4C61A

Inhibitors of jak2 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
272
Chain Sequence
FEERHLKFLQQLGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQAHAERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Discovery of 1-Methyl-1H-Imidazole Derivatives as Potent Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 272
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c61A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c61A01
3AMAA 4HYUA 1PYEA 4NFNA 4NTSA 4FSYA 3PPZA 2UZTA 3QD4A 2JBOA 2UW0A 1UU3A 3FKLA 4EORA 5HTCA 3ZO3A 2HK5A 5L6PA 4IX4A 1OKWA 2EXEA 3OC1A 5J1VA 3LCOA 3QALE 4F1MA 3BYOA 4G5PA 5FDXA 3VUMA 3H30A 5HD4A 3DJ7A 4B0GA 5JQ8A 5E90A 2GNFA 2HCKA 2X7FA 4MNFA 4NKAA 3VQHA 2PE1A 3GI3A 2VGOA 4RZWA 4BIEA 5IUHA 2PMNX 3P7AA 4IM0A 2RKUA 4F9AA 4ZK5A 5LMAA 3E3BX 4QNYA 2C3LA 2C6TA 3RCJA 4BCIA 5EI6A 2C6DA 5H8EA 3LQ8A 4IWQA 5JFXA 3ANQA 5DLSA 4MWIA 2XJ0A 1PMNA 3EN7A 3IDBA 4MF0A 5EDRA 3NUNA 3S00A 1IAJA 1OKVA 2JFLA 3QAME 3F69A 1NA7A 2VO3A 1YWRA 1WBPA 5CYIA 3N9XA 4WBBB 3HLLA 3BBWA 2HZNA 4Q9ZA 4YHFA 2PE0A 1J1CA 1ZMWA 4JDIA 5IH5A 3JUHA 4NJ3A 4H1MA 5CASA 4KKGA 4UYAA 5EM8A 1U59A 3CIKA 2X39A 3V8WA 4EOPA 2IW8A 1VYZA 4QQTA 1B39A 1B6CB 1JWHA 2OJIA 2P2HA 3EH9A 4KS7A 4BZNA 2XKEA 3MFSA 3ALOA 4ZSLA 2EXMA 2A1AB 4CCBA 2PULA 4YTFA 2W1HA 4ZTHA 3BYMA 3RZFA 3JY9A 4FKTA 3FE3A 3CKWA 1KE9A 3IGGA 3QLGA 3UOLA 4W4YA 5E92A 1YXXA 5EKOA 5L6WL 4C4GA 3ZBXA 4HVSA 3UO4A 3I4BA 1YXTA 4Y95A 1GZKA 3E8NA 3QX2A 3G5DA 3UVQA 4APCA 3QU0A 4U3YA 3DJ6A 3F66A 4GVJA 5AUTA 2ITUA 3BLHA 4IDVA 1O6YA 4AN2A 4LMUA 3OXTA 1GZ8A 4W4XA 4KBCA 5ETIA 3DQWA 4JG6A 2GDOA 5CU2A 3R0TA 3R9DA 3UC3A 4BKYA 4YTCA 2PUNA 4DF3A 3DZQA 4AGUA 2GFCA 3NAXA 1PRYA 4I0TA 2J9MA 2C0TA 2WTKB 3EMGA 4RSSA 3TNHA 4O7NA 4AS0A 4GYIA 2QLUA 4YZBA 2X2MA 4JT3A 3LFEA 3O51A 3TNPC 1M2RA 4GG5A 2PMOX 3I79A 5ACBC 3BLQA 3CPCA 3PWDA 3UMXA 5LOHA 4MQ1A 3A7HA 5IQCA 2J2IB 4AFJA 1H28A 4HNFA 3UYTA 3P79A 3LQ5A 4KD1A 1WVWA 1YOJA 1JSTA 4AT3A 2FH9A 4ENXA 4I0RA 3II5A 3S2PA 3PLAE 1XH8A 3FLNC 3MA6A 2R3MA 5IQIA 4FV1A 2JKKA 4AF3A 3BGZA 3FY0A 4JBPA 5CVGA 3VWAA 3UO6A 2EXCX 3ALNA 4C4HA 5IA4A 2B4SB 4AGCA 4YPDA 3TXOA 3C0GA 3QLFA 2R3NA 4YBKA 4MD8E 4NM3A 4BL1A 5BVOA 2Z7LA 5TF9A 3VS3A 4O83A 4FSRA 3KXGA 5C27A 2UUEA 4EH9A 3QRTA 1PXMA 5CI7A 2C0IA 5FQDC 1JPAA 4BTKA 2PL0A 3I7BA 3KEXA 2QLQA 4I23A 4RJ5A 4GUEA 4GJ2A 4I22A 5DE2A 2JKQA 3D5VA 1K9AA 4PP7A 4BHNA 4QYYA 4KSPA 3GFEA 3IONA 4PMPA 3MH3A 1XO2B 4AT5A 3P78A 4CYJA 4JRVA 5IUIA 3UZTA 2ITTA 4LOOA 5E1EA 1H1PA 5D12A 2C47A 3G0EA 3LCKA 1REKA 3A7JA 4FT9A 5JRSA 2GQGA 2XJ2A 2IW6A 2ZDTA 3MIYA 3E87A 2R3FA 4O0WA 2X9FA 4EWQA 1M14A 2XNEA 1UKHA 4GSBA 5J1WA 5HOAA 3NYVA 2VTPA 1YDSE 3DLSA 5CT0A 4EOJA 4Q5EA 4IIRA 5IQDA 3A62A 4WSYA 3OF0A 2OZAB 3WF6A 5BQ0A 2OGVA 3UODA 2PUUA 2OFUA 3ZDIA 3LW0A 4QD6A 4DEDA 4FZ7A 2UW5A 2QI8A 4LUDA 4LOPA 4DG3E 4AZWA 5A4QA 1ERKA 4G5JA 4XV1A 4FV0A 4AWIA 2PZIA 3DK3A 5KZ0A 3IW4A 2ITNA 4RJ7A 3H9FA 2QOQA 2C5VA 4Y5HA 2WTIA 4BBEA 5EM5A 4YO4A 1OBGA 1UU8A 2Z7QA 4UWYA 3E92A 3VS2A 1XKKA 4TYJA 4F08A 2WXVA 3LM5A 3PJ3A 4ANMA 3DNEA 5JEBA 4FI1A 3TCPA 2JFMA 3PVGA 3KRWA 4I93A 1XH4A 3FZSA 3OBGA 1XQZA 3NNWA 3ACKA 4H3PA 4BDGA 3MYGA 4GMYA 4WG5A 2IG7A 1CMKE 2IZUA 4DBXA 4DE4A 2VX1A 4C35A 3FLWA 4IE9A 4BBMA 1Q62A 3PUPA 3MESA 2E9UA 2PVYA 3VUGA 2UZVA 1FVVA 2VWWA 3OW3A 2BZHB 4FIJA 3MH2A 5CSVA 5L8KA 3MFUA 2IZTA 3AT3A 5I5ZA 3P08A 3L8PA 4R1YA 2YZLA 3QXOA 1G8AA 5BYZA 4CYIA 3RAWA 2JDRA 1YDRE 5J5SA 3DNDA 4QMTA 3I6UA 2VU3A 4AGWA 4K2RA 3UIUA 1T45A 4O7SA 1NVRA 2X4FA 3OY1A 4XG2A 3NIZA 3G2FA 2PVLA 2ZM4A 3MVHA 4ZJJA 3QTSA 3N51A 3WYYA 3FI2A 1XH9A 2OI4X 3R04A 4O0SA 1E1VA 4TPTA 3VS6A 4BB4A 4E4MA 3U4UA 5AM7A 3KXXA 4W4WA 3SXFA 3BWJA 4EH5A 5BMMA 1OPLA 4ZTRA 5TT7A 3RI1A 4PDPA 3ORXA 5FEEA 5AP0A 3LM0A 3OTVA 4GH2A 4OTDA 1IEPA 1KV2A 3Q6WA 4X3FA 4DINA 4FOCA 4YGAA 4CTCA 5AV4A 2QOHA 3GC8A 2G2IA 3VJNA 2VNWA 4I92A 5A3XA 3Q2MA 3DDPA 4ZTLA 3UGCA 2W5HA 5EM7A 4DTKA 3E8CA 4XLIA 3NW7A 3IW8A 4IC8A 3FAAA 5HG9A 4GCJA 1IA8A 3GCSA 2ZB1A 3QQUA 3HKOA 4IQ6A 4ACDA 5HIBA 4BKJA 1OMWA 2RG6A 5HKMA 3RNYA 3DU8A 4Z3VA 3QGWA 3ZLXA 5GHVA 3PY0A 4K0YA 3TUDA 5C4LA 4JDJA 3EIDA 5DWRA 3ATTA 4BDEA 2YACA 4YO6A 1VYWA 1FQ1B 3OP5A 3LCSA 4L45A 4O2ZA 3E88A 2H6DA 2R3KA 2VUWA 1ZOHA 4FKSA 4EUUA 5BVFA 2C69A 2BRBA 3DBQA 5H8BA 5HLWA 3WZKA 5L2TA 2DS1A 2C6OA 2IZRA 3WILA 5H8GA 4DGLC 1UU7A 5E91A 2PVMA 1W83A 2IVTA 5CEIA 3KRXA 4QPAA 5AV1A 1ZYCA 3KK8A 2JKOA 1RQQA 4ANOA 4D1SA 4ZZMA 1J91A 3FMMA 1IG1A 2VD5A 2GS2A 3MV5A 1IR3A 4XX9A 5DVRA 4BYIA 4RBLA 5JT2A 5CXZA 4HGTA 4WT6A 5E8XA 1YXUA 1XHAA 3G0FA 2FUMA 3UP7A 2BMCA 4WSQA 1WBWA 3C7QA 3A60A 2XK8A 3Q4TA 1LUFA 2BHHA 2HELA 4O0XA 3RWQA 1AGWA 4FNXA 4FKOA 3OEZA 5IDNA 1OPJA 4FOBA 2VX0A 4RMZA 5GNKA 2WZJA 3DBFA 4P5ZA 1M2QA 3OG7A 4FSWA 4MX9A 1ZY5A 2GCDA 4NIFA 4HGLA 4KWPA 3TKIA 2DWBA 2HY0A 2IZSA 5CEQA 1OZ1A 3R1QA 3G33A 4W9WA 4FNYA 4V0GB 1H08A 4DG0E 2XCKA 3TV7A 4CLIA 3CEKA 4ZIMA 2VWVA 3HP5A 4FV2A 3UVRA 4XBRA 2W17A 4HPTE 4I6FA 4AU8A 4F7LA 5M56A 4EHZA 5FLFA 2ZDUA 4OBPA 1OIQA 4JQ7A 4ZSGA 3MFTA 1TVOA 2YAKA 4GKHA 4EK5A 4TYIA 4RIXA 3NUYA 4U3ZA 4UMQA 5EYDA 1J7UA 