3ZDUA

Crystal structure of the human cdkl3 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
309
structure length
297
Chain Sequence
MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTDIYDDEVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELKAKLLQEAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CYCLIN-DEPENDENT KINASE-LIKE 3
publication title Crystal Structure of the Human Cdkl3 Kinase Domain
rcsb
source organism Homo sapiens
total genus 89
structure length 297
sequence length 309
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zduA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zduA01
4V01A 2B55A 5EW8A 3HUBA 4QP7A 3FI8A 5I4NA 4JX3A 5K3YA 3NNVA 5DT4A 1Q8WA 4E6AA 4J53A 3GENA 3NSZA 4MBLA 1IR3A 5FXSA 4AW1A 4ONAA 1H4LA 4AP7A 3QTXA 5CSPA 1U46A 2FSOX 3GCSA 3IW4A 2JDVA 3I6UA 1YRPA 4GYGA 4PF4A 4C2VA 2Z7SA 3V51A 5AUTA 4CKRA 4QMYA 3MH2A 4PNIA 4TKSA 4NT4A 4U9AA 3ZBFA 2UVZA 2C3JA 4HGLA 4WNMA 2I0EA 3NPCA 4FV6A 4J97A 5L6WL 2J90A 1Q3WA 3DGKA 3UVQA 4FUYA 3FPMA 4KIKA 3DXNA 1OKZA 4TWPA 4FEXA 3WZKA 3OT3A 3CQUA 4RPVA 1GAGA 3ZLYA 1XBAA 4EKLA 3TEIA 2HZIA 5CU0A 3C4ZA 1WFCA 4YC8A 3ZDUA 4BCHA 1UV5A 3UIUA 4OAUC 3QZIA 3C4CA 4FTKA 1OB3A 4AW5A 4D4RA 3MH1A 1OKVA 5ITAA 4S34A 3T3VA 5J5TA 2CKOA 3BV2A 4QMMA 4YJSA 2XB7A 3QD3A 3UO6A 4AFEA 3QXOA 4I41A 2JIVA 5FGKA 4DGMA 4TYHB 4BDCA 3HP2A 5HBEA 1O6KA 3U6JA 2O3PA 3C4WA 5J79A 5CT0A 4CNHA 3RJCA 3QQJA 3LXLA 4E6DA 4U5JA 2Y8OA 2IPXA 4CXAA 4O0RA 3TCPA 3EKNA 3VNTA 2VWIA 4O86A 2QKWB 5L3AA 5AR8A 3ZH8A 3TUCA 1H27A 4YZDA 1ZOGA 4TT7A 4IB0A 4YSMA 3NWWA 5FDXA 4GV1A 4RBLA 2VO3A 4YHFA 4DG3E 4WIHA 3AT3A 3NLBA 3MVJA 1CKIA 4AU8A 4O91A 5L2QA 4X3JA 2YIXA 2BUJA 4EH8A 2B54A 3VS4A 2VN9A 4C33A 3JY9A 2QOLA 1PXIA 3DAJA 4J8NA 2C6OA 2XJ1A 4FV9A 5HD7A 4JR7A 3SKCA 5HNGA 1FVVA 2R5TA 5EH0A 2O8YA 2OFVA 3B8QA 2QOIA 4E5AX 5KMIA 2GNHA 3PZEA 4FSMA 3D5VA 5HLWA 4UZHA 1Q24A 2I6LA 2YHVA 4FV5A 4KSPA 4XLVA 3I81A 3VBXA 5IQDA 1OL1A 2J51A 1PW2A 3F61A 5DRDA 3VUKA 1KE7A 3W32A 3OWPA 3I7CA 1WBSA 4UYNA 2YIQA 3GI3A 4RRVA 3QF9A 2X2MA 4AW2A 4EKKA 5A4TA 3PVUA 4AT5A 2EB3A 4M67A 5HCXA 4DTKA 3CQEA 1EH4A 2BTRA 5FD2A 4ITJA 5CZIA 2W1EA 5D7AA 3LQ3A 5AR5A 5HBHA 4WO5A 1E1VA 4D9UA 3PWDA 5IEVA 3O8TA 3FDNA 2ZV8A 4I22A 3UTOA 3HRBA 3ULIA 2QLQA 2PHKA 1H0WA 5AP1A 2OIBA 3E92A 3IW7A 4FTJA 4BZDA 2QURA 4GS6A 4NSTA 4DF3A 4JBQA 1JSTA 5FTOA 2X8EA 3SLSA 5C1QB 2V5QA 4YZBA 2ETKA 4CCBA 2XBAA 3QD0A 1OZ1A 2WGJA 4PRJA 5JMSA 2ZM4A 4LL5A 3VN9A 3DFAA 2IZRA 3GFWA 1T46A 4NEUA 1SM2A 5HZNA 1H26A 4Z55A 1HCKA 4GH2A 1GJOA 4G6NA 4USEA 2YWPA 3FXZA 3SD0A 4GJ3A 5AV2A 4FK6A 5E1SA 3WILA 1XKKA 5LCJA 4FEWA 3DV3A 4N6YA 3TN8A 4DE4A 2F9GA 2O65A 1ZARA 2IW8A 3DBCA 3FMEA 4EJNA 3FZOA 3QRIA 3TNWA 3F2NA 2A27A 4QP4A 3VWAA 3Q3BA 4O7ZA 3BIZA 3D14A 3W16A 1PXOA 2G2FA 4IWQA 5ANGA 4B4LA 5AUVA 3ZO1A 2BIYA 2YAAA 3PSDA 1TVOA 4EI4A 2CNUA 1JLUE 3NAYA 4C57A 3C50A 3ACJA 3IW6A 3NYXA 4RIOA 3SAYA 1E9HA 3WBLA 3ZM9A 3BEAA 4FZDB 4MF0A 1H28A 3DTWA 4HGEA 4AUAA 3CSVA 2XNEA 1FVRA 4MEDA 2UW4A 3ZSGA 4LGHA 4C36A 4EYMA 4OTQA 3WF7A 4C35A 1U5QA 3QD2B 2QR8A 3BE9A 4OUCA 4NUSA 3M1SA 2UZDA 4NH1A 5AX9A 4DEEA 4QYEA 3SX9A 1H25A 4FEVA 4D0XA 3H0YA 2XP2A 4DA5A 4K8AA 3QD4A 3CTQA 1CMKE 3KXXA 5DG5A 3QCYA 5HQ0A 3N4UA 2WTCA 4I93A 4M69B 3TIZA 2YISA 5D9HA 3UBDA 3MFRA 4BR3A 3ZUTA 2CN8A 5J87A 3S2PA 4QQTA 3U55A 2ZV7A 3KXMA 4UN0C 3KK8A 1OIUA 2HY0A 4I94A 4ITIA 5DA3A 4XV2A 4DH1A 5AP5A 4PP7A 4ZTNA 3NNWA 4R3PA 4BTFA 3TV6A 2XKFA 4JBOA 2XJ0A 3OWLA 3VF9A 5I9UA 4ANNA 3PFQA 4L52A 2YFXA 3CIKA 5M09A 3MFSA 2WAJA 3C9WA 3LLAA 4ASZA 4HPTE 3QA0A 1V0PA 4GU6A 4QYYA 4S2ZA 4QTDA 3IECA 2OU7A 3H10A 4QPMA 2FUMA 3MGYA 1XH4A 2QHNA 4O0WA 4AZWA 3IW5A 4F1MA 5HOAA 4P7EA 2VTHA 2YDKA 2WMSA 4UYAA 3SG9A 3NNXA 4ID7A 4RIYB 2JLDA 3F5PA 4YJUA 4W9XA 3TUBA 3LFDA 3KRLA 3OEZA 4U45A 4EH6A 1G8SA 4I5HA 4XOYA 5KCVA 4ZSGA 4FNWA 4A4LA 4R3CA 4ASXA 3A7GA 5IU2A 3UQFA 4CG9A 4EK8A 5A4CA 3WE4A 1FMKA 2FO0A 3EQPA 2XNBA 3R1NA 3A61A 4IQ6A 4A07A 3OW3A 4IANA 4O1PA 4F1OA 4IVAA 4UZDA 4F1TA 1AGWA 2PUNA 2ZMCA 1NW1A 5CSXA 2QC6A 4ALWA 3MB7A 1QPDA 3LCTA 4D2PA 4EBVA 4IHPA 4ZY4A 3PY1A 3V5LA 3L9MA 3UOJA 4WRGA 2PULA 4U3ZA 4ACHA 3TACA 5M57A 4DCEA 3QCXA 3GU4A 4UBAA 2OXXA 1OKWA 2J0MB 3MA6A 4BCJA 4JIAA 1QCFA 3CKXA 3F66A 1UU3A 3U6HA 4TYIA 3HLLA 4JRNA 5AP6A 3UQCA 5A4EA 4H3PA 3GOKA 3R8MA 5HCZA 3H9FA 1PXKA 3HRCA 4AW0A 4D5KA 4EH3A 5IA3A 2XM9A 4O7RA 4JQ7A 4G3DA 4BDAA 5CEOA 2BZJA 2W9FB 3MH3A 3W8LA 3VS6A 5CASA 4QP6A 3FXWA 3RMFA 3PRFA 3DZQA 2C6KA 3AC2A 3DK7A 3POOA 4BI0A 4BC6A 2XNPA 1Y6AA 1Q8YA 2ITUA 2RFSA 4LRKA 4WA9A 5LMKA 4H58A 4P2KA 3SOCA 4FKPA 4C4GA 4JQ8A 1TQMA 3QQGA 2ERZE 3MI9A 3NUAA 4P90A 4O38A 3OFMA 3AG9A 3NYVA 2H9VA 3F88A 2B4SB 3RPVA 3D5WA 3DJ7A 3T3UA 3E8NA 3L8SA 2J4ZA 5I5ZA 5E8VA 3MH0A 4EK3A 3NYNA 4PV0A 2PZPA 4FKWA 3PVBA 3L9NA 4OTDA 4QD6A 4FIEA 4IC8A 2ITZA 1DM2A 2UZOA 4G6LA 3PVWA 4NU1A 3AMAA 4IVDA 4O2PA 3QKLA 2BAQA 3V5QA 3WZEA 2YERA 4QMOA 2REIA 4JT3A 4EYJA 1PJKA 3IQ7A 4FODA 4MAOA 2Z60A 2ZV9A 4HZRA 4ACDA 1MQ4A 3K3JA 4JR3A 4YJRA 1JPAA 3A60A 4JDIA 3I4BA 2E9NA 3RM7A 4EHZA 1Z57A 3I0OA 4EOPA 3S95A 4MXCA 4MXAA 4AE9A 1F3MC 1SMHA 3LJ1A 3OWKA 