4C61A

Inhibitors of jak2 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
272
Chain Sequence
b'FEERHLKFLQQLGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQAHAERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Discovery of 1-Methyl-1H-Imidazole Derivatives as Potent Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 272
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c61A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c61A01
2HZIA 1BKXA 4ENXA 5JSMA 4ALWA 2UZVA 1WVXA 4CT1A 2BDFA 5HI2A 3EJ1A 1IG1A 5HG7A 4LMNA 4RG0A 2A0CX 2QC6A 4MF0A 4BDDA 1A48A 4KUJA 3WARA 2R3MA 2GCDA 1O6KA 3UQCA 2WFYA 4FV5A 3UVPA 2C1BA 3DB8A 3OCGA 5DFPA 1JKSA 3POOA 2OKRA 3UVQA 3MVJA 3VBWA 3QZIA 2VNYA 4F9YA 2G2FA 2PVFA 2R3LA 4EHEA 4EWQA 3P1AA 4Z7GA 3AMBA 4YR8A 4YJRA 3ZZEA 2WMQA 3PY1A 2QLQA 1OL7A 4NM5A 4F63A 5DEYA 4XYFA 5I9XA 3LCOA 3TTJA 4J96A 1PXLA 3C5IA 4Q5EA 4G3EA 4PDSA 4APCA 4CSVA 4DEIA 4BIBA 4EHGA 3SG9A 4YNEA 4JL9A 2E2BA 1H0WA 3PRIA 5LWNA 3VRZA 3MPMA 2F57A 3LLAA 5FWKK 5M53A 3R9RA 4XV2A 4E7WA 2VTOA 3HRBA 5FP5A 3BBTB 4YHFA 2IWIA 3SOCA 5C8KA 5AP7A 5BMSA 2YABA 2WTKB 2J6MA 4TWCA 2B9FA 2VWIA 3M2WA 4CV9A 4R8QA 2XJ0A 1UWJA 3KRJA 1LR4A 1REJA 4FICA 4RIWA 5L6WL 3RK9A 2Z7LA 3D7TB 1XH8A 3CTQA 3N4UA 4J1RA 5FXSA 3QL8A 4IAKA 5GZ9A 4Z7HA 4O0TA 4XG4A 4NFMA 4WRSA 3V5WA 2YZLA 3QTWA 5IQGA 4NFNA 2QLUA 1H01A 5CSPA 1O9UA 2C3JA 4YZDA 5H3QA 4CFWA 3QXOA 3ZFXA 5IA3A 4M3QA 4EOSA 2ZV2A 3R8MA 3RZFA 2C6KA 4PPAA 5EKOA 4XG6A 3CXWA 4EQUA 4OBQA 3DTWA 3OXIA 3CBLA 4G9CA 4HPUE 3VBQA 2GTMA 4APPA 3PJCA 1XH9A 1P2AA 3NEWA 1JKTA 3FPMA 4QYHA 4FIIA 3FDNA 3P23A 3I1AA 3EHAA 4JDHA 4WOVA 3GC9A 4ACDA 4Q9ZA 3G51A 4K18A 4CKRA 3U8WA 2J0KA 5A54A 3HX4A 2XJ1A 4EORA 2YJRA 3DCVA 3OOGA 4MNFA 5FGKA 3VAPA 4BTFA 1E1VA 3SXSA 5BVNA 4XLIA 3WZUA 4E6QA 3HUCA 4V05A 4RQKA 4WUNA 4X6QC 3R7UA 3R73A 2JDRA 2ITVA 5CYIA 1TQMA 2BAQA 4PP9A 4N70A 4EH3A 2OIBA 3D2IA 3HMNA 2G01A 3OXTA 3TEIA 2QQ7A 2IW9A 4GFGA 3ORMA 4BZOA 2W1FA 4GFOA 4DEDA 1J7UA 4LUEA 4CLJA 5F1ZA 5K4IA 3PZHA 1PY5A 5BYZA 4DA5A 3UIMA 2W1CA 3HUBA 5IMEA 1YDRE 2O65A 3LPBA 5CVFA 2BAKA 2W17A 4K6ZA 2V0DA 3GC7A 4G3DA 2R3RA 1SZMA 4QMXA 3UGCA 3LKMA 3D83A 2YERA 2VTSA 4JAJA 4KKEA 5AA9A 2FA2A 2XK4A 1U59A 3MFRA 4DN5A 3NLBA 2DYLA 5DEWA 4D0XA 4QNAA 4IBMA 3QRUA 2OH4A 3GI3A 1FGIA 2Y7JA 3NS9A 4AAAA 3KVXA 5CT0A 3R00A 2PL0A 2ESMA 4AZEA 2XIKA 2CKEA 3E87A 3EYHA 2BUJA 2ZM4A 4ID7A 3GEQA 3ZXZA 1OBDA 2WQMA 4IADA 1G8AA 2J51A 3G0EA 3KXNA 2NP8A 5ETIA 5KHWA 1I44A 4HPTE 3SXRA 4FVPA 2YWVA 1OL2A 2I0YA 2G15A 5E4HA 4BTMA 3FZSA 1GIIA 2AC3A 2VN9A 4OAVB 3DDPA 3G90X 5J5TA 3C0IA 2F2UA 3EFLA 3PXYA 5HX6A 2JIIA 4IMYA 4FVRA 2PHKA 3QXPA 4E26A 3FSFA 3AMYA 2QOFA 3I6WA 3F69A 3D5VA 4D58A 3NAXA 3DA6A 4RJ6A 3BE9A 4FTUA 5CLPA 2OG8A 3BPRA 1WZYA 3LJ0A 4BBFA 1OBGA 2C5OA 3P7CA 4ZEGA 3PZEA 4XP0A 3BV3A 4I0SA 4AGCA 4BCGA 5HE1A 5DE2A 5KX8A 4MVFA 3T3VA 2JAVA 4AA4A 4ASXA 3KF4A 1UU7A 5IQEA 5HNBA 3DKCA 5CANA 4IVBA 5J7HA 1OPLA 4CV8A 3CQUA 4DG2E 3AD5A 4GIHA 4IWQA 5FQDC 1OGUA 4FA2A 2FO0A 5L2WA 4PNKA 4FKUA 5DWRA 4ARKA 3MVMA 2QO7A 2P3GX 3DJ7A 5IQBA 5J9ZA 4YTCA 2VU3A 4NK9A 2YHVA 4BDGA 4W4VA 3MSSA 1Q8TA 2J90A 1PYEA 4EUUA 5A4TA 4ENYA 1SMHA 4D4VA 4RJ3A 5IA0A 2H8HA 2R2PA 2W4OA 2XK6A 4NTSA 3KU2A 4M0YA 2OSCA 3MA3A 5HE3A 2CHLA 5IQFA 4FSUA 1KWPA 4E93A 2F4JA 3CKWA 4R1VA 1CTPE 4LOOA 1SVGA 3GUBA 1YRPA 3CPBA 3COKA 5HVKA 4YZMA 3R9DA 4WO5A 3TACA 4ZTNA 4BKJA 3BIZA 5FEQA 4IWPA 4YLKA 3QUEA 4RIYB 2WTJA 3OCTA 3OP5A 4UZHA 3S1HA 3DTCA 3EQRA 4NH1A 4M14A 2WMBA 3LFDA 2QG5A 4B7TA 5IH4A 3U87A 1WBOA 3R71A 4FKLA 5BVFA 2JLDA 3K54A 4L3JA 3MESA 3UNJA 4GVJA 4FV2A 4Y73A 3TI1A 3V6SA 3OEZA 3TNIA 2J9MA 4EBWA 4HCTA 1OUYA 3WF9A 2VTAA 3ATSA 3DNEA 3DKFA 4O7NA 4ZMFA 3ZLXA 4WKQA 3TCPA 5EHYA 5M56A 3BCEA 2OF2A 3F5UA 1J91A 1OIQA 1S9JA 3RTPA 5AV3A 1XH6A 4FT7A 1VR2A 4I23A 1CKIA 4FT3A 3SX9A 4FKWA 3QD2B 5JGAA 4HCUA 2GDOA 3PY3A 5L2QA 3AGLA 2IO6A 3BU6A 4FV0A 4DH1A 2F49A 4FIGA 5IQIA 4O82A 2EXCX 5GHVA 2GNFA 4BDCA 3ACKA 4Z3VA 1JVPP 4DGNA 1M2QA 3DJ6A 4IW0A 2JIUA 4OBPA 5CASA 4TWPA 2X2MA 4D2WA 3BYOA 1XH4A 4GKIA 2YDJA 3AC8A 4B6LA 5AIRA 4YTFA 1XKKA 4MQ1A 4CMTA 1AD5A 2XK3A 5H9BA 4K33A 4CZTA 2C3KA 5HVYA 3RM6A 3GENA 4AW1A 4ZY5A 3KA0A 2EVAA 5M55A 5JRQA 2ZYBA 3PG1A 3VUKA 2G2HA 4RFMA 4QPSA 4DF3A 3V51A 3KRLA 2Y6OA 5KZIA 4G2FA 3BYUA 5AIKA 3I0QA 5HNGA 4XV9A 2GFCA 2UZUE 4MXYA 1YDTE 2JITA 5TKDA 3ZC5A 4CFUA 2XNBA 3ZLYA 1X8BA 2VGOA 3G6GA 3KXGA 3KY2A 4FGBA 5CU3A 4YJOA 3FY0A 2W7XA 4RSSA 5DT0A 3CE3A 5AP1A 5LOHA 2CKQA 2GS6A 4DH7A 4XS2A 2O3PA 1MRVA 2P33A 4ANOA 3PFQA 4FG8A 4QTEA 5KMOA 2PMIA 4EC8A 2CSNA 4RIWB 1MRUA 2XK9A 1DM2A 2RFSA 4F9CA 5EHOA 3ROYA 3L8PA 5C1QB 3DLZA 3IG7A 1G8SA 3GU4A 4O7TA 4GUBA 4D9TA 4ZP5A 2ONLC 3VS0A 1ZYCA 4PMTA 4BCQA 3DAKA 3ORNA 2XIZA 4ZSEA 5HE2A 4C61A 4HGSA 4UMPA 2VO3A 1Q8YA 2CGUA 2BZIB 1OKVA 2ITTA 1VZOA 3E63A 4WSQA 4BIDA 1ZOEA 3REPA 2ZJWA 2YA9A 3RP9A 4Z55A 4X3FA 3OBJA 2B9JA 2VTMA 4W8DA 3VUDA 3BRBA 5C03A 2VUWA 4BCPA 2IZTA 3EKNA 4DE4A 3ZRMA 4AP7A 2X6EA 4XG7A 4UMRA 2OJFE 5CF4A 1FVTA 4FG9A 3IKAA 4FODA 1NW1A 3COMA 4II5A 3OW3A 3RCJA 3DKOA 5GJDA 3CY2A 4U7ZA 5H2UA 4FTNA 1GIHA 