4C61A

Inhibitors of jak2 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
272
Chain Sequence
FEERHLKFLQQLGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQAHAERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Discovery of 1-Methyl-1H-Imidazole Derivatives as Potent Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 272
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c61A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c61A01
2W4JA 5E1SA 3OVVA 4OTFA 4F09A 4DEHA 3PLSA 3QTRA 3FLNC 4UMUA 4NTSA 2OF2A 4O38A 3MY1A 2CGUA 5BYZA 1J3HA 4MNFA 4BI1A 4GEOA 3EL8A 4K33A 4AGWA 3DZOA 2V7OA 2CN8A 3FMLA 2IW6A 2W5HA 3C4EA 3LW0A 1XBCA 3TEIA 3KREA 2WTJA 4IH8A 4I6BA 4GV1A 5HX6A 2BDWA 3MBLA 4HNFA 5FD2A 3R7IA 3O50A 3U4UA 5IA5A 3Q4TA 4KKEA 4YZDA 5JQ5A 3QHWA 2YACA 4RWIA 4F4PA 3KC3A 4DGMA 3OXZA 4XG4A 5AUXA 5HBEA 4FG7A 2F2CB 4HYSA 4G2FA 3NW6A 5H3QA 3RMFA 4CGAA 1XQZA 1SVGA 2C69A 2W1EA 3BX5A 4FTJA 4EC8A 3VRZA 4DEBA 4F9CA 4IVCA 4RIXA 4R7HA 3E3PA 5IH6A 4ERWA 4ASZA 5I9XA 2R3MA 2ZM3A 4HCVA 5ETFA 3QYWA 3I0QA 5HNIX 1ZLTA 3FZ1A 3DZQA 3LQ3A 4ZJJA 3E88A 3MPMA 4RX7A 3FPQA 4BDAA 3NUAA 4BCPA 1P4OA 4I92A 4F70A 2WELA 3HV3A 4O81A 1H25A 4NYEA 4FVPA 4ACGA 3W2RA 4EOQA 3QLFA 2P2HA 2HENA 5DVRA 3KB7A 1F3MC 3VVHA 2RGPA 3FHRA 3WIKA 5AFVA 3C7QA 4YHFA 4IZ7A 3LXNA 4ACMA 1SVHA 4UB7A 4AE9A 2GNIA 4RMZA 1YXUA 1V0OA 3OBGA 5J87A 5EM7A 3S4QA 4C35A 3NPCA 1PXPA 4TPTA 4K6ZA 2JDRA 3C4ZA 3MVHA 4F7JA 1U59A 3ANRA 4QTDA 2OIQA 2UW7A 5HEZA 1KOAA 3P23A 2YDIA 3SRVB 2G2FA 4F0GA 2PSQA 3KULB 2RFSA 4LV5A 4MAOA 3ZO4A 1P5EA 2BAQA 4FSNA 2WTCA 4ACDA 4WRGA 5AP6A 3V8WA 3BKBA 1H4LA 5JGBA 3HLLA 2ITNA 3AGMA 4NM0A 4BGQA 3R1YA 5D9HA 4E6DA 4CG8A 3QCQA 4JAIA 3LVPA 5ANIA 1A48A 5BVOA 2WD1A 4XG7A 4TNBA 3R83A 3WF5A 4EUUA 3QWJA 5HO7A 4NSTA 3TCPA 1BKXA 4J7BA 5HNGA 3CQUA 2C3JA 5A14A 4QP3A 3FY2A 2GS2A 5AR3A 2WMRA 3POOA 5ANDA 4E7WA 5CAOA 3MH1A 4KAOA 2UUEA 2V22A 4KS7A 5LMBA 4JVGA 4NW6A 5HTIA 2VZ6A 4ZSJA 3E7VA 3H9OA 3PXQA 5E8ZA 3OWJA 5EHYA 4A9YA 2BDJA 4WOVA 4BWKA 2WOTA 1REJA 4NIFB 3O8PA 3LHJA 4ASEA 5AR8A 4Y95A 1A06A 1M2RA 4YZ9A 4ZMFA 2W4KA 4AF3A 4C38A 4CFWA 4MVFA 5F4NA 3IQ7A 4RPVA 4X2FA 5FDPA 2PPQA 2I40A 4JIKA 4PL5A 4NUSA 2XK3A 5FTOA 4YC3A 1ZY4A 4AOJA 2PTKA 2HWPA 3UQCA 2BAJA 4EQMA 4G17A 2XKEA 4MX9A 4NCTC 2X81A 5KMMA 4JG6A 5CS6A 1PY5A 2BALA 3K3IA 4QP7A 5T6KA 4FTIA 3RALA 1NW1A 3IPHA 2GNLA 4GL9A 2WQBA 3AOXA 2PVLA 3BHUA 4FR4A 4ALUA 3V5WA 3GC9A 4BBEA 4R5SA 2BKKA 4CCBA 2VX1A 3DAJA 2C6KA 3OCSA 4GRBA 4EWHA 5K9IA 1YXXA 5BVKA 4DT9A 3QUPA 1JKSA 2VV9A 3HGKA 4RSSA 1MQBA 5CSPA 3FQHA 4JS8A 4CD0A 5KX8A 3WIGA 5DR2A 4USEA 4DCEA 5E9EA 2JIUA 3OCGA 4FKTA 4MWHA 3L9PA 4RLLA 2HY81 3PXRA 1WBVA 2P0CA 4IX6A 4AUAA 3QUEA 5C03A 4AN3A 4YR8A 3KL8A 5B2MA 3R2BA 3VS7A 2EXCX 4NWMA 2ZDUA 4ZP5A 3D83A 5AUZA 3U6IA 4O0SA 3QQHA 2VTIA 3P5KA 4TL0A 3QC9A 3WBLA 4FKRA 4FUXA 4CZYB 5FTGA 2JGZA 3KFAA 4NH1A 2GSFA 4U43A 2C1BA 3OEZA 4JR7A 1U54A 5JGDA 2C3IB 4R1VA 2BR1A 4MQ1A 4O2ZA 2QNJA 3FI4A 3GEQA 3TNWA 1YXSA 1I09A 4UXLA 5C8MA 2PU8A 4EH3A 4YUQA 5HU9A 2ZOQA 2JDVA 3ATSA 5TE0A 3Q5ZA 3ZC5A 5C8NA 2UZEA 4Y8DA 4YJSA 1U5QA 3LFAA 4QD6A 4UY9A 5JMSA 4BKJA 1OKWA 3EQPA 4CFVA 4PTCA 4D1ZA 3I6WA 2W0JA 3GGFA 3FZSA 3NNXA 4D2PA 1UU8A 3ZSHA 2J0MB 4EONA 4FZ6A 5M4FA 5IQCA 5A6NA 1FGKA 2QOBA 4AW2A 1M17A 3CR0A 5EH0A 3FQSA 2J4ZA 3JS2A 4ZXTA 5AEPA 3A61A 4PNKA 2X39A 4DFXE 4YNOA 1OKYA 4DF3A 4E5BA 2XM9A 4RRVA 2C3KA 4BYJA 4C59A 3NRMA 3NUNA 4GUEA 4BN1A 1B6CB 3RM6A 4XG2A 3RK5A 2Y4IC 5F95A 3GNIB 2HAKA 4DH8A 1KV2A 3OP5A 4JNWA 3LMHA 1CM8A 2XJ2A 2XIXA 5G6VA 1DM2A 4NJ3A 3WZJA 4W4XA 4IANA 1VYZA 3LJ1A 4C61A 2IN6A 4USFA 4RIOA 4CV8A 3BWJA 4DH7A 5HVJA 5K0XA 4MK0A 3EMGA 4QYHA 4MQ2A 4ACHA 2UVZA 4HGLA 4RIWB 3TUCA 4CFMA 3ORNA 3PFQA 4TY1A 4CRSA 2C5OA 2OI4X 2E9VA 1STCE 3Q4ZA 2OIBA 3NCZA 3PA4A 5HG7A 3CKWA 3QQLA 2ONLC 3F5GA 3MH3A 5LWNA 3UO5A 1JLUE 4XLIA 2QOQA 2C5VA 3A2CA 2B9FA 1SMHA 2R3PA 3GCPA 2PY3A 3LJ0A 4HPTE 4R1YA 3Q9XA 3HZTA 1YOJA 3GFWA 3QD3A 4HPUE 4P5ZA 5BYYA 2YZLA 5IA3A 2F49A 3G5DA 4O0WA 5L8JA 4JDJA 3VW8A 4MXCA 4EOIA 4JX7A 4QNAA 5L2SA 5J95A 4S32A 2YJSA 3ELJA 4N0SA 5EI2A 4FIFA 4IDTA 4IB1A 5AR4A 4KIKB 5AR7A 3NDMA 3TT0A 5AAGA 5M53A 2CNVA 4UALA 3DFCB 3FLQA 4P5QA 5L4QA 4TWCA 1Q4LA 3SLSA 5TOZA 3R1QA 5HVYA 3D5UA 3VS4A 3TDVA 4IZAA 5IA1A 3PSDA 4AQCA 1OVEA 1U4DA 3HMOA 3T9IA 4HVIA 5A4CA 1WVWA 3PE2A 2QKRA 4LOOA 4JR3A 2HOGA 4KA3A 4GCJA 3Q6UA 3RKBA 3F82A 4IE9A 3VW6A 4BIBA 4O21A 1H0VA 1SZMA 4BDIA 4LRJA 1CSNA 4QMPA 4PY1A 4F9AA 3D15A 3F5PA 3UNJA 4CLIA 3FMDA 5A54A 1J7UA 4M66A 4U5JA 1ATPE 2HCKA 4AXAA 3PP0A 4QP6A 4ZMEA 2OO8X 4MXZA 4S34A 2JBPA 4N4SA 5EYCA 2A0CX 3CTHA 3FL5A 4L01A 1KE7A 2GHLA 4XOZA 3UYTA 5T3QA 3FV8A 3LCTA 1Q3WA 4J52A 5J9LA 4G3EA 5EDRA 4ZS0A 2OWBA 4IDVA 1M2PA 3C5UA 1JSVA 4D4SA 4FSWA 3K5VA 4NTTA 3FLYA 4H3QA 4O1PA 3MSSA 4I21A 4GJ2A 2WMQA 3GT8A 5CI6A 5ICPA 3RAIA 2VTJA 2ZAZA 4FVRA 4YLJA 3VQUA 4E4XA 4ITJA 4YZNA 3B8RA 2PULA 4F6UA 4EZ7A 2I0VA 3NAYA 4XG8A 2OXXA 4BZDA 1BYGA 5H8EA 3IKAA 4O84A 5IQIA 3KKVA 1Q3DA 3G6HA 5KMKA 1YVJA 5AR5A 2P2IA 4X0MA 4FT3A 4I6QA 3DTCA 1Z57A 3CE3A 3EB0A 2R0UA 3LCSA 4FT7A 4CYIA 3Q32A 