5L8JA 3BYSA 4C4EA 4D4YA 1R78A 4EH7A 4ZY5A 4M66A 4IZ5A 3CP9A 4MD8E 3FE3A 3L1SA 3QC4A 3QHRA 3QQFA 3CJGA 2PE0A 3H9OA 4X7QA 4IWPA 5DIAA 5BVEA 2WMXA 3OVVA 2OG8A 4RWLA 3EQIA 5K4IA 1XR1A 5BUEA 1W83A 5BVNA 3EN6A 4EOSA 5LMAA 4MH7A 5D11A 2QI8A 5KZ0A 1OPKA 3BRBA 2WQBA 2BAKA 2YIRA 2FGIA 4IX6A 4GG7A 3EFKA 3VC4A 4CGAA 3IW8A 4ANSA 4FICA 4BTKA 3BPRA 4I0TA 3TT0A 1ZZ2A 2BDJA 5KMMA 4R7BA 3OC1A 3P23A 3OTUA 4G9CA 2B7AA 4FKLA 4F09A 3OS3A 4DFZE 5E92A 3DQXA 2H6DA 2VD5A 3LXNA 1VYWA 4V05A 4E4XA 5EYKA 4ZS4A 4JG6A 4QP8A 4BTJA 1BYGA 4BCPA 2VTSA 4MWIA 1KUTA 5EQEA 2W4KA 3IK3A 4XG4A 4BFMA 2HZ4A 5JZJA 5G1XA 1OIRA 1Q99A 4L3JA 2VWVA 3QYWA 2BZKB 3K54A 3FSFA 3Q96A 4ZTRA 4F63A 2FA2A 4PPBA 2YDJA 4U41A 3TV7A 1T45A 3ZRKA 4BYJA 4BICA 2XIKA 5HE3A 3ZLXA 4WOVA 2BMCA 4YMJA 3FKNA 5CSHA 2EWAA 4F0GA 4I5PA 4CFXA 5LOHA 4UMPA 4E4MA 2BCJA 3WI6A 2Q0NA 4TYGA 5E1EA 5CI6A 5ETIA 1J1CA 3OBJA 3AOXA 2YJRA 4U81A 4BCIA 5J9YA 5HIEA 3K2LA 4NTSA 3GQIA 1YDRE 3BQRA 4JS8A 1RE8A 1V1KA 3WZUA 3KK9A 3BBWA 3E87A 1G8AA 2C6MA 5EI2A 2GTMA 5C8NA 2C1AA 3C1XA 3PXKA 4NL0A 4TYEA 3O51A 3R04A 4Q2AA 1J7IA 5CQWA 4H36A 4QQ5A 2HW6A 1DI8A 4XP2A 3SW4A 1ZY4A 1Z5MA 2YACA 3R7EA 3AD4A 2IVUA 2J5FA 4F6UA 1U54B 4APCA 3A7FA 5F4NA 3QYZA 4X2NA 4W4XA 3UP7A 2PVYA 4IWOA 5EHOA 2QKRA 4EOKA 3MB6A 2Z8CA 3PTGA 2R3NA 3KVXA 3ANQA 4D1ZA 4GKIA 3SVVA 4GL9A 5E8ZA 2C5XA 2I40A 5AAEA 1Q97A 4TPTA 4RIWA 3UZRA 4R5YA 3ZO4A 2PK9A 3DNDA 4YPSA 2BIKB 1L8TA 3ODYX 4ZSEA 4NZWB 5DR2A 4L43A 5EM7A 4Z7HA 4XG8A 4A9TA 3C5IA 3OCGA 3FMMA 4EL9A 2P4IA 4J71A 3FKLA 4FG8A 2PU8A 5E8YA 4PL3A 4G5PA 3V5PA 3II5A 3KL8A 2UZTA 2WMAA 3P7CA 4PNKA 2IZSA 4OTHA 4DAWA 3I0QA 4IZYA 4NM3A 4FL1A 2XK7A 4W4VA 1WBOA 2ZM1A 2XM8A 4I23A 4MNEB 5FG8A 5B2MA 2W06A 1REKA 4Q9SA 2X8IA 3PA5A 3MIYA 2HXLA 2QOQA 2C1BA 4FIGA 4FYNA 5M4CA 1UU7A 4K0YA 1FOTA 3G90X 5FTQA 4E5BA 2WPAA 2XVDA 2V7OA 4LGGA 2JIUA 3E3PA 1UA2A 3AC5A 3CCNA 2OJGA 2RF9A 1XBBA 3Q9YA 3PUPA 4HJOA 4ZTLA 4RFZA 4XRLA 3OHTA 4FT0A 4FX3A 4IB5A 2WIPA 4QMXA 4BZOA 3QTSA 4BKYA 3QLGA 3L8VA 2VO0A 4D1XA 1Q62A 4BDDA 3W2CA 2O5KA 5H2UA 3NW5A 5FP6A 3ANRA 3HKOA 4FOBA 2I0VA 3FL5A 3MJ1A 2XNOA 4M68A 3NMUF 1UKHA 3D7TB 5DH3A 2W5BA 4KB8A 2XCKA 3DDQA 4YU2A 2R3QA 3MIAA 2C5YA 4IAZA 4QP3A 4RA5A 2UZUE 5AADA 3NDMA 5A4LA 2HY81 4OTPA 2Z2WA 4RJ4A 2YCQA 3HMOA 4P5ZA 4UMTA 3KCKA 3QUEA 1PMNA 3OXTA 4PDPA 3PLSA 4MCVA 2C6IA 5HCYA 3RNYA 1DAYA 5J1VA 4ORKA 2PWLA 2XKDA 3VS1A 4NJ3A 4N57A 4FSQA 3AT2A 3N9XA 3DDPA 1NVQA 2UVYA 4RIXB 1M2PA 3UVPA 3D2KA 1H1PA 4YJPA 4GK3A 5L2IA 3EFLA 4XUFA 3ODZX 3PIXA 5IH5A 2C69A 5AUZA 5HNBA 5CY3A 4NCTC 4F0IA 2W4JA 5CS6A 5AA8A 2BRBA 3TDVA 4K77A 4L68A 3TZ8A 2JAVA 4P5QA 5HLNA 2C68A 4O22A 4PTGA 3K5VA 3BYMA 4IFGA 4F7NA 4MQ1A 1P2AA 2QG5A 4WUNA 3HZTA 4UXLA 5L4QA 1FINA 5EDPA 2XEYA 3LM0A 1XH6A 4FIIA 4X3FA 4JDHA 3QZGA 3H0ZA 5HTBA 4CZTA 4HVSA 3ATSA 4Y95A 3LMHA 1OECA 2X81A 1UNHA 3EQDA 3K5UA 4JG7A 4U97A 2VX3A 3HV3A 5C26A 4U80A 5IEXA 2CKQA 3GC0A 3TIYA 4DBXA 3KULA 3FL4A 3HGKA 2WMTA 3FXXA 2ZJWA 3NRMA 3QTIA 4H3BA 3BWJA 1JKTA 4NIFA 4PWNA 2O64A 3W55A 4DTAA 3RBWA 3MS9A 4PDSA 4CTCA 4CG8A 4LRJA 3Q04A 2VTTA 1H0VA 3RP9A 1VJYA 3RNIA 3MBLA 3QRUA 4I0SA 4AS0A 4F9AA 5CVHA 3V6RA 3LJ2A 3E62A 3NUYA 4N4SA 2J0IA 4Y85A 4QTCA 4L3LA 4U6RA 4V0GA 4X0MA 3EQGA 4YR8A 4D2TA 5BVOA 3ORXA 4QTEA 4HPUE 3FZSA 3PJ8A 5CANA 4I92A 4AN2A 2BDWA 3GEQA 3KRJA 4UWCA 4IAFA 5DR9A 4BDHA 3DCVA 4ALUA 5TE0A 2C0TA 1QL6A 2I0YA 3ORZA 3TTJA 4YZ9A 3VO3A 2J50A 5I9XA 1WBPA 2YZAA 2JAMA 1KWPA 1H00A 2VTOA 2W1GA 1JSVA 3C0IA 3PXZA 4FOCA 4L67A 3ZFMA 4HW7A 4FR4A 4RVTA 3VBVA 3EMGA 5DGZA 2UW3A 4KINA 5AM6A 4DEHA 5AR2A 1SNXA 3POZA 4B8LA 4C59A 4IB3A 4F4PA 4CSVA 1FVTA 4IVBA 5G6VA 2QD9A 3P4KA 3FYJX 5CF4A 5JKGA 1YW2A 3BELA 5GINE 4EQUA 2BRMA 5H3QA 4BRXA 4C7TA 3FLQA 4D2SA 4DC2A 4S30A 5GHVA 4BBFA 1KOBA 4TWCA 4DGNA 3BGQA 3QBNA 2YABA 5L8LA 2IVVA 4AF3A 1PMUA 2VTQA 3ZXTA 5I9VA 5DYJA 1YHSA 2JFMA 5DEYA 4J7BA 4ARKA 5IUGA 2O0UA 4AQCA 3P7BA 4KS8A 3HA6A 4LUDA 5C03A 3Q9XA 3ZSHA 4UWYA 4RGJA 2XRUA 4MK0A 4XJ0A 2WTDA 3D15A 3FMHA 1DAWA 1H1WA 1OL7A 2BTSA 2FB8A 3OT8A 4V0GB 2CNQA 4UY9A 2QHMA 4A4XA 4OTIA 4RT7A 5C8KA 3UYSA 3A99A 4DFLA 5D41A 4FNZA 3R9NA 3EN4A 1E1XA 3CGFA 3QU0A 3UZPA 4IX5A 3DAKA 4ZOGA 3ENMA 3LQ8A 5FBOA 4ZY6A 3W2SA 4DGLC 4YUQA 5HU9A 2Y6OA 2WTKB 5D7VA 4L45A 4OR5A 3PE1A 1IRKA 4K2RA 2JDTA 1LUFA 3R6XA 4AN3A 3COMA 2X1NA 3SW7A 1YHWA 4JNWA 4YJNA 4L44A 4NFNA 4IAAA 3NUUA 1JVPP 3NIEA 4E73A 2Y4IC 5LCKA 4J8MA 4MD9E 4QO9A 4BDJA 4ASEA 2CN5A 5GZ9A 3ZM4A 5B2LA 4IVCA 2HAKA 2R3FA 3U8WA 4QPAA 4O6EA 4XYFA 4FTRA 4O0XA 5BVFA 2G01A 4CQGA 4B8MA 1Q8UA 2RFNA 1BL7A 4FVPA 4YZNA 1PXNA 1PKGA 5FEQA 5B0XA 3UIBA 2UW7A 2PZYA 2R3JA 3R1QA 1PXJA 1CTPE 4FUXA 2BFYA 3AQVA 2B9JA 4M3QA 4IM3A 3U9CA 1K9AA 4DINA 3E64A 2VX1A 3KRXA 4O83A 3CPBA 2YITA 4IFCA 2W5HA 3V5TA 3GU6A 2PSQA 3GU7A 3QC9A 2OICA 4YJTA 2CJMA 5FEEA 4PUZA 4GVAA 3R9DA 1Y8GA 3W33A 3I5ZA 4ZTMA 3EQCA 3ACKA 4LGDA 3DU8A 1YDSE 3P79A 4ZS0A 2I0HA 5AMNA 2OLCA 3TV4A 5F9EA 2AUHA 4IADA 4M12A 2BKZA 3KU2A 4F99A 1F5QA 2QOOA 1UVRA 3FQHA 3FUPA 3KN6A 3COIA 4J96A 3GBZA 4FG7A 3VHKA 1YI6A 3N4TA 4DGGA 1YDTE 2OIQA 3AD5A 3GC9A 3ID6C 3JUHA 4OTWA 4RC2A 3ZTXA 3RINA 