5DN3A 3HMMA 5J1VA 4L7FA 3TXOA 3UO5A 3Q60A 4P90A 4GH2A 3FLQA 2J5FA 2NRYA 5I9YA 2W1HA 4DTAA 5DRDA 2WGJA 3QQLA 4PDOA 4RIXA 1PYXA 5CEQA 3LW0A 2J0JA 5G6VA 3W55A 4G9RA 5IA4A 3KMUA 3GCUA 3C50A 3PPZA 4EQMA 3UZTA 1J1BA 3QQHA 4GJ2A 2BRNA 3K2LA 5LWMA 4FEUA 1O6LA 2VTRA 2XJ2A 1U46A 2F7ZE 3D9VA 3NW7A 4GRBA 2Q83A 2JBPA 4H3PA 1SVEA 1SNXA 2YITA 3HV6A 3QD0A 1BI8A 4FNXA 2PPQA 3MWUA 2YEXA 2OH0E 5JGBA 4HVGA 3FZTA 1BI7A 1ZYLA 1YOLA 1WBSA 3AC3A 5FDXA 4YBKA 5AUWA 2XYNA 3FMHA 1MP8A 3IW4A 4JDKA 5EW8A 2XK8A 3E8NA 3AT4A 2XNNA 2I6LA 2P2HA 4U6RA 3M42A 4S2ZA 1MUOA 1OPKA 1UWHA 5FD2A 2UVYA 4CTBA 1SVHA 4DCEA 3VUHA 3WI6A 2R4BA 3AC2A 3TIZA 4O1OA 3JY0A 2KULA 3R7EA 2I0HA 1JKKA 4X21A 1W0XC 3TKHA 3UNZA 3LMIA 4MXXA 5G1XA 3U51A 4BWXA 4CFXA 3QC9A 2UW3A 3R8PA 4FZAB 3R0TA 5AP6A 4MXZA 3TNPC 5IEXA 3KFAA 4RQVA 2F7XE 1UA2A 3RGFA 4D2SA 3DJ5A 5EM8A 3V3VA 2B4SB 4XV3A 5KO1A 3P5KA 4FIFA 5HD7A 1H1SA 2C0OA 4NEUA 1U5RA 4B99A 4AZSA 3FZRA 5T6KA 5JMSA 3OF0A 3D7ZA 3R8UA 4FZFB 4D55A 1URWA 5J87A 4FC0A 1ZOGA 1O6YA 3KF7A 3EFWA 3G6HA 2BRGA 3EN5A 5BMMA 4YURA 3OCSA 5C4LA 3CKXA 4AGDA 3HP5A 2VD5A 3VBVA 4RA4A 4X2GA 1F3MC 2VO0A 2R3IA 1JSUA 3G33A 1S9IA 4HYUA 4ACCA 1KE5A 4MNEA 4U44A 3PVGA 5HG5A 5CU0A 5TT7A 3WE4A 4FZ6A 3K3IA 4HGLA 4O21A 3G15A 4UX9A 4BGQA 5E8WA 2F9GA 2H96A 2FSTX 3C7QA 1XH7A 5E8ZA 4EJ7A 1CM8A 3BQRA 1U54A 3AD6A 5EM5A 1W83A 5KKRC 2CGVA 3EQBA 3TNQB 3QQKA 2UW7A 3TWJA 1SNUA 1KE8A 4BWPA 4CFMA 4JDJA 2BVAA 4MTAA 2HYYA 4P5QA 2E9VA 2HWPA 3KCKA 4KBAA 5DPVA 4EOJA 1M2PA 2X0GA 1FGKA 4F9WA 4RVLA 4FKTA 4XBRA 3MTFA 2IVVA 2OZAA 4C4HA 2WTCA 1JQHA 2E9UA 4H39A 2BIKB 4BICA 5HTBA 2RFEA 3ZO3A 3R2BA 2X1NA 5L8JA 2WEIA 3G9NA 3PP0A 2XK7A 3GC8A 4OTRA 4BCMA 2PYWA 1CMKE 1ZZ2A 3H0YA 4WA9A 3W8LA 2VTTA 1W8CA 3H9OA 3MV5A 3ALNA 4GK2A 3BEGA 1OVEA 4ZS0A 2BIYA 5T68A 3QQJA 3RVGA 2ZM3A 4ZSGA 3K5VA 3QQUA 4OR5A 4TYJA 1Q8UA 4RGJA 3PWYA 3HAVA 3A7JA 5B0XA 3O8PA 2OJGA 3DZQA 2QU6A 4UYAA 5M4CA 3KL8A 2B53A 3ACJA 4L46A 3QYWA 4BGGA 4IM3A 2Q0BA 4LL0A 4KSQA 5IH5A 3WF5A 5JZJA 3GU8A 2C5VA 5HLNA 1KSWA 3FYJX 5D9HA 3BHVA 4OT5A 4MD8E 2R3FA 3C4WA 3MBLA 5L2SA 4AOIA 3PDTA 2HK5A 5FXQA 3EQIA 4A9YA 5AEPA 3SQQA 5IZFA 4ALUA 3N9XA 5EDRA 3CLYA 2SRCA 3UG2A 5FBOA 1E1XA 1TVOA 3FAAA 4FMQA 4OTPA 1R78A 4PMMA 3UOLA 1P14A 5DIAA 3NUUA 3Q6WA 4IZYA 5EHLA 4IX5A 3WE8A 1M7NA 4RRVA 4AS0A 2XIYA 3BLRA 4NWMA 4QO9A 4BFMA 4D4YA 4HVSA 2P4IA 5EI6A 1H1WA 5E9EA 3MA6A 3E8CA 3PG3A 4GU6A 3SD0A 1IASA 3S00A 4L3LA 5AX3A 3WZEA 3G9LX 2W1DA 2OW3A 3VULA 1KUTA 2JDTA 5CU6A 4ACHA 4QTBA 3OFMA 4FIHA 3CGFA 3G0FA 3MFTA 2NO3A 3ORKA 4ACGA 3QKKA 1NT2A 3KQ7A 4PX6A 3DBEA 2XRWA 4XG2A 4EJNA 2IW8A 2WQNA 4I41A 4FTAA 3GVUA 4RJ4A 3TIYA 2J7TA 2BRMA 2W06A 3LJ2A 4R3CA 4IB3A 2XUUA 3VHKA 4QMTA 4IB0A 3TN8A 2XKEA 3V8SA 3DZOA 2ONLA 3IO7A 2IVSA 4TNDA 3LMHA 3O8TA 1YOJA 1GAGA 3MPAA 3QLFA 5FEEA 4JDIA 4ZZMA 2XKFA 2YIRA 4FUYA 3S3IA 5IQHA 3CP9A 5LCJA 3NCZA 2PVKA 4FTQA 4TT7A 5CWZA 5DI1A 1ERKA 5DRBA 4A4LA 3CJFA 5C26A 3BYMA 4MBLA 2QVSE 3FMJA 4BDHA 4C4FA 4GVAA 3VN9A 4PP7A 3F3UA 2C47A 2EUFB 3RHXA 2X7OA 3SXFA 3ZSHA 3ENHA 4G6LA 5AV2A 2XZSA 4A7CA 3OC1A 3P7AA 5H8GA 1V1KA 3MN3A 4LRJA 4ITJA 4QQCA 1ZRZA 3VWAA 3ZZWA 1Q61A 1YHSA 2QONA 3EZRA 4QOXA 4RC3A 2IN6A 5KMIA 5L2TA 3UMXA 4CT2A 4KAOA 4MX9A 5CF6A 2UZWE 2BKKA 3O96A 3R9HA 3GU5A 2HZNA 4TRLA 5GZAA 4N6ZA 3C0HA 4X3FB 4CD0A 4WG3A 4U79A 3FI3A 5AV1A 1YXVA 2PU8A 2CJMA 2ZDTA 4E73A 1HCKA 3BGQA 1FOTA 3GOKA 5EM7A 1YXSA 4RC2A 3FL5A 3SW4A 4AOTA 1OL6A 3RPVA 4R7BA 3HV7A 3W2QA 4O7SA 4IX4A 4QP9A 4P4CA 3NGAA 4E6DA 4IB1A 4NZWB 2X7GA 4YP8A 1IEPA 5HOAA 4I93A 4IIRA 3G5DA 4RIXB 2F7EE 4M12A 3TJDA 3CQEA 2W5HA 2QURA 3ORTA 3OXZA 4WNMA 2PY3A 3RMFA 4GCJA 4E8AA 2XCKA 5HZNA 2W99B 1KV2A 5CAVA 2X6DA 3NVKI 3FMKA 3KVWA 4IJPA 4G31A 2W9ZB 3DOGA 4ANQA 5HLPA 4YC8A 3V5JA 2UW8A 4BKZA 3E3PA 3ERKA 5IUIA 2ZV9A 4EHVA 4WUAA 4C7TA 3BYVA 4YJPA 3FSKA 3KXXA 3DU8A 5LVMA 4O7LA 3NMUF 2ZMDA 5ITAA 3VC4A 1SM2A 3LIJA 5A6NA 2VX3A 3MH0A 1YOMA 2CKOA 2HY81 3E8EA 3AT2A 4C34A 3RNYA 5EDQA 1P4OA 1NY3A 4D28A 3NIEA 5BX0A 2CKPA 3QD4A 4QP8A 4AOJA 3Q5IA 3P78A 3C13A 3VUMA 5I5ZA 3BKBA 4MEDA 3D0EA 3F5PA 4OW8A 3WF6A 4RBLA 5E8XA 4E20A 4EHZA 3ZDIA 4BBMA 4ZAUA 5M57A 4L3PA 3VJNA 3A4PA 4B4LA 4XJ0A 2OU7A 5KZ0A 2PMOX 3WOWA 2OBJA 4A4XA 4GUEA 3TDVA 2PVLA 4FSQA 3O51A 2OJJA 1B38A 5BVKA 5C27A 3VS3A 2QKRA 3HZTA 4I92A 3PA3A 3UYSA 2VWVA 3SDJA 4JQEA 3U4WA 1M7QA 4LV8A 4A9RA 5IUHA 1OUKA 3H9RA 3L8XA 4YO6A 2HXLA 3EQHA 2V5QA 2HW6A 1H1PA 3EZVA 2WXVA 1Y57A 3NR9A 4KINA 4UWBA 5CQUA 5EYDA 3TT0A 5L3AA 3UIBA 3CD3A 4BHZA 3TDWA 4FKVA 2XNEA 2ITXA 3ORZA 4JT3A 4AT4A 4BI1A 1ZLTA 4TWNA 2C69A 4Y95A 3NSZA 5DH3A 4DC2A 3ZRKA 1OB3A 2QO2A 2ZAZA 2JDSA 1YHVA 2YM8A 5E7RA 4X2FA 4CMUA 2PZRA 2BHEA 3W2RA 2PUUA 3MVHA 4M67A 3A2CA 3FUPA 3FMNA 5IMXA 4MNEB 5M09A 1FPUA 3DK3A 1UNHA 2YLFA 3F5XA 3NW6A 3RKBA 1W84A 5EI2A 4QMQA 1H26A 1PMUA 1Z57A 4FKIA 2WHBA 3CR0A 3L9PA 2X8IA 4FG7A 4YJQA 5M4IA 3DPKA 2YIYA 3FC1X 2YCSA 3CC6A 3ORIA 3DK7A 4AT5A 4CFVA 1U54B 4AFEA 4O0YA 2X8EA 3M11A 3HNGA 4AE6A 5KMLA 3R7OA 4EQCA 4EUTA 2QOLA 5DLSA 4EOMA 4FK3A 3R83A 3OY1A 4YZBA 3DBFA 3OUKA 2OLCA 3FLSA 4MYGA 4I5HA 4AN3A 3FLNC 4FYOA 4KIPA 