1KUTA 2W4JA 3PIYA 2ZMCA 4AW0A 4F7SA 3RJCA 4FG7A 3KA0A 2OF4A 2XNPA 5HLPA 3H4JA 2W1GA 3HUBA 4R3PA 4A9YA 4RA4A 3F5UA 3NUUA 3Q9YA 5EKNA 5EM6A 3F61A 2RG5A 3D7TB 4FIFA 3ZDUA 5CSPA 2X0GA 1Q41A 2I0VA 5CAVA 2XKFA 4CG8A 4E5AX 4J7BA 3KKVA 4NH1A 4XUFA 5CF5A 3K54A 4WUAA 2WB8A 2BTSA 2ESMA 3OXIA 4J98A 5M4UA 1WFCA 3DBCA 4ANQA 2J0LA 4RWIA 3U54A 1Y6BA 4YC3A 3LFFA 4DGMA 4HGSA 4RJ8A 4KKHA 4XJ0A 1YKRA 3QA8A 4XG4A 2GQRA 4C57A 4CFXA 2IJMA 4O0YA 1OI9A 5M57A 1YOLA 2F7ZE 1U54A 3ZO2A 4G31A 3NW5A 4CFWA 4M68A 2CNQA 2WGJA 1YOMA 5F1ZA 3BE2A 1ZYJA 4DCEA 4NM0A 4E20A 5FTOA 3TDWA 4ACHA 2KULA 4HCTA 4PY1A 5CSXA 3CBLA 1YI4A 4IDTA 5JGAA 5FTGA 3DA6A 3VS7A 3KMMA 3EQRA 3H3CA 3KB7A 3TL8A 1OL5A 5CAOA 4LYNA 3GQLA 4EOIA 4S33A 4G6LA 4NKSA 3KRJA 4QP9A 4K9YA 3TUBA 1GIHA 4YTIA 4MNEB 3DB6A 5KBRA 4R5SA 4D2RA 3MGYA 4ASEA 4F0IA 5C4KA 4Z16A 2BZJA 2AUHA 3CD3A 3HMIA 4G3FA 4L01A 4FKQA 4WD5A 2HYYA 3KL8A 4D58A 5IA1A 1MRUA 1SNXA 4A9UA 5CU4A 2WQNA 2A4LA 1F0QA 4U81A 3TV4A 2P3GX 4G3EA 3V6SA 4KUJA 3BIZA 2X6EA 4QMWA 3ACJA 2LAVA 2UZUE 3H10A 3I0OA 1OECA 4IWDA 4BHZA 4EH4A 3AMBA 2HENA 2WOTA 4QP3A 2R3HA 3KN6A 3PRFA 5E8WA 3QC9A 3TTIA 2VTJA 3BYUA 1JKKA 1GY3A 1R78A 4GIHA 2YIRA 4FZ6A 4B8MA 2YA9A 3RPRA 1GOLA 3GU8A 3MTLA 2XBAA 4GT3A 2C30A 3FL5A 4PMTA 5T3QA 2IW9A 3UQGA 5LMBA 2NNWB 1NW1A 3KRLA 3CQUA 3FKOA 3VUTA 4AZSA 2QG7A 3SOCA 4UBAA 5EDPA 3RALA 1H27A 4PL3A 3OUKA 4FT5A 4PP9A 2V62A 3EQDA 1I09A 3QC4A 3UJGA 2YN8A 3L9PA 3C9WA 2SRCA 3EFJA 5CS6A 3BU3A 4QTAA 3F5XA 5LVOA 2F9GA 2Y4IB 3FLQA 3PVBA 2WD1A 4TXCA 4X6QC 3V5PA 4EH6A 5CAPA 2Z02A 5DYJA 5AEPA 4ZTSA 5E1SA 3LMIA 4GL9A 3ZBFA 2QHNA 3ULZA 4A9SA 4OAVB 1SZMA 3CR0A 4JVGA 3DKCA 4Y8DA 3K3IA 5HLNA 4OTHA 3HRFA 3P86A 5HX8A 3G9LX 4HW7A 2XMYA 2ITYA 1WBSA 2WTKC 5HU3A 4M15A 1YI3A 3VS0A 2B52A 2X7OA 4R3RA 2B9FA 2J0IA 3PVWA 3KRRA 3TI1A 4ANBA 3QGYA 1H25A 4IANA 5DGZA 2C6EA 3ORPA 4UWCA 4IAIA 3OD6X 5M44A 4FIHA 3Q4CA 4PL5A 5GJDA 4BDAA 4F4PA 3D2IA 2CCIA 2FA2A 4GW8A 5CVFA 3RBWA 4DH1A 1ZZ2A 3E63A 4BGHA 5LCJA 4J8NA 1QPJA 5B0XA 1JVPP 1WBVA 2QR7A 3LPBA 1H4LA 2YAAA 4DEEA 5KCVA 2YFXA 3AC5A 3EN4A 3FUPA 2WMSA 3QD0A 4MXAA 3WF8A 4QYGA 2W96B 2Z60A 3QQHA 4CRLA 5KKRB 1R39A 2XNNA 5GZAA 4N6YA 3LFCA 4MD7E 2C1BA 2WTDA 3ZOSA 1A06A 3MJ1A 3BU6A 2B7AA 3LJ0A 5IA5A 4L9IA 1O9UA 1I44A 5KMNA 1KE5A 3C0IA 3ET7A 4FV9A 4YLLA 3QL8A 2B53A 3VS5A 5AWMA 4CKIA 5EFQA 4C4EA 4LOQA 4TWOA 4XLVA 2Y0AA 3ZS5A 1VJYA 4H58A 3TV6A 4O0TA 4FNWA 5JMSA 2OFVA 1ZXEA 1HCKA 3PXYA 1Q97A 2UW4A 4O7ZA 4RIWA 2IVVA 4RVLA 3A7GA 3LHJA 4ZTMA 4YC8A 4YLJA 2YIWA 2XF0A 3ORTA 2OJFE 1XH6A 3PYYA 1H07A 3R63A 3V51A 2X2LA 2NP8A 5KMIA 2ITOA 4L7SA 5I4NA 2XCHA 3C4EA 2XBJA 2CGUA 2JKMA 3AGMA 3TZ8A 5AV0A 3O7LD 1OKZA 4I6BA 2IN6A 4D28A 5KX8A 3P23A 1JKLA 2OJ9A 4JRNA 4QT1A 5I9ZA 2VX3A 2J51A 3NIEA 3OWLA 1WZYA 2R7BA 3COKA 5D10A 3PVUA 3QRKA 5DR6A 5BUJA 4BZOA 5LMKC 2J4ZA 2UZEA 4UXQA 2JGZA 4UMUA 4YMJA 4EL9A 2Z7RA 3FLZA 4F6UA 2ACXA 4GUBA 4GEOA 5AJQA 5HG7A 5C26A 5L8JA 1BLXA 3AC8A 1H0VA 3UP2A 3FC2A 4JG7A 4C36A 4FTOA 4QNAA 3NAYA 1QPEA 1M7QA 4IVAA 5GJFA 5AA8A 5BX0A 1NVQA 3NSZA 3PSBA 4LGHA 3THBA 5T68A 4KA3A 4NM5A 4O2PA 2QO2A 2VV9A 5GZ9A 4M69B 5AX3A 3QXPA 2WEVA 4YNOA 1DS5A 1PXKA 1PMVA 3C51A 3GU5A 3PIXA 2XK7A 2PUPA 4RWLA 1DI8A 4HYIA 3H0YA 5TKDA 3VUIA 3PXZA 4BCKA 2WOUA 4DT9A 3EWHA 3PA3A 4QMMA 1JKTA 4LG4A 1S9JA 1Q61A 3QD3A 4E26A 4QMZA 4F99A 4I3ZA 4AACA 5EK7A 2QURA 3S95A 5CTPA 2E9VA 2BTRA 5HEZA 3NUAA 4NZWB 3V8TA 1H00A 2ETMA 1YI6A 3U9CA 3VBTA 4C4JA 3MTFA 4XV3A 4JAJA 3SA0A 2VWIA 3R9OA 5IQFA 2RIOA 4O0RA 4CXAA 5H2UA 3EFLA 4IMYA 2VZ6A 3B2WA 3KN5A 3RAKA 3LKMA 5KMMA 4XG9A 3UOHA 1XBBA 2HAKA 3KVXA 3V8SA 5AP1A 3U6JA 3HZTA 3LMHA 3U8WA 3FLYA 1ZLTA 1MRYA 3FMNA 5A4CA 4O7RA 2XJ1A 3QA0A 4RQKA 4Y83A 4GT4A 3C0HA 3DZOA 4KINA 4YJNA 3VBVA 2X4ZA 3FHIA 4AW5A 4L67A 1WMKA 4FIGA 1Y57A 2QOLA 5H3QA 2HY81 4KSQA 3DV3A 4WNMA 2UZNA 4EHGA 5I3RA 4F7JA 4PUZA 3PPJA 1VEBA 3G9NA 4BCPA 2UW7A 1BL6A 2IWIA 1WCCA 2JIIA 3V04A 1JQHA 4J53A 4USEA 4C02A 4A4XA 1CTPE 4M14A 1RJBA 4MYGA 4X3JA 4F0GA 4U42A 5JQ5A 4HJOA 4P2KA 4FTKA 3TACA 1Q24A 4BCNA 1UNHA 3PG3A 3QBNA 2BRGA 3VBQA 2HXQA 2OF2A 4IWPA 4OLIA 3E7VA 4XHKB 4C2WA 2WO6A 4YSJA 4D2TA 4NIFB 5AIRA 4OGRA 2PYWA 4I5MA 5CY3A 5A4TA 4XOYA 2BAJA 4ZY6A 3VUDA 2R3IA 2I40A 3BV2A 4WOVA 3KMWA 2YIQA 3ELJA 3Q4UA 5M55A 3EQIA 3DAEA 4OBOA 2QOIA 4XRJA 5LARA 5IZFA 1ZYSA 4CCUA 4UB7A 5J9ZA 3CJFA 3IECA 4L00A 4NCTC 2R0UA 5IA3A 4ANSA 3DAKA 4WRSA 4AAAA 3LXPA 4JDKA 1UNGA 4N4SA 2F2CB 4QMOA 4QP4A 5FBNC 3SVVA 3BU5A 3O50A 3R8PA 3V01A 2C3JA 3VUHA 3QFVA 3PWYA 2ZB0A 3PXQA 4FKVA 4M97A 1OIYA 2A0CX 3MIAA 5AR3A 4ZMFA 5A6NA 2XNBA 2W06A 2XYUA 5CLPA 4D1XA 4ZSAA 5K5NA 2BAQA 3DDQA 2ITZA 3IW5A 4HYSA 4O6LA 4TN6A 3R7GA 4U44A 4CQEA 5G6VA 4BI1A 1V0PA 2G9XA 2EVAA 5KHXA 2B9HA 2LGCA 2QO9A 5J95A 3SRVB 3RTPA 4CFMA 5IQBA 2RL5A 1GIIA 3S3IA 2BKKA 4H39A 1ZMUA 4LRJA 4I1ZA 2YITA 2X8DA 2YM7A 1Z9XA 3COHA 2X6DA 4CFFA 1YW2A 3FEGA 4ZMEA 3W8LA 5BUEA 4FYOA 3GB2A 5IKWA 4ITHA 4CNHA 3EL7A 4TYGA 4MXYA 4G6OA 1XBAA 1DM2A 1H1RA 2WMAA 5FTQA 3VC4A 3ZUUA 3ZZEA 4EZ3A 5JKGA 3ORZA 4QOXA 5T6KA 3ITZA 3EHAA 3GCVA 3WI6A 2EU9A 3ORKA 4OTIA 4XNEA 5CVHA 1ATPE 4RFZA 