4IWOA 5ETCA 4C34A 1OPJA 4D2TA 3AMYA 3U9NA 5D12A 4TTHB 5IPJA 1XR1A 2R4BA 3NUXA 4B6LA 3R9DA 2W4OA 4U6RA 5A6OA 5KMOA 3QQKA 2R7BA 4LUEA 1H1RA 3OZ6A 4NCTA 4O96A 3TL8A 3UOJA 3VS5A 2NRYA 2QR8A 4Q5HA 3KF4A 4ZSLA 3TNQB 1B38A 4O0VA 4IAKA 1OPKA 4K18A 2QOHA 4JX3A 4E20A 4GK2A 4IM3A 3UTOA 3DLZA 2VGOA 2C6DA 3OFMA 4BHZA 5CNOA 2CDZA 2W7XA 1OL1A 3VS6A 1PHKA 1QPEA 3QLGA 4PV0A 5BQ0A 1DAWA 1WZYA 3R7UA 3UJGA 3NCGA 3WF7A 3ZSIA 4IXPA 1YI4A 2XBJA 1OECA 3RBWA 1JPAA 3ORIA 5D7VA 2FSLX 4DEAA 2CNUA 4I4FA 3IDBA 4FKUA 2OJGA 2XK7A 4NFMA 4A9TA 2DQ7X 3ZFMA 3PXKA 5EFQA 4WHZA 1HOWA 5DOSA 3DTWA 3HV4A 3H0ZA 3CTQA 2GPHA 4IX5A 4EBVA 2XJ0A 5AP7A 2QC6A 4V01A 4WSYA 3EN7A 4MBLA 3KMWA 5KMJA 3EKKA 4RC3A 5CU4A 4F9YA 5BVEA 2G01A 3HECA 3QCSA 4EHZA 3NX8A 3D7TA 4LRKA 1PKDA 2XNMA 3FSKA 1XJDA 3PJ2A 4B8LA 1H1WA 3QZGA 3ACKA 3LFDA 3Q4CA 4P7EA 4PP7A 1Q8TA 4U0IA 5L8KA 4O7TA 4ARKA 2F4JA 5M55A 1JOWB 1ZYJA 3FUPA 3QD4A 4L43A 2E9NA 3DKGA 4ZZOA 3IGOA 2JBOA 1RW8A 3BU5A 3OCBA 3L9MA 1GJOA 4AT4A 4L53A 2IVVA 5IG1A 5CX9A 3MN3A 3ORZA 3COMA 3QQFA 4HVHA 3GCUA 5HKMA 3T3UA 4FV3A 4N70A 3PJCA 4D55A 3QAME 1XH6A 1OBGA 3QGYA 4G9CA 3A7IA 4ZIMA 3G9LX 3FEGA 3JUHA 2QO9A 1YHSA 4E6CA 2QOIA 2GMXA 3A4OX 4U45A 3TJDA 4A7CA 4KIPA 1JNKA 3TZ7A 5DHJA 3ID6C 4AZVA 4UWBA 5CNNA 2WB8A 5EM6A 2YFXA 2YEXA 3COHA 4X21A 2UV2A 4L7FA 4PDPA 3BBTB 3UYSA 3F3TA 3W10A 4AZSA 2QO2A 2C6TA 3PVUA 5I3RA 5DGZA 2VTHA 4ZY4A 3C51A 4NU1A 4M69B 1P4FA 5CSXA 3NNVA 4YO6A 2CSNA 5C4LA 4EYJA 2VTRA 4AZWA 3I6UA 4DYMA 2XCKA 1RDQE 3CQEA 5HESA 2VTNA 3W2PA 2QHNA 4TWNA 4ANSA 3W16A 4LOPA 1UV5A 3DDQA 4BI0A 4AA5A 5AIRA 1G8AA 3GC7A 4BTFA 4ONAA 4QMWA 3TNPC 3CIKA 4JDHA 4TT7A 3VN9A 3R1NA 2YAAA 2C4GA 5C01A 2VRXA 4MCVA 3TNIA 4EH9A 3NVKI 1GZNA 3UO6A 3MS9A 5I3OA 1H27A 5DLSA 5AAFA 5JFXA 3DY7A 3LFBA 4I5CA 4U41A 4YJRA 3KXMA 3VBQA 4CTCA 4UYAA 5I0BA 3MVMA 2BCJA 3E5AA 4L46A 5J5SA 5JK3A 3HL7A 4A9SA 4ASXA 5CLPA 4RLKA 4CLJA 5JH6A 1R0EA 2IVUA 3FI2A 4FL1A 2W06A 3EN4A 3HNGA 4LI5A 3W33A 4BBFA 4BGGA 3HV6A 1O9UA 4H3BA 5AIKA 3TIYA 5HLNA 3EYGA 3PVWA 2CLQA 3Q53A 3QKKA 3CTJA 1AGWA 4AT3A 3N4TA 4XLVA 3O51A 1XHAA 3ZZEA 2PMIA 3P7AA 3OY1A 2PVRA 2OG8A 3QZHA 2C6IA 4I20A 1OIQA 2F2UA 5BYLA 2VWIA 4U42A 3SXSA 3V01A 2BRGA 3VRYA 4DLIA 5J9ZA 4FTRA 3R1SA 4FKWA 3RTPA 4HVDA 2XNNA 5J1WA 4EHGA 1MP8A 3F3WA 1Q8UA 2CLXA 2YIXA 5CVFA 3PXYA 4ZTSA 4U80A 2HXQA 5IDNA 4BGHA 4F9BA 2X9FA 5BUJA 4LV8A 5JZJA 2YCSA 5HLPA 4C8BA 5JKGA 4DFUA 1R78A 4L52A 2JC6A 3V6SA 1W8CA 3NVMB 3W2SA 4KRCA 3KVWA 3OWLA 2WQEA 3EZVA 3VWAA 3NWWA 5CU0A 3TUBA 2YM8A 4DG0E 4W4WA 5M4CA 4Q5EA 4UWCA 3FSFA 3HP2A 4KIQA 3U9CA 2CKQA 1HCKA 4D4YA 2Z7RA 3EZRA 1MQ4A 1W82A 5AP2A 5J5TA 2QG7A 5B7VA 4R7BA 3MA6A 1XH4A 1XKKA 3TZ8A 3FMNA 5IQBA 4OAVB 5C27A 4CRLA 2W05A 3LM5A 4WBOA 3T8OA 2WIPA 3GI3A 3I1AA 3AQVA 2OXYA 3H30A 1GY3A 2Y6MA 2NPQA 2XBAA 3SOAA 2PZPA 3AC5A 3QWKA 3ROCA 5LWMA 4QP9A 2X0GA 5D10A 2XKFA 4D4RA 2GTMA 4O7NA 3VUDA 2X7OA 2F57A 3G90X 4AGUA 3IECA 4I41A 4YLLA 3WE8A 2VD5A 4WO5A 2G1TA 4A9RA 3JY9A 4IZ5A 3FQEA 3LE6A 3PIYA 4FV7A 2CGXA 4BDCA 4RZVA 4DTKA 2R3GA 3EOCA 4G5PA 4J98A 2WXVA 4FL3A 4EOMA 1DAYA 4WD5A 4BCOA 3I5NA 4P2KA 2YWPA 4L3PA 4UN0C 2VNWA 1WVYA 4FKJA 3PA5A 2Q83A 5HBJA 3R00A 5GJGA 1ZOHA 3RHXA 3W2OA 4CG9A 4MYGA 3OT8A 2VWXA 5AUTA 1PXMA 1JSUA 1PF8A 4IAYA 4PMTA 5HCZA 5M56A 3SXFA 5FP5A 2G2HA 2ZV8A 2JDTA 3F2AA 5EKOA 4CTBA 3CQWA 2HWOA 5L6WL 3RAKA 3DBQA 4BDEA 4I5HA 2HK5A 1LP4A 3ZXTA 2YCRA 2ZDTA 3DFAA 4D0XA 2WMXA 2ACXA 3TN8A 2OXDA 1Q41A 4XV2A 2YDKA 1UKHA 4RBLA 2WMWA 5HG5A 4YPSA 4FBXA 4FMQA 4HJOA 5E8YA 3W8QA 4EH8A 1KUTA 3R63A 3B2WA 5JSMA 4AFJA 4G31A 4Y85A 4EK6A 3TWJA 4H58A 1Q62A 1M14A 4EH5A 4G16A 3JVRA 2OZAB 4QPSA 4OTIA 1VJYA 4XBRA 3FMEA 4BWPA 4FTUA 2IW9A 2OJ9A 3ZONA 3V51A 2A1AB 3IOKA 4YGAA 4W9WA 3FZTA 3DCVA 4KUJA 3MTFA 4DINA 3BGZA 2BZIB 4YC8A 1BMKA 4JXFA 2VGPA 4O0TA 2I6LA 4TYGA 5L2QA 3MIYA 4CXAA 4QPMA 3WF9A 3ZLXA 3OXIA 3OXTA 2PZ5A 3VS2A 4R77A 1KV1A 1DI8A 3EQRA 3O8TA 4A4OA 3Q60A 3HMMA 4ZLOA 4BR3A 3GOPA 4RJ6A 2J9MA 1W84A 3NYOA 2PE2A 4FK3A 5EQPA 3BYVA 4EQUA 4FT5A 3VJNA 3NS9A 4OTHA 4OW8A 1T45A 3AMBA 4FC0A 3R8VA 2P3GX 3BZ3A 4ITHA 2OSCA 3VAPA 4DITA 4BCJA 1X8BA 2IVSA 2PVFA 3MVLA 2C0IA 4EHEA 3LXPA 1FVVA 3CPCA 4LGHA 4ZZNA 4PDOA 5LVMA 3UVRA 4GG7A 5IQEA 5AJQA 3FHIA 5CTPA 4WG5A 3SRVA 3ZUVA 2JITA 5HE3A 3SC1A 4QRCA 4BF2A 4EBWA 3KULA 4EEVA 5HORA 3ORXA 4Z55A 5FUTA 3UE4A 3AC1A 4FT0A 4EOKA 2Y7JA 3EQCA 3GBZA 3HMPA 5DA3A 2YM3A 3JR1A 4QYYA 3CY3A 5H8GA 4CV9A 4FGBA 3UG2A 3VUMA 2J51A 4I0RA 4Z7HA 3PVBA 2XRWA 3NGAA 3O0GA 2VX0A 3UQFA 1QPJA 1JWHA 5E4HA 3Q5IA 4ANLA 2RKUA 1BLXA 3VHEA 3E8DA 5LARA 2ZV2A 5IMEA 3HAVA 4J99A 2WTVA 2X8IA 2GNFA 2ZV7A 3HP5A 5IF1A 4UV0A 3OWKA 4L42A 1G5SA 4RJ7A 5EYKA 3K3JA 3PUPA 4OT5A 5LQFA 3N51A 3FWQA 5HOAA 4NIFA 3KXZA 4DEGA 2VWYA 3PY0A 4FV2A 1CMKE 2Z7LA 4APCA 2YIYA 4QQTA 5ETIA 5KCVA 2RFDA 4BCIA 3HEGA 5BVDA 3A60A 2W1GA 3PWDA 4IW0A 4F7LA 3ATTA 4RA4A 2BZHB 2R3NA 4QMQA 1UA2A 3FYJX 2QO7A 3BV3A 4F64A 5HU3A 1SYKA 3TJCA 3NUUA 5IQGA 4KNBA 5AM6A 5EYDA 4KSPA 5I9UA 3AC8A 4AW0A 3A8XA 3PIZA 2GCDA 4BZNA 4CSVA 5CYIA 2R0IA 3G9NA 3RZBA 3E92A 4M12A 2XK4A 3HA6A 4YLKA 4C4EA 5E8TA 4LMUA 4EJ7A 