3PPKA 4X2NA 3ZFYA 1REKA 3P08A 3Q04A 3SRVA 4C58A 3GT8A 1PXIA 2H34A 4UN0C 1E9HA 3SGCA 3D5XA 2OZAB 4DGOA 3F7WA 4PMSA 2YIQA 4ASZA 3OG7A 1IR3A 4LGGA 3SV0A 2BRHA 2HELA 2PVYA 4UZDA 2W1EA 3LAUA 3NIZA 1P4FA 2OZOA 4H3QA 4DYMA 2CGXA 4ZLYA 4YLLA 3OD6X 4TZRA 5HIEA 3GCVA 1Y8GA 2ITQA 1H27A 3VBTA 5LMAA 1VEBA 3ZYAA 1WBPA 4IEBA 2VWZA 4DFXE 3QTRA 4MWHA 4YUQA 2ETMA 2JIVA 4JBOA 2RF9A 3UO4A 4R3RA 3TJCA 2YISA 1A06A 1T46A 2F2CB 3P4KA 4Y83A 3PVUA 2X39A 3EQDA 4TNBA 4NU1A 5M4FA 3C51A 3E88A 4A9SA 4C62A 3VW6A 4CYJA 4BCOA 3SG8A 2UW4A 4C8BA 3O71A 3FLYA 5K5XA 3HA8A 3AG9A 3R02A 4RT7A 3BLHA 2UVZA 1APME 4KA3A 3KULA 4QQ5A 4M8TA 5HG8A 2NNWB 2C6EA 3LJ1A 5A3XA 4JOAA 3L1SA 5JEBA 4BTKA 3F6XA 4S34A 1YI6A 4ZJJA 5I9ZA 2XNOA 2R3KA 3AD4A 4QTAA 4FVQA 2UZNA 3QRIA 3Q6UA 4FI1A 2W1ZA 3ZTXA 2X9FA 1LUFA 1M2RA 2EWAA 4Q5HA 5HNIX 5FRIA 4D5KA 2GPHA 3BE2A 3R7VA 3ZDUA 5CEOA 3S2PA 4Y5HA 4D4SA 4WG5A 3ZOSA 4IDTA 4ANMA 4AF3A 1Z9XA 1ZWSA 4QYFA 1RDQE 2O64A 4RZWA 5FDPA 5HD4A 2RGPA 5CXZA 2R7IA 3FI2A 1H8FA 3SOAA 3R22A 4L67A 2WOTA 2G2IA 3PXKA 1OECA 4GIIA 1Q5KA 3PUPA 5KHXA 1SYKA 2WMSA 4QNYA 4TYIA 4WBOA 5HEZA 3TTIA 3UBDA 4D4RA 4PDPA 1LEWA 2PE2A 4U3YA 3EN6A 3OWLA 5AMNA 3KREA 1LEZA 1Q8ZA 4XRLA 5HIDA 5A9UA 4G16A 4GT4A 4JG8A 5FTGA 4FTTA 1ZZLA 2FYSA 5CU4A 1DS5A 3VQUA 4F1OA 1CDKA 3R1NA 3NAYA 4J97A 4JJRA 1GZKA 4RVKA 5AM6A 4J95A 3DLSA 4I21A 4RJ5A 4L00A 2EB3A 3LFFA 2BMCA 3N4TA 4QMVA 1XHAA 2PVHA 4K8AA 3NYNA 1JAMA 1BMKA 3D5UA 4R7HA 2BZHB 5CS6A 5HG9A 5I4NA 5HCXA 3V5LA 1WMKA 3VNTA 3ZUTA 4CXAA 5BQ0A 3UE4A 4YC6A 4QD6A 3SHEA 5LMBA 5C8NA 3OWJA 2C3LA 4CQEA 3WIKA 3PY0A 3QD3A 1W7HA 3F3ZA 3OT8A 5CZHA 3MW1A 1UU9A 4DEAA 3RALA 1RE8A 5CSVA 5T3QA 3OWPA 4LV5A 5KE0A 1U5QA 4PRJA 3SC1A 5L6OA 4GK3A 4O2PA 5CEKA 2UZOA 4AACA 4IANA 4XH6A 4EBVA 3ZSGA 4QP1A 3WIGA 2VWWA 4QP6A 2BFYA 2VTJA 1MQBA 1W82A 2WOUA 4U0IA 4A4OA 4JLCA 2C6OA 5CQWA 2YM3A 3P9JA 4GYIA 4YHTA 3UQFA 3VVHA 3W10A 4U40A 2HWOA 5AV4A 2ERKA 3WYXA 3F3VA 4U43A 1ZY5A 4QYYA 1M52A 4CNHA 3UJGA 3UIUA 1H24A 2WTWA 5IG1A 5HHWA 4IJ9A 3S0OA 1FINA 1Y8YA 1YWNA 3NDMA 4RPVA 5J79A 3KRWA 3SKCA 4FTIA 3TV4A 4KRDA 3RAHA 4GG5A 2XCHA 4O91A 4FSZA 4BY9E 4JBQA 3UMWA 5CAUA 4U41A 2GNGA 4PUZA 3RJCA 4ORKA 4LI5A 3VS4A 1PXKA 4Z9LA 3F66A 3FL4A 3KRRA 4XBUA 5JKGA 4QMOA 1H4LA 3Q9XA 2Z60A 4YSMA 4QYGA 3KMWA 2YN8A 2YM6A 3KRXA 4F0FA 1J7IA 3LMGA 1NVSA 2VO7A 4FYNA 4IWOA 3HECA 4OBOA 4X3JA 4EK3A 2HZ0A 5B2KA 4QP2A 1PW2A 3ANQA 3V8TA 4PMPA 4R77A 3EWHA 3ODZX 3OTVA 5DHJA 4E5BA 3FI8A 3M1SA 3A62A 3ORXA 4QMMA 4CKIA 3OTUA 4KKHA 4K2RA 4L68A 4TKSA 5ICPA 1UKIA 1ZXEA 2VTQA 4MKCA 4MD9E 2ETRA 5E1EA 4XG8A 3TKUA 2B7AA 4D1XA 2C30A 3HMOA 3E7OA 1QPDA 4FZDB 2CGWA 4FSTA 5DT3A 2YZAA 3AMAA 4FEXA 1V0BA 3E8DA 4FK6A 2A2AA 4XEYA 2IZSA 5IPJA 3LM5A 3R04A 5HBHA 1QPJA 4K77A 3W1FA 1OKWA 2Y9QA 3QRKA 4USFA 2PUNA 4BDJA 4O7RA 2HENA 4RX8A 3E93A 5CNOA 5EW9A 4ERWA 4IZ5A 2V62A 4UALA 2ZDUA 5IUGA 1R39A 2PWLA 1FBNA 3WILA 4KIOA 4OTHA 5JT2A 4AGUA 3A7GA 4PTCA 3AQVA 3ZRLA 2R3PA 3VF9A 4A9TA 2GNHA 4A9UA 4JIAA 3BX5A 5AR2A 4GJ3A 3DBCA 4NM3A 2P2IA 4PY1A 3A8WA 1Q8WA 5IDPA 1XBBA 2BTRA 2B54A 3KXMA 1GOLA 4RMZA 4UEUA 5TOZA 5TO8A 2CLXA 4AA5A 4E4XA 1ZYJA 2C5YA 2WMTA 3QX2A 2W4JA 3R01A 2A4LA 3AC5A 3SRVB 2VAGA 3ZFMA 2UW5A 4CQGA 4CVAA 3HDNA 3ZBFA 3R9NA 3ZXTA 3DKGA 1H08A 4XNEA 1BL7A 1BL6A 3H9FA 3I5ZA 3LCKA 3O8UA 4O22A 3IGGA 5LARA 3I4BA 1XH5A 2OJ9A 5HLWA 3P7BA 1AGWA 4JXFA 5FTQA 5I3RA 5J9YA 3CTHA 1PXMA 1YXXA 2UV2A 1PHKA 2VWUA 3FHRA 3GP0A 2JDOA 3GQIA 1PXJA 2BCJA 3I79A 1V0OA 3LFNA 3LFBA 3LHJA 3Q53A 2GS7A 4FNWA 4DGMA 4FV8A 4YZCA 4X2KA 2DQ7X 5FUTA 4I94A 2XIXA 1UV5A 2OXXA 2RG6A 3QF9A 3QTZA 5AFVA 3RAWA 5BYLA 3BQCA 4TYGA 3EOCA 2XEZA 3QQFA 3NX8A 2GNJA 4G34A 5ETFA 3QZHA 4DBNA 4DHFA 5AUTA 3OT3A 3HA6A 4IC7A 3SVVA 2WU7A 4IAIA 4ZSLA 3UC3A 3R7GA 5IQDA 3RPSA 3QTUA 2PVJA 3IDCA 5EQYA 3F3WA 4MBIA 2YIWA 5TF9A 4B8LA 4EZ3A 4BZNA 4CFFA 4DINA 3Q4UA 4C4JA 2R0IA 3FZPA 5LVOA 3GOPA 3SAYA 4DT9A 3KULB 2FH9A 2XKDA 3R9OA 4ASDA 3EYGA 5IISA 5KMKA 4TXCA 4XOZA 3HYHA 4PV0A 4YLJA 2B1PA 2V7OA 4F6SA 4D0WA 1HOWA 4NJ3A 2LAVA 3PRFA 5A4LA 4LM5A 5J5SA 2Y4IB 3N4VA 4EH7A 3FQEA 4AWIA 1OL5A 5DVRA 2A27A 2J0LA 3MIAA 3O50A 2XNPA 4EH5A 1DAWA 4DLIA 3W16A 3EQGA 4I6FA 2VNWA 3MY1A 4IWDA 3NW5A 3S95A 4AN2A 4D1ZA 4FOBA 4RFYA 1EH4A 1H1RA 2CPKE 3NNVA 1J1CA 3AOXA 3MH3A 4N57A 1OITA 5EQEA 3VRYA 2O2UA 3WZDA 5KMNA 2IVUA 4ZSJA 5BUEA 2JFMA 4BGHA 4U97A 5J95A 4O7WA 1JBPE 2BILB 1B6CB 4WD5A 5CI7A 3QAME 2XEYA 4Y5QA 3MY0A 2BPMA 3EB0A 4ALVA 3L9NA 5AUUA 4F7JA 4F7SA 4EOPA 4AX8A 4JQ8A 4FEWA 4GS6A 2VO6A 5FXRA 4FV4A 3JVRA 4E5WA 2IPXA 1RJBA 2XH5A 3H4JA 1PXNA 2QOKA 2ERZE 4QPMA 1H25A 1OI9A 1YHWA 2BKZA 3GU6A 3ENMA 4AUAA 4K11A 3R1QA 5M44A 4EZ5A 4RWKA 3NWWA 2NRUA 4J8NA 5AP0A 3ROCA 2OO8X 5AAFA 3LCDA 3LOKA 5C8MA 2BDJA 3DBQA 5A46A 5CVHA 3Q96A 2PVNA 3E7VA 1NVQA 4AW2A 2WMWA 3FMDA 4M66A 4O0XA 4XHKB 3V5PA 1FVVA 4QMNA 5GJGA 3C1XA 2QI8A 1OM1A 2XBAA 1YI3A 3Q52A 5M07A 3D14A 2OI4X 3TNHA 4AT3A 1M17A 2WMXA 4L44A 4PQNA 2C5NA 3TG1A 3W32A 2VTIA 5F9EA 5C4KA 2XBJA 5D1JA 4FL3A 2VTHA 2H9VA 3KXZA 3BHHA 5GJFA 5JZNA 3G2FA 2VTPA 3PWDA 3FMEA 3DY7A 3D4QA 4NUSA 2CMWA 5EI8A 5GIOE 4NKSA 4G6NA 