A 3OCBA 4QTAA 2UW5A 3VAPA 5A3XA 4BDDA 1ZYCA 4E6DA 1H26A 4M3QA 5BVKA 5IA1A 2XYUA 5FM2A 3TTJA 2YM7A 5CU0A 2XRUA 2OZAA 1FVVA 4K0YA 1GY3A 4EBWA 4W4XA 5HI2A 4FGBA 4IX5A 4L3JA 3PP0A 3RWQA 3PE2A 4MK0A 4MVFA 3U6HA 3ZSHA 5CXZA 3MTLA 2PMNX 3MDYA 4BRXA 4NTSA 3D4QA 2OZAB 3GB2A 4M0YA 1ZMWA 3ENHA 2YZLA 3PPKA 4D55A 3BBTB 4E5BA 2AYPA 4D1XA 2GHGA 4FL2A 4O1PA 4G3GA 4B7TA 3BV2A 3D2KA 3GCUA 4J1RA 5EDPA 1UU9A 4QOXA 5M55A 3MV5A 4WSYA 2J5EA 4BN1A 3I5NA 2W4KA 5HO6A 3BPRA 5IUIA 2V0DA 4FZFB 3GU6A 3QU0A 3QTQA 2PL0A 4NH1A 2OJJA 4FUXA 3EMGA 3RNYA 4AGDA 1ZMUA 2VTNA 5ETCA 1V0PA 4FIHA 5KMNA 5EQEA 3FHRA 4LV7A 3AD6A 5L3AA 3R7OA 3RZFA 2UUEA 4AUAA 5DLSA 4AT5A 1OKYA 4WNKA 4LI5A 2OJGA 4ZS4A 2JD5A 3NVKI 4DTAA 4ACDA 2BKZA 4O7VA 3PUFC 4KB8A 4I23A 4JAJA 5IDNA 4BYJA 1YDSE 3ORTA 3P78A 5CAQA 3GC0A 3UBDA 3RM7A 2XJ1A 4TWPA 4PPBA 2QG5A 3R8MA 5B2KA 3RCJA 2YLEA 4PDOA 4D2TA 3FC1X 4RJ5A 5B0XA 3PA5A 4AZEA 4MQ2A 4CZUA 4M13A 4FVRA 2BZJA 4HCVA 3ORMA 3BWJA 3E87A 5CSHA 5CF4A 4QMOA 3UO5A 4K77A 3HNGA 4QTDA 1BL6A 2JFLA 1AD5A 3DQWA 3P79A 1H28A 2Z7LA 3W18A 4RZVA 5CI6A 1YVJA 3DJ5A 2A19B 3JPVA 3PRFA 2JIUA 5AR8A 5HG7A 4C38A 4DAWA 4DG3E 2BDFA 3V01A 1APME 4XJ0A 3MA6A 3QC9A 2W1DA 4FUYA 2YIXA 4C36A 3ORXA 5AA8A 2I0YA 1PKDA 2GPHA 4IEBA 5FRIA 4AW5A 4AAAA 4I0SA 3QYWA 4O22A 5D1JA 3TIZA 1H1PA 4BGHA 3QAME 4YHTA 4ZJJA 2RSVA 4U80A 3QUPA 4QMNA 3LFSA 3RKBA 3R1QA 5AUTA 1SM2A 2XF0A 5EOLA 4ZTRA 3KULA 4IWQA 3UG1A 4ORKA 3ITZA 5HE3A 3QYZA 4EHEA 3A61A 3P9JA 4CZYB 4E7WA 3GCSA 4ACHA 2VNWA 3LFCA 1G5SA 3KIOC 4ZTMA 1PYXA