1I44A 3ALOA 4M0YA 5KO1A 1CKIA 2GHGA 3S95A 3CS9A 4J8NA 3UIBA 4RGJA 4HGSA 2JKMA 2FSMX 2YHVA 3ENHA 3IOPA 1WVXA 2Z7QA 4JDIA 4MKCA 4ZSGA 2BZKB 3Q52A 4GUBA 5HO6A 2X9EA 1YWNA 3AT2A 4YJPA 3W18A 4DGLC 5IH4A 5M51A 2HYYA 2XVDA 4L3JA 3RPSA 4YSJA 5IA2A 5JN2A 3ZHPC 3U6HA 3GQIA 4O83A 3NLBA 2PUIA 2Y9QA 3W32A 4OGRA 4CNHA 1UWJA 2V7AA 3GCSA 2JAMA 3E7OA 4W4VA 1H07A 4TNDA 5AV2A 3RCDA 4QMVA 3RNYA 3ZLYA 5A9UA 5M06A 1OM1A 1PMNA 4R3CA 4RC2A 4DFZE 2G9XA 2XYNA 4CFNA 2FB8A 4OTDA 3RK9A 2WEVA 3MPTA 5A4TA 2QONA 4M15A 4RC4A 4JDKA 1A9UA 4D28A 4UMQA 1WBNA 4FX3A 4GU6A 4HYIA 3EFJA 2PVJA 4A06A 5M09A 2YIQA 4A07A 5EQEA 1MRUA 3KRJA 4MNEA 3UZTA 1WCCA 1G3NA 4I22A 3QRJA 3HDNA 4YHJA 2YISA 5IMXA 2BZJA 4UMTA 4EK5A 3AD5A 3WARA 4RFZA 2UZBA 4EK3A 2X8DA 4WBBB 1KSWA 5CVHA 5EM8A 3ULZA 5CAQA 2C6OA 3KCKA 4GS6A 2OZOA 3ITZA 4GYIA 4RQVA 5C26A 4HVSA 4RT7A 3I5ZA 3UNKA 4O7ZA 3TKHA 2WQMA 3O8UA 4K1BA 1PXLA 4O7VA 3O23A 4WG3A 3FXXA 3OF0A 4YJTA 3RPYA 3UVQA 2A2AA 5HE1A 5AP5A 1RE8A 4FKVA 4W4YA 1PJKA 2DYLA 2J0KA 5CU2A 4AGCA 4M67A 4O2PA 2C3LA 5CAUA 2WFYA 3BQRA 3BHHA 4FZFB 2B0QA 3P0MA 3PPZA 4IFGA 4BB4A 4GFMA 1BL7A 4CMTA 1W0XC 2XIKA 5FG8A 3PPJA 4Q9ZA 4GYGA 1PYEA 5EHLA 3NUPA 3PJ8A 3MIAA 3HRBA 4F0FA 4HCUA 3PPKA 3U51A 2HY0A 2X4FA 1KE6A 4IB3A 2Z7SA 4PDSA 2E9UA 3BEGA 3OCTA 1BL6A 2BDFA 3ZUUA 4M68A 2GQGA 2B1PA 3UIXA 3PRFA 4L7SA 1WBPA 3R04A 4FTLA 4X3FB 1UNHA 1MRVA 4UYNA 1YHVA 4RIWA 3VS3A 3VUIA 2J2IB 5HE2A 1YWRA 4AZFA 4PPCA 5CVGA 3EIDA 3UDBA 4AFEA 4CQEA 5AADA 4JQ8A 4NM3A 4Y72A 3RWPA 1YHWA 5AAEA 2X7FA 3P4KA 4FTCA 2WTWA 3IW8A 5M4UA 3ZLSA 5KBRA 3TKIA 4HW7A 1E1XA 1R39A 3RNIA 4XRLA 4UEUA 1ND4A 3A7GA 5EM5A 3UQGA 4EK4A 5DRDA 3NW7A 4FV8A 4M97A 4U40A 5C8KA 4S30A 4DCAA 4KB8A 4BDFA 1ZYDA 3BYUA 5FM2A 4G3DA 3ZDUA 2JDSA 3NYVA 1FBNA 5GZ9A 2BVAA 3LFEA 4KIKA 3TKUA 5CEPA 5CT0A 3F2NA 3OC1A 2QLQA 1KE9A 3IS5A 2UW5A 3LXLA 3P1AA 3HRFA 3DB8A 4GU9A 4YNEA 5HI2A 5BUEA 4MEDA 4CT2A 4XEYA 5J8IA 2O5KA 3DV3A 4YJVA 3H10A 2H96A 3KCFA 1V0BA 2OH4A 4FT9A 2JKQA 3UOLA 4FNZA 2ZMCA 3EYHA 3R7YA 1U46A 3HUBA 4PL3A 3KRXA 5FP6A 5CF8A 1PMEA 1ZOEA 3ZDIA 1OUKA 4FTOA 4CYJA 3OG7A 4QMUA 4RVLA 4BDHA 3L9NA 1TKIA 2X7GA 4YP8A 2W1HA 3AC2A 1OL6A 4Y83A 5D41A 3GU6A 4C4GA 2CMWA 3F5XA 3L9LA 5CXHA 1W83A 3P78A 2QU6A 2EVAA 4JT3A 3ORKA 4TYHB 2HIWA 3EQBA 3R73A 5EDQA 5JFSA 4ANOA 1OI9A 3TG1A 4I24A 4I5PA 5AM7A 3U54A 1U54B 1V0PA 5B0XA 1ZY5A 4JQEA 4GKIA 4JAJA 4BDBA 4DFLA 2FH9A 3MB6A 4U81A 3M42A 3NEWA 2P4IA 2PVNA 2GHMA 3ACJA 3FMHA 3R30A 3VJOA 2VTSA 4BCQA 4HGEA 2GQSA 3PP1A 1UU9A 3DXNA 2R3OA 3HDMA 4NFNA 5CANA 5KBQA 3PZHA 1H1PA 3AD6A 3FXWA 4K2RA 2YITA 3UG1A 4JI9A 2PL0A 4HGTA 4I6FA 2WMAA 4OTGA 4P90A 4LGGA 2BILB 4EOLA 4TWPA 3S1HA 4U8ZA 3MH0A 3BI6A 4AWIA 4USDA 3SKCA 3E63A 5E8WA 4PDYA 3BYOA 4FV9A 4CFUA 3U87A 2GQRA 5DNRA 1H1SA 3ZCLA 1AQ1A 2VUWA 3C0IA 5DR6A 4DGGA 4G3FA 5E8SA 3B8QA 2GTNA 4BDGA 4M8TA 1J7IA 4BTJA 4C57A 3SVVA 5TF9A 3F6XA 4FSRA 3PDTA 4ANMA 5IUHA 5IISA 5M57A 3CLYA 3QF9A 4XP0A 4CQGA 5CQWA 3EQFA 3IG7A 2ETKA 5HVKA 2R7IA 2ZB0A 3JYAA 2XNEA 3LFFA 1JBPE 1IA8A 4V04A 3MTLA 5HG8A 4NW5A 3FZPA 4BDDA 4R5YA 1S9IA 4RVTA 5TO8A 1Q97A 4FL2A 3ZO2A 5HO8A 5ANEA 3U55A 3FJQE 4IAAA 3V8TA 3TDWA 3H9RA 3AC3A 4JG8A 2C47A 4QMSA 3R8UA 1R1WA 4RVKA 3G51A 3LAUA 4JRVA 1XO2B 3LMIA 4I23A 2GNHA 4CEGA 3KK9A 3ZSGA 5LVLA 2OGVA 2XIYA 3E87A 3B2TA 2X2KA 3DJ5A 3R71A 4J97A 1Z5MA 4O0XA 2XH5A 5F20A 3FC1X 1P2AA 2VTLA 3QKMA 4MWIA 2DUVA 3PWYA 4XV9A 2Y8OA 5KHWA 5HQ0A 3ZEWA 5BVNA 3IDCA 5CENA 4D4VA 3QRIA 3PG3A 3PA3A 1NVRA 3KN5A 5LMKC 1XH9A 1URCA 5KE0A 1LEWA 3HV5A 1Q8YA 4CZTA 2VNYA 3FXZA 3ZM9A 4BKZA 1EH4A 3ORTA 3UOHA 4C62A 4WKQA 3VBWA 4GK3A 4BCNA 4PP9A 1URWA 3QRUA 3LLAA 3KVXA 3ODZX 2X8EA 2IZUA 5JEBA 3SW7A 2V0DA 3K54A 2B55A 2YCFA 3L8SA 3RI1A 4U9AA 2XZSA 4H1JA 5AV4A 3KF7A 4AZEA 4QO9A 5F9EA 3R22A 3D5WA 3UZRA 3N4UA 2OIDA 3REPA 4RG0A 1T46A 2XNGA 3ZRLA 3QCYA 5FXQA 3M11A 3ZXZA 1K2PA 3FL4A 4BRXA 2J5FA 5IA0A 4D5KA 4YU2A 2ETMA 2EXEA 3PRIA 4IVDA 3IO7A 3N4VA 4O0YA 4X7QA 2B53A 3L8PA 3KK8A 4XNEA 2O0UA 3V5TA 4GJ3A 4ORKA 4AW5A 3P9JA 4YPDA 2VO7A 5ANJA 4F08A 3EN9A 2X4ZA 2P55A 3I0OA 4E4NA 3A7HA 1UWHA 2BHEA 3ZRMA 2XIZA 1WBSA 3V6RA 5J9YA 2HXLA 3MB7A 3HMIA 4YZCA 4IWQA 5DT0A 3F9NA 2H6DA 2GNGA 3MPAA 5K5NA 4ZS4A 3NR9A 5H2UA 1J7LA 3DNEA 2VU3A 2RG6A 3OOGA 5GJFA 3ZO3A 3KRLA 2J0JA 1UVRA 3ZFYA 2PYWA 3EQGA 3FLWA 3H3CA 2I0HA 2B9IA 4M3QA 3AD4A 4N6ZA 3O2MA 4J8MA 5EW9A 4FIJA 1OITA 1REKA 1YOLA 3MY0A 3G2FA 4FV6A 3DPKA 4CKJA 1GOLA 4ANQA 3HUCA 4D5HA 2NNWB 1PYXA 4FG9A 4RWJA 2BIKB 4FF8A 4M0ZA 1ZARA 1TQIA 3ANQA 3EFKA 1OIRA 4O1OA 2ITZA 3LJ2A 3ZBFA 3G0EA 3OOMA 2UZVA 4GVAA 3RINA 5KKRC 3G33A 4M69A 5AUVA 3BHYA 5EKNA 2W1ZA 5B2LA 4PQNA 4GKHA 4QMLA 4B0GA 5DWRA 4EZ3A 4AX8A 4FEQA 5A4LA 5E91A 2XKDA 1KE8A 3QA0A 3QQJA 5CU6A 4J96A 5HGIA 5DBXA 3EQHA 3TXOA 5IQAA 4KD1A 2HZIA 4Y46A 4XBUA 1K9AA 3V5JA 4Z16A 5FGKA 2ESMA 2NRUA 5FRIA 3FMMA 5AV1A 3BGQA 4LM5A 3KA0A 4YMJA 5BNJA 3C4XA 3RZFA 3S0OA 5E8UA 5GZ8A 4CZUA 2JEDA 1GIHA 2HELA 2UZTA 2XNPA 3R01A 3R0TA 1Q5KA 2HW6A 2VO3A 4FYOA 4K9YA 4EUTA 3QZFA 3FBVA 3D5XA 4PPBA 4FSTA 4E6QA 4DA5A 1H1QA 4JJRA 4XV1A 2Z02A 2XUUA 4E5AX 2CJMA 2WTIA 1QCFA 2GDOA 1ZOGA 