3NUPA 2HXQA 1XR1A 4E6CA 4HYHA 4YTHA 4BDIA 4BIEA 2QOBA 4FTKA 2OIDA 3ZHPC 1A9UA 2HIWA 2XM8A 2R0UA 5D11A 3HEGA 3Q2JA 3KKVA 3PXRA 3RAIA 4OTWA 5E91A 3FXWA 5LCKA 4F65A 4NKAA 5AR3A 3FKOA 3UODA 5AUZA 3PIZA 2WQOA 4FUXA 4C2VA 2JD5A 4CLIA 2PZYA 3RNIA 3C0GA 4EOOA 1R3CA 4CTCA 4GMYA 2JKQA 4M13A 3FPQA 4IAFA 2RIOA 5HE0A 4O2ZA 4AZWA 2RSVA 3UOHA 3PSBA 2WQBA 3Q2MA 1FMOE 1ZYDA 1DI9A 3BGZA 4FBXA 3EQCA 2QR8A 3QGWA 4O86A 4KS8A 4WT6A 3WZKA 3OW4A 4BCKA 5HU9A 5LVNA 4ZS4A 1XBCA 2WPAA 3LFSA 4GK4A 1KV1A 3WF8A 1CKPA 4X2JA 2VWBA 2WIHA 2FSLX 4LRKA 5ANOA 3R28A 5M06A 4TW9A 4E1ZA 3PJ8A 1JSTA 5DT4A 4FKJA 3MFUA 4FZ7A 4RJ7A 4EI4A 2W4KA 3ORPA 2W5AA 4XUFA 3RHKA 2VX1A 2VZ6A 4RWJA 5CEMA 4L01A 5CAPA 4DH3A 4X0MA 2GNLA 3B2WA 4D2TA 4C4EA 2PMNX 4USDA 4EOLA 1G5SA 4XRJA 5FBNC 5CY3A 4ZLOA 3MB6A 2ZVAA 1PJKA 2HZ4A 4C57A 2EU9A 3V5TA 3OVVA 4O0WA 4H36A 5ACBC 2QHNA 4EYMA 4H1JA 4NSTA 5EKNA 3E62A 4ONAA 4NIFA 4FSYA 4FSRA 5E8UA 2YLEA 5IH6A 2FVDA 3LXLA 3U9NA 2QHMA 1OZ1A 2X9EA 4ANBA 4O81A 4NW6A 4FT0A 5L6PA 3PA5A 5F4NA 3FLWA 2PSQA 4L45A 3NNXA 1WVWA 4FKSA 3BI6A 3R63A 4BDFA 4FKRA 4DFUA 4J99A 3GXLA 4BC6A 2XRUA 2GHMA 5DR6A 4Y8DA 4KKGA 3COIA 3R8VA 2XMYA 3NUNA 4OGRA 4O1PA 3MJ2A 3B8QA 4JG6A 4YGAA 4HNIA 3E5AA 4R6VA 5CAOA 2R9SA 3QC4A 4UXQA 1H0VA 4YPSA 3QTXA 4Q9SA 3F82A 5FM2A 2B9HA 1NA7A 4AXAA 4FV1A 2Z7SA 5AAEA 5LQFA 4P2KA 5A4CA 2X2LA 4MXCA 2OWBA 5AWMA 3LE6A 3T9IA 5EYMA 1L3RE 3WYYA 2GHLA 4EH4A 3H0ZA 4HYSA 2XYUA 4JBVA 4KBCA 4JRVA 2C6LA 3HV5A 4EK4A 3UP2A 3B2TA 1STCE 1ZAOA 4CKJA 3QRTA 3NVMB 5HO8A 5AP3A 3UOJA 4M69A 2OJIA 4JR7A 5HCZA 4C4IA 4CEGA 3SW7A 5D7AA 4PWNA 1K2PA 5AA8A 4CRLA 2VTNA 2VX0A 5KMJA 3OMVA 4XV1A 3C4EA 3HRCA 4M68A 4M84A 5EOLA 3CEKA 5DOSA 4OLIA 2Z7QA 2E9OA 4FTCA 4ZJIA 1GZNA 1XBAA 3NUYA 5EG3A 1KE7A 3EIDA 4V04A 3NYVA 4YZ9A 4FTOA 5HICA 4I5PA 3VBXA 5CXHA 3C4ZA 4HVDA 3MH1A 4EKKA 3A7IA 3D15A 1YXTA 4FIJA 4AA0A 2VWXA 4KIKA 1PMEA 2G1TA 2I40A 3BHYA 1BX6A 2WMUA 2R64A 3FLZA 3TV7A 3U55A 4HOKA 3PIYA 4G17A 3A4OX 4PL5A 3R7IA 5ANDA 3R1YA 3PIXA 3DV3A 3QA0A 3O2MA 2WQEA 5B2MA 2BZKB 4BCNA 2O8YA 5ANKA 3UOKA 3W8QA 4F1TA 3FMLA 4UMQA 4IM0A 4IVAA 1UU3A 3MB7A 4ANSA 4AZVA 3PXZA 4AW0A 4FTLA 2DUVA 2X81A 4OTGA 4MBJA 2YAKA 4EK8A 3A7HA 5BYYA 5AP4A 2V55A 1HCLA 1XJDA 3EMGA 3L9MA 4BRXA 1GZOA 4LUDA 3KK9A 3DQWA 3K5UA 4ZTQA 4DEBA 3L9LA 3QYZA 4FTMA 3SA0A 3NYOA 3DXPA 2WU6A 2PZIA 3HV3A 4U3ZA 4PTGA 3U4UA 5A14A 4LGHA 4J53A 1PRYA 2RKUA 3A61A 2UZLA 3Q9ZA 2H6DA 2E9NA 2OFUA 3I0OA 4ZK5A 4QTCA 4IB5A 5FM3A 4FGRA 1NXKA 4ASEA 3F61A 3DK6A 3P0MA 2R3GA 5CSWA 4U45A 1Q62A 2B55A 4FSNA 4M0ZA 3MVLA 2JKMA 1W98A 3AT3A 2PVMA 2BALA 3OWKA 4L42A 4CFNA 1V0PA 3HMIA 4FEQA 4ZTLA 5B7VA 4O7VA 2IJMA 3LXPA 5CF8A 3I81A 4IM2A 4BI0A 3NUAA 5ANEA 4ZTRA 4C38A 4AW5A 4RX5A 4F6UA 2QOQA 2QOCA 1GNGA 1M14A 2OK1A 3BZ3A 3ZLWA 5EK7A 1YI4A 3QUDA 4GW8A 3ZUVA 3PE2A 3ELJA 3DFCB 4IACA 5CSXA 5CTPA 3O0GA 3QA8A 3HL7A 4L43A 3ATTA 3QZGA 4JVGA 1LP4A 3KC3A 3Q4ZA 4HJOA 2YDIA 2J0MB 2XF0A 1WCCA 2AUHA 3HDMA 4G3FA 4D9UA 4E4MA 5CALA 3KCFA 3ZBXA 4LOPA 2YWPA 2Z2WA 4KWPA 4UMTA 1Q24A 1WAKA 5AM7A 4F4PA 3EL8A 4BCIA 4ZOGA 5HO7A 3JUHA 3EKKA 4A07A 4FT9A 2BDWA 4IC8A 2WIPA 2ZM1A 3DBDA 5AV0A 4QMYA 4BB4A 1WFCA 1WBNA 4K0YA 2C6TA 4J7BA 2J0IA 4RA5A 5IEVA 4D5HA 4F7NA 2R3JA 3RK7A 3KK8A 4BDBA 2UZDA 3GCPA 4JRNA 4CGAA 3QCYA 2R5TA 4DFYA 5HTCA 2V7AA 4RX7A 5EFQA 5IEYA 2A1AB 4G5JA 4U8ZA 4DEHA 2UW9A 4LRMA 3TUCA 4FIEA 4RWIA 3UTOA 2I7QA 2OGVA 3FXZA 4EYJA 4GG7A 4BWKA 1YW2A 2GQRA 3OS3A 3BWJA 3FC2A 4MD7E 5AJQA 5BVDA 3R30A 5DA3A 4JIKA 4TYEA 2O63A 4XX9A 5KBRA 2RG5A 4HVHA 5KUPA 3TZMA 3Q4CA 5K3YA 4A06A 4BCHA 2JAMA 2YFXA 3KXHA 5E8TA 5K9IA 2W96B 4BDKA 4RVTA 5I0BA 3VS6A 4TL0A 5ETAA 2HW7A 3LLTA 3V04A 3FV8A 3O7LD 5E90A 4AN9A 2CCIA 2ITZA 3KB7A 3QQGA 4O38A 4O83A 3RPOA 1GIJA 4U5JA 4CZUA 5JFXA 4K1BA 3QZFA 4GL9A 3ZS5A 1R1WA 4IDVA 2WO6A 2W05A 1OPJA 2ZMCA 3D5WA 4I22A 2C3IB 4FEVA 3GCSA 5F94A 3ZSIA 3PP1A 3VO3A 1P5EA 3DS6A 3PVBA 2PULA 2UZBA 3P79A 4YMJA 2YCRA 4ZTHA 2IG7A 5IA5A 3C4FA 3FYKX 3DNDA 3CY3A 3OROA 4GT3A 3KN6A 3P86A 4I6HA 3VS5A 2PVRA 3DDQA 3O7LB 1ZYSA 4IAYA 4FF8A 4H58A 4AE9A 4EH6A 3RBWA 3HV4A 2FSMX 3PXFA 1UU8A 4R78A 3GCQA 3JYAA 1B39A 4WRGA 3CIKA 4JQ7A 4NYEA 3UO6A 1PKGA 4BTJA 4IAZA 2XNGA 3Q9WA 3LCTA 4S33A 4CG9A 3FI4A 1KOBA 4FOCA 5GIPE 5KMMA 2WD1A 4NIFB 5AR4A 1KOAA 4DH5A 2QG7A 3RPRA 3D2KA 3RWQA 4IFCA 3PJ3A 1GZ8A 5EW3A 3KGAA 2RFDA 3F88A 4RLLA 4BHNA 2VRXA 2FGIA 3DAEA 4Y46A 4PTEA 1U4DA 4DTBA 3LFQA 3THBA 1F0QA 4DLJA 4E5AX 4FX3A 4C37A 4DH8A 1OL1A 4DG0E 2WEVA 4TPTA 3ZMMA 2IZRA 3VUIA 3QKMA 5GZ8A 4X3FC 2C68A 5CU2A 4J71A 3W2CA 3RM7A 2PUIA 1PXOA 4YJSA 4L7SA 3RWPA 2GQGA 4QMPA 5E8YA 4JBPA 1KE9A 2WKMA 3QFVA 4O27B 2DS1A 2PK9A 4GFMA 3AC1A 3E92A 5J1WA 2V22A 5HVJA 1OKZA 4HZSA 4DFLA 2GNIA 5HU3A 4LL5A 3F5GA 5M51A 4BR3A 3EFJA 5HQ0A 5EOBA 4FE2A 3HP2A 3QCSA 1OMWA 4TWOA 3UP7A 5IDNA 4M69B 4JG7A 3IDBA 4F7LA 3R21A 2HOGA 4AGWA 2EB2A 4XMOA 1BYGA 4MAOA 1F5QA 5M4UA 4QT1A 4N6YA 4RC4A 4NL0A 4LMUA 4CG8A 3EN7A 3OZ6A 1JSVA 3RCDA 1DI8A 4C02A 2HCKA 3O17A 3OOMA 4E4LA 4FV3A 5CF5A 3TZ7A 4IAAA 4JX7A 5IKWA 3FKNA 5CX9A 3RAKA 4BDEA 3NRMA 3MJ1A 4F99A 2YACA 2WAJA 1IA8A 1QCFA 1YWRA 