1LR4A 5HO6A 4FT3A 4LL5A 3NUXA 2BAKA 5LVMA 4AZEA 1FOTA 4X2GA 4CMOA 4AQCA 2CNVA 4YBJA 3R9HA 5B2LA 5DT3A 3ORNA 4MBJA 2X7GA 3DKGA 2JC6A 3AC3A 3OY3A 2BALA 3NCZA 5DHJA 2CLXA 4FG8A 2NRYA 2E9NA 3FSFA 4MCVA 1SMHA 2PVNA 5J7BA 5K9IA 4AGDA 2FVDA 3AGLA 3CKXA 3T3VA 5FXQA 1TQIA 3V5JA 3ZFYA 5DMZA 3EOCA 5I9VA 4FL1A 4D55A 2PVFA 2XNMA 4JI9A 3QCSA 2ZM3A 1AQ1A 3ZUVA 3C4WA 2PWLA 3QCXA 5EYKA 5HE0A 4DFLA 2XNGA 1KE8A 2GTNA 2RSVA 3F7WA 3G51A 3C50A 4K11A 4U79A 3AXWA 2WMTA 3MDYA 2CN5A 2ZV2A 3HX4A 3P0MA 4GS6A 4AP7A 5B2MA 4IAAA 5LVPA 3HA8A 5IDPA 2XK9A 1WVYA 2WQMA 1ZY4A 4KBKA 4LV8A 4S32A 5D7AA 4ZXTA 2W1ZA 4EZ5A 3WIGA 3A4OX 4FKJA 4QPMA 2W1CA 1NT2A 3NPCA 4FV4A 5DPVA 3DXQA 3F82A 4FTAA 2WQBA 2PE2A 5IUGA 2PZPA 3ODZX 4ACGA 4HVDA 4J8MA 4DN5A 4C3PA 5LVNA 5BNJA 4L42A 2F4JA 4FVPA 3UZPA 4O7YA 3PJ8A 2GHLA 3C1XA 2FSMX 3F3TA 4G16A 4O38A 2YCSA 2I1MA 5DBXA 4BDIA 4CV8A 4E6QA 1W7HA 4EH3A 4GG7A 2O5KA 3FQEA 4C38A 2VTRA 2VAGA 1ZYDA 4DGGA 3TIYA 2PUIA 3FPQA 2CGVA 1IASA 3BCEA 2VWBA 1WBOA 2JDVA 3R7IA 3HECA 4FK3A 4O0VA 1QL6A 3U87A 2PU8A 3BX5A 3CCNA 4ZS4A 4O0UA 1LP4A 4IZ7A 1LEZA 1XBCA 2BVAA 3SQQA 1BYGA 5HQ0A 3UVPA 2OZOA 5CEMA 2Y9QA 4E5BA 3OZ6A 3Q9XA 3QWJA 4XG8A 3OT8A 5D9HA 2VWUA 1W8CA 3O8UA 4EHVA 2QOCA 5HESA 4FEXA 2W1IA 3Q52A 3RAIA 3A7IA 3I6WA 5FGKA 5ANIA 4CT2A 2AC5A 4DH3A 1PKGA 5L2IA 4WHZA 2NO3A 4EKLA 3KCKA 5KMOA 5DEWA 4FV6A 3FSKA 4J97A 2PMIA 3KK9A 1ZYLA 5EHLA 4O82A 5D1JA 3ROCA 5AFVA 4E6CA 4EI4A 2QKWB 3MFRA 3OT3A 3D7ZA 4EOKA 4TL0A 4E4XA 5EQYA 3GBZA 4MXCA 5CT7A 3UDBA 5CF8A 4IAKA 3GOKA 3TWJA 5AAEA 5IEXA 4YJUA 3MBLA 2B9JA 4AT4A 4RIYA 4IVCA 4RX7A 2Y8OA 4RZVA 3QRIA 2GNHA 4IFCA 4YJOA 4O27B 5JK3A 2R3OA 3KXMA 3FMDA 3G6HA 3ERKA 4OTPA 4USFA 4DFXE 1KOBA 2YCQA 4YJQA 1FVRA 2OJGA 3AT4A 3JPVA 4J1RA 2Y4IC 4L6QA 5EG3A 5FG8A 4CZUA 4DITA 5CX9A 4MKCA 4QMSA 5A46A 3LFDA 2E2BA 5AX9A 3UIMA 2VTMA 1JLUE 3PLSA 3ZZWA 1SYKA 3CTJA 3N4UA 4ZLYA 2P55A 2XRWA 4O84A 4RIWB 3RHXA 1PJKA 2J50A 5K0KA 3CXWA 3PY3A 3JXWA 4GFGA 5IA2A 3QZGA 5AADA 5KUPA 5HORA 4ASXA 3ZLSA 1PMEA 4QQJA 4TW9A 4A7CA 1BI7A 1UVRA 4II5A 3BQCA 3C5UA 4D2VA 5HD7A 4EEVA 4CG9A 4HZRA 3ZONA 4WKQA 2CN8A 3Q9WA 4RLLA 5LCKA 4F63A 2W0JA 5JZNA 4JX3A 4FTUA 4EK4A 2RF9A 4XEYA 4F7NA 4RJ4A 2XS0A 4P5QA 2QVSE 4FT7A 4PDYA 5AP5A 2H96A 4O22A 4V01A 1AD5A 3R8LA 2GHGA 4G1WA 3SHEA 3SW7A 4KKEA 4R3CA 3PY1A 4EQCA 1V0BA 3UO5A 4D2SA 2OW3A 1BUHA 1KOAA 3IK3A 4MBLA 2GU8A 2W7XA 3SX9A 3F3VA 5HG5A 1QMZA 5M53A 1PXPA 1YVJA 3MB6A 5A54A 2ZJWA 2XP2A 1P14A 3DJ5A 4O1PA 3ENHA 5KKRC 2CPKE 4HNIA 5HE1A 3R7VA 2CKOA 4PDOA 3OUNB 2YM3A 2ZV9A 4QQCA 3U6HA 3FXXA 3VW8A 4I94A 3CGFA 1PXNA 5FP6A 1OPKA 1W98A 4GU6A 4OR5A 3NGAA 3NDMA 3RGFA 3F7ZA 3H9OA 3OBJA 4M66A 5D7VA 3W2PA 5AAGA 5GIPE 3SXSA 2W4OA 1R3CA 4RPVA 4M0YA 3OS3A 5JZJA 4ACCA 1Q8TA 3FJQE 2I7QA 2BUJA 4KIPA 4F0FA 3D5WA 4YJPA 2CLQA 3M1SA 4RVTA 4RFYA 5EI8A 4R7BA 4I4EA 3R02A 4DLIA 1E9HA 5JGDA 1SM2A 2UW6A 4RJ3A 4EHEA 5IEVA 5AR7A 4X0MA 3N4TA 1J3HA 4ID7A 2ERKA 3Q04A 5K5XA 4C58A 4FSNA 4FUYA 4QMLA 3QTQA 4LUEA 2F49A 3V5LA 5DT0A 4O7VA 3ZXZA 4A4LA 2P4IA 3GOPA 4I6QA 2FGIA 2DUVA 4YNEA 1Q99A 1M2PA 3OTUA 2VTHA 3BEGA 4F65A 1STCE 3SW4A 4CKJA 3PXRA 3LE6A 1EH4A 3KF7A 4IB3A 2WTCA 3BWFA 3N4VA 3WE4A 3R8MA 5BYYA 4G34A 2XIXA 3W2SA 1P2AA 3M11A 4BBFA 4DH5A 3I0QA 5TOZA 3IDPA 3ROYA 3BGPA 3CQEA 3RVGA 3QTUA 3VBWA 2X1NA 1UNLA 2JIUA 2REIA 4K33A 4PTCA 4TNBA 4U41A 3DTWA 3QTWA 2I0EA 5GIOE 4ACMA 3ODYX 2A19B 1Q8ZA 4EOOA 2CKEA 4Q5HA 1BKXA 2YWPA 3ORIA 3MA3A 5DIAA 4I5HA 3QTXA 3D9VA 3I1AA 5E7RA 5AP6A 3VUKA 3TJCA 2W9ZB 4AFEA 5C1QB 2YM5A 4D1ZA 3WE8A 3TJDA 2OO8X 4FKLA 1GJOA 4IX5A 3VQUA 5IQGA 5HIDA 3SDJA 4GRBA 4NSTA 2ZAZA 3ZRLA 3W2QA 4D4RA 4DBNA 4FKGA 1T46A 4KIKA 2J0JA 4BGQA 3EKKA 3QYZA 3OWJA 1REJA 5ETCA 2XEYA 3VBXA 5J79A 4U9AA 3RMFA 3VS1A 2ZM1A 3UBDA 3FMJA 1UA2A 5C01A 4AZVA 5IPJA 2W5AA 3E62A 5CNOA 4QQ5A 4JBQA 4RT7A 5FM2A 3HYHA 4NJDA 4TY1A 3LFSA 2UZWE 2FSLX 4QTCA 5AIKA 4G9CA 4IAZA 4IX3A 4FKWA 3W18A 4CZTA 1R0EA 3QTZA 3QX4A 4IVBA 2XVDA 2XA4A 4EBWA 4L68A 2C3KA 3F88A 4WA9A 4BVUA 5LJJA 1JSVA 5AMNA 2VTSA 4RG0A 3LJ1A 5BVEA 4Q9SA 4XP3A 1IA9A 3GUBA 3HNGA 3P1AA 4FSZA 4EK6A 3PP1A 4DFYA 2GMXA 2BPMA 4C4FA 4ENYA 2JDOA 4BWKA 4LMNA 3PXKA 4EOLA 5EDQA 1JKSA 1L3RE 3UZRA 2WMUA 4DEAA 4D4VA 2PTKA 4OTGA 2HWOA 3QKLA 3GC0A 4M3QA 5IQAA 4DEBA 4YZDA 3TUCA 4DCAA 5BPYA 2QODA 4FVQA 4JQ8A 4D0XA 3ZYAA 5G1XA 2R3RA 2WPAA 3E5AA 3RPSA 3TKHA 3BLRA 3UE4A 4D5HA 2A27A 3CTHA 3LOKA 4IACA 1A48A 5M09A 2X81A 3KVWA 5AP2A 1G5SA 4FZDB 4MVFA 3EFKA 3R1SA 4FTIA 4WIHA 3Q53A 2IPXA 2CGWA 2OG8A 4E4NA 4EC8A 3MS9A 2PZRA 2OIBA 4QPSA 3NYXA 4DGOA 4AOTA 2QNJA 3QHWA 2B9IA 3BHUA 3VAPA 5FUTA 1QCFA 4RVMA 3IGOA 4GK4A 5CI6A 3LIJA 2XKDA 1BX6A 5E4HA 5L4QA 3IKAA 4FV3A 5CU3A 5AUYA 5HCYA 3R73A 3EYHA 1ZAOA 2C4GA 4KABA 4IAYA 4MH7A 3HV7A 2CSNA 3AMYA 4XG6A 3QHRA 2VTLA 3R7UA 2RFDA 1VZOA 5AUXA 4X6RA 4BKZA 2FSTX 4YC6A 4MK0A 3G90X 5DA3A 3GNIB 3TT0A 2YDKA 3AD6A 3ETAA 1JSUA 1PW2A 4FG9A 4O7LA 3NZ0A 4QYHA 3U4WA 1G8SA 1XH5A 5EH0A 3IDCA 3BHVA 3ENMA 4FTQA 1U5RA 3AT2A 4BGGA 3ZSIA 2WMBA 3IG7A 1OL2A 5DI1A 4A06A 4C0TA 3WZEA 5AUUA 3Q4ZA 4G3DA 4IHPA 5CNNA 5DRBA 2OH0E 2UVXA 3ZEWA 4UMTA 5L2SA 