4JS8A

Crystal structure of ttk kinase domain with an inhibitor: 401348
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
279
structure length
259
Chain Sequence
NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity protein kinase TTK
publication title Crystal structure of TTK kinase domain with an inhibitor: 401348
rcsb
source organism Homo sapiens
total genus 70
structure length 259
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4js8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4js8A01
4WNPA 3R8MA 5E8UA 1WVXA 3R8ZA 4CT1A 5GIOE 4ZTRA 4I5PA 4BL1A 3SA0A 3PIXA 4E4NA 3GEQA 3F2RA 5LARA 1Q97A 4KINA 2ZV8A 2VTJA 4K11A 3CBLA 4V04A 4PNIA 4M66A 3C0GA 3PFQA 5HE1A 3QKMA 2B52A 2FO0A 3UZTA 3TNWA 4EJNA 3UE4A 1NVSA 3W55A 2C0IA 2UVZA 4M14A 3F69A 4JRVA 4N6YA 4G9CA 3N4VA 3H9FA 3R22A 4F6SA 4BCJA 2JBOA 3HMOA 4J8MA 1AQ1A 1VR2A 2H9VA 5EM8A 4FTUA 3WBLA 3C4CA 5IUGA 3LXNA 1QCFA 4JG8A 3W2QA 1PXJA 4EZ3A 4NKSA 3TNPC 4PTEA 4ZSGA 5ETIA 4E6QA 5D12A 4BGGA 3RVGA 4O2PA 3LZBA 3PXYA 4RFZA 3QD4A 3Q9ZA 4HNFA 2W9ZB 2YITA 2HWPA 2XM9A 5FDPA 2SRCA 3OUKA 2HZ0A 4O0WA 5AP2A 3VUDA 5AUTA 3UVQA 2OW3A 4JT3A 4QMQA 1OM1A 4HCVA 3NNVA 4IZ7A 4ZTLA 4YGAA 5DR6A 3E92A 3ZLXA 2C6LA 2UW0A 3QRJA 1OECA 1MRUA 1YI4A 2QOFA 3JXWA 3QA0A 4LOOA 5E8SA 2CKOA 4F64A 3JUHA 2I0VA 2J50A 3GUBA 1ZOEA 4AU8A 2RG6A 3KXXA 4F1OA 3QAME 2A19B 4Q9SA 3ZO2A 4B7TA 5CF8A 3TKUA 4O27B 1JKLA 1U46A 2XB7A 4CKJA 2E2BA 1M7QA 4FSWA 2R3MA 4HNIA 3THBA 5BUJA 4D0XA 5H8GA 1PXLA 3EKNA 2UVXA 5DI1A 3MVHA 3SXFA 3R7EA 3MVLA 3FZTA 3P7BA 4L00A 5GHVA 2OIBA 1GZKA 4IADA 5C8KA 3WARA 3NR9A 4CT2A 4FNZA 3LFBA 4YJUA 4IFCA 4EZ5A 5M06A 3R00A 1REKA 5L2TA 5L8KA 4PRJA 3GI3A 4I92A 2OLCA 3LMHA 4QOXA 1M7NA 4YTHA 5CEQA 3T3UA 2XCHA 3H0YA 4GT3A 3R71A 4TYIA 4YJPA 4IAAA 5I0BA 1YHVA 4O0UA 4U3YA 4QMOA 2XNEA 4QYGA 3C0HA 5JFWA 3HV5A 5AMNA 3HYHA 5AV2A 5HHWA 4RX5A 3A62A 3CJGA 3OHTA 5CAOA 4DEEA 4AF3A 3DKOA 3GCSA 3ACJA 1Q8WA 3WIKA 3WYYA 1JAMA 2HYYA 1U5QA 3IW8A 3PP1A 4A7CA 3V5WA 5IZFA 4K8AA 2BKKA 1URCA 2OH4A 3A8XA 2QKWB 4A9UA 2C47A 3SGCA 4CFUA 2R3PA 3GNIB 4JDIA 1M17A 1K3AA 5C03A 3LE6A 4I0RA 4ACCA 4H3QA 4R5YA 5DVRA 4RJ7A 4EOSA 4DT8A 4DBXA 3Q60A 5D7VA 5HI2A 4AG8A 4PL3A 1IR3A 5H3QA 2QG5A 4PV0A 4QMYA 4GG7A 4M3QA 3VUMA 2PVYA 3H3CA 5EDRA 3GC9A 2VTLA 4QMLA 2C6DA 3DA6A 4UALA 2V22A 2JD5A 3CTQA 4BB4A 4FZ6A 4GK3A 3G0FA 4AGDA 3S0OA 5DRDA 5B7VA 3LLTA 4I5HA 4ZTNA 4F08A 4FKJA 1YXXA 2VO0A 1BL6A 2CDZA 2X1NA 3IECA 2XEZA 2VTRA 1OKZA 3DB6A 3RKBA 1BI8A 4IAIA 2BRMA 1Q99A 4RSSA 3JS2A 1VYWA 3IW7A 4NK9A 2C6TA 4YPSA 1K2PA 3QD0A 2QO7A 5ANJA 3REPA 2CHLA 2UW7A 3HV7A 4EBVA 5J1WA 4UYNA 3ZTXA 4RJ5A 3SQQA 5A4TA 3TM0A 2A4LA 5IA2A 4PTCA 3U6HA 5ANEA 3KRXA 4HYHA 4ZTMA 4DT9A 4F7NA 4QTCA 5BUIA 3FY2A 4CYIA 4F7JA 1KE6A 4GG5A 4IZ5A 4QMVA 3TUDA 1Q8TA 3PIZA 4FTOA 3GOKA 2CLXA 2JIVA 5AR5A 3V5JA 