5J8IA 4HW7A 4IX3A 3U6HA 3DXQA 3PE1A 2JBOA 4F09A 4O0SA 2XVDA 4I4EA 5B2LA 2Z02A 3HGKA 3B8RA 1ZMUA 4IH8A 5A6OA 5DYJA 1RQQA 5A4EA 4KIKB 2XM9A 4ANLA 3QCXA 4S30A 3VBYA 3PTGA 3QRJA 2E9PA 3QHWA 4ITHA 4KRCA 3VF8A 2B52A 3FY2A 4I0TA 1PMNA 3F2NA 4TN6A 2UW0A 5JH6A 1R0PA 1QPCA 4W4WA 1XQZA 3GQLA 5HIBA 3QHRA 4R7IA 4BBEA 4GKHA 3JS2A 4O96A 2OFVA 3F9NA 2I0VA 4O0VA 2W1GA 2ZOQA 4W9WA 3ZM4A 4BCJA 4UXLA 3R8ZA 4USEA 4FSWA 1CSNA 3I5NA 1PMVA 3PYYA 3UQGA 2WMRA 4I4FA 5CEIA 3T9TA 3ULZA 4DAWA 2BR1A 1IRKA 3QWKA 5IQCA 3NNWA 2Y6MA 5EYCA 3IDPA 1JNKA 3FKLA 3LCSA 4EKLA 3OCBA 4GU9A 1OIUA 4HVIA 2GFSA 2PTKA 4LQMA 3BWFA 1CKJA 3U6JA 2ZV8A 4FKQA 4FL2A 3A7FA 3TZ9A 3CQWA 1XWSA 3ET7A 4YNOA 1T45A 1PF8A 4QMWA 3ZO1A 3PLAE 4IVDA 4R5YA 4RX9A 2AYPA 3FZ1A 4UBAA 3BHTA 1ZMVA 2JKOA 3E64A 5CVGA 2J4ZA 2X4FA 3LM0A 4AG8A 3O23A 3WZJA 3PSCA 3CD8A 3DGKA 4HGTA 4ZY6A 2R3NA 3COHA 3IECA 3T8OA 4FV7A 3FQSA 3UPXA 3ZU7A 4C3RA 4OTIA 3LQ3A 2JDVA 4C3PA 4WIHA 2JGZA 5LMKC 3BU3A 2PZ5A 1WBTA 4D2PA 4TY1A 4ZSAA 5HTIA 4F9AA 3L8SA 3SLSA 2QODA 4PF4A 5E8SA 1WBVA 1J7LA 3FXXA 2BRBA 3F3TA 3OEFX 3BLQA 3MDYA 1Y6AA 1TQIA 2WTKC 5JN2A 4OTFA 4PNIA 2OXDA 5GNKA 3MPTA 5EDPA 4R5SA 3S4QA 2VWYA 5EYKA 3I7BA 3WBLA 3C4CA 3QX4A 4RLKA 5BVEA 2WMAA 3TNWA 4CCBA 5KKRB 3R8LA 4E4NA 5ANJA 3GFWA 1UKHA 4QMZA 1JLUE 4DFZE 5IQAA 3PXQA 3RI1A 5EM6A 3KEXA 4L6QA 2B0QA 2QO9A 5D7VA 4ZMEA 5BVWA 2XS0A 3JY9A 5A4QA 2ZB1A 4G3GA 5CENA 2YAAA 4QP7A 5JQ5A 2R3OA 3NYXA 1TQPA 5K0KA 2W9FB 4BDAA 4JS8A 2PE0A 4MF1A 5FP6A 4NCTC 4WBBB 3ALOA 4IZ7A 5CEPA 5LVLA 5HO6A 3H3CA 3EQPA 4NT4A 3OUNB 2C5XA 5HBJA 3VS2A 1FMKA 4AFJA 2XP2A 2J5EA 5AUYA 3ZLSA 4BF2A 3CCNA 5D41A 2ETKA 1BUHA 1YVJA 1PKDA 1Q97A 3CS9A 2B9IA 4FSMA 4G6OA 2R3QA 4G5PA 4CZYB 4YO4A 4H1MA 5I9WA 4AZFA 3V5QA 3W33A 4B0GA 4YSJA 3IONA 5JK3A 3OBGA 4Y85A 1LPUA 1YWVA 3DT1A 1R0EA 5HX8A 5KNJA 3D94A 2CNQA 2Q0NA 4GV1A 2O5KA 3PJ2A 4FNZA 4UV0A 3UIXA 1H00A 4C2WA 4C3FA 3PA4A 4FT5A 4I6QA 4O7ZA 3VJOA 3BHUA 5TR6A 3BELA 4NW5A 3U54A 3LZBA 4BL1A 1JOWB 2X8DA 1VYWA 2GHGA 3FBVA 4I5MA 4XG9A 1Q3DA 2W5BA 5C9CA 3VQHA 2UUEA 4N0SA 2Y8OA 3ZUUA 3CJGA 3OY3A 4XP2A 5JFSA 4JAIA 1GY3A 3NZ0A 4HCVA 4IZAA 4ERKA 4CRSA 5FTOA 3NUSA 3C5UA 2WTIA 4BYIA 4EOQA 3I7CA 5AADA 5AUVA 3H10A 1K3AA 2ACXA 4H3BA 3IPHA 2PZPA 4X6RA 5J9LA 4EH2A 3UZPA 3GNIB 2AC5A 4GSBA 4EH9A 2GTNA 4YJVA 3IOKA 5FEDA 5K5NA 1H07A 4W8EA 4L9IA 3QUPA 5AR5A 5H8EA 3TZ8A 4C33A 2I1MA 3RINA 4ZJVA 3CPCA 4WSYA 1OIRA 1RW8A 2FB8A 3OHTA 4RIOA 3LXNA 4O0UA 4CCUA 4G3CA 2Y0AA 3PPJA 4H05A 2YIXA 3JXWA 4FTRA 3EL7A 4O6EA 4UYNA 2BAJA 4OTQA 2G9XA 4K9YA 4YJUA 4ZLZA 4FKPA 2CNUA 4YHJA 3IK3A 1Q4LA 2CN5A 4BZDA 3Q3BA 4I0RA 4YTIA 4DITA 3ZO4A 3I6UA 4PPBA 2BHHA 1YXUA 3C4XA 3HVCA 2NPQA 2QNJA 2XIRA 5K0XA 3L8VA 3TUDA 3A99A 3FHIA 5L8LA 3IW6A 3GU7A 5HORA 1K9AA 2KTYA 3BEAA 4TYHA 1TKIA 1OKYA 2C6DA 4I3ZA 4ZXTA 4ZZOA 4YJNA 3MH2A 3CTJA 2OF4A 1IAJA 4Q2AA 4V0GA 4QP3A 4IFGA 3IW5A 3LFEA 3PLSA 3QALE 4F9BA 1H28A 5J7BA 3ZCLA 3GC0A 4I20A 4DT8A 5CZIA 4C35A 3ITZA 5C01A 2PE1A 3VUTA 5BPYA 5JGDA 4JX3A 4EH8A 4F0IA 1L8TA 4G1WA 5JFWA 2XB7A 4DFNA 3QGYA 3FQHA 3DFAA 4MWIA 3HRFA 3ZEPA 1ZOHA 2UVXA 2UZEA 2OIQA 3PVWA 4GEOA 4NJDA 4P5ZA 3LXKA 4J8MA 4KNBA 5F95A 4QMUA 5AAGA 3TUBA 2WTDA 2CN8A 3FWQA 5M08A 2CNVA 4QQJA 2ITWA 3QTQA 2X7FA 3N51A 3KN5A 2YM4A 5E1SA 5HESA 3R7YA 1GJOA 1QPEA 3ZO2A 4Y72A 3H30A 2C6IA 3ZM9A 4IE9A 4MK0A 5DR9A 4MXAA 5JRSA 4CMOA 5DMZA 3MFSA 3V6RA 5KBQA 3QTIA 1PXPA 4UB7A 1JWHA 1WVYA 2J2IB 2QOHA 2WELA 4NM0A 4U80A 3QWJA 4UWCA 4OAUC 4LFIA 4C36A 5DR2A 2QR7A 1NVRA 3Q4TA 2W1IA 1FVRA 4EWHA 2ZB0A 1URCA 4FV6A 5EQPA 5CAQA 2Z7RA 2I0EA 2HAKA 4ACMA 4PDYA 3TKIA 3UG1A 3ETAA 3W2OA 2QCSA 5BVOA 5IF1A 4AZTA 2WNTA 5L2IA 3ULIA 5AR7A 1DAYA 5LMKA 1ND4A 3R1SA 3VIDA 4HGEA 5CNNA 4KSPA 3TV6A 4AU8A 4EZ7A 4EC9A 4YPDA 4FKOA 2YM7A 3II5A 3PJ1A 4FV9A 4DGLC 3NUXA 4BYJA 3AXWA 4J52A 4ZY4A 4RZVA 4LYNA 3LVPA 4KD1A 4E3CA 3F2AA 3IOPA 4S32A 3MYGA 2C0TA 3W18A 1AQ1A 4R1YA 3D7TA 3ZONA 3ANRA 4M7IA 4FR4A 5DG5A 5DNRA 1Q3WA 3V01A 3FEGA 5AP5A 4IQ6A 4IX6A 1QL6A 2REIA 4LG4A 1VYZA 2QOIA 4FTJA 4JR3A 4QP4A 3NNUA 2BTSA 3QCQA 5F20A 4AQCA 3BYSA 4RWLA 4QMLA 5ACKA 3WF7A 2EXEA 3IGOA 2YJSA 4D2VA 3LQ8A 5LXMA 4O6LA 2CLQA 4XG3A 4UWYA 3ORLA 4ZTSA 3QBNA 4ZZNA 3RZBA 1UNGA 5JFVA 4NCTA 4KABA 4D2RA 1YQJA 4MXOA 1VJYA 4UMUA 5BUJA 5TE0A 4B8MA 1ZARA 3A8XA 4Z16A 5JQ8A 2OICA 1MQ4A 2QD9A 3DAJA 3MGYA 1UNLA 4XOYA 2WB8A 4NM7A 2O0UA 4O7YA 5ETCA 2GMXA 4QYEA 2VGPA 4ITIA 3Q9YA 5FG8A 3MI9A 2CCHA 3RK5A 4ANNA 3UNKA 2BFXA 3T3UA 3HKOA 1Y6BA 1BLXA 2CDZA 4BVUA 3ODYX 4V01A 4RVMA 4F6WA 2XKCA 2X2KA 3VS1A 4XP3A 2YDKA 1Q99A 4M15A 5AP2A 4QQTA 3C9WA 3POZA 1Q41A 2QU5A 5BNJA 4EOIA 1ATPE 5I3OA 5H8BA 5HBEA 4RJ8A 1XO2B 4XLVA 4EK6A 5AR8A 2LGCA 4TTHB 4UY9A 1JPAA 5AX9A 4DEGA 2JC6A 4EONA 4I1ZA 3UVRA 2GQSA 4JNWA 4P7EA 3Q5ZA 2YCQA 5D10A 1ZMWA 2QKWB 5DGZA 3UDBA 5IU2A 1IAHA 5E92A 4R3PA 5L4QA 4C0TA 3VHEA 2DWBA 4BCFA 3BBWA 4YU2A 4DGGA 1OIYA 4HZRA 4QPAA 4PL3A 4EEVA 4KIQA 4MCVA 2ITNA 2HY0A 3MY5A 4NTTA 3CGOA 3ZH8A 4OT6A 2JKKA 2JEDA 2Y4IC 4WHZA 2EXMA 2P0CA 4FL1A 4C4GA 5E8VA 4LOQA 4GYGA 4QMSA 3QLGA 1KE6A 3NCGA 4YC3A 5EH0A 2A19B 2YCFA 3HMPA 3K3JA 5CI6A 3TL8A 4L53A 