3ZZEA 1XJDA 2GMXA 2IW6A 2X7GA 3F3UA 3LXPA 3UC3A 3F82A 5L6PA 3BQCA 1JKLA 4L53A 3ZZWA 4O2ZA 4K1BA 4CEGA 4FL2A 4G3FA 3HAMA 4LOQA 4AN9A 5HGIA 3RVGA 3AC4A 2W1DA 3ALOA 3VUGA 4EC8A 4JAJA 4DG0E 4UB7A 1JAMA 5E7RA 4EH4A 3RTPA 3EFWA 3QGYA 2XK4A 1P4FA 2B9HA 4DH5A 4EZ3A 4XG7A 4M8TA 4B0GA 2R3PA 5H8EA 5M06A 3UG1A 2QOBA 4J95A 2GHMA 3ORNA 3IS5A 1Y57A 3Q9WA 2C30A 4EQCA 4KNBA 4YGAA 3BYVA 1JQHA 3R71A 2W1FA 2PVHA 3Q9ZA 3OTVA 4N70A 3KXZA 2YCRA 1TQIA 3FY0A 5CSWA 5T6KA 3MYGA 3QQKA 4QNYA 5DR6A 2ZB1A 2B1PA 4ANOA 5HVKA 1Y91A 4D4SA 5CALA 2UW5A 4MBJA 3FI3A 4XP3A 3HRFA 1B39A 3QHWA 4QMZA 4YPDA 4EONA 4WBOA 3ZO3A 4ZLZA 4BDEA 4PX6A 4EC9A 3W8QA 4DEAA 3QTZA 4RJ6A 1R39A 3A8WA 4X3FC 3A7JA 3KC3A 3R83A 4QMUA 2HW7A 4CT2A 4HYUA 3VIDA 3WYYA 3BV3A 3ROYA 3BU5A 3C0HA 3VUHA 4J99A 5L6OA 3HECA 2JEDA 4F0FA 3HV4A 4BDFA 3QFVA 2VGOA 5KMNA 4CCUA 3EQHA 1GOLA 3DBFA 4CD0A 2C6LA 3GCPA 3SV0A 4F7JA 2BFXA 2GTNA 2C4GA 5JFXA 5TR6A 2R3OA 2WB8A 4O0YA 1PF8A 1IASA 3TNQB 3S3IA 5IG1A 4CRSA 4AOJA 3FZ1A 5CLPA 4C38A 3LMIA 3LM5A 3DS6A 4YBJA 2W96B 4HVIA 4U8ZA 3ZLWA 2G2HA 4HYIA 1ZYCA 1UNLA 1ZAOA 3D7ZA 3GU5A 4UXQA 5CAVA 4XG9A 2BALA 4C62A 3RAWA 2WXVA 3CTJA 4RVLA 2XUUA 3MPMA 4EH9A 4RQVA 3MWUA 4C37A 2QR7A 2HXQA 2GFCA 4EOLA 4QYGA 1UNGA 2ITTA 4AX8A 3C13A 5CXZA 5LVNA 5EYMA 4A4OA 1CKPA 4F6SA 4F6WA 5BYLA 3F2AA 2IG7A 2C0IA 3KXHA 4AGCA 3AT4A 3SXRA 3OUNB 1JWHA 1ATPE 1ZMUA 4JXFA 4O82A 1OIQA 2PMLX 5IUHA 1IAJA 2CKEA 2E9OA 4TWOA 3DXQA 3A2CA 4I1ZA 3VQUA 3B8RA 2OKRA 3R0TA 5TKDA 2X39A 3RPRA 4FTQA 4EOMA 2PVNA 2YM6A 3UP2A 2V0DA 3HMMA 1KE9A 4C4HA 2UW9A 4AE6A 4F7LA 4L6QA 2P55A 3O2MA 5HICA 2Z02A 5KO1A 2GFSA 4FSTA 3JVRA 3PXRA 3M42A 3NW7A 4TTHB 2C0OA 1RW8A 4YTCA 1ZYDA 2IN6A 4TNBA 5D12A 2NRYA 3Q4TA 4A9RA 4DFXE 3EN9A 2VWYA 4QQCA 5JN2A 3ENHA 4OGRA 5LXMA 3OCSA 3ZOSA 2V7AA 2W1CA 3DOGA 1XO2B 3V01A 4XNEA 2W17A 1U4DA 2XKEA 2V55A 4I21A 3MTLA 2X0GA 4IWDA 4FV1A 2YZLA 5HEZA 2IJMA 3F5UA 5HU3A 4Q9ZA 4OAVB 4ACMA 5GZ8A 2PL0A 3VUIA 4CV8A 3UNKA 4A9YA 2WQEA 2C5OA 1OGUA 4LRMA 4O7SA 4TYHA 2PE1A 3VS5A 3N4VA 4TZRA 4FV2A 1G5SA 2OH4A 2WKMA 3TL8A 4LFIA 5DE2A 3UZTA 5HX6A 4BCQA 4Y73A 2BZIB 1GZOA 3E3BX 5J8IA 1KV2A 4GIHA 3VS2A 3FLNC 3C7QA 4BKJA 2VTLA 5LVOA 2BRGA 4K18A 3HUCA 3NVKI 4ANBA 1YKRA 3DKCA 2VNWA 2CGXA 4PMTA 2JDRA 4RJ5A 4YJVA 4HGSA 4N0SA 4OBOA 3R7UA 3UNJA 4TW9A 5IA5A 4FK3A 4RMZA 2RG6A 3LPBA 4GYIA 4BWXA 2J7TA 2VUWA 4JLCA 3WYXA 4O6LA 3C4EA 4RJ7A 2CHLA 2GDOA 3MVMA 4FYOA 5DFPA 5DOSA 1WMKA 5H8GA 2A4LA 1TKIA 1APME 2WHBA 3FAAA 3MN3A 4U40A 3ORMA 1OL6A 4NM5A 2HENA 3ULZA 4C34A 5IQIA 4O21A 2J2IB 2BR1A 5JK3A 3TZ7A 3F3TA 3GGFA 4W8DA 1R3CA 3G51A 3PSBA 3JR1A 2JBPA 1RDQE 4AWIA 3KREA 3GP0A 4HCTA 4L3PA 4RX5A 4GJ2A 5K9IA 2WMWA 3W2OA 1PY5A 3QRKA 2GS2A 4D5HA 4BI1A 2P3GX 4R1VA 1M2RA 4QMTA 4IM2A 1ZOEA 4FIJA 4IDVA 2HWOA 4ZIMA 1SZMA 2UZVA 2YM7A 4E4LA 5HTCA 3HL7A 4JJRA 1WVXA 4UX9A 4O7TA 3TKHA 2NP8A 3H4JA 2VGPA 3C5UA 4B6LA 5I9ZA 3LFAA 3BZ3A 4W4YA 4X6RA 4DCAA 4PMSA 3CE3A 3FC2A 3DKFA 4XH6A 4EHGA 3V6SA 4J98A 5FM3A 3VVHA 4G16A 5AFVA 5IDPA 1ZWSA 1OPJA 3LMGA 1Q41A 3P5KA 4NCTA 3RWPA 3LFCA 5IQBA 3ZDIA 2JKMA 4IM0A 5L8KA 5LVPA 3LKMA 2OJ9A 4JQEA 4O0SA 5D1JA 2YA9A 1SVEA 4XEYA 3EQBA 3QZFA 4XV1A 4RA4A 2YEXA 4UWBA 3RAKA 1OL2A 4HVDA 1H1RA 4RVMA 2XIXA 1URWA 4G9RA 5CI7A 5AAFA 3R7YA 5DVRA 5JZNA 3RK5A 4AZVA 2ITPA 3I5NA 4NKAA 3FQSA 3MY0A 3SRVB 3GB2A 3Q5ZA 5GJDA 4PPAA 4CMOA 5GZAA 2CGWA 3DBDA 3R7VA 4L01A 2VWZA 4YHJA 2YM4A 4YZMA 5DT0A 3S00A 4FTCA 4LM5A 3UO4A 3ZS5A 2XZSA 4XLIA 2SRCA 3JS2A 1AD5A 3KXNA 2RSVA 4KABA 3SXFA 3VJOA 4FI1A 2J9MA 3BI6A 3HA8A 2JGZA 4ANLA 4C4FA 4CQEA 1B6CB 3G9NA 3U54A 3P78A 2B53A 4EH5A 2IO6A 4GK2A 3KMMA 5DPVA 3UE4A 4CT1A 3CY3A 3R63A 5M51A 3BU6A 3QQLA 5M53A 2W1IA 4BZNA 4ERWA 2C5NA 3NGAA 2UW6A 2FH9A 1O6LA 3OUKA 1ZLTA 2XYUA 4KKEA 1BKXA 5KUPA 5CX9A 4R1YA 4DN5A 4DHFA 3FJQE 1U5RA 3E5AA 4W8EA 1OM1A 2PZ5A 1I09A 2PPQA 5CF6A 2GHGA 3VQHA 4FEQA 4U3YA 2QOKA 3R8UA 3RZFA 3ORIA 4R78A 3KA0A 4FT5A 3BU3A 1KE5A 1M52A 3NYOA 4UMQA 3PY0A 4M69A 4AZEA 4Z16A 5ANJA 2JKOA 3ORLA 4YHTA 1W7HA 2EXCX 2EXMA 2HIWA 4MQ2A 4H1JA 4FVQA 5EW3A 5KKRC 5AAGA 4ZZMA 3G33A 1QMZA 5JGDA 4ALVA 4E20A 3P7AA 1A48A 5ICPA 4X2JA 2C47A 4GKHA 2W05A 1WBNA 3JYAA 2HZNA 4WKQA 5BVWA 5EOBA 2GHLA 3O0GA 2JIIA 5HVJA 2R3KA 4ZSJA 4QP2A 4S31A 3RCDA 5AP2A 3FC1X 1QPCA 5HX8A 3Q4ZA 4I6BA 5A4QA 1UU9A 1Z9XA 3F3VA 4ACCA 3VBTA 3JPVA 4GFMA 4RZWA 2ETMA 5JH6A 4CKIA 3NCGA 4RIYA 2CLXA 3TZ9A 4BDKA 4C2WA 4IZ7A 1O6YA 3FBVA 4FBXA 4E5WA 1AQ1A 3EOCA 4YTHA 4BIBA 5AA9A 4EJ7A 5C4KA 1CM8A 3OWJA 1XH9A 4RLLA 3G9LX 3PIYA 4QMSA 3VBWA 4DEGA 3E8CA 4EOJA 4KBCA 4RLKA 4JG8A 3A4OX 5AX3A 4BGGA 4C61A 4EEVA 5I9YA 3OF0A 3HMIA 2QO7A 4S33A 4PPCA 2CDZA 3VW8A 2JKKA 3R7IA 4FZ6A 3E7VA 4AFJA 4FZFB 4F9WA 5CXHA 4U43A 3RHXA 4RC3A 5EQPA 3TDWA 1ZY5A 3A62A 5IA0A 3ZUVA 4OT6A 3Q6UA 1V0OA 5ANKA 4CZYB 1HCLA 4FV8A 1YI3A 4XP0A 4GT5A 4XS2A 1IA9A 2XK6A 2YN8A 4BIDA 1A9UA 1YVJA 3EB0A 3MVLA 4MD7E 4M14A 4Q5HA 5A54A 2ITVA 3CGOA 2YM3A 5DN3A 4D55A 4RX8A 1YHVA 4ZP5A 2YM8A 3CEKA 3R30A 4YNOA 5C27A 4NFMA 3O71A 2BVAA 4QPSA 4F64A 4RX7A 2GNFA 3WE8A 2GNIA 4S32A 2FSMX 5E9EA 5KZIA 5AV4A 4E7WA 3MV5A 4R5SA 3LAUA 5EK7A 2OZAB 4QQJA 3G15A 