3PA4A 1UV5A 4JL9A 4FTJA 4AW1A 4C4IA 1FPUA 2BIYA 3OOMA 5BVDA 5M4FA 3RPOA 2UVYA 4C33A 3OMVA 4BZDA 4RGJA 3OEFX 5M4IA 1OGUA 4EYMA 4IB0A 1WVXA 1Y8GA 3QQGA 5ACKA 3OCGA 4ZTNA 1Q8WA 4BCJA 3IW7A 4KS8A 2CHLA 4FEUA 3MW1A 5BVKA 5FXRA 4XV9A 3CSVA 1OUYA 2OSCA 3CE3A 3AQVA 4BDHA 2RFSA 4OTRA 4W9XA 5HHWA 3ZRKA 2RFEA 1QPDA 2EUFB 1OITA 4FSMA 3PJ2A 5KMKA 3R6XA 4TNDA 4A07A 5EQPA 1ZZLA 2RGPA 5DR9A 2E9PA 1JAMA 3QUPA 4WNOA 5AUWA 3EZVA 4QYEA 2VTIA 3HP2A 3EN9A 5E8ZA 5KMLA 3COIA 5ANEA 5M08A 3R2BA 3POOA 3ATSA 4CTBA 3EQHA 4IX6A 4DH7A 3FI8A 1G3NA 2PVHA 3FQHA 3BELA 5JFSA 5C03A 5DR2A 4B4LA 5AP3A 4YTHA 3UOKA 4J99A 5CZIA 3E8DA 1NVSA 3AD4A 2VWZA 4RC4A 3HMOA 2BDWA 1Q8YA 4ASDA 4B6LA 5HG8A 4FNZA 3V5TA 2WMVA 3UYSA 2EB2A 2VO0A 3DFAA 3LMGA 3NX8A 4CFUA 4MTAA 3WARA 3U9NA 2IVSA 2W1EA 3CTQA 4IAFA 4JIAA 4MXZA 4X21A 3M42A 4BTMA 5A4EA 4U97A 3LXKA 3ANRA 3TIZA 1MQ4A 4RIYB 4TWNA 2BCJA 4EOMA 4E93A 4CKRA 2XIKA 3GT8A 5KMJA 2I0HA 3PJCA 2B1PA 3UG2A 1W82A 2OKRA 4TWPA 2O3PA 4MWHA 3I81A 4XH6A 3DB8A 3L8VA 3WZUA 1B38A 3RINA 3QCYA 2CJMA 4KAOA 4M67A 3F5GA 1H26A 2QHMA 4ZTQA 3UC4A 2ONLC 3GEQA 3WF7A 4F9CA 3Q3BA 5TE0A 1P5EA 2WIPA 4KIOA 2HW7A 1RE8A 2H9VA 3EQPA 4AG8A 3L9LA 4ZJIA 3SG9A 5C9CA 3SG8A 3UOJA 5HIEA 2WTJA 2YHVA 5TO8A 3EL8A 4FBXA 4ERWA 5HBJA 4CFVA 2R3PA 3KXNA 4CMUA 4GKIA 4DTBA 5FM3A 4OT5A 4FICA 4D4YA 4H3QA 5EI2A 3NVMB 5CEPA 5HTIA 3Q60A 3HRCA 4ZOGA 3FC1X 2V7AA 3P7CA 5JFVA 4I6HA 3W16A 4IZAA 3PFQA 2G1TA 2H34A 1M7NA 2QOOA 4S31A 3WZDA 3PJ1A 4OAUC 2OBJA 3O8TA 4BN1A 2OH4A 3FKNA 3VBYA 2YISA 5HNBA 1HOWA 3V5WA 2GPHA 3EZRA 2Z2WA 4DAWA 5IMEA 3NNVA 4R77A 3VIDA 2BKZA 1PXJA 1GZNA 1CSNA 1H1WA 3CY3A 5J9LA 3GC9A 4X7QA 4NT4A 4QP8A 5DNRA 2G01A 5FWKK 4DH8A 5D11A 3QTRA 5FD2A 1XH7A 4AA4A 2B54A 4OBQA 4O7TA 4UWBA 4NK9A 4FIIA 2C0OA 3JVRA 3PIZA 1MRVA 1UU9A 4USDA 4X3FB 4G9RA 1PYXA 2B55A 4J95A 3NS9A 4Z7HA 2BFYA 3HV5A 5B7VA 1PF8A 2JD5A 4YHTA 2WU6A 3UIBA 5IH4A 4E1ZA 4DFNA 4CEGA 2QOKA 3EQBA 4C8BA 2YWVA 4DEHA 5LWMA 2XB7A 4JBOA 4RC3A 3KXHA 5IA0A 3ZM9A 2OXYA 3OVVA 4C7TA 5BYLA 2PMLX 5ETFA 3EN6A 2C5OA 4CMTA 5LXMA 3LJ2A 5CANA 5K3YA 3U51A 4Q2AA 3I60A 5HBEA 4OUCA 1V1KA 5AP7A 2VTQA 2OXDA 4A9RA 4DGNA 4EUTA 3V6RA 4S34A 1O6KA 3Q5IA 4K18A 3BHTA 2B0QA 4GYGA 4IVDA 3RK9A 3FI4A 3EQFA 3U6IA 4ZY5A 2R4BA 2BRHA 4FK6A 2P0CA 4QO9A 4FVRA 3ZC5A 4QMYA 1PXOA 4C59A 4CRSA 2VWXA 3RM6A 3BYSA 2YLFA 3PZEA 4WNPA 5C8NA 3OWKA 4FKUA 2XNOA 4H3BA 1J1BA 1SVEA 2V55A 4NW6A 4I21A 4P4CA 5FP5A 4BDKA 5L2QA 4BC6A 4E3CA 5KBQA 3VRZA 3IO7A 2Z8CA 4CT1A 3NEWA 3HAVA 4BR3A 2EWAA 2WEIA 5M07A 5FEDA 2JAMA 3LFQA 1H8FA 4FMQA 4UN0C 3G15A 4UZHA 5IQEA 1VR2A 3QZFA 4EOQA 4FTTA 5ITAA 4K8AA 2WTVA 4C2VA 5KE0A 3A4PA 3FV8A 5HTBA 5DOSA 5K4JA 2H8HA 4ALWA 2NPQA 4FF8A 3UQFA 2C5NA 5ICPA 4QTBA 3QD2B 4IH8A 4V04A 4S2ZA 4M7IA 1GAGA 2G2HA 4KIKB 5E8TA 2Q0BA 1UWJA 2Z7SA 2F57A 5IF1A 3JR1A 4L7FA 3RK5A 3W10A 4KRCA 2ITWA 3EYGA 2HW6A 5E8UA 5DEYA 2CKPA 3HGKA 2BZIB 3S0OA 4NL0A 1GZOA 3MVJA 3D15A 3QZIA 2QOFA 4QTDA 4J52A 2OLCA 4IADA 1PKDA 2QD9A 2YEXA 4RQVA 3ZM4A 4BDBA 1YHVA 1YXVA 2R9SA 2WKMA 3ZU7A 4HOKA 3O2MA 5HNGA 2YM6A 2QO7A 3ID6C 4F1OA 2WAJA 2EB3A 4IBMA 2V5QA 3DKFA 4FUXA 4MEDA 2YZAA 4DLJA 4EH8A 4F1TA 3BQRA 3SXRA 3MPMA 4N6ZA 3DTCA 3U55A 4H1JA 4M13A 5AAFA 1FBNA 3C4FA 3FQSA 5CALA 3FI3A 3R9NA 4RIXB 4NTTA 3DS6A 5D41A 4XG3A 1XWSA 2VGPA 5J7HA 2Y6MA 3EQGA 3CC6A 3O0GA 3L8SA 3W32A 3C5IA 3GC7A 4CQGA 1Q3WA 2F7XE 3MSSA 1JNKA 4FYNA 3TEIA 3BEAA 3R28A 4V0GA 2HWPA 3PSDA 4YSMA 4BYJA 2J0MB 5CU6A 3FXWA 2AC3A 1XR1A 4F64A 4M8TA 4AZFA 5IQHA 3W2RA 2JBPA 3ZFXA 4F6SA 2Y4PA 3ZO4A 3KXZA 3ZFMA 1MQBA 3LFNA 4KIQA 4TYEA 2UW9A 3WOWA 4UMPA 4NYEA 3NYNA 2XIRA 4ZEGA 3LVPA 2YM4A 3MN3A 1PHKA 4LGDA 3R9RA 3TN8A 2CMWA 3MH0A 2ZV7A 1H24A 3RHKA 3UQCA 1YHWA 4X2FA 3BHHA 4V05A 5L3AA 2YDJA 4G2FA 1NXKA 4FTCA 4M84A 4R7IA 1Y6AA 5EHYA 3LAUA 3RAHA 2PPQA 3ZSGA 5AR8A 5AA9A 1OBDA 1U54B 3P9JA 5J9YA 4L3PA 2OIQA 3BE9A 3D7TA 4X2JA 4APPA 4C37A 2JLDA 4LGGA 3DBDA 3NNXA 4J71A 4AE9A 2DYLA 3PRIA 3F3WA 5J87A 3NMUF 2J5FA 4ZSEA 3F9NA 2FO0A 4ZY4A 5AV2A 3CLYA 3VS4A 4PV0A 5CF4A 3SGCA 2QC6A 3PA5A 4EQMA 3FDNA 3FMHA 4Z9LA 5CENA 3QUDA 4DC2A 5JRQA 3DK6A 4RIOA 4PDSA 4ZAUA 3GCPA 4TKSA 2VO7A 3Q9ZA 4FTLA 3QF9A 2J7TA 4WNKA 3OFMA 5AP4A 4HVIA 1FGKA 4RA5A 3VF9A 4YUQA 3DQXA 2QU6A 3GU4A 3M2WA 4D4SA 4FSUA 2XRUA 3CGOA 3F5PA 1KE6A 3VW6A 5IU2A 4TZRA 3BBTB 4EJ7A 1MP8A 2R3LA 1YHSA 3MY1A 4BCMA 3F3ZA 1ND4A 4R1VA 2C1AA 3IQ7A 4L43A 4IM2A 3HRBA 3IOPA 1CDKA 2WFYA 3ZEPA 4MAOA 3VVHA 5A9UA 1Q4LA 2PSQA 4QP1A 4YLKA 4F9BA 2R2PA 4Z55A 1L8TA 2UZBA 5HICA 5J5TA 4YP8A 3E64A 4MNEA 4BWPA 4RFMA 3PZHA 4U80A 4WG4A 3ZO1A 2GQSA 4JG8A 4I41A 4ANLA 4JX7A 4PMMA 4U8ZA 4U0IA 5FRIA 4EZ7A 3RPYA 4XRLA 2QOBA 1ZRZA 3ZLWA 3DXNA 2BDFA 3R7EA 3IW6A 3WF9A 3RK7A 4K6ZA 2PVRA 4GFMA 5ANOA 3WF5A 2P2IA 4O81A 2WNTA 3Q6UA 4AOIA 2ITVA 3ORLA 1URCA 2OIDA 2R5TA 5ETAA 3R1YA 1UWHA 3QQLA 4O91A 1RDQE 1CKPA 5CAQA 2GHMA 5F9EA 1OM1A 5EW8A 5H9BA 2PHKA 5IEYA 5EQEA 4K77A 2ZV8A 2PZYA 5HI2A 3R30A 4TWCA 5CWZA 2GNLA 4EC9A 3OCBA 2R0IA 3T8OA 2X9EA 3SAYA 4IXPA 3OOGA 3UMWA 4XS2A 4NM7A 4FKIA 3S1HA 3NW6A 4O96A 3MI9A 4L8MA 2BR1A 5HO8A 1Q3DA 3KF4A 4I20A 1CKIA 5IH6A 4UMRA 