3E3BX 3IS5A 3QU0A 4YBJA 3VUGA 2W0JA 4F08A 4F0GA 3I60A 2BROA 3GGFA 4J98A 4WNPA 3TM0A 4WG4A 5IA2A 3DB6A 3U9CA 3GBZA 5LJJA 2PMLX 2FUMA 2P55A 3DQXA 3EN9A 3FJQE 4MH7A 3R6XA 2VV9A 2YM5A 2R3HA 3GB2A 1J3HA 3EQFA 3F7ZA 3JPVA 3MTLA 2ITPA 2RFNA 3NPCA 2IZUA 4L8MA 5HCYA 3UC4A 4BI2A 4BKYA 4C59A 3F2RA 3AGMA 4FNYA 4DBXA 2WZJA 3BGPA 4EOKA 3U6IA 4O84A 3GFEA 3MS9A 5I9UA 4ZIMA 4CYIA 5GINE 1WBWA 3LFAA 5HGIA 3W2SA 4DG3E 2C0IA 3JVSA 3ID6C 2QOOA 3LFCA 4OTDA 1MRYA 3BU5A 2IW6A 3BV2A 4RFZA 4W4XA 2BZJA 3KMMA 4X7QA 4DTKA 5IA1A 4QRCA 5ANGA 2GS2A 4DCAA 4EK5A 3CSVA 4HYIA 4EL9A 3FE3A 3R2YA 4GT5A 4F70A 5ANIA 3HAMA 2RL5A 3IQ7A 4FKGA 5I9VA 2PUPA 5CT7A 1Z5MA 3AC4A 2ITOA 4W4YA 5AUXA 4JI9A 2X4ZA 4IXPA 2J50A 5FLFA 1ZY4A 4MHAA 5HKMA 3LQ5A 4D1SA 5K4JA 2UZTA 5D12A 2GU8A 3HLLA 1YDSE 3UYTA 4L52A 3W2PA 4U81A 3ZC6A 3ZEWA 2OXYA 5KCVA 2ITUA 4I5CA 4F1MA 4PPCA 2VTLA 3PSDA 3FZOA 4F64A 4N4SA 5LVPA 2ITYA 2R7BA 4XCUA 2C6MA 4KB8A 4QTDA 4LGDA 1UVRA 4DEEA 4RIYA 1G3NA 3V8WA 4WNOA 4TYHB 1FQ1B 1Y91A 1QMZA 3IW7A 4ZTMA 3IW8A 3QTSA 4KS7A 3A60A 3DXNA 4V0GB 4WNKA 3UPZA 3VS7A 2IVTA 3JR1A 2Z8CA 3EFKA 1JKLA 4PL4A 3MIYA 1IA9A 2UW6A 2FSOX 2XNMA 3EN4A 4O0RA 5DBXA 2GSFA 3VW8A 4DFBA 4I6BA 4W9XA 5BUIA 4MQ2A 5L8KA 1H1QA 4IVCA 4B9DA 3QKLA 4OUCA 2WTVA 2XA4A 4U42A 2ZV7A 4KBKA 4U9AA 2C1AA 4I24A 3RPYA 2WMVA 2Y4PA 2JFLA 3Q32A 4HNFA 5CSHA 4E6AA 4M97A 2C4GA 4BN1A 1I09A 3EH9A 4YZNA 3UZRA 4YJTA 1YKRA 3FMMA 4IHPA 4S31A
chains in the Genus database with same CATH superfamily
2HZIA 1BKXA 4ENXA 5JSMA 4ALWA 2UZVA 1WVXA 4CT1A 2BDFA 5HI2A 3EJ1A 1IG1A 5HG7A 4LMNA 4RG0A 2A0CX 2QC6A 4MF0A 4BDDA 1A48A 1XMLA 4KUJA 3WARA 2R3MA 2GCDA 1O6KA 3UQCA 2WFYA 4FV5A 3UVPA 2C1BA 3DB8A 3OCGA 5DFPA 1JKSA 3POOA 2OKRA 3UVQA 3MVJA 3VBWA 3QZIA 2VNYA 4F9YA 2G2FA 2PVFA 2R3LA 4EHEA 4EWQA 3P1AA 4Z7GA 3AMBA 4YR8A 4YJRA 3ZZEA 2WMQA 3PY1A 2QLQA 1OL7A 4NM5A 4F63A 5DEYA 1G8KA 4XYFA 5I9XA 3LCOA 3TTJA 4J96A 1PXLA 3C5IA 4Q5EA 4G3EA 4PDSA 4APCA 4CSVA 4DEIA 4BIBA 1W2CA 4EHGA 3SG9A 4YNEA 4JL9A 2E2BA 1H0WA 3PRIA 5LWNA 3VRZA 3MPMA 2F57A 3LLAA 5FWKK 5M53A 3R9RA 4XV2A 4E7WA 2VTOA 3HRBA 5FP5A 3BBTB 4YHFA 2IWIA 3SOCA 5C8KA 5AP7A 5BMSA 2YABA 2WTKB 2J6MA 4TWCA 2B9FA 2VWIA 3M2WA 4CV9A 4R8QA 2XJ0A 1UWJA 3KRJA 1LR4A 1REJA 4FICA 4RIWA 5L6WL 3RK9A 2Z7LA 2XAMA 3D7TB 1XH8A 3CTQA 3N4UA 4J1RA 5FXSA 3QL8A 4IAKA 5GZ9A 4Z7HA 4O0TA 4XG4A 4NFMA 4WRSA 3V5WA 2YZLA 3QTWA 5IQGA 4NFNA 2QLUA 1H01A 5CSPA 1O9UA 2C3JA 4YZDA 5H3QA 4CFWA 3QXOA 3ZFXA 5IA3A 4M3QA 4EOSA 2ZV2A 3R8MA 3RZFA 2C6KA 4PPAA 5EKOA 4XG6A 3CXWA 4EQUA 4OBQA 3DTWA 3OXIA 3CBLA 4G9CA 4HPUE 3VBQA 2GTMA 4QDEA 4APPA 3PJCA 1XH9A 1P2AA 3NEWA 1JKTA 3FPMA 4QYHA 4FIIA 3FDNA 3P23A 3I1AA 3EHAA 4JDHA 4WOVA 3GC9A 4ACDA 4Q9ZA 3G51A 4K18A 4CKRA 3U8WA 2J0KA 5A54A 3HX4A 2XJ1A 4EORA 2YJRA 3DCVA 3OOGA 4MNFA 5FGKA 3VAPA 4BTFA 1E1VA 3SXSA 5BVNA 4XLIA 3WZUA 4E6QA 3HUCA 4V05A 4RQKA 4WUNA 4X6QC 3R7UA 3R73A 2JDRA 2ITVA 5CYIA 1TQMA 2BAQA 4PP9A 4N70A 4EH3A 2OIBA 3D2IA 3HMNA 2G01A 3OXTA 3TEIA 2QQ7A 2IW9A 4GFGA 3ORMA 4BZOA 2W1FA 4GFOA 4DEDA 1J7UA 4LUEA 4CLJA 5F1ZA 5K4IA 3PZHA 1PY5A 5BYZA 4DA5A 3UIMA 2W1CA 3HUBA 5IMEA 1YDRE 2O65A 3LPBA 5CVFA 2BAKA 2W17A 4K6ZA 2V0DA 3GC7A 4G3DA 2R3RA 1SZMA 4QMXA 3UGCA 3LKMA 3D83A 2YERA 2VTSA 4JAJA 4KKEA 5AA9A 2FA2A 2XK4A 1U59A 3MFRA 4DN5A 3NLBA 2DYLA 5DEWA 4D0XA 4QNAA 4IBMA 3QRUA 2OH4A 3GI3A 1FGIA 2Y7JA 3NS9A 4AAAA 3KVXA 5CT0A 3R00A 2PL0A 2ESMA 4AZEA 2XIKA 2CKEA 3E87A 3EYHA 2BUJA 2ZM4A 4ID7A 3GEQA 3ZXZA 1OBDA 2WQMA 4IADA 1G8AA 2J51A 3G0EA 3KXNA 2NP8A 5ETIA 5KHWA 1I44A 4HPTE 3SXRA 3NFFB 4FVPA 2YWVA 1OL2A 2I0YA 2G15A 5E4HA 4BTMA 3FZSA 1GIIA 2AC3A 2VN9A 4OAVB 3DDPA 3G90X 5J5TA 3C0IA 2F2UA 3EFLA 3PXYA 5HX6A 2JIIA 4IMYA 4FVRA 2PHKA 3QXPA 4E26A 3FSFA 3AMYA 2QOFA 3I6WA 3F69A 3D5VA 4D58A 3NAXA 3DA6A 4RJ6A 3BE9A 4FTUA 5CLPA 2OG8A 3BPRA 3P5JC 1WZYA 3LJ0A 4BBFA 1OBGA 2C5OA 3P7CA 4ZEGA 3PZEA 4XP0A 3BV3A 4I0SA 4AGCA 4BCGA 5HE1A 5DE2A 5KX8A 4MVFA 3T3VA 2JAVA 4AA4A 4ASXA 3KF4A 1UU7A 5IQEA 5HNBA 3DKCA 5CANA 4IVBA 5J7HA 1OPLA 2XANA 4CV8A 3CQUA 4DG2E 3AD5A 4GIHA 4IWQA 5FQDC 1OGUA 4FA2A 2FO0A 5L2WA 4PNKA 4FKUA 5DWRA 4ARKA 3MVMA 2QO7A 2P3GX 3DJ7A 5IQBA 5J9ZA 4YTCA 2VU3A 4NK9A 2YHVA 4BDGA 4QDVA 4W4VA 3MSSA 1Q8TA 2J90A 1PYEA 4EUUA 5A4TA 4ENYA 1SMHA 4D4VA 4RJ3A 5IA0A 2H8HA 2R2PA 2W4OA 2XK6A 4NTSA 3KU2A 4M0YA 2OSCA 3MA3A 5HE3A 2CHLA 5IQFA 4FSUA 1KWPA 4E93A 2XAOA 2F4JA 3CKWA 4R1VA 1CTPE 4LOOA 1SVGA 3GUBA 1YRPA 3CPBA 3COKA 5HVKA 4YZMA 3R9DA 4WO5A 3TACA 4ZTNA 4BKJA 3BIZA 5FEQA 4IWPA 4YLKA 3QUEA 4RIYB 2WTJA 3OCTA 3OP5A 4UZHA 3S1HA 3DTCA 3EQRA 4NH1A 4M14A 2WMBA 3LFDA 2QG5A 4B7TA 5IH4A 3U87A 1WBOA 3R71A 4FKLA 5BVFA 2JLDA 3K54A 4L3JA 3MESA 3UNJA 4GVJA 4FV2A 4Y73A 3TI1A 3V6SA 3OEZA 3TNIA 2J9MA 4EBWA 4HCTA 1OUYA 3WF9A 2VTAA 3ATSA 3DNEA 3DKFA 4O7NA 4ZMFA 3ZLXA 4WKQA 3TCPA 5EHYA 5M56A 3BCEA 2OF2A 3F5UA 1J91A 1OIQA 1S9JA 3RTPA 5AV3A 1XH6A 4FT7A 1VR2A 4I23A 1CKIA 4FT3A 3AKLA 3SX9A 4FKWA 3QD2B 5JGAA 4HCUA 2GDOA 3PY3A 5L2QA 3AGLA 2IO6A 3BU6A 4FV0A 4DH1A 2F49A 4FIGA 5IQIA 4O82A 2EXCX 5GHVA 2GNFA 4BDCA 3ACKA 4Z3VA 1JVPP 4DGNA 1M2QA 3DJ6A 4IW0A 2JIUA 