2R9SA 4JI9A 5A3XA 3A7HA 3O17A 3RKBA 4I4EA 3RAIA 4F08A 2YM5A 4FT7A 3CPCA 2CGVA 1FGIA 2ZYBA 1RQQA 2OIDA 3LE6A 4U42A 3F7WA 3GQLA 3R9RA 3ZFXA 2ACXA 4I20A 2WMQA 4R8QA 4AA0A 4FTUA 2J0JA 5M4UA 2C3IB 4DITA 5TF9A 2OK1A 1PHKA 3JY0A 2H8HA 2UZWE 1MRYA 3DY7A 5L2WA 2XS0A 3T9TA 2Y6MA 3SDJA 3HMPA 2G2IA 2Y4PA 4F7SA 5EKNA 5HBJA 4FSRA 3P0MA 1I44A 2VTRA 2DUVA 1IA8A 1YXXA 4QMNA 3KN5A 4DTBA 1BMKA 4Z3VA 1YXSA 5IQGA 1RJBA 1YXUA 3QA8A 2QU6A 5FWKK 3PJCA 4O27B 5JGBA 3AC1A 3IOKA 3R73A 4XHKB 4QMQA 2HWPA 2QO2A 3D83A 5K0XA 1NT2A 3R2YA 4O7NA 4RFYA 3UIMA 4RWKA 3QCSA 5CEPA 2ITXA 4BYIA 1JSUA 4FIHA 5ACKA 3PPKA 5IUIA 5HG7A 3H30A 4ZK5A 5KNJA 4WUAA 1KE8A 3ELJA 5CNNA 4L9IA 3WOWA 3LLTA 4QP1A 3O8PA 4WRSA 3LCKA 4ANMA 1H1SA 1IEPA 3I60A 4CVAA 5IF1A 3RK7A 2PTKA 5DI1A 3HDNA 1LP4A 3PJ3A 4X21A 5FXQA 5EM5A 4PY1A 1W8CA 2PMNX 3LZBA 3RK9A 4O0UA 3MVHA 3ET7A 4YO6A 5CF5A 2VTAA 1Q8TA 5LVLA 5L2SA 4FEUA 1WVWA 3CTHA 1ZRZA 4M84A 2P2HA 4II5A 3BYOA 1H08A 2X7OA 4KBAA 5H9BA 2FSLX 2OJIA 5HE0A 4F70A 4IX4A 3AC8A 3AMBA 1BI8A 2Y9QA 5HVYA 4ZJJA 3UODA 5AR7A 4KIKB 5CEIA 3PYYA 4HYHA 3IPHA 2PYWA 4FC0A 3ETAA 1OKYA 4U44A 1W0XC 4O96A 4P4CA 2I7QA 4O7VA 4FKOA 5JT2A 1LPUA 5HTIA 4BCNA 3QTUA 2YDIA 3LCSA 3C51A 3QLFA 5K0KA 4ZEGA 3LFSA 4GCJA 4MWHA 2WELA 3EL8A 2R0IA 3ORTA 4FKJA 4NK9A 5EM8A 1P14A 3WARA 3QAME 4FVRA 5BMMA 4BN1A 4UEUA 2Q83A 3LXKA 4ANQA 4Y5HA 3ZO2A 2BZHB 3BLQA 4FV0A 5EI6A 3TWJA 3E88A 3F69A 1WCCA 3KY2A 3IOPA 4YLKA 4YNEA 5CTPA 5AP7A 3VS3A 3FI2A 2O2UA 3ZRMA 3R7OA 1F0QA 3HDMA 3LVPA 3U87A 4FT3A 1UWJA 5DHJA 3A8XA 5J5SA 4U0IA 3FQEA 2R3GA 3LFNA 4YLLA 5CAOA 5CF8A 4HNIA 1ND4A 3VHEA 3DBEA 1XH7A 5DRBA 3DK3A 3C4FA 3Q52A 3OW4A 1ZZLA 3OZ6A 4USDA 1U54A 3IG7A 3UVRA 3IONA 3VRYA 3V5WA 4MTAA 3KKVA 2YLEA 4FV4A 4ZTSA 2ZV2A 3G6HA 4IAYA 4JX7A 1H07A 4EOQA 3D5XA 2AC5A 3BHVA 4BCFA 5A9UA 3QUPA 2IZTA 3HX4A 4ZTQA 4G34A 2Z7QA 3H9RA 4GT4A 3UJGA 4CRLA 3FSKA 3UO5A 3BHUA 3UOKA 2HZ0A 4EK5A 2ZDTA 2W7XA 3IO7A 4QMLA 3DAEA 4OTRA 1R0EA 4DYMA 4KRDA 3GNIB 5JQ8A 5AUYA 5CEQA 2XF0A 4IX3A 1JBPE 4PDOA 2RFEA 3OEFX 1WAKA 2VV9A 5AUXA 5TOZA 1WBTA 4L00A 2JITA 5M07A 3DKOA 3A4PA 4BVUA 3DFCB 5IMEA 4R77A 3WZDA 1ERKA 4FA2A 4C4IA 2ONLC 3R21A 1GIHA 4FKQA 5IQFA 1GZ8A 3F3ZA 5M08A 3GXLA 1W84A 4B9DA 4E6QA 4MNEA 5AIRA 2WTIA 3TI1A 3VAPA 3BBTB 4A9SA 3WF8A 2XK9A 3DBQA 4TNDA 2ESMA 3GC8A 4WNPA 2C5VA 4FSUA 3Q2MA 4X2KA 3W1FA 3EJ1A 3IGOA 5M44A 4O0TA 2WU6A 4IH8A 1ZMWA 4FTOA 2VTMA 1XBCA 5CWZA 5KMJA 3NAXA 4BY9E 4GG5A 2WNTA 4MHAA 4CTBA 4X2GA 2J6MA 1YWRA 1DI9A 1REJA 3R28A 2WU7A 4MKCA 4XV9A 4FTMA 4HYSA 5AWMA 2JDOA 2W1ZA 1V0BA 3BKBA 3DJ5A 1IAHA 3IKAA 4O0VA 4GUBA 1XH5A 5E8TA 1U59A 3Q2JA 4NKSA 4BBMA 5CEKA 2BKKA 5CENA 4AZSA 4CFVA 4I6FA 1PMEA 3FV8A 3ZUUA 3CBLA 3C4XA 2UZLA 2DQ7X 4AGWA 5M4FA 2GNGA 2PVLA 4R7IA 5KBRA 5IPJA 3D7TA 3FMDA 4CFNA 4G31A 1UWHA 4Y83A 4GU9A 4NM0A 3R8LA 2C6TA 2PVRA 2YWVA 2UZNA 2ZOQA 4FKUA 1SVHA 5LMBA 1JOWB 2BDFA 5IQAA 1MRVA 1WZYA 3MSSA 4NTTA 4FMQA 4L8MA 4CMUA 4YO4A 5HO8A 1GIIA 4KRCA 2C6DA 1OVEA 4BWKA 3AC3A 5EDQA 4ENXA 2PVFA 3FI4A 3R01A 5KMLA 2IW9A 4AZFA 3TXOA 4RIXA 4FSNA 3Q6WA 3DPKA 4Z7GA 5D10A 2OW3A 2R0UA 2YCSA 3PLAE 4WBBB 3QRJA 2UW8A 5EM6A 3TKIA 4BDIA 4HVGA 4L7SA 3M11A 3PZHA 3BX5A 4BCGA 2CKPA 4I3ZA 2RGPA 5C9CA 2GNJA 3C0GA 5EKOA 3U4WA 3LFQA 2JD5A 5HG9A 4BWPA 1UU8A 3ITZA 3ZHPC 2OXYA 2PVJA 3R22A 3RM6A 3DB8A 3E93A 3KMUA 2XA4A 4IAKA 4PMMA 4EK4A 2PZRA 4H39A 4MNFA 3EHAA 4DLIA 4TL0A 5L2TA 4B7TA 3R02A 4AAAA 4MBIA 3SA0A 4RJ8A 4O7LA 2EVAA 1FGKA 4DEDA 2NO3A 4K9YA 4KWPA 1VR2A 2X8DA 4HCUA 3RGFA 4C8BA 5I3RA 3FHIA 2NPQA 2BRNA 4DH3A 2RG5A 3DZOA 2QG7A 3BYUA 4J1RA 2XIYA 3AMYA 4E8AA 2RIOA 5EI8A 2V62A 4IEBA 4CFMA 2XBJA 1J7UA 2VTIA 3F5GA 4FTTA 4GT3A 4UMUA 4E4NA 4FGRA 3O23A 3ZLSA 2GS7A 2BHHA 4EZ5A 3FLSA 4O84A 1Q3DA 1KV1A 2F7EE 5F1ZA 3G5DA 2EB2A 3BGPA 4GMYA 4LV8A 4RVKA 4YBKA 3EIDA 5J9ZA 3ORPA 3Q5IA 3WIKA 4BL1A 5KX8A 1MP8A 5GJFA 2HK5A 5FLFA 3PP0A 2FYSA 4FGBA 2VWWA 4GIIA 1P5EA 4MF1A 4U7ZA 3LW0A 2A2AA 2PUPA 1TQPA 4LL0A 4AOTA 1GZNA 4CMTA 3DK6A 1VYZA 3ROCA 3ZRLA 4DFUA 2ZDUA 2YCFA 3EQRA 3DNEA 2WFYA 5CVFA 1LEZA 3T9IA 3VULA 3ZXZA 4BHZA 3RPYA 4JIKA 3PWYA 4FZ7A 5HIDA 5JSMA 2F57A 4O7YA 4PTEA 2JC6A 2DYLA 4DGOA 3BGZA 1STCE 2BROA 2Y7JA 4QNAA 3DJ6A 4XOZA 1YWVA 3GC7A 1NXKA 4FG9A 2JDSA 5AP4A 5CQUA 5I3OA 2R4BA 4PTCA 4IBMA 3BHTA 4FTLA 4HGTA 4MX9A 4MXOA 5KBQA 3OY3A 3KGAA 2BHEA 4YTIA 4KAOA 2Z7RA 3UYTA 3KF4A 3EZVA 2UV2A 5LVMA 3GVUA 5ANEA 2WO6A 2IZUA 5C4LA 2XCHA 2UW0A 4I4FA 5HHWA 3F2RA 5FXRA 3PG3A 4ZSLA 5K5XA 4WG4A 3HVCA 2IWIA 2F4JA 3TJDA 5AV0A 1PXLA 5JFVA 4MXXA 4XMOA 3ZBXA 2WTVA 1J7LA 5F95A 5BX0A 4G17A 5B2KA 3BLRA 3FLWA 4KIOA 5K4JA 1OBGA 4FL3A 1HOWA 1YOJA 2PY3A 3GCVA 5LJJA 3EYHA 4EZ7A 2OGVA 3PA3A 3QKKA 3QCQA 4IIRA 3D4QA 4OLIA 4ZZOA 4GRBA 4GUEA 5IZFA 3NX8A 5KMKA 4LQMA 2BAJA 4DFNA 1ZYSA 4FV3A 4V04A 3R8ZA 5F20A 4F9BA 4PP9A 5J7BA 1P4OA 2BPMA 3P1AA 4PL5A 4PQNA 1YQJA 3LIJA 5AIKA 1NVSA 1OUKA 2G1TA 3OBGA 2WMBA 3OROA 2R3IA 3FKOA 3QZHA 5EFQA 5I0BA 5IH4A 4OTGA 3PXYA 4QTBA 3CC6A 3R1SA 3GUBA 3FHRA 1A06A 4JDJA 4W4WA 3DXPA 5HIBA 5C8MA 4D2WA 4HCVA 2CMWA 5HI2A 5EYCA 3G0EA 2JBOA 5B7VA 4DH8A 5JFSA 3O50A 1SNUA 2RKUA 4RG0A 3VRZA 4CLJA 1QPEA 