3O96A 4U3YA 5GIOE 3FI3A 1PW2A 2ITPA 3MJ2A 4UXQA 1LUFA 3MWUA 2H8HA 4ZAUA 4BY9E 3SG9A 3DJ7A 3ZH8A 3V5LA 4ZY5A 2WTKC 3R7OA 4FKIA 1QL6A 2H34A 4OUCA 3DJ6A 3E3BX 3KXXA 4JQ7A 2V5QA 3OD6X 3FI8A 3KN6A 4FNYA 2Y4PA 2CHLA 1PKGA 3DB6A 3ZZWA 1QMZA 3DK7A 3F61A 3RPVA 5E1EA 2ZM4A 2BMCA 4R3PA 2PUNA 5IH5A 2OICA 2FSTX 4IWPA 3PJ1A 3PE1A 4H39A 2YLEA 3VUHA 2WMVA 2GFSA 3D94A 1FVTA 2WO6A 2JDOA 4MBJA 4IBMA 3LCDA 1HCLA 4I93A 2C0OA 3GP0A 4DT8A 3VQHA 2BKZA 1ZYCA 4ZJIA 1U5RA 2VWUA 4K8AA 3S2PA 4AN2A 4F1MA 2O65A 1ZZLA 3C4FA 3KY2A 4BVUA 4O7LA 4QMTA 3E93A 1Y91A 3DXQA 2XP2A 5J1VA 5CEOA 2ONLA 2B52A 5AWMA 2WGJA 3BU6A 3R7GA 4RJ4A 4XCUA 4GW8A 2QVSE 2QQ7A 1M2QA 3DDPA 4TWOA 5AUUA 1APME 1AD5A 1GZKA 2QHMA 3LZBA 2EB2A 3I60A 3VS1A 4AP7A 3CGFA 5KMIA 2B4SB 3WE4A 4C33A 3DKFA 2VTPA 4QTEA 5D11A 4RFYA 3U6JA 4QMMA 5DRBA 5EQYA 4F63A 1NT2A 2C5NA 5L2TA 2KULA 5KZ0A 2O64A 3C0HA 5J7HA 2HZ4A 3GCVA 2XKCA 2JLDA 2O8YA 5H8BA 4V0GB 3DBDA 4IB0A 3OS3A 3GENA 4BIEA 1ZAOA 1NVSA 2I1MA 4IVBA 3UBDA 1BI7A 3NW5A 3MFUA 2ITOA 1OBDA 4U7ZA 2PK9A 3GOKA 4NKAA 4II5A 2HW7A 5FXSA 4EL9A 1TVOA 3QTWA 2IO6A 4WT6A 5HE0A 1ZYSA 4FKLA 4NM7A 3UIUA 1WBTA 2UZWE 3IONA 4FUYA 3TV4A 2QG5A 5HD7A 1LEZA 2CKOA 3WZDA 2R3IA 5M08A 2XA4A 4QQCA 3EHAA 4DGNA 5FXRA 4O7SA 1PXIA 5IEYA 5AUWA 5TKDA 1E9HA 3DK3A 4QOXA 4DTBA 4IWDA 4HZRA 3LXKA 2XEZA 3KMMA 4X3FC 3NIZA 4EH4A 4FV0A 4EKKA 5IZFA 4F99A 4X6RA 5L6PA 4AS0A 4B7TA 4OAUC 3R2YA 4TXCA 3UC3A 2NO3A 2W96B 2JKOA 3R8MA 4G3CA 5GNKA 5IQHA 4DG2E 2R9SA 3HYHA 4DH1A 4EH6A 2C5YA 5D1JA 4O22A 4IIRA 3Q3BA 3F88A 5LVOA 2DWBA 2GFCA 5HZNA 4JLCA 3L8VA 4CKRA 4D9UA 4DC2A 4ALVA 3BRBA 1PXOA 5LVNA 3OTVA 1WFCA 2JAVA 2UZUE 1YOMA 2QLUA 2AC3A 3QRKA 4QQJA 3EKNA 4F1TA 5I9ZA 1ZRZA 4IAIA 3SGCA 2QOFA 2OZAA 4FSUA 3PJ3A 4KINA 5EW3A 3UPZA 4AA0A 3MFTA 4JG7A 4DAWA 5CXZA 4X2GA 3AXWA 2W1DA 3GCQA 3UC4A 3QU0A 3QL8A 4KWPA 4IVAA 4KSQA 5K4JA 4BCMA 1ZYLA 1UU7A 3EQIA 2EWAA 3RPRA 3RAWA 3MESA 4GVJA 3U4WA 4CFXA 5CALA 3BE9A 2BIYA 2QURA 3E8CA 3EL7A 5D7AA 5EW8A 3CBLA 3LFSA 3QX2A 3Q9WA 4FKGA 3JXWA 2R3HA 3OEFX 2UW6A 3ZM4A 3BLQA 4YJOA 1TQMA 5CSVA 3V5PA 4D1XA 2UW0A 4XG9A 4BDKA 2FUMA 3C0GA 2Z2WA 3G6GA 2YERA 2CNQA 5ETAA 4DH5A 2R64A 2LAVA 5L6OA 3RAHA 3E8EA 4IM0A 3K2LA 2FYSA 3MA3A 5HCXA 3ZUTA 4FIEA 1CKJA 3UODA 4IX3A 3ZO1A 3JY0A 3DKCA 3UNZA 2QKWB 2QOOA 3Q6WA 2B7AA 2X1NA 4IM2A 3R7VA 2QD9A 3EFWA 4I1ZA 4KBAA 3BE2A 3KXGA 2PVHA 4TKSA 1CTPE 4XHKB 2C6MA 2J0IA 3D0EA 4CT1A 1H8FA 5FEEA 3EWHA 4FICA 2WMSA 3I7BA 3HKOA 4F7SA 4ACCA 3M1SA 4E1ZA 2E2BA 2ITUA 2X2LA 2V55A 3DLSA 3LFQA 4IZYA 4IHPA 5DEYA 2XYUA 5M07A 4EHVA 1F0QA 2GU8A 3BWFA 1FVRA 2IWIA 4FEWA 4OTRA 5CQUA 3KXHA 2YM5A 1SNXA 3PSCA 3QA8A 4OBQA 4KBKA 5CY3A 3WZUA 1FINA 3VULA 3QTZA 2YDJA 5HIDA 3QD2B 2WMTA 2BTRA 3ZLWA 3A7FA 3I7CA 3I79A 4FKPA 5CU3A 5FM3A 3DQXA 3DBCA 3LQ8A 4EK8A 1XH5A 4PUZA 2J90A 4FTMA 3BBWA 2XRUA 3QKLA 3DOGA 3ERKA 4AAAA 1BI8A 1XWSA 4TW9A 3VIDA 4BICA 3QXPA 4TN6A 4GFGA 4O91A 2WNTA 3LQ5A 4K0YA 4WSQA 4WNKA 5DT4A 4C3FA 4D2VA 5CT7A 4X2JA 4JBVA 4F6SA 2I7QA 1FQ1B 4QP2A 4YTHA 5M44A 1Q24A 1YKRA 4F6WA 4I94A 4QMOA 3S00A 3PYYA 1OUYA 2OJIA 3HMNA 2Y0AA 2B9JA 2QR7A 1DS5A 3TACA 5CF4A 2FVDA 5M4IA 4E6AA 3PY1A 4E3CA 1PXKA 2W99B 1CDKA 3H9FA 5EI6A 1FGIA 3QCXA 3NUYA 4FSZA 4C2VA 3GB2A 4RJ5A 1OL7A 3VBXA 4APPA 4B9DA 3ZMMA 4HVGA 4X6QC 4XMOA 5KKRB 1H28A 1CKPA 1E1VA 1P14A 2ERKA 2PVYA 4IJ9A 5F1ZA 4LOQA 3PZEA 3V04A 4AZTA 4BWXA 3D2KA 3FE3A 3SA0A 4AW1A 3LFNA 4OBPA 3FAAA 5ACKA 4WNOA 3VF8A 2ZVAA 2WQOA 4L45A 4BKYA 4FYNA 5G1XA 3GXLA 2IZSA 2J0LA 4RIYB 4WNMA 4M84A 3AT3A 4LL0A 3V3VA 3ALNA 2BTSA 3SHEA 3EN5A 3OUNB 1JKLA 3P7CA 4GH2A 2XB7A 2X6DA 4UMPA 3R6XA 5CI7A 2WU6A 2UZOA 4B4LA 3II5A 5DT3A 2QCSA 3D2IA 3DBFA 4QMYA 4M7IA 3TI1A 3ORPA 3O7LB 5J79A 3GU7A 5ITAA 1YQJA 5EOBA 5C4KA 1Y6BA 5E90A 5JRQA 4M14A 2O63A 3A8WA 2W1CA 5JRSA 1FMKA 2WTKB 4KABA 5IDPA 2BUJA 4FIGA 1Y6AA 3ENMA 3FDNA 4LUDA 4BDJA 3OBJA 4BZOA 5CAPA 1KWPA 5LVPA 1TQPA 4C4FA 4XX9A 3VF9A 3UGCA 4JBPA 1YDRE 2VTTA 3UPXA 4E73A 2UVYA 3KEXA 3DU8A 5I4NA 2BAKA 2IVTA 3AMAA 4RIXB 4ZY6A 3Q2MA 4YTIA 2CGVA 1WMKA 5TR6A 2BRNA 5AV0A 2R3RA 4QYEA 4G34A 4RVMA 3C1XA 2JIIA 4XP2A 3SAYA 4R8QA 2VO0A 5DEWA 4FSYA 4F7NA 3KQ7A 5IQDA 3ZOSA 1IASA 3QTUA 4YBKA 5CF5A 4O27B 3FKLA 4O6EA 4PL4A 5LCKA 4IEBA 4BFMA 4U3ZA 4IAZA 4F65A 1LPUA 4K77A 3ORLA 5CZIA 1PRYA 4BCHA 5JT2A 4QYGA 4RX9A 2FA2A 4X3FA 5KZIA 3SXRA 2F9GA 5CAVA 4CMUA 4ZTMA 1OPLA 4UX9A 5CF6A 2W9ZB 2LGCA 4IJPA 3TIZA 4O7YA 4E93A 3RHKA 3VNTA 5K0KA 1B39A 1J1BA 3QBNA 1F5QA 3QQGA 4FV5A 3P7BA 3T9TA 5I9WA 1M7NA 3AGLA 2HZNA 3IW7A 4W8DA 4DFBA 1YRPA 2EB3A 3FYKX 5EOLA 2A4LA 4WUNA 3TV6A 2PZYA 2BPMA 3NYNA 5DIAA 4ZTNA 3LM0A 3QXOA 2XS0A 2C1AA 1OL5A 2G2IA 2J5EA 3PTGA 3F66A 5GIPE 3T3VA 2PWLA 2XK6A 2QOKA 4J71A 3F69A 2R3KA 5AP3A 3ZTXA 2J7TA 3ZS5A 3DT1A 1OIYA 4PTGA 4N6YA 5DN3A 4DGOA 3ORMA 5GHVA 5JFVA 3DAKA 1O6KA 3RK7A 4JRNA 1GIJA 2O3PA 2RL5A 3JPVA 2CKPA 4ZJVA 4EWQA 4PWNA 1JQHA 3OUKA 4WRSA 3F5UA 4IB5A 3RVGA 2VAGA 3ETAA 4X3JA 5IEVA 2FO0A 2WQNA 4XG6A 3R8LA 2GS6A 4PMPA 4J53A 3I81A 5BVWA 3BEAA 4XYFA 4DFNA 2W5AA 4F0IA 5I9YA 4YBJA 4HYUA 2YN8A 3LCOA 4DTAA 4LFIA 5DI1A 3QTIA 3DGKA 2I0YA 4XG3A 3MYGA 