4OBPA 5CASA 4TWPA 2X2MA 4D2WA 3BYOA 1XH4A 4GKIA 2YDJA 3AC8A 4B6LA 5AIRA 4YTFA 1XKKA 4MQ1A 4CMTA 1AD5A 2XK3A 5H9BA 4K33A 4CZTA 2C3KA 5HVYA 3RM6A 3GENA 4AW1A 4ZY5A 3KA0A 2EVAA 5M55A 5JRQA 2ZYBA 3PG1A 3BL7A 3VUKA 2G2HA 4RFMA 4QPSA 4DF3A 3V51A 3KRLA 2Y6OA 5KZIA 4G2FA 3BYUA 5AIKA 3I0QA 5HNGA 4XV9A 2GFCA 2UZUE 4MXYA 1YDTE 2JITA 5TKDA 3ZC5A 4CFUA 2XNBA 3ZLYA 1X8BA 2VGOA 3G6GA 3KXGA 3KY2A 4FGBA 5CU3A 4YJOA 3FY0A 2W7XA 4RSSA 5DT0A 3CE3A 5AP1A 5LOHA 2CKQA 2GS6A 4DH7A 4XS2A 2O3PA 1MRVA 2P33A 4ANOA 3PFQA 4FG8A 4QTEA 5KMOA 2PMIA 4EC8A 2CSNA 4RIWB 1MRUA 2XK9A 1DM2A 2RFSA 4F9CA 5EHOA 3ROYA 3L8PA 5C1QB 3DLZA 3IG7A 1G8SA 3GU4A 4O7TA 4GUBA 4D9TA 4ZP5A 2ONLC 3VS0A 1ZYCA 4PMTA 4BCQA 3DAKA 3ORNA 2XIZA 4ZSEA 5HE2A 4C61A 4HGSA 4UMPA 2VO3A 1Q8YA 2CGUA 3BLAA 2BZIB 1OKVA 2ITTA 1VZOA 3E63A 4WSQA 4BIDA 1ZOEA 3REPA 2ZJWA 2YA9A 3RP9A 4Z55A 4X3FA 3OBJA 2B9JA 2VTMA 4O4EA 4W8DA 3VUDA 3BRBA 5C03A 2VUWA 4BCPA 2IZTA 3EKNA 4DE4A 3ZRMA 4AP7A 2X6EA 4XG7A 4UMRA 2OJFE 5CF4A 1FVTA 4FG9A 3IKAA 4FODA 1NW1A 3COMA 4II5A 3OW3A 3RCJA 3DKOA 5GJDA 3CY2A 4U7ZA 5H2UA 4FTNA 3PFYA 1GIHA 5DN3A 3HMMA 5J1VA 4L7FA 3TXOA 3UO5A 3Q60A 4P90A 4GH2A 3FLQA 2J5FA 2NRYA 5I9YA 2W1HA 4DTAA 5DRDA 2WGJA 3QQLA 4PDOA 4RIXA 1PYXA 5CEQA 3LW0A 2J0JA 5G6VA 3W55A 4G9RA 5IA4A 3KMUA 3GCUA 3C50A 3PPZA 4EQMA 3UZTA 1J1BA 3QQHA 4GJ2A 2BRNA 3K2LA 5LWMA 4FEUA 1O6LA 2VTRA 2XJ2A 1U46A 2F7ZE 3D9VA 3NW7A 4GRBA 2Q83A 2JBPA 4H3PA 1SVEA 1SNXA 2YITA 3HV6A 3QD0A 1BI8A 4FNXA 2PPQA 3MWUA 2YEXA 2OH0E 5JGBA 4HVGA 3FZTA 1BI7A 1ZYLA 1YOLA 1WBSA 3AC3A 5FDXA 4YBKA 5AUWA 2XYNA 3FMHA 1MP8A 3IW4A 4JDKA 5EW8A 2XK8A 3E8NA 3AT4A 2XNNA 3W0NA 2I6LA 2P2HA 4U6RA 3M42A 4S2ZA 1MUOA 1OPKA 1UWHA 5FD2A 2UVYA 4CTBA 1SVHA 4DCEA 3VUHA 3WI6A 2R4BA 3AC2A 3TIZA 4O1OA 3JY0A 2KULA 3R7EA 2I0HA 1JKKA 4X21A 1W0XC 3TKHA 3UNZA 3LMIA 4JMQA 4MXXA 5G1XA 3U51A 4BWXA 4CFXA 3QC9A 2UW3A 3R8PA 4FZAB 3R0TA 5AP6A 4MXZA 3TNPC 5IEXA 3KFAA 4RQVA 2F7XE 1UA2A 3RGFA 4D2SA 3DJ5A 5EM8A 3V3VA 2B4SB 4XV3A 5KO1A 3P5KA 4FIFA 5HD7A 1H1SA 2C0OA 4NEUA 1U5RA 4B99A 4AZSA 3FZRA 5T6KA 5JMSA 3OF0A 3D7ZA 3R8UA 3W0OA 4FZFB 4D55A 1URWA 5J87A 4FC0A 1ZOGA 1O6YA 3KF7A 3EFWA 3G6HA 2BRGA 3EN5A 5BMMA 4YURA 3OCSA 5C4LA 3CKXA 4AGDA 3HP5A 2VD5A 3VBVA 4RA4A 4X2GA 1F3MC 2VO0A 2R3IA 1JSUA 3G33A 1S9IA 4HYUA 4ACCA 1KE5A 4MNEA 4U44A 3PVGA 5HG5A 5CU0A 5TT7A 3WE4A 4FZ6A 3K3IA 4HGLA 4O21A 3G15A 4UX9A 4BGQA 5E8WA 2F9GA 2H96A 2FSTX 3C7QA 1XH7A 5E8ZA 4EJ7A 1CM8A 3BQRA 1U54A 3AD6A 5EM5A 1W83A 5KKRC 2CGVA 3EQBA 3TNQB 3QQKA 2UW7A 3TWJA 1SNUA 1KE8A 4BWPA 4CFMA 4JDJA 2BVAA 4MTAA 2HYYA 4P5QA 2E9VA 2HWPA 3KCKA 4KBAA 5DPVA 4EOJA 1M2PA 2X0GA 1FGKA 4F9WA 4RVLA 4FKTA 4XBRA 3MTFA 2IVVA 2OZAA 4C4HA 2WTCA 1JQHA 2E9UA 4H39A 2BIKB 4BICA 5HTBA 2RFEA 3ZO3A 3R2BA 2X1NA 5L8JA 2WEIA 3G9NA 3PP0A 2XK7A 3GC8A 4OTRA 4BCMA 2PYWA 1CMKE 1ZZ2A 3H0YA 4WA9A 3W8LA 2VTTA 1W8CA 3H9OA 3MV5A 3ALNA 4GK2A 3BEGA 1OVEA 4ZS0A 2BIYA 5T68A 3QQJA 3RVGA 2ZM3A 4ZSGA 3K5VA 3QQUA 4OR5A 4TYJA 1Q8UA 4RGJA 4DHZA 3PWYA 3HAVA 3A7JA 5B0XA 3O8PA 2OJGA 3DZQA 2QU6A 4UYAA 5M4CA 3KL8A 2B53A 3ACJA 4L46A 3QYWA 4AQKA 4BGGA 4IM3A 2Q0BA 4LL0A 4KSQA 5IH5A 3WF5A 5JZJA 3GU8A 2C5VA 5HLNA 1ST4A 1KSWA 3FYJX 5D9HA 3BHVA 4OT5A 4MD8E 2R3FA 3C4WA 3MBLA 5L2SA 4AOIA 3PDTA 2HK5A 5FXQA 3EQIA 4A9YA 5AEPA 3SQQA 5IZFA 4ALUA 3N9XA 5EDRA 3CLYA 2SRCA 3UG2A 5FBOA 1E1XA 1TVOA 3FAAA 4FMQA 4OTPA 1R78A 4PMMA 3UOLA 1P14A 5DIAA 3NUUA 3Q6WA 4IZYA 5EHLA 4IX5A 3WE8A 1M7NA 4RRVA 4AS0A 2XIYA 3BLRA 4NWMA 4QO9A 4BFMA 4D4YA 4HVSA 2P4IA 5EI6A 1H1WA 5E9EA 3MA6A 3E8CA 3PG3A 4GU6A 3SD0A 1IASA 3S00A 4L3LA 5AX3A 3WZEA 3G9LX 2W1DA 2OW3A 3VULA 1KUTA 2JDTA 5CU6A 4ACHA 4QTBA 3OFMA 4FIHA 3CGFA 3G0FA 3MFTA 2NO3A 3ORKA 4ACGA 3QKKA 1NT2A 3KQ7A 4PX6A 3DBEA 2XRWA 4XG2A 4EJNA 2IW8A 2WQNA 4I41A 4FTAA 3GVUA 4RJ4A 3TIYA 2J7TA 2BRMA 2W06A 3LJ2A 4R3CA 4IB3A 2XUUA 3VHKA 4QMTA 4IB0A 3TN8A 2XKEA 3V8SA 3DZOA 2ONLA 3IO7A 2IVSA 4TNDA 3LMHA 3O8TA 1YOJA 1GAGA 3MPAA 3QLFA 5FEEA 4JDIA 4ZZMA 2XKFA 2YIRA 4FUYA 3S3IA 5IQHA 3CP9A 5LCJA 3NCZA 2PVKA 4FTQA 4TT7A 5CWZA 5DI1A 1ERKA 5DRBA 4A4LA 3CJFA 5C26A 3BYMA 4MBLA 2QVSE 3FMJA 4BDHA 4C4FA 4GVAA 3VN9A 4PP7A 3F3UA 2C47A 2EUFB 3RHXA 2X7OA 3SXFA 3ZSHA 3ENHA 4G6LA 3ML1A 5AV2A 2XZSA 4A7CA 3OC1A 3P7AA 5H8GA 1V1KA 3MN3A 4LRJA 4ITJA 4QQCA 1ZRZA 3VWAA 3ZZWA 1Q61A 1YHSA 2QONA 3EZRA 4QOXA 4RC3A 2IN6A 5KMIA 5L2TA 4O4CA 3UMXA 4KAOA 4MX9A 4CT2A 2UZWE 5CF6A 2BKKA 3O96A 3R9HA 3GU5A 2HZNA 4TRLA 5GZAA 4N6ZA 3C0HA 4X3FB 2X0OA 4CD0A 4WG3A 4U79A 3FI3A 5AV1A 1YXVA 2PU8A 2CJMA 2ZDTA 4E73A 1HCKA 3BGQA 1FOTA 3GOKA 5EM7A 1YXSA 4RC2A 3FL5A 3SW4A 4AOTA 1OL6A 3RPVA 4R7BA 3HV7A 3W2QA 4O7SA 4IX4A 4QP9A 4P4CA 3NGAA 4E6DA 4IB1A 4AAYA 4NZWB 2X7GA 4YP8A 1IEPA 5HOAA 4I93A 4IIRA 3G5DA 4RIXB 2F7EE 4M12A 3TJDA 3NFGB 3CQEA 2W5HA 2QURA 3ORTA 3OXZA 4WNMA 2PY3A 3RMFA 4GCJA 4E8AA 3UDTA 2XCKA 5HZNA 2W99B 1KV2A 5CAVA 2X6DA 3NVKI 3FMKA 3KVWA 4IJPA 4G31A 2W9ZB 3DOGA 4ANQA 5HLPA 4YC8A 3V5JA 2UW8A 4BKZA 3E3PA 3ERKA 5IUIA 3W0MA 2ZV9A 4EHVA 4WUAA 4C7TA 3BYVA 4YJPA 3FSKA 3KXXA 3DU8A 5LVMA 4O7LA 3NMUF 2ZMDA 5ITAA 3VC4A 1SM2A 3LIJA 5A6NA 2VX3A 3MH0A 