1XWSA 2CNVA 3L9LA 4FTNA 5FTGA 4EHEA 1WBVA 4HNFA 4XBRA 3UPZA 5DWRA 4CYJA 3LJ0A 5CU4A 5A6NA 3EFJA 4LOOA 3DKGA 4A9UA 5M4IA 4BF2A 5FBNC 4I24A 3SG8A 1CSNA 2J0LA 3FZPA 3QGWA 4BGQA 5DBXA 5IQEA 5ANOA 1Q5KA 4E26A 5JEBA 3RWQA 1GIJA 4TRLA 3W2QA 4UALA 4E3CA 4ZSAA 5AEPA 3DT1A 3ZC5A 1W82A 2OO8X 5BYZA 2RFDA 3MJ2A 5M56A 5EDRA 4HZSA 3SQQA 2XJ2A 4FV7A 3MTFA 4Q5EA 3GFEA 3HV5A 4TYJA 3NUNA 3SC1A 1M7NA 4K33A 5EW9A 3FPQA 5BUIA 3AGLA 2OJFE 2XNNA 2ITWA 5HG8A 3WF5A 2GU8A 2QO9A 5ETAA 3F6XA 5TT7A 5CU2A 1H1QA 3L8XA 2EU9A 1M7QA 3DLSA 2CSNA 4H3QA 4C3RA 5AP3A 2GNLA 2X7FA 5GNKA 2X2LA 2XYNA 2ITOA 1YOLA 2X9EA 3BHHA 2R3RA 5J95A 3R8VA 4JRVA 3W10A 3U6IA 2PMOX 4AZTA 4K6ZA 2J0KA 3EN5A 3KFAA 3P86A 4M13A 1PYXA 4YP8A 3U9NA 3UOLA 3ZONA 2PUIA 2WOUA 2X2KA 3O96A 4FSYA 4WNOA 2WQNA 4RC4A 4RFMA 5CVGA 3RCJA 3VBYA 3D94A 3VS0A 4F9CA 4TWNA 4DEBA 5DEWA 5AUUA 1OBDA 4DT9A 5E4HA 4JBPA 5KHWA 1PXMA 3MFUA 4L46A 5KMOA 3OY1A 4JBVA 3Q4CA 4RZVA 3PJ2A 3E8EA 3GCQA 4QYFA 2RL5A 2UUEA 3PPZA 3U4UA 4FSZA 5IH6A 4RSSA 4ZLOA 5BQ0A 2UZBA 4PL4A 2LGCA 3RALA 2VTPA 2WMVA 4DT8A 4RIWB 3F9NA 3OP5A 3V5JA 2WQOA 4EUUA 2XNMA 4O1OA 2UZEA 4XG3A 2IVSA 4NYEA 2Y4IB 5CT7A 3ATTA 4AG8A 1SYKA 2OI4X 4Y46A 2VZ6A 4EORA 4H1MA 2WIHA 4IJ9A 3QWJA 2R2PA 4HOKA 3W2RA 5CSVA 2R3LA 3VJNA 2KTYA 4RWJA 1H8FA 3PP1A 4KKHA 2V22A 4C3PA 4ZAUA 5GIOE 1SVGA 4N6ZA 4O81A 2ETRA 2OF2A 4ZMEA 2VO6A 4BIEA 2O63A 3BCEA 3TG1A 2YLFA 3REPA 3KRWA 5ANDA 2YIYA 4JL9A 2WEVA 5FM2A 5HG5A 4DG2E 3G0FA 4QMPA 3MFTA 4MVFA 3UIXA 3UG2A 3QALE 5JFWA 1XH8A 3PSCA 2WD1A 5TO8A 3R1YA 1OITA 4XRJA 4Z9LA 5CU6A 3TKUA 5IQCA 1OMWA 2P33A 4Y5QA 3RAHA 3VS7A 1VZOA 2H96A 4OTFA 5CZHA 3F5XA 3CY2A 3TNHA 3ZFYA 3Q60A 4H05A 3N51A 4I0RA 4AT3A 3MY1A 2W0JA 4QT1A 5HO7A 3MW1A 2ITYA 5E90A 5ETCA 5CAQA 2GPHA 3ERKA 3KRRA 4FSWA 4CFFA 4F9YA 1GNGA 1UKIA 1ZYJA 2VTNA 3CXWA 4YJQA 2B9FA 3GU8A 2QOCA 2ZM3A 3PIZA 4FKGA 4G3GA 3QKMA 2QODA 4IDTA 4BKZA 4KIQA 2JFLA 2R3HA 2B9IA 2X4FA 4ZMFA 3QTWA 3F3WA 1FMOE 3FLZA 4XV3A 5AUWA 5A46A 5LARA 4QMVA 3VUMA 2NRUA 4C02A 2G9XA 3R2BA 4B99A 1VEBA 3THBA 3UQGA 2QCSA 3RHKA 2QVSE 1R1WA 4YJOA 4D28A 1PXPA 2CLQA 1M17A 3I6WA 3ORKA 1KSWA 4KA3A 3UPXA 2J5EA 4BDGA 4YC3A 2AC3A 3QTQA 3NVMB 4FKSA 5C01A 4BB4A 4BCMA 3IDPA 1Y8YA 3EH9A 4EWHA 4FNYA 2X6DA 4NW5A 3D9VA 1J91A 3FMJA 1S9IA 3MY5A 1KOAA 1JKKA 5HKMA 3DQWA 1H01A 3GT8A 3PXQA 5BVKA 4AGDA 2Z7LA 4GEOA 2F7ZE 2JKQA 3WZJA 4LYNA 4EOOA 3OOMA 1FBNA 4FTAA 2WMUA 4FKIA 4E1ZA 5IA1A 3PG1A 3R9HA 4L42A 4GVJA 4YLJA 2FSTX 3LOKA 2DWBA 5DLSA 4CZUA 2PZIA 3EQFA 4M15A 2QONA 3VW6A 4M0ZA 5GIPE 5FUTA 1M14A 1KE6A 2ONLA 3WF9A 2HELA 3D0EA 4USFA 4G1WA 4G5JA 1DS5A 3LFEA 3V3VA 1S9JA 3SXSA 3HYHA 3KMWA 4WG3A 1K2PA 3SHEA 2F2CB 2WOTA 4X3FB 4AACA 5JGAA 2DS1A 4KUJA 3NW6A 4G3EA 2WTKC 3FMNA 3KF7A 3HMNA 4EK6A 3L9PA 2VWBA 2OFUA 2QLUA 3PRIA 3E8DA 2W9ZB 2XK8A 3G6GA 4EHVA 5EQYA 4J52A 5J9LA 3B2WA 5DNRA 1Y6BA 3NIZA 3CJFA 3KULB 3QX2A 3ALNA 4D2RA 4DH7A 2C6EA 3FMLA 2E9VA 2OJJA 3KCFA 3QL8A 2VRXA 4IMYA 4RX9A 2GQRA 3JVSA 4NIFB 3SOAA 3PPJA 3R00A 2GS6A 2YAKA 3NZ0A 2A19B 3CD8A 5M55A 3BLHA 4UMRA 2XH5A 1YI4A 4WSQA 3V8SA 3D2IA 4KSQA 4M7IA 5EHLA 3Q32A 1OUYA 3DA6A 4NW6A 2ITNA 2IVTA 2ZVAA 2E2BA 3QTRA 4GSBA 5FRIA 3ZEWA 4K11A 3FYKX 3BE2A 2QNJA 2GSFA 3LFBA 2OBJA 3UDBA 2XEZA 4AT4A 4FF8A 1OPLA 5E8XA 4BBEA 4ENYA 2FVDA 1MQBA 1MRUA 2VWXA 2W99B 4M97A 2AYPA 3O8UA 2WTJA 3H3CA 4NJDA 5T3QA 4FT9A 3UGCA 5CAUA 5DMZA 2Q0BA 3FMKA 3BEGA 2F49A 3F7ZA 3QRTA 3BWFA 4EOIA 5FQDC 3T8OA 3I79A 3KEXA 5AP0A 2H34A 2ITQA 4OBPA 4AGUA 3DB6A 4AXAA 4KS7A 3TTIA 3EN7A 1GY3A 2E9UA 4IE9A 3V8WA 2YJSA 3PVGA 2CGUA 3G2FA 4KD1A 5EOLA 3CQWA 3COKA 4G2FA 4LV5A 3GCUA 4I6QA 3UOHA 3LCDA 2WZJA 3UNZA 4D2VA 4D9TA 1BLXA 5BNJA 3TNIA 3L8PA 4M0YA 3W2PA 2XRWA 1BUHA 3FZTA 5BUJA 5HNIX 3OXZA 5AV3A 1FQ1B 5LWNA 4KKGA 4ZJVA 4APPA 3WF6A 5T68A 2XMYA 1ZMVA 4FZAB 4BCKA 5A14A 2C3LA 4GFGA 4QP9A 3AXWA 3FWQA 5CEMA 4ZZNA 2WMRA 3D5UA 5ANIA 4MYGA 4AA5A 1NA7A 2F7XE 4JOAA 1OI9A 4BCOA 1J3HA 5JRQA 4LMNA 3QQHA 3B2TA 5E8WA 3RZBA 4DEIA 1CDKA 3EL7A 2W4OA 3FY2A 4TN6A 4WHZA 3ZMMA 3P9JA 2C3KA 2CCIA 5K5NA 3NR9A 4LUEA 3O7LB 4CFWA 3IGGA 3NUPA 4BHNA 5I9WA 2QU5A 3LQ5A 2CPKE 2VU3A 3PE2A 4LMUA 4RQKA 4D1SA 4ACGA 5IA4A 2OZOA 3S1HA 3AGMA 5LWMA 4D0WA 3SRVA 4XCUA 3O7LD 4DFBA 2ERKA 2PUUA 5AV1A 4ASDA 3PDTA 1YXVA 4W9WA 2P2IA 4EQMA 5HE1A 2R7IA 2R3MA 4GW8A 1MUOA 5IISA 2GQGA 3RPSA 5HD4A 1Q8ZA 4FIFA 3KXGA 1B38A 4ITHA 5J7HA 3FEGA 2QOHA 3TM0A 3NUSA 4IZAA 5IDNA 1XQZA 4KBKA 3S0OA 3HV6A 2PE2A 2F2UA 1OL5A 3EKKA 1FPUA 3R7GA 3CR0A 2X4ZA 2P0CA 3OCTA 4JDKA 4DBNA 4A06A 3P08A 5DT3A 3ZCLA 3PY3A 5IMXA 4O7WA 2XIRA 2B52A 4QTAA 2WEIA 4WG5A 5AR3A 2HOGA 1G3NA 4EWQA 1BI7A 4IW0A 2EXEA 4IAIA 4IACA 4TY1A 4A7CA 3QUDA 4WT6A 2I1MA 4GK4A 1W98A 5AJQA 4FKVA 2VWUA 3DTCA 4QYHA 5F94A 3RPOA 1PKDA 3JXWA 4AOIA 3UC4A 5GJGA 3ZEPA 1PYEA 4I5MA 3V04A 4TXCA 5CNOA 3ZU7A 5IEYA 1WVYA 3Q53A 5LMKC 2BILB 1O9UA 4LG4A 3Q4UA 3QQUA 3NEWA 1LEWA 5HLPA 1YOMA 4PDYA 2OSCA 5E91A 3A7IA 3E7OA 3MPAA 4X2FA 3UMWA 3ZYAA 5BVDA 3HP5A 3KB7A 1PMVA 2PMIA 4ERKA 5FEDA 5HE2A 2VO7A 4IXPA 4CLIA 3DLZA 3EWHA 1JKSA 3ZSIA 1Q4LA 4ZJIA 1BX6A 4C3FA 4OW8A 3TJCA 1URCA 4C4JA 3MA3A 1Q61A 4EH2A 2W5AA 