4XYFA 2J0KA 3BGQA 3F2AA 3KCFA 4I5PA 4BY9E 3HMNA 3PE2A 3TNQB 1BL7A 2WIHA 4JAIA 4NWMA 3LLTA 4DYMA 5EOBA 4MBIA 4IB5A 2YERA 3O17A 4BFMA 4ONAA 4LQMA 4BDJA 4MD9E 3WYXA 3NLBA 2V7OA 3D4QA 4NU1A 1Q5KA 3NCGA 1PY5A 2PZ5A 3R01A 5I9YA 1TKIA 4CLJA 5TR6A 2C3IB 4G17A 4JR3A 3E93A 3JY0A 2O63A 2R3QA 2X2KA 3NWWA 3DKOA 3KREA 2OICA 4FX3A 5AV3A 3DPKA 3IPHA 4TRLA 3G6GA 3A7FA 3BI6A 3FLSA 2R3JA 5EYCA 1OVEA 1YWVA 1XJDA 3P7BA 3MJ2A 3O7LB 3C4ZA 4IWOA 4L44A 5I9UA 5AR4A 3RCDA 2ETKA 5HO7A 2QG5A 3CS9A 3VNTA 4YR8A 2R3GA 4MQ2A 4YZCA 4QYFA 3ZMMA 3WZJA 3R1NA 2KTYA 4BF2A 4BCHA 4DFUA 4L53A 5IISA 4Y72A 3CY2A 4NFMA 4RWJA 3REPA 4JQEA 2IVUA 4OW8A 1PMUA 2FB8A 2AYPA 2VNYA 5FDPA 1URWA 3A2CA 3VF8A 4S30A 4AZTA 4MHAA 3FZ1A 4N0SA 4AA5A 1ZMVA 2UVZA 5HVYA 4GK2A 3QRJA 5HGIA 5EHOA 2W5BA 4PX6A 4LRKA 2OWBA 4DFZE 1Y91A 4OT6A 5KZIA 2XK6A 2XM8A 1U46A 3GXLA 4OTQA 4Y73A 4B7TA 4Y46A 5EW9A 5AUVA 1JBPE 5JH6A 1OIRA 4BDFA 3V3VA 4E6AA 3OROA 4QRCA 3BYVA 4BICA 4CD0A 3DY7A 4F70A 2I0YA 4EK8A 2G2FA 3PG1A 4CSVA 4PTEA 3ZH8A 5I0BA 4E7WA 4R8QA 2FYSA 2F7EE 2UZOA 2XYNA 3AD5A 5BVWA 3SKCA 3FPMA 2JDSA 1FMOE 3CPBA 5HCZA 3D0EA 4C3RA 1H1SA 2OU7A 3TDVA 2BHEA 4FSQA 4GV1A 3FZPA 3P5KA 3BHYA 3EFWA 4EH2A 4R7HA 2VO6A 5HE2A 5LQFA 3RPVA 3R8UA 4M69A 4PWNA 1BMKA 2JEDA 4KNBA 5HU9A 2QCSA 5DT4A 3KULA 3NVKI 5ANJA 3BKBA 5EYMA 3C4CA 3TNIA 2BROA 4F09A 3B8RA 3FHRA 2JAVA 5HVKA 2VRXA 3PTGA 3R8VA 2GFSA 4LI5A 1DI9A 4FC0A 4ERKA 5CEKA 4ZJVA 2CGXA 5I3OA 1APME 4LM5A 3WIKA 3R21A 5CQWA 5DG5A 4B99A 1P4OA 2ZOQA 5ANDA 3B8QA 5FEQA 1K3AA 2ITQA 3UPXA 3PE1A 2YCFA 4IC7A 1OL6A 3CQWA 4DEGA 4EOSA 4RJ6A 2ERZE 3HMMA 4YHJA 4F9WA 4MXXA 4G6NA 3RKBA 4X3FC 3UNJA 1X8BA 4GFOA 1K2PA 4IM3A 4TYHA 3LZBA 2G15A 4XBUA 4EBVA 2XIZA 4JS8A 3KMUA 4C3FA 4XOZA 4YU2A 3TZMA 4AX8A 2A2AA 1QPCA 3A61A 4QP7A 5CEOA 2QKRA 4CGAA 3D94A 5LVLA 3KGAA 5C8MA 2Q83A 5A6OA 5IG1A 3MVLA 5I9XA 5F94A 3T9IA 4N57A 5CXHA 4JBVA 4O86A 4BCOA 4UY9A 4HCVA 4ZZNA 3AC2A 4ZLOA 1FGIA 5DN3A 3NYOA 5HBHA 3DK7A 2ETRA 3GU7A 3HV6A 2IO6A 4U45A 4FV8A 5AUZA 4XP2A 3C4XA 5CQUA 4LL0A 1J7LA 1U5QA 4D9UA 4XG7A 4F6WA 4XCUA 2HXLA 4FEVA 1GIJA 2C5XA 3WBLA 4EH7A 2C6KA 3PXFA 3VO3A 5HNIX 3VN9A 1R1WA 4I5CA 4JDHA 4LV5A 1SNUA 4TT7A 2BILB 1KE7A 3D5UA 2YLEA 3LFAA 2F2UA 3D83A 4OTWA 3NUPA 3HV3A 3T9TA 4ALUA 4R78A 5CSWA 4IZYA 3S4QA 3QKMA 4FIEA 4DFBA 5FBOA 3EQCA 3HMPA 4N70A 4AN3A 4GT5A 5E8VA 5HZNA 4QP6A 3O71A 1FMKA 4IW0A 3NR9A 4PPAA 4BTJA 4CZYB 3DCVA 3BZ3A 4UV0A 3T3UA 5HCXA 4IJ9A 1KSWA 4C62A 4FODA 2FSOX 4R5YA 4ALVA 5L2WA 2VTNA 5DFPA 5ANKA 5HE3A 2XKCA 4ITIA 3UPZA 4D2WA 4AE6A 3UTOA 3NUSA 4QMXA 1SVHA 2O65A 3E8EA 3Q2JA 3K3JA 3FL4A 1ZWSA 4J96A 5KO1A 2VWYA 2WHBA 2HOGA 2R64A 4WRGA 3FXZA 5A4LA 3QQFA 5L8LA 3OW4A 3RZBA 4ANNA 4C61A 3AC4A 5F95A 2JDTA 4WBOA 2XK3A 3C13A 4RX8A 4JOAA 3R7YA 2WQEA 4GK3A 4QMUA 2BRNA 1M17A 1U4DA 3L9MA 5CAUA 5E9EA 3QWKA 3SRVA 3QQJA 4M12A 2W9FB 3QRUA 1TQPA 4FZAB 1OL7A 1ZOEA 4BCGA 1S9IA 2Y7JA 1TQMA 3HV4A 3ZSHA 2YM8A 4L3JA 5M51A 1H01A 4QMVA 4DHFA 3HDMA 3RNIA 1Q8UA 1WBNA 3R2YA 4Y85A 3SD0A 2WMWA 3AG9A 3COMA 2UV2A 4AUAA 4HVGA 2HZIA 1WAKA 4WO5A 2YCRA 2BRMA 3R7OA 3VHKA 4BTFA 4FA2A 4U40A 5JFWA 4GVAA 4H36A 3PSCA 4NUSA 1OB3A 3RP9A 4EWHA 4XV2A 2GTMA 3MY0A 5M06A 3FYKX 3GCQA 3IS5A 4IB1A 4EYJA 4I0SA 2WTWA 3QKKA 3VJOA 4FKPA 4K1BA 2BFXA 3ZHPC 4BI2A 3JVSA 3SOAA 3DFCB 5I9WA 4UEUA 5L6OA 4B9DA 2J90A 4PF4A 3VRYA 3VULA 3AOXA 2I6LA 2CDZA 3HEGA 3QTIA 1NY3A 1R0PA 3FZTA 3JS2A 4UALA 3ZXTA 4D5KA 2E9OA 4BIDA 3K5VA 4W4VA 4FV7A 5LWNA 2NRUA 4LRMA 4PMSA 4ZS0A 5GINE 4D2PA 2W1FA 4HYHA 4ZLZA 2CNUA 2ZYBA 1IAHA 3BPRA 2PVKA 1GNGA 5FXSA 2DQ7X 2XUUA 4I24A 3PDTA 3DBEA 3D2KA 3UIXA 5M4CA 2HZ4A 4ZSJA 4CV9A 5JSMA 3FYJX 1PXLA 2YDIA 3LCDA 2YIYA 3Q5ZA 4HCUA 5ANGA 2C5YA 4EK3A 1OUKA 1O6LA 3CD8A 4YJSA 4BI0A 2BZKB 3KC3A 3V5QA 1RW8A 4GJ3A 4PRJA 4FZFB 3LXLA 3UNKA 3EB0A 3W33A 3FZOA 4HGEA 5K0XA 2CKQA 3EN5A 1SVGA 3GVUA 3TG1A 4GU9A 3W2CA 2QR8A 4PL4A 1KWPA 1FINA 3BRBA 4RRVA 4RX5A 3GENA 4E6DA 3L1SA 3F3UA 3GGFA 1CKJA 4IZ5A 2UW8A 5BMSA 3L9NA 5BUIA 4U6RA 2ONLA 2Q0NA 2WELA 2C68A 4U5JA 3TKUA 3L8XA 4FTRA 4XP0A 2XH5A 3GFWA 4HPUE 4YZ9A 4BDDA 2UZDA 3A8WA 3KU2A 5E8SA 3GCUA 3GU6A 5DRDA 5GJGA 1F3MC 3CP9A 1M52A 3P4KA 4BCQA 4ZZOA 3NRMA 4L52A 4AA0A 1V0OA 2C6IA 2ZVAA 4UYNA 2PVJA 3QZHA 5A14A 4X2NA 2ITPA 4FL2A 3R71A 3D14A 4LFIA 4G3CA 3A8XA 2J6MA 4OTFA 1PXIA 1JOWB 2P33A 2GS6A 3LQ3A 2VN9A 1FVTA 2CCHA 1YWNA 3OCSA 5LMKA 3LLAA 2OZAA 4QMPA 4JXFA 3AC1A 3R00A 2UZLA 4YZNA 1E1XA 3K5UA 3OXZA 4IFGA 3SLSA 3DAJA 3MVMA 2BDJA 2QQ7A 3DOGA 4WG3A 2W4KA 3ZCLA 2RFNA 1BI8A 5JGBA 3ZLYA 3R8ZA 3SV0A 3KFAA 4ASZA 4F9YA 1W84A 2JIVA 4UZDA 4D0WA 5HX6A 4FGBA 4RWKA 4CFNA 1KV1A 2OXXA 4C34A 4E5WA 3UG1A 5AR2A 4AW2A 3RWPA 2OJJA 2QONA 4ITJA 4RX9A 5F4NA 1Z5MA 1ZOGA 2PK9A 3LXNA 3TZ7A 3W2OA 2GNIA 3O96A 1H0WA 2C6LA 5EOLA 4YPSA 3I5ZA 4O7WA 3OCTA 2XK4A 4BRXA 2O8YA 2XM9A 4DTAA 4WUNA 2O64A 4RC2A 4Y5QA 4ZP5A 3W1FA 5C8KA 4MF1A 4FV5A 3SC1A 3F6XA 3ZUTA 5BVNA 1H1QA 2YJRA 4KRDA 5JN2A 1J7IA 1CM8A 3PP0A 4L3LA 4XMOA 4FE2A 4FKRA 2X8EA 4PPBA 3QUEA 1YDTE 3DXPA 3R22A 1Y8YA 4DT8A 5EW3A 5F20A 1OIUA 4JNWA 4FR4A 3R83A 4A9TA 3HA6A 4YJTA 3CJGA 3W55A 4O21A 5KHWA 