4O6LA 3WI6A 4B0GA 3BYOA 2ZAZA 4EH6A 4EK5A 5A6OA 3QRIA 4G31A 2W4KA 2WQEA 3AT4A 4WNKA 3UOKA 4O96A 4WNMA 1PMNA 4HZRA 1OPJA 1M52A 4ZIMA 4F9BA 4IX5A 3FMKA 4J8NA 4XP2A 3RBWA 2BZIB 3M42A 2E9NA 3OY1A 3FPMA 2FA2A 4X2KA 2PU8A 4EORA 4Y73A 3VS4A 2GS7A 5M53A 3VIDA 4XMOA 4FT5A 5KHXA 1IASA 3TDVA 2W1EA 3K3IA 3NDMA 2PYWA 5CALA 2YLEA 2Y7JA 3BE9A 2ITVA 3JVSA 3KB7A 2F2CB 4FKQA 1YXSA 5AJQA 3A60A 4JBOA 3KA0A 4XG6A 3Q53A 3RJCA 1SNUA 4K6ZA 2OBJA 4R3PA 3WE8A 4D1XA 4Y46A 4MWHA 3I1AA 3RALA 3EMGA 3WZEA 4ASDA 3BYVA 3BYSA 1PXIA 2F2UA 3NSZA 2ITOA 4KAOA 4E93A 4EWHA 1REJA 3SV0A 3DY7A 3RK5A 3FI3A 2X7GA 2VWXA 3MPMA 1Q8YA 4X2JA 4YJOA 5EQPA 2HW7A 2QO9A 1JPAA 4JQ8A 4Y5HA 2XM8A 4TY1A 2ZDTA 4CCUA 3SG8A 2O65A 5F95A 3NNWA 2HIWA 2XNOA 1FOTA 1XHAA 4FKWA 5AP4A 4MNEA 3LFSA 4GT5A 2BCJA 3R9HA 3ZSHA 5KMNA 3FZSA 3UVRA 2WMVA 4FL3A 3N4TA 4BY9E 3KGAA 4DLJA 3OXTA 4K18A 4NWMA 4RPVA 4XH6A 4OTGA 3QRTA 3C1XA 4MD9E 3EZRA 4BYJA 3BI6A 3AOXA 2XVDA 4MF0A 3C50A 2NO3A 3QTZA 4AA5A 4EI4A 5J9LA 4P5QA 3CY2A 4NKAA 2WTIA 4QD6A 5AP0A 2WIHA 1GIHA 4C8BA 1ZRZA 3DKFA 5FEEA 3RPYA 4UMPA 3WYXA 3ZO4A 2VX0A 3EH9A 5IQHA 1KE9A 4ACMA 2Y4IB 4FT7A 5E8XA 3BV3A 3UQCA 4HVSA 4O91A 3A7FA 4FZFB 5CQWA 5FBNC 2X6EA 4C35A 3R83A 1G8SA 2UUEA 3VS5A 3PSDA 4QYHA 1H24A 3Q9YA 1RW8A 2YCRA 5AUYA 1OIRA 4V0GB 4GH2A 5EOBA 5CS6A 3L8XA 3ODYX 3RHKA 4CZYB 3ULZA 3KRRA 3VAPA 1XH5A 4Y72A 3Q4ZA 3NW7A 3MY0A 4NH1A 3UMWA 2IPXA 3TJDA 2R7IA 5KE0A 3NNXA 4FUYA 5HICA 4CYJA 4GUEA 3P0MA 1W83A 3I4BA 3P23A 4HGTA 3FHRA 5EM6A 5KZ0A 4BBMA 5A4LA 3UGCA 4M0ZA 5F9EA 3F5PA 2W1ZA 5BQ0A 4CG9A 4QT1A 1UV5A 4ALVA 2VV9A 1M2RA 3MH2A 3D7TA 2VWUA 4FV3A 4LV8A 3U55A 1WBVA 5HIEA 4IX3A 5IISA 3PVBA 3E7OA 4U8ZA 5CZHA 3VN9A 3NUAA 1FGKA 1TQMA 3HDMA 1XO2B 1YDRE 4DAWA 3D5UA 1UWJA 4EH9A 5HORA 4X3FC 2XJ2A 5D7AA 5HOAA 3ZSIA 1CM8A 3P5KA 1GZNA 4ANLA 4C3PA 1XKKA 4DA5A 4HW7A 4KIPA 3FXZA 4BTMA 3TNIA 5JGBA 5LVOA 3QQHA 4X2GA 1ZOHA 3VBQA 2XNMA 4OTRA 2WU6A 4OAVB 1PMEA 2WD1A 1ZLTA 3OCSA 3EFJA 4PPBA 5IA0A 2OIQA 2PSQA 2VU3A 2WTVA 3FMJA 3SRVB 3F88A 4FTRA 3B8RA 4TXCA 2VTHA 4G6OA 3QQFA 3ZBFA 4E20A 4DITA 2QOHA 5FTGA 4DC2A 4I93A 1P5EA 2UV2A 3OY3A 3QWKA 4RA4A 3UDBA 3LM5A 4JIAA 3SOAA 5CQUA 4QMNA 4FMQA 3NIEA 3ZRKA 2YCSA 4FYOA 4FNXA 2PTKA 3R7VA 4BWXA 4M0YA 4W8DA 3MS9A 3PE2A 5CEOA 2VTQA 5FG8A 4O7WA 4IAFA 3FKNA 4QP3A 4F6WA 1TVOA 3CP9A 2QI8A 5B0XA 2OJ9A 3GENA 4FGRA 3O51A 4L8MA 4L68A 3QTSA 4R3CA 4EOMA 2RSVA 4C02A 5IH5A 3I81A 1TQIA 4YZ9A 4KNBA 3DAJA 1J1BA 4YSMA 2ONLC 5ICPA 4L44A 2R3HA 3W16A 2QD9A 2VTSA 4UBAA 4LL5A 5CAQA 1YDTE 1QPEA 3R8VA 3UMXA 3BKBA 4YZBA 5J8IA 4J96A 2PHKA 4F1TA 2B9IA 3SKCA 2YDIA 4RIWB 4F7LA 4O86A 2YAAA 1A48A 4KWPA 5JRSA 3OCBA 2WMXA 4MVFA 3O50A 2HWOA 5LMBA 2Y6MA 4FOCA 1ZMWA 1E1XA 3KULA 4HGSA 4O0SA 3V5TA 1H0WA 4CEGA 3R63A 1PKGA 1H28A 2RKUA 4BDHA 4BDIA 3LXLA 5DOSA 2JDSA 4FTCA 2QO2A 4S31A 4X6QC 