2ZAZA 3FLYA 4YURA 2HYYA 4YZCA 4BGHA 2OWBA 2E9PA 5LQFA 3IDBA 2YIWA 5BMSA 4OT5A 3VUDA 3W18A 4NM7A 3SGCA 1IG1A 2PVMA 1ZXEA 3RI1A 2G15A 1NY3A 5HO6A 3HAVA 4XG2A 4XBUA 3VF8A 3PA4A 1K3AA 3LCOA 2R64A 4HVHA 4Y8DA 3R8PA 4IB1A 4D58A 2QQ7A 2VTJA 4C58A 3NS9A 1PRYA 3IDCA 4R6VA 2GQSA 2LAVA 3I7BA 1J1BA 3CKWA 2VAGA 3R9OA 1LR4A 1X8BA 2A1AB 2QOFA 4FKTA 4E6CA 2OXDA 3UMXA 2BRHA 4G6OA 3HEGA 4ZLYA 4BTMA 3TNPC 4RWIA 3MDYA 3M2WA 3NCZA 3NUXA 2CCHA 4UV0A 3CD3A 1GZKA 5BYYA 5JQ5A 5IQHA 2OH0E 3LFFA 4I6HA 4R3RA 5ETFA 5IKWA 3VBQA 4PMPA 5KHXA 4ZXTA 4IC7A 5FP5A 4BDBA 2XNGA 2R7BA 3EYGA 5CU3A 4YSJA 3AD6A 2ZB0A 2X9FA 4QMWA 3MPTA 5FDPA 4XG6A 3OCBA 3ZC6A 1L3RE 4QRCA 3V8TA 1YWNA 2GCDA 3NNUA 4L7FA 4BI2A 1JNKA 4WSYA 5HESA 1CKJA 4DLJA 4OBQA 3LHJA 3OXIA 3KVWA 3QXPA 4C0TA 1QPJA 4D4VA 3GOPA 3TZMA 1ZOHA 3OG7A 4ZTHA 5ACBC 2OZAA 5AR4A 5HORA 4FNXA 2VX0A 2WTWA 3BHYA 4EUTA 2B0QA 4GFOA 1WBWA 3WIGA 4I5CA 2HCKA 2Y0AA 3I1AA 5CAPA 3FZRA 4G3CA 3S4QA 5H8BA 2UVXA 4IJPA 4AA4A 4FTIA 2OF4A 1OIYA 3QWKA 3MESA 2PVKA 4CYIA 4JAIA 5EYDA 4F65A 3K3IA 2KULA 2X6EA 4DFYA 3VUTA 4LI5A 5JRSA 2VNYA 3CLYA 1ZYLA 4LOPA 5KKRB 4Y72A 2W1HA 3COHA 4E93A 4EBWA 2XK3A 3PXFA 4JVGA 4MXYA 2XIZA 3HNGA 4WNKA 5AM7A 2NNWB 5CYIA 4U79A 4CFUA 5IA2A 1R0PA 2ZMDA 2XKCA 3KQ7A 4CV9A 4KIPA 1NVRA 1M2QA 5KE0A 4WD5A 5J1WA 5EHYA 2EUFB 4RJ3A 4NWMA 5E8SA 1BL6A 4CKJA 3U51A 5A6OA 4QOXA 4YC6A 4R7HA 3EZRA 3QX4A 2A0CX 4X6QC 5E8UA 3CS9A 4FKRA 4FE2A 4XX9A 3OOGA 3TUDA 5EG3A 3PJ1A 1XHAA 3OMVA 3HV7A 3E63A 5BPYA 4YTFA 1YXTA 3OD6X 2WQMA 4MXZA 1H24A
chains in the Genus database with same CATH superfamily
4V01A 2B55A 5EW8A 3HUBA 4QP7A 3FI8A 5I4NA 4JX3A 5K3YA 3NNVA 5DT4A 1Q8WA 4E6AA 4AXDA 4J53A 3GENA 3NSZA 4MBLA 1IR3A 5FXSA 4AW1A 4ONAA 1H4LA 4AP7A 3QTXA 5CSPA 1U46A 2FSOX 3GCSA 3IW4A 2JDVA 3I6UA 1YRPA 4GYGA 4PF4A 4C2VA 2Z7SA 3V51A 5AUTA 1OGYA 4CKRA 4QMYA 3MH2A 4PNIA 4TKSA 4NT4A 4U9AA 3ZBFA 2UVZA 2C3JA 4HGLA 4WNMA 2I0EA 3NPCA 4FV6A 4J97A 5L6WL 2J90A 1Q3WA 3DGKA 3UVQA 4FUYA 3FPMA 4KIKA 3DXNA 1OKZA 4TWPA 4FEXA 3WZKA 3OT3A 3CQUA 4RPVA 1GAGA 3ZLYA 1XBAA 4EKLA 3TEIA 2HZIA 5CU0A 3C4ZA 1WFCA 4YC8A 3ZDUA 4BCHA 1UV5A 3UIUA 3PFYA 4OAUC 3QZIA 3C4CA 4FTKA 1OB3A 4AW5A 4D4RA 3MH1A 1OKVA 5ITAA 4S34A 3T3VA 5J5TA 2CKOA 3BV2A 4QMMA 4YJSA 2XB7A 3QD3A 3UO6A 4AFEA 3QXOA 4I41A 2JIVA 5FGKA 4DGMA 4TYHB 4BDCA 3HP2A 5HBEA 1O6KA 3U6JA 2O3PA 3C4WA 5J79A 5CT0A 1ST0A 4CNHA 3RJCA 3QQJA 3LXLA 4E6DA 4U5JA 2Y8OA 2IPXA 4QDVA 4CXAA 4O0RA 3TCPA 3EKNA 3VNTA 2VWIA 4O86A 2QKWB 5L3AA 5AR8A 3ZH8A 3TUCA 1H27A 4YZDA 1ZOGA 4TT7A 4IB0A 4YSMA 3NWWA 5FDXA 4GV1A 4RBLA 2VO3A 4YHFA 4DG3E 4WIHA 3AT3A 3NLBA 3MVJA 1CKIA 4AU8A 4O91A 5L2QA 4X3JA 2YIXA 2BUJA 4EH8A 2B54A 3VS4A 2VN9A 4C33A 3JY9A 2QOLA 1PXIA 3DAJA 4J8NA 2C6OA 2XJ1A 4FV9A 5HD7A 4JR7A 3SKCA 5HNGA 1FVVA 2R5TA 5EH0A 2O8YA 2OFVA 3B8QA 2QOIA 4E5AX 5KMIA 2GNHA 3PZEA 4FSMA 3D5VA 5HLWA 4UZHA 1Q24A 2I6LA 2YHVA 4FV5A 4KSPA 4XLVA 3I81A 3VBXA 5IQDA 1OL1A 2J51A 1PW2A 3F61A 5DRDA 3VUKA 1KE7A 3W32A 3OWPA 3I7CA 1WBSA 4UYNA 2YIQA 3GI3A 4RRVA 3QF9A 2X2MA 4AW2A 4EKKA 5A4TA 3BLAA 3PVUA 4AT5A 2EB3A 4M67A 5HCXA 4DTKA 3CQEA 1EH4A 2BTRA 5FD2A 4ITJA 5CZIA 2W1EA 5D7AA 3LQ3A 5AR5A 5HBHA 4WO5A 1E1VA 4D9UA 3PWDA 5IEVA 3O8TA 3FDNA 2ZV8A 4I22A 3UTOA 3HRBA 3ULIA 2QLQA 2PHKA 1H0WA 5AP1A 2OIBA 3E92A 3IW7A 4FTJA 4BZDA 2QURA 4GS6A 4NSTA 4DF3A 4JBQA 1JSTA 5FTOA 2X8EA 3SLSA 5C1QB 2V5QA 4YZBA 2ETKA 4CCBA 2XBAA 3QD0A 1OZ1A 2WGJA 4PRJA 5JMSA 2ZM4A 4LL5A 3VN9A 3DFAA 2IZRA 3GFWA 1T46A 4NEUA 1SM2A 5HZNA 1H26A 4Z55A 1HCKA 4GH2A 1GJOA 4G6NA 4USEA 2YWPA 3FXZA 3SD0A 4GJ3A 5AV2A 4FK6A 5E1SA 3WILA 1XKKA 5LCJA 3W0QA 4FEWA 3DV3A 4N6YA 3TN8A 4DE4A 2F9GA 4BJJA 2O65A 1ZARA 2IW8A 3DBCA 3FMEA 4EJNA 3FZOA 3QRIA 3TNWA 3F2NA 2A27A 4QP4A 3VWAA 3Q3BA 4O7ZA 3BIZA 3D14A 3W16A 1PXOA 2G2FA 4IWQA 5ANGA 4B4LA 5AUVA 3ZO1A 2BIYA 2YAAA 3PSDA 1TVOA 4EI4A 2CNUA 1JLUE 3NAYA 4C57A 3C50A 3ACJA 3IW6A 3NYXA 4RIOA 3SAYA 1E9HA 3WBLA 3ZM9A 3BEAA 4FZDB 4MF0A 1H28A 3DTWA 4HGEA 4AUAA 3CSVA 2XNEA 1FVRA 4MEDA 2UW4A 3ZSGA 4LGHA 4C36A 4EYMA 4OTQA 3WF7A 4C35A 1U5QA 3QD2B 2QR8A 3BE9A 4OUCA 4NUSA 3M1SA 2UZDA 4NH1A 4AQKA 5AX9A 4DEEA 4QYEA 3SX9A 1H25A 4FEVA 4D0XA 3H0YA 2XP2A 4DA5A 4K8AA 3QD4A 3CTQA 1CMKE 3KXXA 5DG5A 3QCYA 5HQ0A 3N4UA 2WTCA 4I93A 4M69B 3TIZA 2YISA 5D9HA 3UBDA 3MFRA 4BR3A 3ZUTA 2CN8A 5J87A 3S2PA 4QQTA 3U55A 2ZV7A 3KXMA 4UN0C 3KK8A 1OIUA 2HY0A 4I94A 4ITIA 5DA3A 4XV2A 4DH1A 5AP5A 4PP7A 4ZTNA 3NNWA 4R3PA 4BTFA 3TV6A 2XKFA 4JBOA 2XJ0A 3OWLA 3VF9A 5I9UA 4ANNA 3PFQA 4L52A 2YFXA 3CIKA 5M09A 3MFSA 2WAJA 3C9WA 3LLAA 4ASZA 4HPTE 3QA0A 1V0PA 4GU6A 4QYYA 4S2ZA 4QTDA 3IECA 2OU7A 3H10A 4QPMA 2FUMA 3MGYA 1XH4A 2QHNA 4O0WA 4AZWA 3IW5A 4F1MA 5HOAA 4P7EA 2VTHA 2YDKA 2WMSA 4UYAA 3SG9A 3NNXA 4ID7A 4RIYB 2JLDA 3F5PA 4YJUA 4W9XA 3TUBA 3LFDA 3KRLA 3OEZA 4U45A 4EH6A 1G8SA 4I5HA 4XOYA 5KCVA 4ZSGA 4FNWA 4A4LA 4R3CA 4ASXA 3A7GA 5IU2A 3UQFA 4CG9A 4EK8A 5A4CA 3WE4A 1FMKA 2FO0A 3EQPA 2XNBA 3R1NA 3A61A 4IQ6A 4A07A 3OW3A 4IANA 4O1PA 4F1OA 4IVAA 2XALA 4UZDA 4F1TA 1AGWA 2PUNA 2ZMCA 1NW1A 5CSXA 2QC6A 4ALWA 3MB7A 1QPDA 3LCTA 4D2PA 4EBVA 4IHPA 4ZY4A 3PY1A 3V5LA 3L9MA 3UOJA 