3QQKA 4HVHA 4FTNA 1DAYA 4BDCA 4O6EA 2HZ0A 4YURA 2WQOA 3FBVA 4MXOA 1F5QA 2W1DA 3W8QA 4P90A 2WMRA 4A4OA 3I7CA 2VTTA 3MB7A 1OKYA 1IRKA 4YZMA 4FEWA 1P4FA 5CSHA 1WBTA 3E3PA 3ORMA 4UXLA 3K2LA 1W0XC 4GIIA 3F2RA 4D9TA 1MUOA 4KB8A 4IJPA 4PPCA 2YABA 4RLKA 4ARKA 4UX9A 4E8AA 2XIYA 3GP0A 3DLZA 4ORKA 3I5NA 3MPAA 2WMXA 4Z7GA 2GNGA 4R6VA 3ZC6A 2HIWA 2XEZA 1UKIA 3TNWA 4KBAA 4AN9A 3O23A 4RVKA 5KNJA 3DGKA 4NW5A 2YJSA 4DA5A 3KULB 4PQNA 3EJ1A 2GSFA 3TM0A 5DH3A 1Z57A 2VTOA 1OL1A 2UW3A 3HL7A 2WU7A 2W99B 4H05A 2OK1A 2V22A 2R7IA 3FZRA 4G3GA 4CVAA 3H9RA 3HAMA 5CU0A 3RM7A 2O0UA 4QMNA 3EKNA 3H0ZA 3NNUA 4BIBA 3E7OA 3Q32A 3OWPA 3LCTA 4FEQA 4FT0A 4QMQA 3BV3A 3FMEA 5CZHA 4E4LA 4EQUA 5K4IA 3QYWA 4O1OA 3GQIA 4U7ZA 3OHTA 4EKKA 4EONA 2ITXA 2W05A 1DAWA 3HDNA 2O2UA 4JIKA 4E73A 1YXSA 2J5EA 3VHEA 3TTJA 2VTAA 4QTEA 4PTGA 1LPUA 4TYHB 3JYAA 2JITA 3DT1A 3MPTA 4DEIA 2WMQA 3POZA 5J8IA 4AXAA 4YJVA 4HZSA 3FY2A 4L46A 5B2KA 5HVJA 3KY2A 4NCTA 3MWUA 4TTHB 2ZMDA 4M0ZA 4P7EA 4U43A 4DG2E 3UNZA 3HVCA 1ZARA 4EJNA 2QU5A 4BWXA 3FWQA 3FMLA 4B8LA 3Q96A 4PNKA 3KQ7A 3ULIA 3B2TA 3D5XA 2BIKB 4YJRA 4FTMA 3FMKA 3ZTXA 5AM6A 3PPKA 2V0DA 4FL3A 3LFBA 4QP2A 4IEBA 4JLCA 2Y6OA 4BCFA 4AOJA 4JR7A 1HCLA 4W8EA 4PNIA 3MH1A 2X8IA 2YIXA 3MY5A 3A99A 3HUCA 3QCQA 5CF6A 1YQJA 3F2NA 5GZ8A 4FGRA 4X2KA 1YRPA 4NEUA 1LEWA 2C6MA 2XZSA 4I4FA 4JJRA 3TZ9A 3IOKA 2PY3A 4FSTA 5IMXA 5AR5A 2GNJA 3O8PA 5E8YA 2GS7A 3ZRMA 1A9UA 4W8DA
chains in the Genus database with same CATH superfamily
3AMAA 4HYUA 1PYEA 4NFNA 4NTSA 4FSYA 3PPZA 2UZTA 3QD4A 2JBOA 2UW0A 1UU3A 3FKLA 4EORA 5HTCA 3ZO3A 2HK5A 5L6PA 4IX4A 1OKWA 2EXEA 3OC1A 5J1VA 3LCOA 3QALE 4F1MA 3BYOA 4G5PA 5FDXA 3VUMA 3H30A 5HD4A 3DJ7A 4B0GA 5JQ8A 5E90A 2GNFA 2HCKA 2X7FA 4MNFA 4NKAA 3VQHA 2PE1A 3GI3A 2VGOA 4RZWA 4BIEA 5IUHA 2PMNX 3P7AA 4IM0A 2RKUA 4F9AA 4ZK5A 5LMAA 3E3BX 4QNYA 2C3LA 3W0MA 2C6TA 2XANA 3RCJA 4BCIA 5EI6A 2C6DA 4DHJA 5H8EA 3LQ8A 4IWQA 5JFXA 3ANQA 5DLSA 4MWIA 2XJ0A 1PMNA 3EN7A 3IDBA 4MF0A 5EDRA 3NUNA 3S00A 1IAJA 1OKVA 2JFLA 3QAME 3F69A 1NA7A 2VO3A 1YWRA 1WBPA 5CYIA 3N9XA 4WBBB 3HLLA 3BBWA 2HZNA 4Q9ZA 4YHFA 2PE0A 1J1CA 1ZMWA 4JDIA 5IH5A 3JUHA 4NJ3A 4H1MA 5CASA 4KKGA 4UYAA 5EM8A 1U59A 3CIKA 2X39A 3V8WA 4EOPA 2IW8A 1VYZA 4QQTA 1B39A 1B6CB 1JWHA 2OJIA 2P2HA 3EH9A 4KS7A 4BZNA 2XKEA 3MFSA 3ALOA 4ZSLA 2EXMA 2A1AB 4CCBA 2PULA 4YTFA 2W1HA 4ZTHA 3BYMA 3RZFA 3JY9A 4FKTA 3FE3A 3CKWA 1KE9A 3TMOA 3IGGA 3QLGA 3UOLA 4W4YA 5E92A 1YXXA 5EKOA 5L6WL 4C4GA 3ZBXA 4HVSA 3UO4A 3I4BA 1YXTA 4Y95A 1GZKA 3E8NA 3QX2A 3G5DA 3UVQA 4APCA 3QU0A 4U3YA 3DJ6A 3F66A 4GVJA 5AUTA 2ITUA 3BLHA 4IDVA 1O6YA 4AN2A 4LMUA 3OXTA 1GZ8A 4W4XA 4KBCA 5ETIA 3DQWA 4JG6A 2GDOA 5CU2A 3R0TA 3R9DA 3UC3A 4BKYA 4YTCA 2PUNA 4DF3A 3DZQA 4AGUA 2GFCA 3NAXA 1PRYA 4I0TA 2J9MA 2C0TA 2WTKB 3EMGA 4RSSA 3TNHA 4O7NA 4AS0A 4GYIA 2QLUA 4YZBA 2X2MA 4JT3A 3LFEA 3O51A 3TNPC 1M2RA 4GG5A 2PMOX 3I79A 5ACBC 3BLQA 3CPCA 3PWDA 3UMXA 5LOHA 4MQ1A 3A7HA 5IQCA 2J2IB 4AFJA 1H28A 4HNFA 3UYTA 3P79A 3LQ5A 4KD1A 1WVWA 1YOJA 1JSTA 4AT3A 2FH9A 4ENXA 4I0RA 3II5A 3S2PA 3PLAE 1XH8A 3FLNC 3MA6A 2R3MA 5IQIA 4FV1A 2JKKA 4AF3A 3BGZA 3FY0A 4JBPA 5CVGA 3VWAA 3UO6A 2EXCX 3ALNA 4C4HA 5IA4A 2B4SB 4AGCA 4YPDA 3TXOA 3C0GA 3QLFA 2R3NA 4YBKA 4MD8E 4NM3A 4BL1A 5BVOA 2Z7LA 5TF9A 3VS3A 4O83A 4FSRA 3KXGA 5C27A 2UUEA 4EH9A 3QRTA 1PXMA 5CI7A 2C0IA 5FQDC 1JPAA 4BTKA 2PL0A 3I7BA 3KEXA 3BL9A 2QLQA 4I23A 4RJ5A 4GUEA 4GJ2A 4I22A 5DE2A 1W2FA 2JKQA 3D5VA 1K9AA 4PP7A 2XAOA 4BHNA 4QYYA 4KSPA 3GFEA 3IONA 4PMPA 3MH3A 1XO2B 4AT5A 3P78A 4CYJA 4JRVA 5IUIA 3UZTA 2ITTA 4LOOA 5E1EA 1H1PA 5D12A 2C47A 3G0EA 3LCKA 1REKA 3A7JA 4FT9A 5JRSA 2GQGA 2XJ2A 2IW6A 2ZDTA 3MIYA 3E87A 2R3FA 4O0WA 2X9FA 4EWQA 1M14A 2XNEA 1UKHA 4GSBA 5J1WA 5HOAA 3NYVA 2VTPA 1YDSE 3DLSA 5CT0A 4EOJA 4Q5EA 4IIRA 5IQDA 3A62A 4WSYA 3OF0A 2OZAB 3WF6A 5BQ0A 2OGVA 3UODA 2PUUA 2OFUA 3ZDIA 3LW0A 4QD6A 4DEDA 4FZ7A 2UW5A 2QI8A 4LUDA 4LOPA 4DG3E 4AZWA 5A4QA 1ERKA 4G5JA 4XV1A 4FV0A 4AWIA 2PZIA 3DK3A 5KZ0A 3IW4A 2ITNA 4RJ7A 3H9FA 2QOQA 2C5VA 4Y5HA 2WTIA 4BBEA 5EM5A 4YO4A 1OBGA 1UU8A 2Z7QA 4UWYA 3E92A 3VS2A 1XKKA 4TYJA 4F08A 2WXVA 3LM5A 3PJ3A 4ANMA 3DNEA 5JEBA 4FI1A 3TCPA 2JFMA 3PVGA 3KRWA 4I93A 1XH4A 3FZSA 3OBGA 1XQZA 3ML1A 3NNWA 3ACKA 4H3PA 4BDGA 3MYGA 4GMYA 4WG5A 2IG7A 1CMKE 2IZUA 4DBXA 4DE4A 2VX1A 4C35A 3FLWA 4IE9A 4BBMA 1Q62A 3PUPA 3MESA 2E9UA 2PVYA 3VUGA 2UZVA 1FVVA 2VWWA 3OW3A 2BZHB 4FIJA 3MH2A 5CSVA 5L8KA 3MFUA 2IZTA 3AT3A 5I5ZA 3P08A 3L8PA 4LV7A 4R1YA 2YZLA 3QXOA 1G8AA 5BYZA 4CYIA 3RAWA 2JDRA 1YDRE 5J5SA 3DNDA 4QMTA 3I6UA 2VU3A 4AGWA 4K2RA 3UIUA 1T45A 4O7SA 1NVRA 2X4FA 3OY1A 4XG2A 3NIZA 3G2FA 2PVLA 2ZM4A 3MVHA 4ZJJA 3QTSA 3N51A 3WYYA 3FI2A 1XH9A 2OI4X 3R04A 4O0SA 1E1VA 4TPTA 3VS6A 4BB4A 4E4MA 3U4UA 5AM7A 3KXXA 4W4WA 3SXFA 3BWJA 4EH5A 5BMMA 1OPLA 4ZTRA 5TT7A 3RI1A 4PDPA 3ORXA 5FEEA 5AP0A 3LM0A 3OTVA 4GH2A 4OTDA 1IEPA 1KV2A 3Q6WA 4X3FA 4DINA 4FOCA 4YGAA 4CTCA 5AV4A 2QOHA 3GC8A 2G2IA 3VJNA 2VNWA 4I92A 5A3XA 3Q2MA 3DDPA 4ZTLA 3UGCA 2W5HA 5EM7A 4DTKA 3E8CA 4XLIA 3NW7A 3IW8A 4IC8A 3FAAA 5HG9A 4GCJA 1IA8A 3GCSA 2ZB1A 3QQUA 3HKOA 4IQ6A 