3ZC6A 3OROA 1VYWA 2FGIA 4A9UA 2VWZA 4DHFA 1JVPP 4UMRA 4E8AA 3SW4A 2WEIA 3WYXA 2E9PA 2NP8A 4KRDA 4O6LA 5I5ZA 1UNGA 3Q04A 4U97A 1QPCA 2CCHA 1R3CA 4TYHA 4MBIA 4WUAA 3GU5A 4D2SA 1YI3A 3BLHA 3LCKA 1YW2A 4GSBA 4X2KA 4EJNA 4FZDB 4O7RA 3QTQA 4HYHA 2PUPA 3VBVA 1YDSE 1RJBA 4PNIA 4YJQA 2YM6A 4FVQA 3D9VA 4Z9LA 3WZEA 5LCJA 4MNEB 2WMBA 5FLFA 4CMOA 4XS2A 4EI4A 5K4IA 4G9RA 2WTDA 3NYXA 2H9VA 4NT4A 4KIOA 4OBOA 4UZDA 5DMZA 3ET7A 4P4CA 3WZKA 2I0EA 1YI6A 2OJFE 4PMMA 3TM0A 4GT4A 1RQQA 4QP1A 4QP8A 3BYSA 1SNUA 1H24A 2J6MA 2Z60A 4MD9E 4BYIA 2VX3A 4C4IA 3DBEA 1J91A 4E26A 3GQLA 4HOKA 4MXXA 2CCIA 4ZTRA 4IX4A 3ZBXA 2A27A 3CXWA 4LGDA 3UMXA 1H0WA 5KHXA 4F1OA 2W1IA 4ASDA 3CP9A 3THBA 2F7ZE 3DQWA 4ZTLA 4EYMA 2ITWA 3ZEPA 4BIDA 2ITVA 1YWVA 3ZYAA 2J50A 1OGUA 4A4XA 4AACA 1BUHA 4FI1A 2VTMA 4WG4A 2PMLX 2VN9A 4IC8A 3LKMA 2AC5A 4RQKA 4HZSA 2X2MA 4IMYA 5TT7A 5IU2A 1M7QA 4IFCA 3GFEA 3EJ1A 4C3PA 5E7RA 2XMYA 5HG9A 2WHBA 4FODA 4WNPA 5KMLA 3NSZA 3F7WA 1PMUA 4L44A 5ANOA 4G3GA 4TYIA 5HICA 3C4CA 2YZAA 3AT4A 2ERZE 2IZTA 2ZMDA 5AV3A 1WAKA 3HA8A 3C9WA 2PVMA 1NXKA 4GG5A 2W17A 4I4EA 2F7EE 3RGFA 3UIMA 3VS0A 3NMUF 4H1MA 5A4QA 1M52A 4S2ZA 2WOUA 2UW3A 4R7IA 3WF6A 1WBWA 3G15A 3D5VA 1FMOE 2PMNX 3FMJA 3DK6A 4X2NA 3DS6A 4DE4A 3FMKA 3BV2A 4J1RA 2WAJA 4IQ6A 4LQMA 4RJ8A 4BCKA 2OFVA 5FBNC 1IA9A 4FEUA 2PZIA 5CEQA 2XNBA 2OW3A 4JOAA 5ANGA 4FV1A 2YJRA 4C3RA 4NZWB 3BLRA 2OF4A 3PY3A 2ITYA 1L3RE 4TYEA 4OTPA 4XV3A 1H26A 2PE0A 2XCHA 3QALE 4FNWA 1FOTA 2ETRA 5IUIA 2EUFB 3Q9ZA 4YSMA 2R2PA 4M13A 2VTAA 3QTSA 3IDPA 3RM7A 4D9TA 4D1SA 1Y57A 1ZWSA 3WI6A 2VWBA 5CWZA 4D0WA 3LLTA 2ITXA 3FPMA 4RA5A 5A4EA 1W7HA 3UP2A 4C2WA 1XH8A 2OLCA 2OU7A 4E5WA 2R5TA 1IEPA 3BU3A 3BHVA 2OFUA 2JFMA 1OB3A 2CGWA 2YABA 3Q4UA 3QD0A 4ZOGA 5IQFA 2C68A 4L9IA 3MH2A 4WIHA 3D4QA 5DPVA 5LMAA 1YXVA 4R3RA 3FZOA 3ROYA 4EH7A 5HLWA 2YIWA 2VTQA 1WBOA 1GZOA 5JZNA 2C6EA 3HRCA 4XH6A 3U8WA 2Q0NA 3P86A 4YZMA 5HTBA 5FEDA 5F94A 2Q0BA 3O71A 5K3YA 3Q9YA 3LIJA 5AMNA 1UU3A 2BRHA 3V5QA 3ULIA 4EORA 3OWPA 4Y73A 2HZ0A 4ANNA 4I5MA 3SOCA 1L8TA 3H0YA 3GU4A 4PMSA 3LPBA 3MGYA 3QYZA 5HTCA 2JD5A 3UVPA 3V8SA 1GZ8A 4FOBA 3L1SA 4FTAA 5EG3A 5KUPA 2UZLA 5L8LA 4S31A 4DH3A 4FIHA 3MFRA 4MH7A 4OLIA 2VWVA 5BPYA 4QMZA 4L3LA 1PXNA 2OKRA 4IADA 3IGGA 3LOKA 1JKKA 2AUHA 2CN5A 3HVCA 4C0TA 3DA6A 4IACA 5CSHA 1Q61A 2YM4A 3C13A 4NM5A 4EQCA 5AA9A 3DAEA 4MF0A 4Z3VA 3IW6A 3CPBA 2PZRA 4AN9A 5B2KA 5H9BA 2Z8CA 3KMUA 4C36A 1ZXEA 2PUUA 3R8PA 3IK3A 3P08A 2BROA 3MW1A 5AUYA 2IG7A 2RIOA 2X6EA 4JIAA 1NA7A 5CZHA 2UW8A 5CEKA 4AG8A 4H3PA 4YTFA 3EH9A 5AP4A 4YHTA 3PIXA 4QPAA 3R8ZA 2WMUA 4FGRA 2XF0A 4UWYA 3FKOA 2YLFA 3KXNA 3OTUA 3ZRKA 5I9VA 4BCGA 4O0RA 2PVKA 1ZMVA 3MV5A 4O0UA 4ZEGA 4U79A 1OKZA 5FBOA 1G8SA 3NNWA 5FTQA 3TTIA 1GAGA 3CJFA 5EK7A 2BRBA 1OL2A 5CASA 3GU8A 2UZNA 2B9HA 3GC0A 4HNIA 4V05A 4XJ0A 5AR2A 3VBYA 5FQDC 3F3ZA 4WA9A 5HCYA 3CD3A 2VTOA 3F7ZA 4L8MA 3H4JA 3KGAA 3RWQA 3SV0A 3SG8A 4OTQA 3P79A 5CEMA 3HAMA 4YZBA 4OTWA 4BTMA 4EOJA 1SM2A 2CKEA 4U44A 5BVFA 3BHTA 3BIZA 4FZ7A 4MD7E 1ZMUA 4ITIA 4Z7GA 2JKKA 4RJ3A 2PE1A 1OZ1A 3OT3A 5BMSA 4C4HA 1NVQA 3QUDA 5CSWA 4FEXA 1YDTE 5FEQA 3C50A 1KOBA 3UO4A 2R3LA 4CFFA 2WPAA 3Q2JA 3NIEA 2KTYA 1H01A 2BFYA 5LJJA 3CY2A 4RX8A 3NZ0A 4TZRA 2W5BA 4RWKA 3QGWA 4Y5QA 4B99A 4AT5A 1IG1A 3N9XA 3PG1A 5HIBA 3CGOA 4EOOA 4CVAA 2YA9A 5KNJA 1JSTA 3A62A 3DXPA 4EOPA 3AC4A 2ZYBA 2C6LA 1IR3A 4G6NA 4ZSEA 4MXYA 4EKLA 2QOLA 4PPAA 1PXJA 2UVXA 3OMVA 1PMVA 2WIHA 2UW9A 4LRMA 4GIHA 4NJDA 3TTJA 1VEBA 4ZLZA 5L2IA 4LG4A 4FV4A 4LL5A 5EYMA 4FEVA 1V1KA 3NAXA 3BELA 3KRRA 4XUFA 4GIIA 2VWWA 4KKHA 5C9CA 4BI2A 3PXFA 4G6LA 4J95A 4FK6A 3BYMA 4G5JA 2FSOX 3QFVA 4W9XA 2ZJWA 2C5XA 3JVSA 3TZ9A 3EQDA 3ZU7A 5IEXA 1IAJA 3BCEA 3O17A 4A4LA 4FOCA 3R9NA 4FG8A 4V0GA 5JGAA 4QYFA 4JBQA 4GFOA 1XBAA 4O7WA 3CCNA 5A46A 1VZOA 3A99A 3FLSA 3Q96A 3WF8A 4EH2A 4BCFA 3PLAE 2XK9A 3GUBA 3ZFXA 2SRCA 4NKSA 4EZ5A 3AG9A 1Y8YA 3GC8A 5AP0A 5J7BA 4ALWA 2YIRA 3WOWA 2OK1A 2REIA 4QP4A 3SD0A 4FKQA 3G0FA 4ZSAA 3POZA 1H08A 2GNJA 4JBOA 1LR4A 3D7TB 2PHKA 5HIEA 2B54A 2OJJA 4QMXA 4BC6A 2IJMA 3TNHA 1R0PA 1Q99A 4GMYA 4TYJA 4DN5A 4Q2AA 1XH7A 4ID7A 3S3IA 2ZM1A 2IZRA 2XEYA 3W8LA 4D58A 3HX4A 3MI9A 3QC4A 2OBJA 3RJCA 3W2CA 1DI9A 4DBNA 4DFYA 4MF1A 2C30A 3VUGA 2PMOX 4C02A 2QOCA 4JL9A 3UMWA 4FTTA 3F2RA 1J1CA 1QPDA 3CC6A 2RG5A 5IKWA 4DBXA 1O6YA 1ZMWA 4G6OA 4FTNA 2E9OA 2W1FA 5EI8A 4RZWA 4EC9A 4YO4A 3NUSA 2YM7A 5DYJA 2VO6A 4BHNA 4QMNA 3R9HA 1NY3A 5E8VA 5IUGA 4YTCA 4CCUA 4YJNA 3VC4A 5AX9A 1OIUA 3E64A 4ANBA 3COIA 4S33A 1IRKA 2WU7A 3GVUA 4YC6A 2P33A 4ENXA 3QZIA 4DEDA 4QTBA 5HX8A 3M2WA 3MJ1A 2AYPA 5HNBA 4R78A 1O6LA 3KU2A 3OW3A 5C1QB 1GIIA 4QQ5A 2ITQA 4E4LA 4XOYA 3WYYA 2Y4IB 3FZRA 4LMNA 2XIRA 4C4JA 5JFWA 2BRMA 2RSVA 3DKOA 4DEIA 3CKXA 4FTKA 4FA2A 3TV7A 5FWKK 2RF9A 3BGPA 2UZDA 1K3AA 4AU8A 4L00A 3OW4A 3VO3A 5LOHA 3ODYX 3I4BA 2O2UA 4ZTQA 4I3ZA 3UP7A 4K11A 5GJDA 2ZB1A 5BX0A 3D7ZA 2RFEA 3VBTA 4FNXA 1UNLA 3R28A 2UW4A 5AX3A 2BFXA 3R7EA 4HCTA 3LFCA 4ZTHA 3EFLA 3W55A 5L2WA 1H00A 4L6QA 4H36A 4OR5A 5DFPA 4CKIA 4EOSA 1VR2A 3R02A 5L3AA 3COKA 3R21A 4OT6A 3SDJA 4PRJA 2RFNA 4C58A 3BPRA 4DEEA 