4WRGA 2PULA 4U3ZA 4ACHA 3TACA 5M57A 4DCEA 3QCXA 3GU4A 4UBAA 2OXXA 1OKWA 2J0MB 3MA6A 4BCJA 4JIAA 1QCFA 3CKXA 3F66A 1UU3A 3U6HA 4TYIA 3HLLA 4JRNA 5AP6A 3UQCA 5A4EA 4H3PA 3GOKA 3R8MA 5HCZA 3H9FA 1PXKA 3HRCA 4AW0A 4D5KA 4EH3A 5IA3A 2XM9A 4O7RA 4JQ7A 4G3DA 4BDAA 5CEOA 2BZJA 2W9FB 3MH3A 3W8LA 3VS6A 5CASA 4QP6A 3FXWA 3RMFA 3PRFA 3DZQA 2C6KA 3AC2A 3DK7A 3POOA 4BI0A 4BC6A 2XNPA 1Y6AA 1Q8YA 2ITUA 2RFSA 4LRKA 4WA9A 5LMKA 4H58A 4P2KA 3SOCA 4FKPA 4C4GA 4JQ8A 1TQMA 3QQGA 2ERZE 3MI9A 3NUAA 4P90A 4O38A 3OFMA 3AG9A 3NYVA 2H9VA 3F88A 2B4SB 3RPVA 3D5WA 3DJ7A 3T3UA 3E8NA 3L8SA 2J4ZA 5I5ZA 5E8VA 3MH0A 4EK3A 3NYNA 4PV0A 2PZPA 4FKWA 3PVBA 3L9NA 4OTDA 4QD6A 4FIEA 4IC8A 2ITZA 1DM2A 2UZOA 4G6LA 3PVWA 4NU1A 3AMAA 4IVDA 4O2PA 3QKLA 2BAQA 3V5QA 3WZEA 2YERA 4QMOA 1VLRA 2REIA 4JT3A 4EYJA 1PJKA 3IQ7A 4FODA 4MAOA 2Z60A 2ZV9A 4HZRA 4ACDA 1MQ4A 3K3JA 4JR3A 4YJRA 1JPAA 3A60A 4JDIA 3I4BA 2E9NA 3RM7A 4EHZA 3UDTA 1Z57A 3I0OA 4EOPA 3S95A 4MXCA 4MXAA 4AE9A 1F3MC 1SMHA 3LJ1A 3OWKA 5L8JA 3BYSA 4C4EA 4D4YA 1R78A 4EH7A 4ZY5A 4M66A 4IZ5A 3CP9A 4MD8E 3FE3A 3L1SA 3QC4A 3QHRA 3QQFA 3CJGA 2PE0A 3H9OA 4X7QA 4IWPA 5DIAA 5BVEA 2WMXA 3OVVA 2OG8A 4RWLA 3EQIA 5K4IA 1XR1A 5BUEA 1W83A 5BVNA 3EN6A 4EOSA 5LMAA 4MH7A 5D11A 2QI8A 5KZ0A 1OPKA 3BRBA 2WQBA 2BAKA 2YIRA 2FGIA 4IX6A 4GG7A 3EFKA 3VC4A 4CGAA 4JMQA 3IW8A 4ANSA 4FICA 4BTKA 3BPRA 4I0TA 3TT0A 1ZZ2A 2BDJA 5KMMA 4R7BA 3OC1A 3P23A 3OTUA 4G9CA 2B7AA 4FKLA 4F09A 3OS3A 4DFZE 5E92A 3DQXA 2H6DA 2VD5A 3LXNA 1VYWA 4V05A 4E4XA 5EYKA 4ZS4A 4JG6A 4QP8A 4BTJA 1BYGA 4BCPA 2VTSA 4MWIA 1KUTA 5EQEA 2W4KA 3IK3A 4XG4A 4BFMA 2HZ4A 5JZJA 5G1XA 1OIRA 1Q99A 4L3JA 2VWVA 3QYWA 2BZKB 3K54A 3FSFA 3Q96A 4ZTRA 4F63A 2FA2A 4PPBA 2YDJA 4U41A 3TV7A 1T45A 3ZRKA 4BYJA 4BICA 2XIKA 5HE3A 3ZLXA 4WOVA 2BMCA 4YMJA 3FKNA 5CSHA 2EWAA 4F0GA 4I5PA 4CFXA 5LOHA 4UMPA 4E4MA 2BCJA 3WI6A 2Q0NA 4TYGA 5E1EA 5CI6A 3UDSA 5ETIA 1J1CA 3OBJA 3AOXA 2YJRA 4U81A 4BCIA 5J9YA 5HIEA 3K2LA 4NTSA 3GQIA 1YDRE 3BQRA 4JS8A 1RE8A 1V1KA 3WZUA 3KK9A 3BBWA 3E87A 1G8AA 2C6MA 5EI2A 2GTMA 5C8NA 2C1AA 3C1XA 3PXKA 4NL0A 4TYEA 3O51A 3R04A 4Q2AA 1J7IA 2IF8A 4H36A 4QQ5A 2HW6A 1DI8A 4XP2A 5CQWA 3SW4A 1ZY4A 1Z5MA 2YACA 3R7EA 3AD4A 2IVUA 2J5FA 4F6UA 1U54B 4APCA 3A7FA 5F4NA 3QYZA 4X2NA 4W4XA 3UP7A 2PVYA 4IWOA 5EHOA 2QKRA 4EOKA 3MB6A 2Z8CA 3PTGA 2R3NA 3KVXA 3ANQA 4D1ZA 4GKIA 3SVVA 4GL9A 5E8ZA 2C5XA 2I40A 5AAEA 1Q97A 4TPTA 4RIWA 3UZRA 4R5YA 3ZO4A 2PK9A 3DNDA 4YPSA 2BIKB 1L8TA 3ODYX 4ZSEA 4NZWB 5DR2A 4L43A 5EM7A 4Z7HA 4XG8A 4A9TA 3C5IA 3OCGA 3FMMA 4EL9A 2P4IA 4DDGA 4J71A 3FKLA 4FG8A 2PU8A 5E8YA 4PL3A 4G5PA 3V5PA 3II5A 3KL8A 2UZTA 2WMAA 3P7CA 4PNKA 2IZSA 4OTHA 4DAWA 3I0QA 4O4CA 4IZYA 3BL7A 4NM3A 4FL1A 2XK7A 4W4VA 1WBOA 2ZM1A 2XM8A 4I23A 4MNEB 5FG8A 5B2MA 2W06A 1REKA 4Q9SA 2X8IA 3PA5A 3MIYA 2HXLA 2QOQA 2C1BA 4FIGA 4FYNA 5M4CA 1UU7A 4K0YA 1FOTA 4AXFA 3G90X 5FTQA 4E5BA 2WPAA 2XVDA 2V7OA 4LGGA 2JIUA 3E3PA 1UA2A 3AC5A 3CCNA 2OJGA 2RF9A 1XBBA 3Q9YA 3PUPA 4HJOA 4ZTLA 4RFZA 3W0SA 4XRLA 3OHTA 4FT0A 4FX3A 4IB5A 2WIPA 4QMXA 4BZOA 3QTSA 4BKYA 3QLGA 3L8VA 2VO0A 4D1XA 1Q62A 4BDDA 3W2CA 2O5KA 5H2UA 3NW5A 5FP6A 3ANRA 3HKOA 4FOBA 2I0VA 3FL5A 3MJ1A 2XNOA 4M68A 3NMUF 1UKHA 3D7TB 5DH3A 2W5BA 4KB8A 2XCKA 3DDQA 4YU2A 2R3QA 3MIAA 2C5YA 4IAZA 4QP3A 4RA5A 2UZUE 5AADA 3NDMA 5A4LA 2HY81 4OTPA 2Z2WA 4RJ4A 2YCQA 3HMOA 4P5ZA 4UMTA 3KCKA 3QUEA 1PMNA 3OXTA 4PDPA 3PLSA 4MCVA 2C6IA 5HCYA 3RNYA 1DAYA 5J1VA 4ORKA 2PWLA 2XKDA 3VS1A 4NJ3A 4N57A 4FSQA 3AT2A 3N9XA 3DDPA 1NVQA 2UVYA 4RIXB 1M2PA 3UVPA 3D2KA 1H1PA 4YJPA 4GK3A 5L2IA 3EFLA 4XUFA 3ODZX 3PIXA 5IH5A 2C69A 5AUZA 5HNBA 5CY3A 4NCTC 4F0IA 2W4JA 5CS6A 5AA8A 2BRBA 3TDVA 5BV3A 4K77A 4L68A 3TZ8A 2JAVA 4P5QA 5HLNA 2C68A 4O22A 4PTGA 3K5VA 3BYMA 4IFGA 4F7NA 4MQ1A 1P2AA 2QG5A 4WUNA 3HZTA 4UXLA 5L4QA 1FINA 5EDPA 2XEYA 3LM0A 1XH6A 4FIIA 4X3FA 4JDHA 3QZGA 3H0ZA 5HTBA 4CZTA 4HVSA 3ATSA 4Y95A 3LMHA 1OECA 2X81A 1UNHA 3EQDA 3K5UA 4JG7A 4U97A 2VX3A 3HV3A 5C26A 4U80A 5IEXA 2CKQA 3GC0A 3TIYA 4DBXA 3KULA 3FL4A 3HGKA 2WMTA 3FXXA 2ZJWA 3NRMA 3QTIA 4H3BA 3BWJA 1JKTA 4NIFA 4PWNA 2O64A 3W55A 4DTAA 3RBWA 3MS9A 4PDSA 4CTCA 4CG8A 4LRJA 3Q04A 4O4FA 2VTTA 1H0VA 3RP9A 1VJYA 3RNIA 3MBLA 3QRUA 4I0SA 4AS0A 4F9AA 5CVHA 3V6RA 3LJ2A 3E62A 3NUYA 4N4SA 2J0IA 4Y85A 4QTCA 4L3LA 4U6RA 4V0GA 4X0MA 3EQGA 4YR8A 4D2TA 5BVOA 3ORXA 4QTEA 4HPUE 3FZSA 3PJ8A 5CANA 4I92A 4AN2A 2BDWA 3GEQA 3KRJA 4UWCA 4IAFA 5DR9A 4BDHA 3DCVA 4ALUA 5TE0A 2C0TA 1QL6A 2I0YA 3ORZA 3TTJA 4YZ9A 3VO3A 2J50A 5I9XA 1WBPA 2YZAA 2JAMA 1KWPA 1H00A 2VTOA 2W1GA 1JSVA 3C0IA 3PXZA 4FOCA 4L67A 3ZFMA 4HW7A 4FR4A 4RVTA 3VBVA 3EMGA 5DGZA 2UW3A 4KINA 5AM6A 4DEHA 5AR2A 1SNXA 3POZA 4B8LA 4C59A 4IB3A 4F4PA 4CSVA 1FVTA 4IVBA 5G6VA 2QD9A 3P4KA 3FYJX 5CF4A 5JKGA 1YW2A 3BELA 5GINE 4EQUA 2BRMA 5H3QA 4BRXA 4C7TA 3FLQA 4D2SA 4DC2A 4S30A 5GHVA 4BBFA 4O4BB 1KOBA 4TWCA 4DGNA 3BGQA 3QBNA 2YABA 3ML1A 2IEWA 5L8LA 2IVVA 4AF3A 1PMUA 2VTQA 3ZXTA 5I9VA 5DYJA 1YHSA 2JFMA 5DEYA 4J7BA 4ARKA 5IUGA 2O0UA 4AQCA 3P7BA 4KS8A 3HA6A 4LUDA 5C03A 3Q9XA 3ZSHA 4UWYA 4RGJA 2XRUA 4MK0A 4XJ0A 2WTDA 3D15A 3FMHA 1DAWA 1H1WA 1OL7A 2BTSA 