1TKIA 3L1SA 1Y6BA 4FGBA 3O7LD 4IH8A 4AACA 2PUPA 1H1WA 1LP4A 2W1GA 2XCKA 1OIUA 3E8DA 3A7GA 4MD8E 4IMYA 4E4LA 4EBWA 1Z9XA 4IZYA 5EKNA 3F9NA 5BX0A 2PMLX 3U54A 1NVQA 4LV5A 3NYNA 2YIWA 3MH0A 5BUEA 5KCVA 3VHKA 4WG5A 3EWHA 2C6IA 4OR5A 4RVKA 3MB7A 4JJRA 2IW9A 3KC3A 3LW0A 1H4LA 5D1JA 3UYSA 4MAOA 2P3GX 4O82A 2V0DA 3BLHA 1G8AA 5FXSA 3NS9A 3M1SA 1XH6A 2JIUA 4RQKA 4BBFA 4FIJA 3DGKA 4WOVA 5HQ0A 4JG7A 3EKKA 3IKAA 3LAUA 5JEBA 2F7EE 3G5DA 2C6EA 2ITTA 2IZRA 4L52A 2WMUA 3MN3A 3UBDA 2BDJA 4AA0A 3OUNB 4NM5A 2GHMA 1IRKA 1DM2A 1RQQA 3AGLA 2QKRA 3ANQA 3CJFA 3U8WA 3VQUA 2C3KA 3QHRA 2VN9A 3D14A 3R9RA 3OROA 4D9UA 1JQHA 4CCBA 3FWQA 4FSMA 3OG7A 2GDOA 2V7AA 2AC5A 3OEZA 4GVAA 5C01A 4BKZA 2G9XA 3LM0A 3QUEA 5L2QA 1J3HA 3CD8A 3GBZA 4TWNA 2VTAA 3HMIA 5FP6A 5L4QA 4QYYA 5F4NA 4D2TA 5CT0A 3DQWA 3KY2A 4K1BA 4G17A 5JZNA 4A4OA 3NUXA 3OFMA 4BDFA 4DEIA 4DH3A 5CANA 5J9YA 2EB2A 4XV9A 2CLQA 3BGPA 3P79A 5LXMA 1CDKA 3QA8A 4ZSLA 2P4IA 4QQJA 2ZV2A 4DEDA 2O3PA 4RIOA 3QGYA 3FHIA 4J99A 4H05A 3O71A 4ANBA 1FMOE 3HEGA 2J0IA 2PVHA 2Q0NA 3PWDA 4IBMA 4JQ7A 1YI3A 3R2YA 2UW6A 4U0IA 4UYAA 3VUKA 1OL7A 4IVAA 4MXXA 4ENXA 4KSQA 3I7BA 4ZSJA 3RMFA 4DG2E 3FEGA 2OZOA 4D2VA 2C3LA 1ZMUA 4U79A 4QMZA 2CKQA 2R3GA 4NIFB 3HGKA 4AFJA 2G01A 2VO7A 3V8WA 2CGUA 4ACGA 3PRFA 3Q6UA 5K0XA 3P7AA 2E9UA 3ZFXA 3QCSA 2X8EA 3QRUA 4HVIA 4BWPA 3ZMMA 3BLQA 5HTBA 2H34A 3D15A 3PA4A 2JAVA 4PPCA 4C62A 4FEXA 3P86A 4AA4A 2B4SB 3PA5A 5K4IA 3PZEA 3ZLYA 4IACA 3W2RA 2C68A 4YLKA 1Q3DA 1QPCA 3DBCA 4NUSA 1OKWA 4AN9A 2XKFA 4FZ7A 3C4ZA 4AZSA 3F66A 3FKLA 3QXPA 3PY1A 2Y4IC 4M67A 3JY9A 4C37A 4TNBA 1H01A 4JX7A 4FKUA 4AGUA 3F61A 3EFLA 5JQ8A 2GFCA 5KMLA 2CNQA 5AR7A 3R9OA 3HV6A 3I0QA 3QQUA 4CTBA 2BIKB 3OS3A 4AFEA 1GOLA 3N9XA 4EHGA 3UP2A 2YM3A 2B9JA 3RI1A 3VUTA 4FC0A 3ORNA 3PDTA 4HVHA 4FV5A 3TNHA 3EIDA 4KKGA 4QPSA 3S2PA 4FZDB 3W32A 4AX8A 3PZHA 4S32A 3KMWA 4QMTA 4FV7A 4GJ2A 4GCJA 3LFEA 2UZOA 4LOPA 2IZUA 4ACHA 3C4EA 5L6OA 2YIQA 4AOIA 4F0FA 4DFXE 3EJ1A 4BGQA 4EYMA 3VW6A 2VWVA 2V62A 2X7OA 3OWPA 5HO6A 5CASA 5IU2A 1J7LA 5I9YA 3VS2A 1NVRA 3ZUVA 4MBLA 2DQ7X 3C9WA 2VNYA 1GNGA 2B9HA 4BIDA 1EH4A 3COHA 3DZQA 4YJTA 2CGXA 1F5QA 2EWAA 1WVYA 4OTIA 4BRXA 3QTWA 3ZH8A 3MESA 4LM5A 3DFAA 5EDPA 3FI2A 4C4EA 2RGPA 3H10A 3SW7A 4DH8A 5DFPA 3AG9A 3F3VA 2PZ5A 2Y8OA 4FUXA 3R7UA 4IJPA 5M09A 2YABA 1YXTA 3MVJA 4OLIA 4GU6A 2A27A 4GK2A 1P4OA 3U4WA 4P5ZA 2Z7QA 3FLSA 3ERKA 4DINA 2BRGA 4AT4A 2ITQA 3NUYA 3DLSA 3CQEA 4L3JA 3M11A 2X2MA 3DAEA 2ITUA 1GZ8A 5JMSA 4DFBA 2W4JA 4CMOA 3KCFA 2W0JA 1YKRA 1Y8YA 2CCIA 2YM7A 3A61A 3GCPA 4L46A 3RINA 1CKPA 3N51A 4TTHB 4AP7A 3ZYAA 4KD1A 3S3IA 4F0IA 3UP7A 4N0SA 3AC3A 4U7ZA 3UOJA 2W7XA 5DPVA 5I9ZA 4FTNA 4U44A 5FTQA 2OJFE 4QP4A 4G6NA 4ORKA 4WIHA 1YDSE 3TZ8A 3UQFA 4D5KA 3V51A 3PP0A 2IJMA 4AZFA 5B2LA 5E1SA 5CVFA 1FINA 2C1BA 3QALE 2WMTA 4QNYA 4N57A 2VTNA 