2F7XE 2WKMA 4GK4A 4RX5A 5BMMA 1IAHA 3UOKA 2XNOA 3FY0A 4QT1A 3CJGA 4DG3E 3BQCA 3D14A 1OMWA 4ZK5A 4BTKA 4AOTA 4ERKA 5AP1A 5K5XA 5LMKA 4NL0A 1Z9XA 2OH0E 3CEKA 5HHWA 2IW8A 3RP9A 4N57A 3R9RA 3PVGA 4Y5HA 4RWLA 4PTEA 4MXAA 3VUKA 4E4MA 3MFSA 3E8NA 4ZZMA 3F3UA 3NNUA 4FIIA 4TRLA 4FKOA 4C37A 2V62A 4NK9A 3K5UA 3C5IA 4O86A 1XBBA 5EDPA 3EN6A 4G1WA 4ENYA 1MRYA 3C4WA 1Q8ZA 3TZMA 4FSMA 4RFMA 2Y6OA 3FLZA 5GINE 3FKNA 2XK8A 5T68A 4B8MA 5IA4A 4AGDA 1UKIA 3A7JA 5GZAA 3RPOA 4XP3A 2BHHA 4QTCA 2GS7A 1GNGA 3QTXA 3PSBA 4MD8E 2EXMA 4L67A 3FC2A 4Q9SA 4C7TA 4FKSA 3VHKA 4AA4A 3OY3A 3QRTA 5ACBC 4D2WA 3RCJA 4I6HA 4UBAA 5KMNA 2JFLA 4GT3A 4FTQA 4QNYA 3W1FA 3IW4A 4FSQA 5HBHA 4MHAA 5FDXA 4R6VA 4W8EA 2JIVA 2R3QA 1ZZ2A 3QHRA 2ITTA 4NEUA 5DG5A 3DNDA 4DLJA 2R3JA 3QX4A 1FPUA 5DR9A 1OKVA 5AA8A 2YAKA 4XRJA 4IC7A 1KE5A 3E62A 4O82A 2QU5A 3MVJA 3QQUA 3OHTA 4AE6A 4BBMA 3KRWA 5HD4A 1YXTA 1MUOA 3W2QA 4ZLYA 3PXZA 5E92A 3CSVA 3O7LD 4GT5A 4I0TA 4FZAB 3L8XA 4YJUA 5DH3A 3R9OA 4FE2A 4D2RA 4PF4A 3SQQA 4F9WA 1SVEA 2CPKE 5DE2A 1JKTA 1JAMA 2IPXA 3F3VA 4H05A 2ZV9A 4KBCA 3CD8A 3A4PA 4KKGA 2G15A 4AOIA 5EHOA 4MTAA 1Y8GA 3MDYA 4IAFA 2QODA 2WZJA 5JQ8A 2C0TA 2YCQA 3UZPA 5CEIA 1BX6A 2XM8A 3IW5A 4KS8A 4L68A 3SX9A 5LXMA 3TUDA 5A3XA 2YWVA 4I0SA 2QI8A 4YURA 4UZHA 2XJ1A 4BL1A 1Q8WA 3MY5A 1W98A 1ERKA 4MXOA 4QTAA 5ANKA 2R3FA 5E8XA 1S9JA 2DS1A 4RIYA 5BUIA 2EU9A 4PX6A 3WILA 3VUTA 3LMGA 2W9FB 3HV7A 4LYNA 2A19B
chains in the Genus database with same CATH superfamily
2W4JA 5E1SA 3OVVA 4OTFA 4F09A 4DEHA 3PLSA 4QDVA 3QTRA 3FLNC 4UMUA 4NTSA 2OF2A 4O38A 3MY1A 2CGUA 5BYZA 1J3HA 4MNFA 4BI1A 4GEOA 3EL8A 4K33A 4AGWA 3DZOA 2V7OA 2CN8A 3FMLA 2IW6A 2W5HA 3C4EA 3LW0A 1XBCA 3TEIA 3KREA 2WTJA 4IH8A 4I6BA 4GV1A 5HX6A 2BDWA 3MBLA 4HNFA 5FD2A 3R7IA 3O50A 3U4UA 5IA5A 3Q4TA 4KKEA 4YZDA 5JQ5A 3QHWA 2YACA 4RWIA 4F4PA 3KC3A 4DGMA 3OXZA 4XG4A 5AUXA 5HBEA 4FG7A 2F2CB 4HYSA 4G2FA 3NW6A 5H3QA 3RMFA 4CGAA 1XQZA 1SVGA 2C69A 2W1EA 3BX5A 4FTJA 4EC8A 3VRZA 4DEBA 4F9CA 4IVCA 4RIXA 4R7HA 3E3PA 5IH6A 4ERWA 4ASZA 5I9XA 2R3MA 2ZM3A 4HCVA 5ETFA 3QYWA 3I0QA 5HNIX 1ZLTA 3FZ1A 3DZQA 3LQ3A 4ZJJA 3E88A 3MPMA 4RX7A 3FPQA 4BDAA 3NUAA 4BCPA 1P4OA 4I92A 4F70A 2WELA 3HV3A 4O81A 1H25A 4NYEA 4FVPA 4ACGA 3W2RA 4EOQA 3QLFA 2P2HA 2HENA 5DVRA 3KB7A 1F3MC 3VVHA 2RGPA 3FHRA 3WIKA 5AFVA 3C7QA 4YHFA 4IZ7A 3LXNA 4ACMA 1SVHA 4UB7A 4AE9A 2GNIA 4RMZA 1YXUA 1V0OA 3OBGA 5J87A 5EM7A 3S4QA 4C35A 3NPCA 1PXPA 4TPTA 4K6ZA 2JDRA 3C4ZA 3MVHA 4F7JA 1U59A 3ANRA 4QTDA 2OIQA 2UW7A 5HEZA 1KOAA 3P23A 2YDIA 3SRVB 2G2FA 4F0GA 2PSQA 3KULB 2RFSA 4LV5A 4MAOA 3ZO4A 1P5EA 2BAQA 4FSNA 2WTCA 4ACDA 4WRGA 5AP6A 3V8WA 3BKBA 1H4LA 5JGBA 3HLLA 2ITNA 3AGMA 4NM0A 4BGQA 3R1YA 5D9HA 4E6DA 4CG8A 3QCQA 4JAIA 3LVPA 5ANIA 1A48A 5BVOA 2WD1A 4XG7A 4TNBA 3R83A 3WF5A 4EUUA 3QWJA 5HO7A 4NSTA 3TCPA 1BKXA 4J7BA 5HNGA 3CQUA 2C3JA 5A14A 4QP3A 3FY2A 2GS2A 5AR3A 2WMRA 3POOA 5ANDA 4E7WA 5CAOA 3MH1A 4KAOA 2UUEA 2V22A 4KS7A 5LMBA 4JVGA 4NW6A 5HTIA 2VZ6A 4ZSJA 3E7VA 3H9OA 3PXQA 5E8ZA 3OWJA 5EHYA 4A9YA 2BDJA 4WOVA 4BWKA 2WOTA 1REJA 4NIFB 3O8PA 3LHJA 4ASEA 5AR8A 4Y95A 1A06A 1M2RA 4YZ9A 4ZMFA 2W4KA 4AF3A 4C38A 5BV3A 4CFWA 4MVFA 5F4NA 3IQ7A 4RPVA 4X2FA 5FDPA 2PPQA 2I40A 4JIKA 4PL5A 4NUSA 2XK3A 5FTOA 4YC3A 1ZY4A 4AOJA 2PTKA 2HWPA 3W0RA 3UQCA 2BAJA 4EQMA 4G17A 2XKEA 4MX9A 4NCTC 2X81A 5KMMA 4JG6A 5CS6A 1PY5A 2BALA 3K3IA 4QP7A 5T6KA 4FTIA 3RALA 1NW1A 3IPHA 2GNLA 4GL9A 2WQBA 3AOXA 2PVLA 3BHUA 4FR4A 4ALUA 3V5WA 3GC9A 4BBEA 4R5SA 3W0SA 2BKKA 4CCBA 2VX1A 3DAJA 2C6KA 3OCSA 4GRBA 4EWHA 5K9IA 1YXXA 5BVKA 4DT9A 3QUPA 1JKSA 2VV9A 3HGKA 4RSSA 1MQBA 5CSPA 3FQHA 4JS8A 4CD0A 5KX8A 3WIGA 5DR2A 4USEA 4DCEA 5E9EA 2JIUA 3OCGA 4FKTA 4MWHA 3L9PA 4RLLA 2HY81 3PXRA 1WBVA 2P0CA 4IX6A 4AUAA 3QUEA 5C03A 4AN3A 4YR8A 3KL8A 5B2MA 3R2BA 3VS7A 2EXCX 4NWMA 2ZDUA 4ZP5A 3D83A 5AUZA 3U6IA 4O0SA 3QQHA 3PFYA 2VTIA 4DDIA 3P5KA 4TL0A 3QC9A 3WBLA 4FKRA 4FUXA 4CZYB 5FTGA 2JGZA 3KFAA 4NH1A 2GSFA 4U43A 2C1BA 3OEZA 4JR7A 1U54A 5JGDA 2C3IB 4R1VA 2BR1A 4MQ1A 4O2ZA 2QNJA 3FI4A 3GEQA 3TNWA 1YXSA 1I09A 4UXLA 5C8MA 2PU8A 4EH3A 4YUQA 5HU9A 2ZOQA 2JDVA 3ATSA 5TE0A 3Q5ZA 3ZC5A 5C8NA 2UZEA 4Y8DA 4YJSA 1U5QA 3LFAA 4QD6A 4UY9A 5JMSA 4BKJA 3PUFC 1OKWA 3EQPA 4CFVA 4QDEA 4PTCA 4D1ZA 3I6WA 2W0JA 3GGFA 3FZSA 3NNXA 4D2PA 1UU8A 3ZSHA 2J0MB 4EONA 4FZ6A 5M4FA 5IQCA 5A6NA 1FGKA 2QOBA 4AW2A 1M17A 3CR0A 5EH0A 3FQSA 2J4ZA 3JS2A 4ZXTA 5AEPA 3A61A 4PNKA 2X39A 4DFXE 4YNOA 1OKYA 4DF3A 4E5BA 2XM9A 4RRVA 2C3KA 4BYJA 4C59A 3NRMA 3NUNA 4GUEA 4BN1A 1B6CB 3RM6A 4XG2A 3RK5A 2Y4IC 5F95A 3GNIB 2HAKA 4DH8A 1KV2A 3OP5A 4JNWA 2ZFYA 3LMHA 1CM8A 2XJ2A 2XIXA 5G6VA 3BL9A 1DM2A 4NJ3A 3WZJA 4W4XA 4IANA 1VYZA 3LJ1A 4C61A 2IN6A 4USFA 4RIOA 4CV8A 3BWJA 4DH7A 5HVJA 5K0XA 4MK0A 3EMGA 4QYHA 4MQ2A 4ACHA 2UVZA 4HGLA 4RIWB 3TUCA 4CFMA 3ORNA 3PFQA 4TY1A 4CRSA 2C5OA 2OI4X 2E9VA 1STCE 3Q4ZA 2OIBA 3NCZA 3PA4A 5HG7A 3CKWA 3QQLA 2ONLC 3F5GA 3MH3A 5LWNA 3UO5A 1JLUE 4XLIA 2QOQA 2C5VA 3A2CA 2B9FA 1SMHA 2R3PA 3GCPA 2PY3A 3LJ0A 4HPTE 4R1YA 3Q9XA 3HZTA 2AQXA 1YOJA 3GFWA 3QD3A 4HPUE 4P5ZA 5BYYA 4FJVA 2YZLA 5IA3A 2F49A 3G5DA 4O0WA 