2FB8A 3OT8A 4V0GB 2CNQA 4UY9A 2QHMA 4A4XA 4OTIA 4RT7A 5C8KA 3UYSA 3A99A 4DFLA 5D41A 4FNZA 3R9NA 3EN4A 1E1XA 3CGFA 3QU0A 3UZPA 4IX5A 2XANA 3DAKA 4ZOGA 3ENMA 3LQ8A 5FBOA 4ZY6A 3W2SA 4DGLC 4YUQA 5HU9A 2Y6OA 2WTKB 5D7VA 4L45A 4OR5A 3PE1A 1IRKA 4K2RA 2JDTA 1LUFA 3R6XA 4AN3A 3COMA 2X1NA 3SW7A 1YHWA 4JNWA 1G8JA 4YJNA 4L44A 4NFNA 4IAAA 3NUUA 1JVPP 3NIEA 4E73A 2Y4IC 5LCKA 4J8MA 4MD9E 4QO9A 4BDJA 4ASEA 2CN5A 5GZ9A 3ZM4A 5B2LA 4IVCA 2HAKA 2R3FA 3U8WA 4QPAA 4O6EA 4XYFA 4FTRA 4O0XA 5BVFA 2G01A 4CQGA 4B8MA 1Q8UA 2RFNA 1BL7A 4FVPA 4YZNA 1PXNA 1PKGA 5FEQA 5B0XA 3UIBA 2UW7A 2PZYA 2R3JA 3R1QA 2ZFYA 1PXJA 1CTPE 4FUXA 2BFYA 3AQVA 2B9JA 4M3QA 4IM3A 3U9CA 1K9AA 4DINA 4DHJA 3E64A 2VX1A 3KRXA 4O83A 3CPBA 2YITA 4IFCA 2W5HA 3V5TA 3GU6A 2PSQA 3GU7A 3QC9A 2OICA 4YJTA 2CJMA 5FEEA 4PUZA 4GVAA 3R9DA 1Y8GA 3W33A 3I5ZA 4ZTMA 3EQCA 3ACKA 4LGDA 3DU8A 1YDSE 3P79A 4ZS0A 2I0HA 5AMNA 2OLCA 3TV4A 5F9EA 2AUHA 4IADA 4M12A 2BKZA 3KU2A 4F99A 1F5QA 2QOOA 1UVRA 3FQHA 3FUPA 3KN6A 3COIA 4J96A 3GBZA 4FG7A 3VHKA 1YI6A 3N4TA 4DGGA 1YDTE 2OIQA 3AD5A 3AKJA 3GC9A 3ID6C 3JUHA 4OTWA 4RC2A 3ZTXA 3RINA 3O5AA 3ZZEA 1XJDA 2GMXA 2IW6A 2X7GA 3F3UA 3LXPA 3UC3A 3F82A 5L6PA 3BQCA 1JKLA 4L53A 3ZZWA 4O2ZA 4K1BA 4CEGA 4FL2A 4G3FA 3HAMA 4LOQA 4AN9A 5HGIA 3RVGA 3AC4A 2W1DA 3ALOA 3VUGA 4EC8A 4JAJA 4DG0E 4UB7A 1JAMA 5E7RA 4EH4A 3RTPA 3EFWA 3QGYA 2XK4A 1P4FA 2B9HA 4DH5A 4EZ3A 4XG7A 4M8TA 4B0GA 2R3PA 5H8EA 5M06A 3UG1A 2QOBA 4J95A 2GHMA 3ORNA 3IS5A 1Y57A 3Q9WA 2C30A 4EQCA 4KNBA 4YGAA 3BYVA 1JQHA 3R71A 2W1FA 2PVHA 3Q9ZA 3OTVA 4N70A 3KXZA 2YCRA 1TQIA 3FY0A 5CSWA 5T6KA 3MYGA 3QQKA 4QNYA 5DR6A 2ZB1A 2B1PA 4ANOA 5HVKA 1Y91A 4D4SA 5CALA 2UW5A 4MBJA 3FI3A 4XP3A 3HRFA 1B39A 3QHWA 4QMZA 4YPDA 4EONA 4WBOA 3ZO3A 4ZLZA 4BDEA 4PX6A 4EC9A 3W8QA 4DEAA 3QTZA 4RJ6A 1R39A 3A8WA 4X3FC 3A7JA 3KC3A 3R83A 4QMUA 2HW7A 4CT2A 4HYUA 3VIDA 3WYYA 3BV3A 3ROYA 3BU5A 3C0HA 2A98A 4J99A 3VUHA 3HECA 5L6OA 2JEDA 4F0FA 3HV4A 4BDFA 3QFVA 1W2DA 2VGOA 5KMNA 4CCUA 3EQHA 1GOLA 3DBFA 4CD0A 2C6LA 3GCPA 3SV0A 4F7JA 2BFXA 2GTNA 2C4GA 5JFXA 5TR6A 2R3OA 2WB8A 4O0YA 1PF8A 1IASA 3TNQB 3S3IA 5IG1A 4CRSA 4AOJA 3FZ1A 5CLPA 4C38A 3LMIA 3LM5A 3DS6A 4YBJA 2W96B 4HVIA 4U8ZA 3ZLWA 2G2HA 4HYIA 1ZYCA 1UNLA 1ZAOA 3D7ZA 3GU5A 4UXQA 5CAVA 4XG9A 2BALA 4C62A 3RAWA 2WXVA 3CTJA 4RVLA 2XUUA 3MPMA 4EH9A 4RQVA 3MWUA 4C37A 2QR7A 2HXQA 2GFCA 4EOLA 4QYGA 1UNGA 2ITTA 4AX8A 3C13A 5CXZA 5LVNA 5EYMA 4A4OA 1CKPA 4F6SA 4F6WA 5BYLA 3F2AA 2IG7A 2C0IA 3KXHA 4AGCA 3AT4A 3SXRA 3OUNB 1JWHA 1ATPE 1ZMUA 4JXFA 4O82A 1OIQA 2PMLX 5IUHA 1IAJA 2CKEA 2E9OA 4TWOA 3DXQA 3A2CA 4I1ZA 3VQUA 3B8RA 2OKRA 3R0TA 5TKDA 2X39A 3RPRA 4FTQA 4EOMA 2PVNA 2YM6A 4AXCA 3UP2A 2V0DA 3HMMA 1KE9A 4C4HA 2UW9A 4AE6A 4F7LA 4L6QA 2P55A 3O2MA 5HICA 2Z02A 5KO1A 2GFSA 4FSTA 3JVRA 3PXRA 3M42A 3NW7A 4TTHB 2C0OA 1RW8A 4YTCA 1ZYDA 2IN6A 4TNBA 5D12A 2NRYA 3Q4TA 4A9RA 4DFXE 3EN9A 2VWYA 4QQCA 5JN2A 3ENHA 4OGRA 5LXMA 3OCSA 3ZOSA 2V7AA 2W1CA 3DOGA 1XO2B 3V01A 4XNEA 2W17A 1U4DA 2XKEA 2V55A 4I21A 3MTLA 2X0GA 4IWDA 4FV1A 2YZLA 5HEZA 2IJMA 3F5UA 5HU3A 4Q9ZA 4OAVB 4ACMA 5GZ8A 2PL0A 3VUIA 4CV8A 3UNKA 4A9YA 2WQEA 2C5OA 1OGUA 4LRMA 4O7SA 4TYHA 2PE1A 3VS5A 3N4VA 4TZRA 4FV2A 1G5SA 2OH4A 2WKMA 3TL8A 4LFIA 5DE2A 3UZTA 5HX6A 4BCQA 4Y73A 2BZIB 1GZOA 3E3BX 5J8IA 1KV2A 4GIHA 3VS2A 3FLNC 3C7QA 4BKJA 2VTLA 5LVOA 2BRGA 4K18A 3HUCA 3NVKI 4ANBA 1YKRA 3DKCA 2VNWA 2CGXA 4PMTA 2JDRA 4RJ5A 4YJVA 4HGSA 4N0SA 4OBOA 3R7UA 3UNJA 4TW9A 5IA5A 4FK3A 4RMZA 2RG6A 3LPBA 4GYIA 4BWXA 2J7TA 2VUWA 4JLCA 3WYXA 4O6LA 3C4EA 4RJ7A 2CHLA 2GDOA 3MVMA 4FYOA 5DFPA 5DOSA 1WMKA 5H8GA 2A4LA 1TKIA 1APME 2WHBA 3FAAA 3MN3A 4U40A 3ORMA 4FJVA 1OL6A 4NM5A 4LDTA 2HENA 3ULZA 4C34A 5IQIA 4O21A 2J2IB 2BR1A 5JK3A 3TZ7A 3F3TA 3GGFA 4W8DA 1R3CA 3G51A 3PSBA 3JR1A 2JBPA 1RDQE 3W0OA 4AWIA 3KREA 3GP0A 4HCTA 4L3PA 4RX5A 4FRFA 4GJ2A 5K9IA 2WMWA 3W2OA 1PY5A 3QRKA 2GS2A 4D5HA 4BI1A 2P3GX 4R1VA 1M2RA 4QMTA 4IM2A 1ZOEA 4FIJA 4IDVA 2HWOA 4ZIMA 1SZMA 2UZVA 2YM7A 4E4LA 5HTCA 3HL7A 4JJRA 1WVXA 4UX9A 4O7TA 3TKHA 2NP8A 3H4JA 2VGPA 3C5UA 4B6LA 5I9ZA 3LFAA 3BZ3A 4W4YA 4X6RA 4DCAA 4PMSA 3CE3A 3FC2A 3W0NA 3DKFA 4XH6A 4EHGA 3V6SA 4J98A 5FM3A 3VVHA 4G16A 5AFVA 5IDPA 3NFGB 1ZWSA 1OPJA 3LMGA 1Q41A 3P5KA 4NCTA 3RWPA 3LFCA 5IQBA 3ZDIA 2JKMA 4IM0A 5L8KA 5LVPA 3LKMA 2OJ9A 4QEBA 4JQEA 4O0SA 5D1JA 2YA9A 1SVEA 4XEYA 3EQBA 3QZFA 4XV1A 4RA4A 2YEXA 4UWBA 3RAKA 1OL2A 4HVDA 1H1RA 4RVMA 2XIXA 1URWA 4G9RA 5CI7A 5AAFA 3R7YA 5DVRA 5JZNA 3RK5A 4AZVA 2ITPA 3I5NA 4NKAA 3FQSA 4I6LA 3MY0A 3SRVB 3GB2A 3Q5ZA 5GJDA 4PPAA 4CMOA 5GZAA 2CGWA 3DBDA 3R7VA 4L01A 2VWZA 4YHJA 2YM4A 4YZMA 5DT0A 3S00A 3NFFB 4FTCA 4LM5A 3UO4A 3ZS5A 2XZSA 4XLIA 2SRCA 4AAYA 3JS2A 1AD5A 3KXNA 2RSVA 4KABA 3SXFA 3VJOA 4FI1A 2J9MA 3BI6A 3HA8A 2JGZA 4ANLA 4C4FA 4CQEA 1B6CB 3G9NA 3U54A 3P78A 2B53A 4EH5A 2IO6A 4GK2A 3KMMA 5DPVA 3UE4A 4CT1A 3CY3A 3R63A 5M51A 3BU6A 3QQLA 5M53A 2W1IA 4BZNA 4ERWA 2C5NA 3NGAA 2UW6A 2FH9A 1O6LA 3OUKA 1ZLTA 2XYUA 4KKEA 1BKXA 5KUPA 5CX9A 4R1YA 4DN5A 4DHFA 3FJQE 1U5RA 3E5AA 4W8EA 1OM1A 2PZ5A 1I09A 2PPQA 5CF6A 2GHGA 3VQHA 4FEQA 4U3YA 2QOKA 3R8UA 3RZFA 3ORIA 4R78A