4FV1A 4TWCA 4RVMA 4PDPA 4FV4A 4MEDA 2JKQA 3FYJX 4PUZA 2BRHA 2R3KA 2ACXA 4PF4A 4YC6A 4NYEA 2E9PA 1OGUA 3P4KA 4J97A 2BDFA 3MW1A 4RIYA 4F63A 5AR2A 3QQKA 5E8VA 1PXKA 4LOQA 3V8SA 5I9WA 5E9EA 5DN3A 3TV6A 4FTQA 3UO6A 1UNGA 4RJ3A 2OGVA 3L8SA 3NW6A 5DT4A 3RAHA 5JT2A 2CPKE 3NPCA 3Q4CA 4GYIA 2GU8A 3FL4A 5M07A 3LFFA 3COKA 4YTIA 2VO3A 5ANDA 3TCPA 4EK6A 4EJ7A 3ORIA 4HPUE 5ANKA 2CNVA 1YOMA 2YISA 3QKKA 3OD6X 2JKOA 5EH0A 5A46A 1FVTA 2VWBA 3QZGA 1SMHA 4WG3A 1J7UA 3KEXA 4KBCA 3RCJA 3Q52A 4O7RA 3BQRA 2RIOA 3PXQA 3UPZA 1CSNA 3TTIA 3KXGA 4FV8A 4FOBA 5IA5A 5FM2A 3LQ5A 4RC3A 3ZHPC 2W05A 2ITNA 4ZZOA 3RAWA 4UXQA 2A1AB 3IW6A 2IO6A 5HNIX 1T45A 3LIJA 4RJ8A 3FXXA 3LJ1A 3PY3A 4QMXA 4XS2A 5EHLA 2OXYA 4E7WA 1IA9A 4WBOA 5L2WA 3EL8A 3CGFA 4U5JA 2F4JA 2OZAA 3MBLA 3BHUA 3UPXA 1I44A 2OF4A 5M4IA 4BTKA 3ZRMA 2R4BA 3HUBA 5AUVA 3G33A 4OTQA 3MIAA 4FBXA 2QNJA 4L42A 2WFYA 4XOZA 2QVSE 2IZTA 4FKVA 5E90A 5T6KA 3WOWA 2W4OA 2I7QA 4L01A 3BHHA 3MI9A 5K5XA 1YOJA 5JGAA 2QOOA 4HYSA 3JPVA 4M15A 2YM6A 3MB6A 4FR4A 1SZMA 3A7IA 3EQBA 3D4QA 1DAWA 5DG5A 5M4FA 3FLZA 2VGOA 5HG9A 4L45A 2XBAA 4BDKA 4ERWA 2YM4A 5DHJA 4BI2A 1SVHA 5HG8A 3T9IA 4JL9A 3TIZA 2RF9A 3Q4UA 5AV1A 4QTEA 4FG8A 2BILB 3MPTA 2KULA 2CKEA 2XZSA 1UKHA 2PMOX 2C69A 4X3FB 3UIUA 5C26A 4CZTA 3KMMA 3PJ2A 4CMTA 1NT2A 2XIXA 3PE1A 2X9EA 1B6CB 3BBWA 3RAKA 3KK8A 1YVJA 5AP7A 2C1AA 5EW9A 4EEVA 3OT3A 1U54A 3FMMA 2WMQA 2YIYA 4RX8A 4CRSA 4JR3A 4PDOA 4EK8A 4BIEA 5CF4A 3DFCB 4PDSA 5DWRA 3HUCA 1OB3A 3I5ZA 3OOGA 2J6MA 3ETAA 4IB1A 5HBHA 4BCFA 5I9UA 4BDAA 4ACDA 4YR8A 4NTSA 3D5XA 3DPKA 3Q3BA 3TDWA 3RWPA 2BAQA 2VWWA 4O1PA 4XV1A 1KV1A 2WU7A 3NVMB 3BU3A 3BRBA 2OG8A 2GFSA 3KXNA 2W1FA 4KS7A 4QMPA 4YHTA 3PLAE 3UVPA 2WMWA 3T3VA 4JR7A 2R3FA 4C4GA 4I4EA 4KKHA 4ZZNA 4USEA 2HY0A 3D2KA 1WBPA 3R21A 2XKDA 2IW6A 2YM5A 3EN6A 4JBPA 3UG2A 5KKRC 1Y57A 4EH5A 4BCGA 4LGHA 4XCUA 4G3CA 4OTFA 4Y85A 3FZOA 1MP8A 1PYEA 5IEYA 5BVWA 3AXWA 3D83A 4EH8A 1F3MC 2CN8A 2JEDA 3OEFX 4EYJA 5FRIA 2J51A 5CNNA 4CQGA 4C4IA 3EL7A 2PZPA 3EQIA 3QTIA 4ZS0A 4UMQA 5C9CA 3ZXTA 2JKMA 3OWJA 1IEPA 4E5BA 2WQNA 3EB0A 4I23A 3HAVA 3E3PA 5HE3A 3ZZEA 4EKKA 4MCVA 3OWKA 3IDPA 2Z7SA 2WTKB 4A9SA 4E6CA 4DHFA 3OZ6A 3C5UA 4E8AA 3WZUA 1IAJA 5C4KA 2YZLA 4YBJA 5I4NA 4R5SA 3EQDA 4HJOA 4APPA 3L8PA 5LOHA 5IQDA 3ZUTA 4IWDA 1P14A 4QMSA 2GNHA 3R28A 5CU6A 5J87A 4F1MA 3TXOA 4A9RA 2H6DA 1R0PA 1R1WA 1YW2A 2R5TA 2W99B 2XS0A 4GKIA 5C8MA 4QQ5A 2YCQA 4CV8A 3SHEA 1OVEA 2BVAA 3DKCA 4EQMA 5FLFA 1Q4LA 4NSTA 4RX9A 4HCTA 1JOWB 3PJCA 4PL4A 3V01A 4M69B 4YTCA 3BYMA 4E4XA 5EDQA 3DZOA 3FLYA 3GU6A 3R0TA 5CEMA 4BDCA 4RZWA 4WNOA 2IN6A 4XBUA 3F3WA 1LPUA 2P0CA 4CLJA 4F99A 1UU8A 2EB3A 4IIRA 3DXNA 1CKJA 3HDNA 4BDGA 4Q5EA 4I6HA 4YURA 4AS0A 4Q9ZA 3O2MA 2RFNA 3DB8A 4GJ3A 3ZLWA 3QBNA 4WT6A 2XNBA 3MGYA 4GIHA 5LVNA 3MSSA 5IEVA 4CFMA 2CKPA 4QYEA 5AIRA 2QODA 4WSYA 