5L8JA 4JDJA 3VW8A 4MXCA 4EOIA 4JX7A 4QNAA 5L2SA 5J95A 4S32A 2YJSA 3ELJA 4N0SA 5EI2A 4FIFA 4IDTA 4IB1A 5AR4A 4KIKB 5AR7A 3NDMA 3TT0A 5AAGA 5M53A 2CNVA 4UALA 3DFCB 3FLQA 4P5QA 1G8KA 5L4QA 4TWCA 1Q4LA 3SLSA 5TOZA 3R1QA 5HVYA 3D5UA 3VS4A 3TDVA 4IZAA 5IA1A 3PSDA 4AQCA 1OVEA 1U4DA 3HMOA 3T9IA 4HVIA 5A4CA 1WVWA 4DDGA 3PE2A 2QKRA 4LOOA 4JR3A 2HOGA 4KA3A 4GCJA 3Q6UA 3RKBA 3F82A 4IE9A 3VW6A 4BIBA 4O21A 1H0VA 1SZMA 4BDIA 4LRJA 1CSNA 4QMPA 4PY1A 4F9AA 3D15A 3F5PA 3UNJA 4CLIA 3FMDA 5A54A 1J7UA 4M66A 4U5JA 1ATPE 2HCKA 2IF8A 4AXAA 3PP0A 4QP6A 4ZMEA 2OO8X 4MXZA 4S34A 2JBPA 4N4SA 5EYCA 4O4BB 2A0CX 3CTHA 2XAMA 3FL5A 4L01A 3UDZA 1KE7A 2GHLA 4XOZA 3UYTA 5T3QA 3FV8A 3LCTA 1Q3WA 4J52A 5J9LA 4G3EA 5EDRA 4ZS0A 2OWBA 4IDVA 1M2PA 3C5UA 1JSVA 4D4SA 4FSWA 3K5VA 4NTTA 3FLYA 4H3QA 4O1PA 3MSSA 4I21A 4GJ2A 2WMQA 3GT8A 5CI6A 5ICPA 3RAIA 2VTJA 2ZAZA 4FVRA 4YLJA 3VQUA 4E4XA 4ITJA 4YZNA 3B8RA 2PULA 4F6UA 4EZ7A 2I0VA 3NAYA 4XG8A 2OXXA 4BZDA 1BYGA 5H8EA 3IKAA 4O84A 5IQIA 3KKVA 1Q3DA 3G6HA 5KMKA 1YVJA 5AR5A 2P2IA 4X0MA 4FT3A 4I6QA 3DTCA 1OGYA 1Z57A 3CE3A 3EB0A 2R0UA 3LCSA 4FT7A 4CYIA 3Q32A 4IWOA 5ETCA 4C34A 1OPJA 4D2TA 3AMYA 3U9NA 5D12A 4TTHB 5IPJA 1XR1A 2R4BA 3NUXA 4B6LA 3R9DA 2W4OA 4U6RA 5A6OA 5KMOA 3QQKA 2R7BA 4LUEA 1H1RA 1W2FA 3OZ6A 4NCTA 4O96A 3TL8A 3UOJA 3VS5A 2NRYA 2QR8A 4Q5HA 3KF4A 4ZSLA 3TNQB 1B38A 4O0VA 4IAKA 1OPKA 4K18A 2QOHA 4JX3A 4E20A 4GK2A 4IM3A 3UTOA 3NFFB 3DLZA 2VGOA 2C6DA 3OFMA 4BHZA 5CNOA 2CDZA 2W7XA 1OL1A 3VS6A 1PHKA 1QPEA 3QLGA 4PV0A 5BQ0A 1DAWA 1WZYA 3R7UA 3UJGA 3NCGA 3WF7A 3ZSIA 4IXPA 1YI4A 2XBJA 1OECA 3RBWA 1JPAA 3ORIA 5D7VA 3AKKA 2FSLX 4DEAA 2CNUA 4I4FA 3IDBA 4FKUA 2OJGA 2XK7A 4NFMA 4A9TA 2DQ7X 3ZFMA 3PXKA 5EFQA 4WHZA 1HOWA 5DOSA 3DTWA 3HV4A 3H0ZA 3CTQA 2GPHA 4IX5A 4EBVA 2XJ0A 5AP7A 2QC6A 4V01A 4WSYA 3EN7A 4MBLA 3KMWA 5KMJA 3EKKA 4RC3A 5CU4A 4F9YA 5BVEA 2G01A 3HECA 3QCSA 4EHZA 3NX8A 3D7TA 4LRKA 1PKDA 2XNMA 3FSKA 1XJDA 3PJ2A 4B8LA 1H1WA 3QZGA 2X0QA 3ACKA 3LFDA 3Q4CA 4P7EA 4PP7A 1Q8TA 4U0IA 5L8KA 4O7TA 4ARKA 2F4JA 5M55A 1JOWB 1ZYJA 3FUPA 3QD4A 4L43A 2E9NA 3DKGA 4ZZOA 3IGOA 2JBOA 1RW8A 3BU5A 3OCBA 3L9MA 1GJOA 4AT4A 4L53A 2IVVA 5IG1A 5CX9A 3MN3A 3ORZA 3COMA 3QQFA 4HVHA 3GCUA 5HKMA 3T3UA 4FV3A 4N70A 3PJCA 4D55A 3QAME 1XH6A 1OBGA 3QGYA 4G9CA 3A7IA 4ZIMA 3G9LX 3FEGA 3JUHA 2QO9A 1YHSA 4E6CA 2QOIA 2GMXA 3A4OX 4U45A 3TJDA 4A7CA 4KIPA 1JNKA 3TZ7A 5DHJA 2XANA 3ID6C 4AZVA 4AXFA 4UWBA 5CNNA 2WB8A 5EM6A 2YFXA 2YEXA 3COHA 4X21A 2UV2A 4L7FA 4PDPA 3BBTB 3UYSA 3F3TA 3W10A 4AZSA 4I6LA 2QO2A 2C6TA 3PVUA 5I3RA 5DGZA 2VTHA 4ZY4A 3C51A 4NU1A 4M69B 1P4FA 5CSXA 3NNVA 4YO6A 2CSNA 5C4LA 4EYJA 2VTRA 4AZWA 3I6UA 4DYMA 2XCKA 1RDQE 3CQEA 5HESA 2VTNA 3W2PA 2QHNA 4TWNA 4ANSA 3W16A 1ST4A 4LOPA 1UV5A 3DDQA 4BI0A 4AA5A 5AIRA 1G8AA 3GC7A 4BTFA 4ONAA 4QMWA 3TNPC 3CIKA 4JDHA 4TT7A 3VN9A 3R1NA 2YAAA 2C4GA 5C01A 2VRXA 4MCVA 3TNIA 4EH9A 3NVKI 1GZNA 3UO6A 3MS9A 5I3OA 1H27A 5DLSA 5AAFA 5JFXA 3DY7A 3LFBA 4I5CA 4U41A 4YJRA 3KXMA 3VBQA 4CTCA 4UYAA 5I0BA 3MVMA 2BCJA 3E5AA 4L46A 5J5SA 5JK3A 3HL7A 4A9SA 4ASXA 5CLPA 4RLKA 4CLJA 5JH6A 1R0EA 2IVUA 2X0PA 3FI2A 2W06A 3EN4A 3HNGA 4FL1A 4LI5A 3W33A 4BBFA 4BGGA 3HV6A 1O9UA 4H3BA 5AIKA 3TIYA 5HLNA 4AAYA 3EYGA 3PVWA 2CLQA 3Q53A 3QKKA 3CTJA 1AGWA 4AT3A 3N4TA 4XLVA 3O51A 1XHAA 3ZZEA 2PMIA 3P7AA 3OY1A 2PVRA 2OG8A 3QZHA 2C6IA 4I20A 1OIQA 2F2UA 5BYLA 2VWIA 4U42A 3SXSA 3V01A 2BRGA 3VRYA 4DLIA 5J9ZA 4FTRA 3R1SA 4FKWA 3RTPA 4HVDA 2XNNA 5J1WA 4EHGA 1MP8A 3F3WA 1Q8UA 2CLXA 2YIXA 5CVFA 3PXYA 4ZTSA 4U80A 2HXQA 5IDNA 4BGHA 4F9BA 2X9FA 5BUJA 4LV8A 5JZJA 2YCSA 5HLPA 4C8BA 5JKGA 4DFUA 1R78A 4L52A 2JC6A 3V6SA 1W8CA 3NVMB 3W2SA 1ST0A 4KRCA 3KVWA 3OWLA 2WQEA 3EZVA 3VWAA 3NWWA 5CU0A 3TUBA 2YM8A 4DG0E 4W4WA 5M4CA 4Q5EA 4UWCA 3FSFA 3HP2A 4KIQA 3U9CA 2CKQA 1HCKA 4D4YA 2Z7RA 3EZRA 1MQ4A 1W82A 5AP2A 5J5TA 2QG7A 5B7VA 4R7BA 3MA6A 1XH4A 1XKKA 3TZ8A 3FMNA 5IQBA 4OAVB 5C27A 4CRLA 2W05A 4O4DA 3LM5A 4WBOA 3T8OA 2WIPA 3GI3A 3I1AA 3AQVA 2OXYA 3H30A 1GY3A 2Y6MA 2NPQA 2XBAA 3SOAA 2PZPA 3AC5A 3QWKA 3ROCA 5LWMA 4QP9A 2X0GA 5D10A 2XKFA 4D4RA 2GTMA 3P5JC 3VUDA 2X7OA 4O7NA 2F57A 3G90X 4AGUA 3IECA 4I41A 4YLLA 3WE8A 2VD5A 4WO5A 2G1TA 4A9RA 3JY9A 4IZ5A 3FQEA 3LE6A 3PIYA 4FV7A 2CGXA 4BDCA 4RZVA 4DTKA 2R3GA 3EOCA 4G5PA 4J98A 2WXVA 4FL3A 4EOMA 1DAYA 4WD5A 4BCOA 3I5NA 4P2KA 2YWPA 4L3PA 4UN0C 2VNWA 1WVYA 4FKJA 3PA5A 2Q83A 5HBJA 3R00A 5GJGA 1ZOHA 3RHXA 3W2OA 4CG9A 4MYGA 3OT8A 2VWXA 5AUTA 1PXMA 1JSUA 1PF8A 4IAYA 4PMTA 5HCZA 5M56A 3SXFA 5FP5A 2G2HA 2ZV8A 2JDTA 3F2AA 5EKOA 4CTBA 2HWOA 3CQWA 5L6WL 3RAKA 3DBQA 4BDEA 4I5HA 2HK5A 1LP4A 3ZXTA 2YCRA 2ZDTA 3DFAA 4D0XA 2WMXA 2ACXA 3TN8A 2OXDA 1Q41A 4XV2A 2YDKA 1UKHA 4RBLA 2WMWA 5HG5A 4YPSA 4FBXA 4FMQA 4HJOA 5E8YA 3W8QA 4EH8A 1KUTA 3R63A 3B2WA 5JSMA 4AFJA 4G31A 4Y85A 4EK6A 3TWJA 4H58A 1Q62A 1M14A 4EH5A 4G16A 3JVRA 2OZAB 4QPSA 4OTIA 1VJYA 4XBRA 3W0MA 3FMEA 4BWPA 4FTUA 2IW9A 2OJ9A 3ZONA 3V51A 2A1AB 3IOKA 4YGAA 4W9WA 3FZTA 3DCVA 4KUJA 3MTFA 4DINA 3BGZA 2BZIB 4YC8A 1BMKA 4JXFA 2VGPA 4O0TA 2I6LA 4TYGA 5L2QA 3MIYA 4CXAA 4QPMA 3WF9A 3ZLXA 3OXIA 3OXTA 2PZ5A 3VS2A 