2AQXA 5HIBA 4ACDA 4BKJA 1OMWA 2RG6A 5HKMA 3RNYA 3DU8A 4Z3VA 3QGWA 3ZLXA 5GHVA 3PY0A 4K0YA 3TUDA 5C4LA 4JDJA 3EIDA 5DWRA 3ATTA 4BDEA 2YACA 4YO6A 1VYWA 1FQ1B 3OP5A 3LCSA 4L45A 4O2ZA 3E88A 2H6DA 2R3KA 2VUWA 1ZOHA 4FKSA 4EUUA 5BVFA 2C69A 2BRBA 3DBQA 5H8BA 5HLWA 3WZKA 5L2TA 2DS1A 2C6OA 2IZRA 3WILA 5H8GA 4DGLC 1UU7A 5E91A 2PVMA 1W83A 2IVTA 5CEIA 3KRXA 4QPAA 5AV1A 1ZYCA 3KK8A 2JKOA 1RQQA 4ANOA 4D1SA 4ZZMA 1J91A 3FMMA 1IG1A 2VD5A 2GS2A 3MV5A 1IR3A 4XX9A 5DVRA 4BYIA 4RBLA 5JT2A 3W0SA 5CXZA 4HGTA 4WT6A 5E8XA 1YXUA 1XHAA 3G0FA 3W0QA 2FUMA 3UP7A 2BMCA 4WSQA 1WBWA 3C7QA 3A60A 2XK8A 3Q4TA 1LUFA 2BHHA 2HELA 4O0XA 3RWQA 1AGWA 4FNXA 4FKOA 3OEZA 5IDNA 1OPJA 4FOBA 2VX0A 4RMZA 5GNKA 2WZJA 3DBFA 4O4CA 4P5ZA 1M2QA 3OG7A 4FSWA 4MX9A 1ZY5A 2GCDA 4NIFA 4HGLA 4KWPA 3TKIA 2DWBA 2HY0A 2IZSA 5CEQA 1OZ1A 3R1QA 3G33A 4W9WA 4FNYA 4V0GB 1H08A 4DG0E 2XCKA 3TV7A 4CLIA 3CEKA 4ZIMA 2VWVA 3HP5A 4FV2A 3UVRA 4XBRA 2W17A 4HPTE 4I6FA 4AU8A 4F7LA 5M56A 4EHZA 5FLFA 2ZDUA 4OBPA 1OIQA 4JQ7A 4ZSGA 1G8JA 3MFTA 1TVOA 2YAKA 4GKHA 4EK5A 4TYIA 4RIXA 3NUYA 4U3ZA 4UMQA 5EYDA 1J7UA 1KUTA 2W4JA 3PIYA 2ZMCA 4AW0A 4F7SA 3RJCA 4FG7A 3KA0A 2OF4A 2XNPA 5HLPA 3H4JA 2W1GA 3HUBA 4R3PA 4A9YA 4RA4A 3F5UA 3NUUA 3Q9YA 5EKNA 5EM6A 3F61A 2RG5A 3D7TB 4FIFA 3ZDUA 5CSPA 2X0GA 1Q41A 2I0VA 5CAVA 2XKFA 4CG8A 4E5AX 4J7BA 3KKVA 4NH1A 4XUFA 5CF5A 3K54A 4WUAA 2WB8A 2BTSA 2ESMA 3OXIA 4J98A 5M4UA 1WFCA 3DBCA 4ANQA 2J0LA 4RWIA 3U54A 1Y6BA 4YC3A 3W0PA 3LFFA 4DGMA 4HGSA 4RJ8A 4KKHA 4XJ0A 1YKRA 3QA8A 4XG4A 3AKJA 2GQRA 4C57A 1XMMA 4CFXA 2IJMA 4O0YA 1OI9A 5M57A 1YOLA 2F7ZE 1U54A 3ZO2A 4G31A 3NW5A 4CFWA 4M68A 2CNQA 2WGJA 1YOMA 5F1ZA 3BE2A 1ZYJA 4DCEA 4NM0A 4E20A 5FTOA 3TDWA 4ACHA 2KULA 4HCTA 4PY1A 5CSXA 3CBLA 1YI4A 4IDTA 5JGAA 5FTGA 3DA6A 3VS7A 3KMMA 3EQRA 2X0OA 3H3CA 3KB7A 3TL8A 1OL5A 5CAOA 4LYNA 3GQLA 4EOIA 4S33A 4G6LA 4NKSA 3KRJA 4QP9A 4K9YA 3TUBA 1GIHA 4YTIA 4MNEB 3DB6A 5KBRA 4R5SA 4D2RA 3MGYA 4ASEA 4F0IA 5C4KA 4Z16A 2BZJA 2AUHA 3CD3A 3HMIA 4G3FA 4L01A 4FKQA 4WD5A 2HYYA 3KL8A 4D58A 5IA1A 1MRUA 1SNXA 4A9UA 5CU4A 2WQNA 2A4LA 1F0QA 4U81A 3TV4A 2P3GX 4G3EA 3V6SA 4KUJA 3BIZA 4F78A 2X6EA 4QMWA 3ACJA 2LAVA 2UZUE 3H10A 3I0OA 1OECA 4IWDA 4BHZA 4EH4A 3AMBA 2HENA 2WOTA 4QP3A 2R3HA 3KN6A 3PRFA 5E8WA 3QC9A 3TTIA 2VTJA 3BYUA 1JKKA 1GY3A 1R78A 4GIHA 2YIRA 4FZ6A 4B8MA 2YA9A 3RPRA 1GOLA 4QDVA 3GU8A 3MTLA 2XBAA 4GT3A 2C30A 3FL5A 4PMTA 5T3QA 2IW9A 3UQGA 5LMBA 2NNWB 1NW1A 3KRLA 3CQUA 3FKOA 3VUTA 4AZSA 2QG7A 3SOCA 4UBAA 5EDPA 3RALA 1H27A 4PL3A 3OUKA 4FT5A 4PP9A 2V62A 3EQDA 1I09A 3QC4A 3UJGA 2YN8A 3L9PA 3C9WA 2SRCA 3EFJA 5CS6A 3UDZA 3BU3A 4QTAA 3F5XA 5LVOA 2F9GA 2Y4IB 3FLQA 3PVBA 2WD1A 4TXCA 4X6QC 3V5PA 4EH6A 5CAPA 2Z02A 5DYJA 5AEPA 4ZTSA 5E1SA 3LMIA 4GL9A 3ZBFA 2QHNA 3ULZA 4A9SA 4OAVB 1SZMA 3CR0A 4JVGA 5BV3A 3DKCA 4Y8DA 3K3IA 5HLNA 4OTHA 4FJVA 3HRFA 3P86A 5HX8A 3G9LX 4HW7A 2XMYA 2ITYA 1WBSA 2WTKC 5HU3A 4M15A 1YI3A 3VS0A 2B52A 2X7OA 4R3RA 2B9FA 2J0IA 3PVWA 3KRRA 3TI1A 4ANBA 3QGYA 1H25A 4IANA 5DGZA 2C6EA 3ORPA 4UWCA 4IAIA 3OD6X 5M44A 4FIHA 3Q4CA 4PL5A 5GJDA 4BDAA 4F4PA 3D2IA 2CCIA 2FA2A 4GW8A 5CVFA 3RBWA 4DH1A 1ZZ2A 3E63A 4BGHA 5LCJA 4J8NA 1QPJA 5B0XA 3PFYA 1JVPP 1WBVA 2QR7A 3LPBA 1H4LA 2YAAA 4DEEA 5KCVA 2YFXA 3AC5A 3EN4A 3FUPA 2WMSA 3QD0A 4MXAA 3WF8A 4QYGA 2W96B 2Z60A 3QQHA 4CRLA 5KKRB 1R39A 2XNNA 5GZAA 4N6YA 3LFCA 4MD7E 2C1BA 2WTDA 3ZOSA 1A06A 3MJ1A 3BU6A 2B7AA 3LJ0A 5IA5A 4L9IA 1O9UA 1I44A 5KMNA 1KE5A 3C0IA 3ET7A 4FV9A 4YLLA 3QL8A 2B53A 3VS5A 5AWMA 4CKIA 5EFQA 4C4EA 4LOQA 4TWOA 4XLVA 2Y0AA 3ZS5A 1VJYA 4H58A 4O4BB 3TV6A 4O0TA 4FNWA 5JMSA 2OFVA 1ZXEA 1HCKA 3PXYA 1Q97A 2UW4A 4O7ZA 4RIWA 2IVVA 4RVLA 3A7GA 3LHJA 4ZTMA 4YC8A 4YLJA 2YIWA 2XF0A 3ORTA 2OJFE 1XH6A 3PYYA 1H07A 3R63A 3V51A 2X2LA 2NP8A 5KMIA 4MUQA 2ITOA 4L7SA 5I4NA 3W0OA 4AXCA 2XCHA 3C4EA 2XBJA 2CGUA 2JKMA 3AGMA 3TZ8A 5AV0A 3O7LD 1OKZA 4I6BA 2IN6A 4D28A 5KX8A 3P23A 1JKLA 2OJ9A 4JRNA 4QT1A 5I9ZA 1VLRA 2VX3A 2J51A 3NIEA 3OWLA 1WZYA 2R7BA 3COKA 5D10A 3PVUA 3QRKA 5DR6A 5BUJA 4BZOA 5LMKC 2J4ZA 2UZEA 4UXQA 2JGZA 4UMUA 4YMJA 4EL9A 2Z7RA 3FLZA 4F6UA 4DHZA 3BL7A 2ACXA 4GUBA 4GEOA 5AJQA 5HG7A 5C26A 5L8JA 1BLXA 3AC8A 1H0VA 3UP2A 3FC2A 4JG7A 4C36A 4FTOA 4QNAA 3NAYA 2XARA 1QPEA 1M7QA 4IVAA 5GJFA 5AA8A 5BX0A 1NVQA 3NSZA 3PSBA 4LGHA 3THBA 5T68A 4KA3A 4NM5A 4O2PA 2QO2A 2VV9A 5GZ9A 4M69B 5AX3A 3QXPA 2WEVA 4YNOA 1DS5A 1PXKA 1PMVA 3C51A 3GU5A 3PIXA 2XK7A 2AEGA 2PUPA 4RWLA 1DI8A 4HYIA 3H0YA 5TKDA 3VUIA 3PXZA 4BCKA 2WOUA 4DT9A 3EWHA 3PA3A 4QMMA 1JKTA 4LG4A 1S9JA 1Q61A 3QD3A 4E26A 4QMZA 4F99A 4I3ZA 3W0NA 2ZFYA 4AACA 5EK7A 2QURA 3S95A 5CTPA 2E9VA 2BTRA 5HEZA 3NUAA 4NZWB 3V8TA 1H00A 2ETMA 1YI6A 3U9CA 3VBTA 4C4JA 3MTFA 4XV3A 4JAJA 3SA0A 2VWIA 3R9OA 5IQFA 2RIOA 4O0RA 4CXAA 5H2UA 3EFLA 4IMYA 2VZ6A 3B2WA 3KN5A 3RAKA 3LKMA 5KMMA 4XG9A 3UOHA 1XBBA 2HAKA 3KVXA 3V8SA 5AP1A 3U6JA 3HZTA 3LMHA 3U8WA 3FLYA 1ZLTA 1MRYA 3FMNA 5A4CA 4O7RA 4I6LA 2XJ1A 3QA0A 4RQKA 4Y83A 4GT4A 3C0HA 3DZOA 4KINA 4YJNA 3VBVA 2X4ZA 3FHIA 4AW5A 4L67A 1WMKA 4FIGA 1Y57A 2QOLA 5H3QA 2HY81 4KSQA 3DV3A 4WNMA 2UZNA 4EHGA 5I3RA 4F7JA 4PUZA 3PPJA 