3ZFYA 3OBJA 3QC9A 4LMUA 2PULA 5BVDA 5K9IA 2C0OA 2OO8X 3UQGA 2EXCX 4X6RA 4YHJA 4E1ZA 4F65A 4D1ZA 2YDKA 2C5YA 1CMKE 4WD5A 3S1HA 4IX4A 1U5RA 4HYIA 4WHZA 3I6WA 4XP3A 3TACA 3OW4A 4N6ZA 5A4EA 5DYJA 1H25A 4TYEA 4XBRA 4S2ZA 3BGZA 3F82A 3TZ9A 4IC7A 4BHNA 3FMLA 2BFXA 3E5AA 4B8MA 3HL7A 4XG3A 4E5AX 3WF5A 3ZDIA 3TIYA 4G3FA 2WMSA 1FMKA 3R02A 2XK7A 3AC4A 3EHAA 3E8CA 2YWVA 4DN5A 4I4FA 4L67A 4HPTE 2BDWA 3LCKA 1O6YA 2AC3A 5CYIA 1YWVA 4C4FA 5J7HA 4HYUA 5CEPA 4R77A 3ZM9A 3EQCA 4AW2A 4O7LA 4LRMA 1JSUA 4QP8A 3Q4TA 4QP6A 1FQ1B 2XIKA 2GMXA 4G1WA 2QC6A 4DTKA 4A4XA 2G1TA 3FJQE 1UU9A 4JBQA 4MHAA 3U51A 4I21A 5AR4A 2B53A 3P08A 4ZMFA 1G5SA 4C3FA 5ETAA 3PG1A 4IHPA 4ITHA 4TNDA 5CY3A 3AT3A 1BLXA 3GU7A 4BDJA 3VBTA 3FMHA 4ALUA 5A3XA 3E8EA 1AGWA 4LGDA 2WNTA 4FSZA 2YLFA 3KF4A 3MFSA 1V0PA 3PXZA 3QCQA 4FIIA 4FV0A 4X2NA 1GY3A 4YNOA 5LCKA 3WF6A 2VGPA 3NVKI 1M2PA 4J7BA 2KTYA 3LXKA 4U43A 1KSWA 5DR9A 5TT7A 5AFVA 4IFGA 4C58A 2FH9A 3CIKA 4R78A 3RAIA 4FG7A 5AV4A 2OKRA 1MRYA 2YERA 2C6MA 4YZCA 4HCUA 3ROCA 4EOPA 3EOCA 4R7IA 2XKCA 4C3RA 4DFUA 3MH1A 2REIA 4ZMEA 5T3QA 4RIXA 2UZUE 3HP5A 4EZ7A 4I6FA 4RA5A 4ZSEA 1J1CA 1H27A 2DUVA 3W18A 5EQYA 3FDNA 3UYTA 3UG1A 2QLUA 4CG8A 3PXRA 2ERZE 3ULIA 4WKQA 2JDTA 1PXNA 4Z16A 2W96B 2WTDA 3UIMA 5K5NA 4JX3A 3IK3A 3ORPA 2BTSA 1IA8A 5GZAA 4ZXTA 3C13A 4PQNA 3ZEPA 4ZTHA 2GHGA 1R78A 1WBWA 5FQDC 5IKWA 3EQRA 5CSPA 4MXAA 4C61A 1G3NA 2NRUA 4YJRA 2W1CA 5D41A 5ETCA 3NWWA 3TUCA 3ZDUA 5B2KA 1JKTA 2R3OA 3FLQA 4HZSA 3W1FA 2WXVA 4ZS4A 4DGLC 1J91A 4LI5A 1F0QA 4U6RA 2PUUA 4GL9A 4C36A 2GNIA 4O83A 4KB8A 4C59A 4O6EA 3PVUA 4DFNA 5IUHA 5M4UA 2UZTA 2XK9A 4A9TA 2VTPA 2HZIA 1PKDA 4RT7A 2O64A 4FSTA 5KMIA 4YC8A 3RM6A 3BE2A 3ATSA 3BV2A 2WQBA 1V0OA 3ORXA 1XBAA 3BCEA 4XG2A 2PVRA 2NPQA 5HIDA 4BF2A 1OMWA 2CGWA 3MWUA 5GJDA 3H9OA 3PPZA 4MH7A 2IVUA 2UW8A 5FUTA 4A06A 5I9VA 4LUEA 3GC0A 2WTJA 3IQ7A 4FL1A 4LMNA 3ORKA 3DK7A 4HVDA 4FG9A 3NUUA 3AGMA 3P7CA 3R01A 2VX3A 2BFYA 2AYPA 2QCSA 3H0ZA 4O0TA 4WRGA 2HCKA 2YEXA 3HP2A 3D94A 4FSNA 3QCYA 5EW3A 3HV3A 2ZOQA 3KL8A 5AR8A 3TNQB 3VS3A 4W4XA 4BICA 4ZTSA 3AMYA 3CKXA 4RJ4A 5CSHA 4KIKA 1R3CA 4FEQA 4TYHA 2EXMA 2YZAA 4CNHA 1H07A 3D2IA 4LGGA 5L6WL 3NZ0A 3NLBA 1KV2A 2YDJA 5FTOA 3Q9WA 5FD2A 3FMEA 3R7IA 2CN5A 3QX2A 4FNYA 2QLQA 2BIYA 4AW0A 1V1KA 2WELA 5CLPA 4TT7A 4UWBA 3K2LA 1KOAA 5AA8A 5CU0A 3RZBA 4GKHA 1W8CA 2GTMA 4GIIA 3R8UA 2IG7A 3Q5ZA 4JXFA 2OIDA 4UV0A 3NNUA 4ANNA 5IA4A 3RPOA 1M14A 4HOKA 4XRLA 5LWMA 3OTUA 3OTVA 3WZKA 4G9RA 3MTFA 4DGNA 1PXMA 1JVPP 2XK4A 4J1RA 5A4CA 2WTCA 3GB2A 3HNGA 1AD5A 2J9MA 4BZDA 4Z7GA 3FBVA 3F7ZA 4C0TA 2XYUA 3BZ3A 2XK8A 4CFXA 5HD7A 3IS5A 1ZY5A 3QQLA 2ZMDA 4NTTA 3GU5A 3R9NA 4ZJIA 3ZO1A 2XJ1A 2B9FA 2QHNA 3EFWA 4E3CA 4D2PA 2X0GA 4FV9A 1ZYJA 4P2KA 3ANRA 1JNKA 5F94A 3ROYA 3H30A 4B4LA 4FIEA 3DJ6A 4S33A 4E6AA 3VS7A 2WTKC 4AT5A 4RFYA 5GNKA 