1YOMA 2CKOA 2HY81 3E8EA 3AT2A 4C34A 3RNYA 5EDQA 1P4OA 1NY3A 4D28A 3NIEA 5BX0A 2CKPA 3QD4A 4QP8A 4AOJA 3Q5IA 3P78A 3C13A 3VUMA 5I5ZA 3BKBA 4MEDA 3D0EA 3F5PA 4OW8A 3WF6A 4RBLA 5E8XA 4E20A 4EHZA 3ZDIA 4BBMA 4ZAUA 5M57A 4L3PA 3VJNA 3A4PA 4B4LA 4XJ0A 2OU7A 5KZ0A 2PMOX 3WOWA 2OBJA 4A4XA 4GUEA 3TDVA 2PVLA 4FSQA 3O51A 2AQXA 1B38A 2OJJA 5BVKA 5C27A 3VS3A 2QKRA 3HZTA 4I92A 3PA3A 3UYSA 2VWVA 3SDJA 4JQEA 3U4WA 1M7QA 4LV8A 4A9RA 5IUHA 1OUKA 3H9RA 3L8XA 4YO6A 2HXLA 3EQHA 2V5QA 2HW6A 1H1PA 3EZVA 2WXVA 1Y57A 3NR9A 4KINA 4UWBA 5CQUA 5EYDA 3TT0A 5L3AA 3UIBA 3CD3A 4BHZA 3TDWA 4FKVA 2XNEA 2ITXA 3ORZA 4JT3A 4AT4A 4BI1A 1ZLTA 4TWNA 2C69A 4Y95A 3NSZA 5DH3A 4DC2A 3ZRKA 1OB3A 2QO2A 2ZAZA 2JDSA 1YHVA 2YM8A 5E7RA 4X2FA 4CMUA 2PZRA 2BHEA 3W2RA 2PUUA 3MVHA 4M67A 3A2CA 3FUPA 3FMNA 5IMXA 4MNEB 5M09A 1FPUA 3DK3A 1UNHA 2YLFA 3F5XA 3NW6A 3RKBA 1W84A 5EI2A 4QMQA 1H26A 1PMUA 1Z57A 4FKIA 2WHBA 3CR0A 3L9PA 2X8IA 4FG7A 4YJQA 5M4IA 3DPKA 2YIYA 3FC1X 2YCSA 3CC6A 3ORIA 3DK7A 4AT5A 4CFVA 1U54B 4AFEA 4O0YA 2X8EA 3M11A 3HNGA 4AE6A 5KMLA 3R7OA 4EQCA 4EUTA 2QOLA 5DLSA 4EOMA 4FK3A 3R83A 3OY1A 4YZBA 3DBFA 3OUKA 2OLCA 3FLSA 4MYGA 4I5HA 4AN3A 3FLNC 4FYOA 4KIPA 3PPKA 4X2NA 3ZFYA 1REKA 3P08A 3Q04A 3SRVA 4C58A 3GT8A 1PXIA 2H34A 4UN0C 1E9HA 3SGCA 3D5XA 2OZAB 4DGOA 3F7WA 4PMSA 2IF8A 2YIQA 3OG7A 4ASZA 1IR3A 4LGGA 3SV0A 2BRHA 2HELA 2PVYA 4UZDA 4DHIB 2W1EA 3LAUA 3NIZA 1P4FA 2OZOA 4H3QA 4DYMA 2CGXA 4ZLYA 4YLLA 3OD6X 4TZRA 5HIEA 4O4BB 3GCVA 1Y8GA 2ITQA 1H27A 3VBTA 5LMAA 1OGYA 1VEBA 3ZYAA 1WBPA 4IEBA 2VWZA 4DFXE 3QTRA 4MWHA 4YUQA 2ETMA 2JIVA 4JBOA 2RF9A 3UO4A 4R3RA 3TJCA 2YISA 1A06A 1T46A 2F2CB 3P4KA 4Y83A 3PVUA 2X39A 3EQDA 4TNBA 4NU1A 5M4FA 3C51A 3E88A 4A9SA 4C62A 3VW6A 4CYJA 4BCOA 3SG8A 2UW4A 4C8BA 3O71A 3FLYA 4AXCA 5K5XA 3HA8A 3AG9A 3R02A 4RT7A 4O4DA 3BLHA 2UVZA 1APME 4KA3A 3KULA 4QQ5A 4M8TA 5HG8A 2NNWB 2C6EA 3LJ1A 5A3XA 4JOAA 3L1SA 5JEBA 4BTKA 3F6XA 4S34A 1YI6A 4ZJJA 5I9ZA 2XNOA 2R3KA 3AD4A 4QTAA 4FVQA 2UZNA 3QRIA 3Q6UA 4FI1A 2W1ZA 3ZTXA 2X9FA 1LUFA 1M2RA 2EWAA 4Q5HA 5HNIX 5FRIA 4D5KA 2GPHA 3BE2A 3R7VA 3ZDUA 5CEOA 3S2PA 4Y5HA 4D4SA 4WG5A 3ZOSA 4IDTA 4ANMA 4AF3A 1Z9XA 1ZWSA 4QYFA 1RDQE 2O64A 4RZWA 5FDPA 5HD4A 2RGPA 5CXZA 2R7IA 3FI2A 1H8FA 3SOAA 3R22A 4L67A 2WOTA 2G2IA 3PXKA 1OECA 4GIIA 1Q5KA 3PUPA 5KHXA 1SYKA 2WMSA 4QNYA 4TYIA 4WBOA 5HEZA 3TTIA 3UBDA 4D4RA 4PDPA 1LEWA 2PE2A 4U3YA 3EN6A 3OWLA 5AMNA 3KREA 1LEZA 1Q8ZA 4XRLA 5HIDA 5A9UA 4G16A 4GT4A 4JG8A 5FTGA 4FTTA 1ZZLA 2FYSA 5CU4A 1DS5A 3VQUA 4F1OA 1CDKA 3R1NA 3NAYA 4J97A 4JJRA 1GZKA 4RVKA 5AM6A 4J95A 3DLSA 4I21A 4RJ5A 4L00A 2EB3A 3LFFA 2BMCA 3N4TA 4QMVA 1XHAA 2PVHA 4K8AA 3NYNA 1JAMA 1BMKA 3D5UA 4R7HA 2BZHB 5CS6A 5HG9A 5I4NA 5HCXA 3V5LA 1WMKA 3VNTA 3ZUTA 4CXAA 5BQ0A 3UE4A 4YC6A 4QD6A 3SHEA 5LMBA 5C8NA 3OWJA 2C3LA 4CQEA 3WIKA 3PY0A 4QEBA 3QD3A 1W7HA 3F3ZA 3OT8A 5CZHA 3MW1A 1UU9A 4DEAA 3RALA 1RE8A 5CSVA 5T3QA 3OWPA 4LV5A 5KE0A 1U5QA 4PRJA 3SC1A 5L6OA 4GK3A 4O2PA 5CEKA 2UZOA 4AACA 2XARA 3TMOA 4IANA 4XH6A 4EBVA 3ZSGA 4QP1A 3WIGA 2VWWA 4QP6A 2BFYA 2VTJA 1MQBA 1W82A 2WOUA 4U0IA 4A4OA 4JLCA 2C6OA 5CQWA 2YM3A 3P9JA 4GYIA 4YHTA 3UQFA 3VVHA 3W10A 4U40A 2HWOA 5AV4A 2ERKA 3WYXA 3F3VA 4U43A 1ZY5A 4QYYA 1M52A 4CNHA 3UJGA 3UIUA 1H24A 2WTWA 5IG1A 5HHWA 4IJ9A 3S0OA 1FINA 1Y8YA 1YWNA 3NDMA 4RPVA 5J79A 3KRWA 3SKCA 4FTIA 3TV4A 4KRDA 3RAHA 4F78A 4GG5A 2XCHA 4O91A 4FSZA 4BY9E 4JBQA 3UMWA 5CAUA 4U41A 2GNGA 4PUZA 3RJCA 4ORKA 4LV7A 4LI5A 3VS4A 1PXKA 4Z9LA 3F66A 3FL4A 3KRRA 4XBUA 5JKGA 4QMOA 1H4LA 3Q9XA 2Z60A 4YSMA 4QYGA 3KMWA 2YN8A 2YM6A 3KRXA 4F0FA 1J7IA 3LMGA 2IEWA 3TYKA 1NVSA 2VO7A 4FYNA 4IWOA 3HECA 4OBOA 4X3JA 4EK3A 2HZ0A 5B2KA 4QP2A 1PW2A 3ANQA 3V8TA 4PMPA 4R77A 3EWHA 3ODZX 3OTVA 5DHJA 4E5BA 3FI8A 3M1SA 3A62A 3ORXA 4QMMA 4CKIA 3OTUA 4KKHA 4K2RA 4L68A 4TKSA 5ICPA 1UKIA 1ZXEA 2VTQA 4MKCA 4MD9E 2ETRA 5E1EA 4XG8A 3TKUA 2B7AA 4D1XA 2C30A 3HMOA 3E7OA 1QPDA 4FZDB 2CGWA 4FSTA 5DT3A 2YZAA 3AMAA 4FEXA 1V0BA 3E8DA 4FK6A 2A2AA 4XEYA 2IZSA 3W0SA 5IPJA 3LM5A 3R04A 5HBHA 2XALA 1QPJA 4K77A 3W1FA 1OKWA 2Y9QA 3QRKA 4USFA 2PUNA 4BDJA 4O7RA 2HENA 4RX8A 3E93A 5CNOA 5EW9A 4ERWA 4IZ5A 2V62A 4UALA 2ZDUA 5IUGA 1R39A 2PWLA 1FBNA 3WILA 4KIOA 4OTHA 5JT2A 4AGUA 3A7GA 4PTCA 2A98A 3AQVA 3ZRLA 3W0QA 2R3PA 3VF9A 4A9TA 2GNHA 4A9UA 4JIAA 3W0PA 3BX5A 5AR2A 4GJ3A 3DBCA 4NM3A 2P2IA 4PY1A 3A8WA 1Q8WA 5IDPA 1XBBA 2BTRA 2B54A 3KXMA 1GOLA 4RMZA 4UEUA 5TOZA 5TO8A 2CLXA 4AA5A 4E4XA 1ZYJA 2C5YA 2WMTA 3QX2A 2W4JA 3R01A 2A4LA 3AC5A 3SRVB 2VAGA 3ZFMA 2UW5A 4CQGA 4CVAA 3HDNA 3ZBFA 3R9NA 3ZXTA 3DKGA 1H08A 4XNEA 1BL7A 1BL6A 3H9FA 3I5ZA 3LCKA 3O8UA 4O22A 3IGGA 5LARA 3I4BA 1XH5A 2OJ9A 5HLWA 3P7BA 1AGWA 4JXFA 5FTQA 5I3RA 5J9YA 1PXMA 2VWUA 1YXXA 2UV2A 1PHKA 3CTHA 3FHRA 3GP0A 2JDOA 3GQIA 1PXJA 2BCJA 3I79A 1V0OA 3LFNA 3LFBA 3LHJA 3Q53A 2GS7A 4FNWA 4DGMA 4FV8A 4YZCA 4X2KA 2DQ7X 5FUTA 4I94A 2XIXA 1VLRA 1UV5A 2OXXA 2RG6A 3QF9A 3QTZA 5AFVA 3RAWA 5BYLA 3BQCA 4TYGA 3EOCA 1W2DA 2XEZA 3QQFA 3NX8A 2GNJA 4G34A 5ETFA 3QZHA 4DBNA 4DHFA 5AUTA 3OT3A 3HA6A 4IC7A 3SVVA 2WU7A 4IAIA 4ZSLA 3UC3A 3R7GA 5IQDA 3RPSA 3QTUA 2PVJA