4R77A 1KV1A 1DI8A 3EQRA 3O8TA 4A4OA 3Q60A 3HMMA 4ZLOA 4BR3A 3GOPA 4RJ6A 2J9MA 1W84A 3NYOA 2PE2A 4FK3A 5EQPA 3BYVA 4EQUA 4FT5A 3VJNA 3NS9A 4OTHA 4OW8A 1T45A 3AMBA 4FC0A 3R8VA 2P3GX 3BZ3A 4ITHA 2OSCA 3VAPA 4DITA 4BCJA 1X8BA 2IVSA 2PVFA 3MVLA 2C0IA 4EHEA 3LXPA 1FVVA 3CPCA 4LGHA 4ZZNA 4PDOA 5LVMA 3UVRA 4GG7A 5IQEA 5AJQA 3FHIA 5CTPA 4WG5A 3SRVA 3ZUVA 2JITA 5HE3A 3SC1A 4QRCA 4BF2A 4EBWA 3KULA 4EEVA 5HORA 3ORXA 4Z55A 5FUTA 3UE4A 3AC1A 4FT0A 4EOKA 2Y7JA 3EQCA 3GBZA 3HMPA 5DA3A 2YM3A 3JR1A 4QYYA 3CY3A 5H8GA 4CV9A 4FGBA 3UG2A 3VUMA 2J51A 4I0RA 4Z7HA 3PVBA 2XRWA 3NGAA 3O0GA 2VX0A 3UQFA 1QPJA 1JWHA 5E4HA 3Q5IA 4ANLA 2RKUA 1BLXA 3VHEA 3E8DA 5LARA 2ZV2A 5IMEA 3HAVA 4J99A 2WTVA 2X8IA 2GNFA 2ZV7A 3HP5A 5IF1A 4UV0A 3OWKA 4L42A 1G5SA 4RJ7A 5EYKA 3K3JA 3PUPA 4OT5A 5LQFA 3N51A 3FWQA 5HOAA 4NIFA 3KXZA 4DEGA 4DHJA 2VWYA 3PY0A 4FV2A 1CMKE 2Z7LA 4APCA 2YIYA 4QQTA 5ETIA 5KCVA 2RFDA 4BCIA 3HEGA 5BVDA 3A60A 2W1GA 3PWDA 4IW0A 4F7LA 3ATTA 4RA4A 2BZHB 2R3NA 4QMQA 1UA2A 3FYJX 2QO7A 3BV3A 4F64A 5HU3A 1SYKA 3TJCA 3NUUA 5IQGA 4KNBA 5AM6A 5EYDA 4KSPA 5I9UA 3AC8A 4AW0A 3A8XA 3PIZA 2GCDA 4BZNA 4CSVA 5CYIA 2R0IA 3G9NA 3RZBA 3E92A 4M12A 2XK4A 3HA6A 4YLKA 4C4EA 1VLRA 5E8TA 4LMUA 4EJ7A 1I44A 3ALOA 4M0YA 5KO1A 1CKIA 2GHGA 3S95A 3CS9A 4J8NA 3UIBA 4RGJA 4HGSA 2JKMA 2FSMX 2YHVA 3ENHA 3IOPA 1WVXA 2Z7QA 4JDIA 4MKCA 4ZSGA 2BZKB 3Q52A 4GUBA 5HO6A 2X9EA 1YWNA 3AT2A 4YJPA 3W18A 4DGLC 5IH4A 5M51A 2HYYA 2XVDA 4L3JA 3RPSA 4YSJA 5IA2A 5JN2A 3ZHPC 3U6HA 3GQIA 4O83A 3NLBA 2PUIA 2Y9QA 3W32A 4OGRA 4CNHA 1UWJA 2V7AA 3GCSA 2JAMA 3E7OA 4W4VA 1H07A 4TNDA 5AV2A 3RCDA 4QMVA 3RNYA 3ZLYA 5A9UA 5M06A 1OM1A 1PMNA 4R3CA 4RC2A 4DFZE 2G9XA 1W2CA 2XYNA 4CFNA 2FB8A 4OTDA 3RK9A 2WEVA 3VONA 3MPTA 5A4TA 2QONA 4M15A 4RC4A 4JDKA 1A9UA 4D28A 4UMQA 1WBNA 4FX3A 4GU6A 4HYIA 3EFJA 2PVJA 4A06A 5M09A 2YIQA 4A07A 5EQEA 1MRUA 3KRJA 4MNEA 3UZTA 1WCCA 1G3NA 4I22A 3QRJA 3HDNA 4YHJA 2YISA 5IMXA 2BZJA 4UMTA 4EK5A 3AD5A 3UIMA 3WARA 4RFZA 2UZBA 4EK3A 2X8DA 4WBBB 1KSWA 5CVHA 5EM8A 3ULZA 5CAQA 2C6OA 3KCKA 4GS6A 2OZOA 3ITZA 4GYIA 4RQVA 5C26A 4HVSA 4RT7A 3I5ZA 3UNKA 4MUQA 3TKHA 4O7ZA 2WQMA 3O8UA 4K1BA 1PXLA 4O7VA 3O23A 4WG3A 3FXXA 3OF0A 4YJTA 3RPYA 3UVQA 2A2AA 5HE1A 5AP5A 1RE8A 4FKVA 4W4YA 1PJKA 2DYLA 2J0KA 5CU2A 4AGCA 4M67A 4O2PA 2C3LA 5CAUA 2WFYA 3BQRA 3BHHA 4FZFB 2B0QA 3P0MA 4DHIB 3PPZA 4IFGA 4BB4A 4GFMA 1BL7A 4CMTA 1W0XC 2XIKA 5FG8A 3PPJA 4Q9ZA 4GYGA 1PYEA 5EHLA 3NUPA 3PJ8A 3MIAA 3HRBA 4F0FA 4HCUA 3PPKA 3U51A 2HY0A 2X4FA 1KE6A 4IB3A 2Z7SA 4PDSA 2E9UA 3BEGA 3OCTA 1BL6A 2BDFA 3ZUUA 4M68A 2GQGA 2B1PA 3UIXA 3PRFA 4L7SA 1WBPA 3R04A 4FTLA 4X3FB 4QEBA 1UNHA 1MRVA 4UYNA 1YHVA 4RIWA 3VS3A 3VUIA 2J2IB 5HE2A 1YWRA 4AZFA 3UDTA 4PPCA 5CVGA 3EIDA 3UDBA 4AFEA 4CQEA 5AADA 4JQ8A 4NM3A 4Y72A 3RWPA 1YHWA 5AAEA 2X7FA 3P4KA 4FTCA 2WTWA 3IW8A 5M4UA 3ZLSA 5KBRA 3TKIA 4HW7A 1E1XA 1R39A 3RNIA 4XRLA 4UEUA 1ND4A 3A7GA 5EM5A 3UQGA 4EK4A 5DRDA 3NW7A 4FV8A 4M97A 4U40A 5C8KA 4S30A 4DCAA 2A98A 4KB8A 4BDFA 1ZYDA 3BYUA 5FM2A 4G3DA 3ZDUA 2JDSA 3NYVA 1FBNA 5GZ9A 2BVAA 3LFEA 4KIKA 3TKUA 5CEPA 5CT0A 3O5AA 3F2NA 3OC1A 2QLQA 1KE9A 3IS5A 2UW5A 3LXLA 3P1AA 3HRFA 3DB8A 4GU9A 4YNEA 5HI2A 5BUEA 4MEDA 4CT2A 4XEYA 5J8IA 2O5KA 4LV7A 3DV3A 4YJVA 3H10A 2H96A 3KCFA 1V0BA 2OH4A 4FT9A 2JKQA 3UOLA 4FNZA 2ZMCA 3EYHA 3R7YA 1U46A 3HUBA 4PL3A 3KRXA 5FP6A 5CF8A 1PMEA 1ZOEA 3ZDIA 1OUKA 4FTOA 4CYJA 3OG7A 4QMUA 4RVLA 4BDHA 3L9NA 1TKIA 2X7GA 4YP8A 2W1HA 3AC2A 1OL6A 4Y83A 5D41A 3GU6A 4C4GA 2CMWA 3F5XA 4O4EA 3L9LA 5CXHA 1W83A 3P78A 2QU6A 2EVAA 4JT3A 3ORKA 4TYHB 2HIWA 3EQBA 3R73A 5EDQA 5JFSA 4ANOA 1OI9A 3TG1A 4I24A 4I5PA 5AM7A 3U54A 1U54B 1V0PA 5B0XA 2IEWA 1ZY5A 4JQEA 4GKIA 4JAJA 4BDBA 4DFLA 2FH9A 3MB6A 4U81A 3M42A 3NEWA 2P4IA 2PVNA 2GHMA 3ACJA 3FMHA 3R30A 3VJOA 2VTSA 4BCQA 4HGEA 2GQSA 3PP1A 1UU9A 3DXNA 2R3OA 3HDMA 4NFNA 5CANA 5KBQA 3PZHA 1H1PA 3AD6A 3FXWA 4K2RA 2YITA 3UG1A 4JI9A 2PL0A 4HGTA 4I6FA 2WMAA 4OTGA 4P90A 4LGGA 2BILB 4EOLA 4TWPA 3S1HA 4U8ZA 3MH0A 3BI6A 4AWIA 4USDA 3SKCA 3E63A 5E8WA 4PDYA 3BYOA 4FV9A 4CFUA 3U87A 2GQRA 5DNRA 1H1SA 3ZCLA 1AQ1A 2VUWA 3C0IA 5DR6A 4DGGA 4G3FA 5E8SA 3B8QA 2GTNA 4BDGA 4M8TA 1J7IA 4BTJA 4C57A 3SVVA 5TF9A 3F6XA 4FSRA 3PDTA 4ANMA 5IUHA 5IISA 5M57A 3CLYA 3QF9A 4XP0A 4CQGA 5CQWA 3EQFA 3IG7A 2ETKA 5HVKA 2R7IA 2ZB0A 3JYAA 2XNEA 3LFFA 1JBPE 1IA8A 4V04A 3MTLA 5HG8A 4NW5A 3FZPA 4BDDA 4R5YA 1S9IA 4RVTA 5TO8A 1Q97A 4FL2A 3ZO2A 5HO8A 5ANEA 3U55A 3FJQE 4IAAA 3V8TA 3TDWA 3H9RA 3AC3A 4JG8A 2C47A 4QMSA 3R8UA 1R1WA 4RVKA 3G51A 3LAUA 4JRVA 1XO2B 3LMIA 4I23A 2GNHA 4CEGA 3KK9A 3ZSGA 5LVLA 2OGVA 2XIYA 3E87A 3B2TA 2X2KA 3DJ5A 3R71A 4J97A 1Z5MA 4O0XA 2XH5A 5F20A 3FC1X 1P2AA 2VTLA 3QKMA 4MWIA 2DUVA 3PWYA 4XV9A 2Y8OA 5KHWA 3AKJA 5HQ0A 3ZEWA 5BVNA 3IDCA 5CENA 4D4VA 3QRIA 3PG3A 3PA3A 1NVRA 3KN5A 5LMKC 1XH9A 1URCA 5KE0A 1LEWA 3HV5A 1Q8YA 4CZTA 2VNYA 3FXZA 3ZM9A 4BKZA 1EH4A 3ORTA 3UOHA 4C62A 4WKQA 3VBWA 4GK3A 4BCNA 4PP9A 1URWA 3QRUA 3LLAA 3KVXA 3ODZX 2X8EA 2IZUA 5JEBA 3SW7A 2V0DA 3K54A 2B55A 2YCFA 3L8SA 3RI1A 4U9AA 2XZSA 4H1JA 5AV4A 3KF7A 4AZEA 4QO9A 5F9EA 3R22A 4O4FA 3D5WA