4EOJA 3QC4A 2R3LA 1GAGA 2QR7A 4ITIA 4CLIA 2FB8A 3FPQA 4R8QA 5CSWA 5CEIA 4ZSAA 2W06A 1L3RE 4IW0A 5HG7A 3VULA 3DU8A 4HGLA 1W0XC 3E87A 2PZRA 3KK9A 4RG0A 2E9OA 5K4JA 3KRJA 2WZJA 4QQTA 3DBEA 2GNFA 3G51A 4DH1A 3K3JA 5HBJA 2O2UA 4I6BA 3DTCA 4FSRA 4BCHA 4R7HA 4MQ1A 3HECA 4P7EA 4RFMA 2UZLA 3OF0A 4TW9A 4Z7HA 5HZNA 3NGAA 4J71A 5BMMA 5HTCA 3PJ8A 3NIZA 3UOLA 3I0OA 1GIJA 5HESA 4BCKA 5JFVA 1O6KA 4ZAUA 3IDBA 3QD3A 2W5BA 2Z7LA 4JI9A 4MK0A 2NNWB 5CF6A 3E3BX 4EH3A 1CKIA 4QPAA 2WKMA 4MNEB 4WA9A 5GJGA 4QTAA 1WCCA 2C3JA 4V05A 4AUAA 1KWPA 2Z02A 3RWQA 3KVWA 3GFWA 4BI0A 2VWZA 2XRWA 2CMWA 3SX9A 3Q04A 3DKGA 3ZS5A 2R0IA 4JDHA 5FXQA 4CKIA 3KF7A 1DI9A 2ETMA 4PPAA 3QGWA 3KXHA 3AD4A 3POOA 4O2ZA 2UZEA 4FSUA 4G5PA 4CXAA 4FKOA 3MJ1A 1Q62A 2XNGA 3FC1X 3ODZX 4XV2A 3GU4A 4RWKA 2A0CX 2QOKA 2BPMA 3AMBA 3DV3A 4MTAA 5EYKA 3QD2B 4M8TA 1DAYA 5IA1A 2XRUA 3VRYA 3GC8A 4IWOA 5AP3A 5AA9A 2B55A 1PYXA 5IQFA 1R0EA 3DXQA 5DMZA 3AC1A 3P1AA 1CTPE 1A06A 3CGOA 4H1MA 4CFNA 5FDXA 3TT0A 5CF5A 2GTNA 4N70A 4BN1A 2DWBA 1OL5A 5CZIA 4UWYA 5L2SA 3WF9A 4XOYA 2LAVA 3LJ0A 5ITAA 1MQBA 4KRDA 1QL6A 3ET7A 3B8QA 5CAPA 4LUDA 4MXZA 4G3EA 1A9UA 5LWNA 1YWRA 2P33A 2C5VA 1NY3A 4DG3E 4JIKA 4PMMA 5E8TA 5I3OA 2WAJA 3FAAA 3QF9A 4N4SA 5EK7A 3NEWA 4C57A 3QZHA 3OOMA 3ZM4A 1W98A 2ZV7A 3NYOA 3QLGA 3UC4A 3D5VA 2NP8A 5DEYA 3HX4A 3GVUA 3LFAA 4UB7A 4XG7A 4R7BA 5C8NA 2YA9A 2PMNX 4GSBA 3QYZA 5AM7A 4DE4A 2HAKA 4PMPA 2WOUA 5IF1A 4DTBA 1RJBA 2UVYA 1HOWA 4H1JA 5HLPA 2EVAA 4EOKA 2XMYA 5JFSA 3MFUA 5HX8A 4FSQA 2IVVA 4GYGA 5DA3A 1YHWA 5AUWA 3E62A 4ZP5A 4CRLA 4MX9A 5HU9A 2W9FB 4LG4A 2WMAA 2VZ6A 4IAYA 4GU9A 3EFKA 1XH7A 3U6JA 4YP8A 2G2HA 4FL2A 3ZZWA 5HEZA 2VUWA 2J2IB 4IWQA 1XH8A 4KSPA 5DEWA 5J5TA 3DAKA 2YJSA 3FYKX 2PVNA 5KKRB 4XG4A 2I6LA 2W1DA 3UZRA 1JSVA 2UW3A 3CCNA 4ZLYA 1Q8UA 3B2TA 4YJVA 3W8LA 3LKMA 4BVUA 3MJ2A 3QXOA 3VO3A 4YHFA 1YRPA 3M2WA 4FKLA 3JY0A 1H08A 3IO7A 2VAGA 2B7AA 2ETKA 4FVPA 1JSTA 2ZDUA 4OW8A 4ZY5A 5M44A 3LCSA 1Z5MA 4TZRA 4FA2A 4FTKA 2ZM1A 2HENA 4L6QA 5LMKA 2J0JA 4G3DA 2GNLA 4YBKA 5EI2A 3R7OA 1NXKA 5L8JA 4IAZA 1PJKA 4U97A 3V5LA 2ITZA 2BROA 2GCDA 4X3JA 3VBVA 3W2SA 5IMXA 3SG9A 1KE8A 4Y8DA 3TL8A 2PK9A 4FIFA 1U59A 2Y6OA 3V04A 5IA3A 3O7LB 4L9IA 1JKSA 3BEGA 4O0VA 2J5FA 4GFMA 1NW1A 2GQGA 4LYNA 4RC4A 4JS8A 4ZY6A 4D0WA 5HCXA 2VTOA 3UZPA 4H3BA 1OPLA 2GNJA 1PMUA 3V5PA 4IDVA 1KUTA 4GMYA 4KS8A 4EHVA 4EUTA 2BHHA 1PXPA 2RFDA 3RTPA 5HX6A 3RHXA 5F1ZA 2UW4A 3DNDA 3AQVA 3Q96A 3VS0A 4FICA 3G9LX 4F09A 3CPBA 5EHOA 5FM3A 5TO8A 4BCOA 2YWPA 3MDYA 5CSVA 1BMKA 4C33A 4J98A 2J0KA 5KBQA 4W4WA 5DT0A 5JSMA 4IB0A 2XIZA 4AE9A 4NFNA 2QOBA 4YZDA 3FI8A 3HAMA 3AC5A 5AUZA 4I1ZA 1S9JA 2VD5A 4I3ZA 4L43A 4TWOA 4MWIA 1BYGA 3CXWA 3LMIA 2EXEA 1H1PA 3MYGA 5HG5A 3BIZA 5H8EA 2YIRA 4FNWA 4RWIA 2Z60A 5KMMA 3F2NA 1BI7A 2J90A 4FE2A 3C4FA 3U4UA 2W5AA 1UA2A 3D9VA 4IAKA 