1VEBA 3G9NA 4BCPA 2UW7A 1BL6A 2IWIA 1WCCA 2JIIA 3V04A 1JQHA 4J53A 4USEA 4C02A 4A4XA 1CTPE 4M14A 1RJBA 4MYGA 4X3JA 4F0GA 4U42A 5JQ5A 4HJOA 4P2KA 4FTKA 3TACA 1Q24A 4BCNA 1UNHA 3PG3A 3QBNA 2BRGA 3VBQA 2HXQA 2OF2A 4IWPA 4OLIA 3E7VA 4XHKB 4C2WA 2WO6A 4YSJA 4D2TA 4NIFB 5AIRA 4OGRA 2PYWA 4I5MA 5CY3A 5A4TA 4XOYA 2BAJA 4ZY6A 3VUDA 2R3IA 2I40A 3BV2A 4WOVA 3KMWA 2YIQA 3ELJA 3Q4UA 5M55A 3EQIA 3DAEA 4OBOA 2QOIA 4XRJA 5LARA 5IZFA 1ZYSA 4CCUA 4UB7A 5J9ZA 4AXEA 3CJFA 3IECA 4L00A 4NCTC 2R0UA 5IA3A 4ANSA 3DAKA 4WRSA 4AAAA 3LXPA 4JDKA 1UNGA 4N4SA 2F2CB 4QMOA 4QP4A 5FBNC 3SVVA 3BU5A 3O50A 3R8PA 3V01A 2C3JA 3VUHA 3QFVA 3PWYA 2ZB0A 3PXQA 4FKVA 4M97A 1OIYA 2A0CX 3MIAA 5AR3A 4ZMFA 5A6NA 2XNBA 2W06A 2XYUA 5CLPA 4D1XA 4ZSAA 5K5NA 2BAQA 3DDQA 2ITZA 3IW5A 4HYSA 4O6LA 4TN6A 3R7GA 4U44A 4CQEA 5G6VA 4BI1A 1V0PA 2G9XA 2EVAA 5KHXA 2B9HA 2LGCA 2QO9A 5J95A 3SRVB 4AXFA 3RTPA 4CFMA 5IQBA 2RL5A 1GIIA 3S3IA 2BKKA 4H39A 1ZMUA 4LRJA 4I1ZA 2YITA 2X8DA 2YM7A 1Z9XA 3COHA 2X6DA 4CFFA 1YW2A 3FEGA 4ZMEA 3W8LA 5BUEA 4FYOA 3GB2A 5IKWA 4ITHA 4CNHA 3EL7A 4TYGA 4MXYA 4G6OA 1XBAA 1DM2A 1H1RA 2WMAA 5FTQA 3VC4A 3ZUUA 3ZZEA 4EZ3A 5JKGA 3ORZA 4QOXA 5T6KA 3ITZA 3EHAA 3GCVA 3WI6A 2EU9A 3ORKA 4OTIA 4XNEA 5CVHA 1ATPE 4RFZA 1LR4A 5HO6A 4FT3A 4LL5A 3NUXA 2BAKA 5LVMA 4AZEA 1FOTA 4X2GA 4CMOA 4AQCA 2CNVA 4YBJA 3R9HA 5B2LA 5DT3A 3ORNA 4MBJA 2X7GA 3DKGA 2JC6A 3AC3A 3OY3A 2BALA 3NCZA 5DHJA 2CLXA 4FG8A 2NRYA 2E9NA 3FSFA 4MCVA 1SMHA 2PVNA 5J7BA 5K9IA 4AGDA 2FVDA 3AGLA 3CKXA 3T3VA 5FXQA 1TQIA 3V5JA 3ZFYA 5DMZA 3EOCA 5I9VA 4FL1A 4BJJA 4D55A 2PVFA 2XNMA 4JI9A 3QCSA 2ZM3A 1AQ1A 3ZUVA 3C4WA 2PWLA 3QCXA 5EYKA 5HE0A 4DFLA 1XMLA 2XNGA 1KE8A 2GTNA 2RSVA 3F7WA 3G51A 3C50A 4K11A 4U79A 3AXWA 2WMTA 3MDYA 2CN5A 2ZV2A 3HX4A 3P0MA 4GS6A 4AP7A 5B2MA 4IAAA 5LVPA 3HA8A 5IDPA 2XK9A 1WVYA 2WQMA 1ZY4A 4KBKA 4LV8A 4S32A 5D7AA 4ZXTA 2W1ZA 4EZ5A 1ST4A 3WIGA 3A4OX 4FKJA 4QPMA 2W1CA 1NT2A 3NPCA 4FV4A 5DPVA 3DXQA 3F82A 4FTAA 2WQBA 2PE2A 5IUGA 2PZPA 3ODZX 4ACGA 4HVDA 4J8MA 4DN5A 4C3PA 5LVNA 5BNJA 4L42A 2F4JA 4FVPA 3UZPA 4O7YA 3PJ8A 2GHLA 3C1XA 2FSMX 3F3TA 4G16A 4O38A 2YCSA 2I1MA 5DBXA 4BDIA 4CV8A 4E6QA 1W7HA 4EH3A 4GG7A 2O5KA 3FQEA 4C38A 2VTRA 2VAGA 1ZYDA 4DGGA 3TIYA 2PUIA 3FPQA 2CGVA 1IASA 3BCEA 2VWBA 1WBOA 2JDVA 3R7IA 3HECA 4FK3A 4O0VA 1QL6A 3U87A 2PU8A 3BX5A 3CCNA 4ZS4A 4O0UA 1LP4A 4IZ7A 1LEZA 1XBCA 4QEBA 2BVAA 3SQQA 1BYGA 5HQ0A 3UVPA 2OZOA 5CEMA 2Y9QA 4E5BA 3OZ6A 3Q9XA 3QWJA 4XG8A 3OT8A 5D9HA 2VWUA 1W8CA 3O8UA 4FRFA 4EHVA 2QOCA 5HESA 4FEXA 2W1IA 3Q52A 3RAIA 3A7IA 3I6WA 5FGKA 5ANIA 4CT2A 2AC5A 4DH3A 1PKGA 5L2IA 4WHZA 2NO3A 4EKLA 3KCKA 5KMOA 5DEWA 4FV6A 3FSKA 4J97A 2PMIA 3KK9A 1ZYLA 5EHLA 4O82A 5D1JA 3ROCA 5AFVA 4E6CA 4EI4A 2QKWB 3MFRA 3OT3A 3D7ZA 4EOKA 4TL0A 4E4XA 5EQYA 3GBZA 4MXCA 5CT7A 3UDBA 5CF8A 4IAKA 3GOKA 3TWJA 5AAEA 5IEXA 4YJUA 3MBLA 2B9JA 4AT4A 4RIYA 4IVCA 4RX7A 2Y8OA 4RZVA 3QRIA 2GNHA 4IFCA 4YJOA 4O27B 5JK3A 2R3OA 3KXMA 2XALA 3FMDA 3G6HA 3ERKA 4OTPA 4USFA 4DFXE 1KOBA 2YCQA 4YJQA 1FVRA 2OJGA 3AT4A 3JPVA 4J1RA 2Y4IC 4L6QA 5EG3A 5FG8A 4CZUA 4DITA 3AKKA 5CX9A 4MKCA 4QMSA 5A46A 3LFDA 2E2BA 5AX9A 3UIMA 2VTMA 1JLUE 3PLSA 3ZZWA 1SYKA 3CTJA 3N4UA 4ZLYA 2P55A 2XRWA 4O84A 4RIWB 3RHXA 1PJKA 2J50A 5K0KA 3CXWA 3PY3A 3JXWA 4GFGA 5IA2A 3QZGA 5AADA 5KUPA 5HORA 4ASXA 3ZLSA 1PMEA 4QQJA 4TW9A 4A7CA 1BI7A 1UVRA 4II5A 3BQCA 3C5UA 4D2VA 5HD7A 4EEVA 4CG9A 4HZRA 3ZONA 4WKQA 2CN8A 3Q9WA 4RLLA 5LCKA 4F63A 2W0JA 5JZNA 4JX3A 4FTUA 4EK4A 2RF9A 4XEYA 4F7NA 4RJ4A 2XS0A 4P5QA 2QVSE 4FT7A 4PDYA 5AP5A 2H96A 4O22A 4V01A 1AD5A 3R8LA 2GHGA 4G1WA 3SHEA 3SW7A 4KKEA 4R3CA 3PY1A 4EQCA 1V0BA 3UO5A 4D2SA 2OW3A 1BUHA 1KOAA 3IK3A 4MBLA 2GU8A 2W7XA 3SX9A 3F3VA 5HG5A 1QMZA 5M53A 1PXPA 1YVJA 3MB6A 5A54A 2ZJWA 2XP2A 1P14A 3DJ5A 4O1PA 3ENHA 5KKRC 2CPKE 4HNIA 5HE1A 3R7VA 2CKOA 3W0RA 4PDOA 3OUNB 3PUFC 2YM3A 2ZV9A 4QQCA 3U6HA 3FXXA 3VW8A 4I94A 3CGFA 1PXNA 5FP6A 1OPKA 1W98A 4GU6A 4OR5A 3NGAA 3NDMA 3RGFA 3F7ZA 3H9OA 3OBJA 4M66A 5D7VA 3W2PA 5AAGA 5GIPE 3SXSA 2W4OA 1R3CA 4RPVA 4M0YA 3OS3A 5JZJA 4ACCA 1Q8TA 3FJQE 2I7QA 2BUJA 4KIPA 4F0FA 3D5WA 4YJPA 2CLQA 3M1SA 4RVTA 4RFYA 5EI8A 4R7BA 4I4EA 3R02A 4DLIA 1E9HA 5JGDA 1SM2A 2UW6A 4RJ3A 4EHEA 5IEVA 5AR7A 4X0MA 3N4TA 1J3HA 4ID7A 2ERKA 3Q04A 5K5XA 4C58A 4FSNA 4FUYA 4QMLA 3QTQA 4LUEA 2F49A 3V5LA 5DT0A 4O7VA 3ZXZA 4A4LA 2P4IA 3GOPA 4I6QA 2FGIA 2DUVA 4YNEA 1Q99A 1M2PA 3OTUA 2VTHA 3BEGA 4F65A 1STCE 3SW4A 4CKJA 3PXRA 3LE6A 1EH4A 3KF7A 4IB3A 2WTCA 3BWFA 3N4VA 3WE4A 3R8MA 5BYYA 4G34A 2XIXA 3W2SA 1P2AA 3M11A 4BBFA 4DH5A 3I0QA 5TOZA 3IDPA 3ROYA 3BGPA 3CQEA 3RVGA 3QTUA 3VBWA 2X1NA 1UNLA 2JIUA 2REIA 4K33A 4PTCA 4TNBA 4U41A 3DTWA 3QTWA 2I0EA 5GIOE 4ACMA 3ODYX 2A19B 1Q8ZA 4EOOA 2CKEA 4Q5HA 1BKXA 2YWPA 3ORIA 3MA3A 5DIAA 4I5HA 3QTXA 3D9VA 3I1AA 5E7RA 5AP6A 3VUKA 3TJCA 2W9ZB 4AFEA 5C1QB 2YM5A 4D1ZA 3WE8A 3TJDA 2OO8X 4FKLA 1GJOA 4IX5A 3VQUA 5IQGA 5HIDA 3SDJA 4GRBA 4NSTA 2ZAZA 3ZRLA 3W2QA 4D4RA 4DBNA 4FKGA 1T46A 4KIKA 2J0JA 4BGQA 3EKKA 3QYZA 3OWJA 1REJA 5ETCA 2XEYA 3VBXA 5J79A 4U9AA 3RMFA 3VS1A 2ZM1A 3UBDA 3FMJA 1UA2A 5C01A 4AZVA 5IPJA 2W5A