2R3RA 5M51A 3F5UA 4O0YA 4AN2A 2FUMA 1XQZA 4YNEA 4BI1A 4EK3A 5LQFA 1OBGA 4ASZA 4C4HA 5KMJA 1S9IA 4FKIA 3OXZA 1DS5A 5D9HA 5HBEA 5IUIA 3U9NA 3BWFA 4BDDA 3NX8A 4L3PA 5EFQA 5EQEA 5IQBA 2BAKA 3IW5A 2PE0A 3BU5A 3HMPA 3BX5A 3RGFA 1STCE 5DT3A 3ZXZA 4F7SA 1YI6A 3R1SA 3RPRA 2VO6A 1FPUA 3ORTA 1M2QA 4OTPA 1B39A 3KVXA 1MRVA 4W9XA 3HMMA 3DDPA 2ONLA 3FC2A 1WVWA 4GV1A 4S34A 1ZWSA 3FE3A 4O22A 3VJOA 3OT8A 4IB5A 3W2OA 3UODA 3DS6A 4OGRA 2BALA 4P90A 4EWQA 4O1OA 3MPAA 1Q5KA 4M13A 2OSCA 5E8YA 5A9UA 1SNXA 3BU6A 4WSQA 4ZEGA 1YXUA 4G3GA 1Y6AA 2XP2A 1SVGA 3NUPA 1E9HA 3PSCA 2P2HA 3FZRA 4E73A 2PE2A 2BZJA 4DH7A 5BPYA 3PTGA 4FEWA 3IGGA 3OP5A 4RQVA 5JGDA 2GNGA 2O0UA 2QR8A 2YM8A 3DT1A 3KKVA 4ZLOA 1W82A 1X8BA 1XH9A 2HZNA 1OKYA 4D55A 3FV8A 4DFZE 4ZJVA 4JNWA 4ZOGA 3ENHA 1OL1A 1UNHA 3HA6A 2XNNA 3HRFA 3QWJA 3GFEA 5H2UA 2PY3A 4D1SA 4NCTA 2BUJA 2WQMA 3HA8A 4QP1A 5DRBA 5HD4A 4OBPA 2WEIA 4RVTA 5IG1A 3QYWA 1FGIA 4C38A 4IANA 3SOCA 5EW8A 3IDCA 3K5UA 1OKVA 2XF0A 4G5JA 3POZA 1J7IA 5DE2A 4C2VA 2XIRA 3IPHA 4OBOA 4OBQA 3E88A 1Q3WA 3PVGA 4R3RA 5AM6A 4EHEA 3F3ZA 3W2CA 4CVAA 4XRJA 4QP2A 1XBBA 1OUYA 2J4ZA 1HCLA 2W1HA 4FK3A 3VHEA 4WUAA 3LJ2A 3A7HA 4GFGA 5IQIA 3FMNA 4BKJA 1ZOGA 3HLLA 4IVBA 1K9AA 4IM0A 4R6VA 2B1PA 3G6GA 1MQ4A 3BPRA 2NRYA 3TV7A 2C30A 3U87A 3UNZA 4O38A 3W2PA 4AZVA 1ZZLA 5ANGA 2ITWA 4CKRA 4KIOA 4D28A 2W1IA 3EN5A 3TEIA 1ZZ2A 2AUHA 3G2FA 3LLAA 4TN6A 3ORMA 4FIHA 2X7FA 4FKGA 3VF9A 4BTJA 2I0HA 4Z9LA 3OW3A 4MBJA 4R1VA 5AP5A 3SC1A 3RNIA 1OBDA 2RFSA 3QQJA 4R1YA 3LHJA 3DNEA 5I5ZA 3SLSA 4PY1A 5H8BA 2X8DA 4RWLA 1ZYSA 5T68A 4NW5A 4E6DA 4BFMA 4DEHA 5AADA 3R2BA 4CFVA 5C4LA 4XLVA 2BTRA 2QHMA 4JDJA 4M7IA 5GZ8A 3CQWA 4IM2A 4FVRA 5HE2A 3E64A 2F57A 4NU1A 4DGGA 3CTHA 3QKLA 5GIPE 1QPJA 4RGJA 3AC2A 3UO5A 4F70A 3DXPA 4KA3A 3ACKA 1VZOA 5E8ZA 2J7TA 2JKKA 3O8UA 5CTPA 2PZIA 2JBPA 3GQIA 1SVEA 3HV4A 3FZPA 2FYSA 4XG8A 2V5QA 4PNKA 4XNEA 2GQRA 3GCQA 4C4JA 3PYYA 3UNJA 5KO1A 4PMSA 4CFFA 2I40A 2UZWE 3VC4A 5HNBA 4F9AA 3SD0A 3A8WA 3GQLA 1IG1A 1GJOA 5HGIA 3VF8A 4J53A 4WRSA 4PL5A 4YC3A 2DYLA 3JVRA 4IX6A 5E4HA 3F3UA 4MNFA 3EYHA 3O23A 3T8OA 3TTJA 3UTOA 1OUKA 2I0EA 3MA3A 4EHZA 5FXRA 2OICA 4I24A 5M55A 5A6NA 3QL8A 3CC6A 4NM3A 3V3VA 1YXVA 5DGZA 3O8PA 4XLIA 4USDA 2X2LA 2I1MA 2C4GA 3R8LA 4JBVA 4G34A 1H26A 5K0KA 2PVLA 3KU2A 4AN3A 3WILA 3TZ7A 4CSVA 2QU5A 3V5QA 3CY3A 5DH3A 4I94A 4EH4A 3PY0A 4M12A 4NZWB 4UEUA 4D2SA 4ZJJA 3CE3A 3IOPA 3LXPA 3O0GA 1ZARA 3DQXA 2WHBA 4Q2AA 4UXLA 3SW4A 3QU0A 4O7YA 3NUSA 3EN7A 4OT5A 3P9JA 3Q5IA 3GCVA 4AW1A 2BHEA 1W7HA 2OXXA 1Y91A 2VTMA 4NJDA 5KX8A 4F4PA 1TQPA 4YPDA 4B99A 3COIA 4EC8A 2ESMA 4K9YA 2ERKA 2O5KA 5CU2A 4YSJA 4Y83A 3MIYA 3RNYA 5J9ZA 4FKSA 4V0GA 4XUFA 3UOHA 4S30A 3QLFA 3V6RA 5E91A 3PSBA 4BCMA 3KXZA 2JIIA 1JBPE 3DK3A 1E1VA 3Q6WA 4I5MA 2PE1A 4ID7A 4L7FA 4DEBA 4UN0C 3ATTA 2JDOA 4NW6A 2P55A 4USFA 1P2AA 1ZYLA 1B38A 5AV3A 5DBXA 4H36A 3WE4A 4F9CA 3LOKA 1WZYA 1H1RA 1I09A 2UW5A 3R7YA 3E8NA 3O8TA 5HU3A 5HVYA 2H96A 2X39A 3DOGA 2CSNA 4O7SA 3DDQA 4J52A 3KFAA 4CQEA 4PX6A 4HGEA 1OI9A 2HOGA 1P4FA 3QX4A 3RK7A 2B0QA 3ZOSA 3WF7A 4RIYB 4QQCA 1V0BA 4BWKA 4EK4A 1YOLA 3DJ5A 3H4JA 4PWNA 5CENA 5EYDA 2OH0E 5CAUA 5GJFA 5IEXA 2LGCA 4XEYA 3ZLSA 2BR1A 3PVWA 3Q2MA 4AZTA 3RPVA 4C34A 2C0TA 2GPHA 4FZAB 5EHYA 4CMUA 3WF8A 5F20A 2W5HA 3PIYA 2HXQA 3W33A 4IB3A 2XH5A 4RLLA 4KUJA 2R7BA 3MVMA 5E92A 3VW8A 1URWA 2P2IA 4ANOA 5A54A 4F6UA 3NYXA 2QOIA 5DNRA 2H8HA 3SRVA 5CVGA 4DF3A 2ITYA 5H9BA 5LMAA 2OK1A 3FLWA 5HO7A 3ZC5A 1XR1A 4EC9A 3KCKA 3AMAA 4YU2A 2J0LA 2V55A 4A9YA 2OI4X 1RE8A 5BVFA 3LQ3A 3F7WA 3L9MA 3PG3A 4K77A 1JKKA 2UZVA 3DBQA 4DEAA 2JITA 3GCUA 3MY5A 4A4LA 1HCKA 3FSFA 3L9PA 3ZRLA 3N4UA 4TYJA 2OZAB 4U80A 3ENMA 4WUNA 3O17A 5B2MA 3LCOA 3EQFA 3EQHA 4ZK5A 4UMTA 5IMEA 2X8IA 5J1VA 2QOQA 2DS1A 5CXZA 4BCIA 3QQGA 4RJ6A 5I9XA 3VUGA 2PVKA 2BKZA 4JAJA 2QU6A 4F9YA 4TL0A 3V8TA 2QOLA 3F6XA 3OBGA 4W9WA 5GINE 4MXOA 4XV3A 3R30A 3C4XA 3TUBA 3FL5A 2JGZA 4BZNA 3GU8A 5HVKA 2IVTA 4RIWA 5BVNA 4XX9A 4M97A 4G6LA 4EQCA 4BCQA 4NT4A 5EYCA 4ITJA 5AUUA 5JFXA 3NW5A 5EI6A 4QTDA 2F7XE 2YHVA 4C2WA 3BHYA 5J79A 1O6LA 4IZAA 2VWYA 2YCFA 1H00A 3CS9A 4K0YA 5TR6A 4BZOA 4IDTA 4DLIA 3CSVA 3LVPA 3KRLA 1LEZA 5JKGA 3SAYA 3PJ1A 4DYMA 4ZLZA 2JFMA 2IZSA 1ZAOA 4FYNA 3ALOA 3KMUA 3BWJA 5M57A 5TF9A 3LPBA 5AX3A 4PP9A 4AE6A 4YTFA 2HZ4A 3G0EA 2EU9A 4WG4A 4GRBA 2GHLA 2QONA 4EQUA 1U54B 1T46A 4OUCA 2Z8CA 5AX9A 3OCTA 2Y0AA 5ACBC 4LQMA 4M84A 3FKOA 3AD5A 4UX9A 4MQ2A 3C4WA 3DBFA 4GT4A 4F9WA 5IQGA 2GSFA 3UO4A 4O7VA 5EKOA 5BYZA 2WMRA 1MUOA 2J0MB 1LEWA 1VYZA 2JFLA 2R3IA 2CNUA 4QO9A 4GUBA 2WOTA 4AAAA 4QNAA 4W8EA 1FVRA 4IVDA 4XHKB 3UJGA 1Z57A 5BVOA 2VRXA 3K54A 5J5SA 4UZHA 4RX7A 2JAMA 2RL5A 2JDRA 2XIYA 5CSXA 4JOAA 3T9TA 3F5GA 4EOQA 5IPJA 1PRYA 5E1EA 3ZC6A 2ZB1A 5HIBA 5D10A 5AEPA 4MKCA 2R3QA 4EOOA 4NM7A 3HVCA 5CT7A 4FV6A 4K2RA 3VS6A 1Q61A 3FMDA 4FTMA 4FVQA 3U6IA 1U4DA 4QP9A 2IWIA 3NCGA 2WQOA 4TKSA 3BHVA 2QOCA 3R1QA 2HY81 1Y8GA 4Q5HA 2PUNA 2PPQA 3VRZA 4I22A 2YFXA 2OU7A 4RVLA 5AP6A 3UC3A 2WPAA 3OMVA 4DCAA 5AAFA 4GW8A 5LMKC 2BRBA 2PMIA 2XEYA 3A4OX 5L8LA 1ND4A 3ITZA 5DLSA 5HE0A 2ZM3A 4FSYA 4IM3A 4ALWA 1XBCA 2JDVA 2A2AA 3KRWA 5AUXA 4ARKA 4U9AA 1VEBA 4JDKA 5M4CA 2OFVA 4EOLA 1UU3A 2JLDA 3VUHA 4KKEA 2VTIA 4B6LA 4DGMA 3TKIA 4BHZA 4OTHA 4QRCA 4RZVA 3CTJA 4ANQA 2R3NA 4U45A 5IQEA 3QHWA 2Q83A 3IGOA 1LR4A 2XA4A 4JVGA 4AOTA 3VQHA 1W84A 2X4FA 3G6HA 2BZKB 3A99A 4YJSA 4MF1A 2C6OA 4NIFA 4D4VA 1OL2A 3QRKA 4U81A 2QG7A 2PL0A 2C5XA 3BGQA 4FK6A 4GVJA 4ONAA 4RLKA 3G15A 2X9FA 2YIXA 3EQGA 4XYFA 2VTTA 2R64A 4I5CA 4AT3A 4FF8A 4FKTA 1YQJA 5D11A 4YJNA 4EOIA 5J7BA 3QTRA 2ZVAA 3GC7A 2ITXA 1Q24A 1H0VA 4YLLA 3R6XA 3A4PA 4D2WA 1XJDA 3FZ1A 4E26A 5BYYA 3VJNA 2UW9A 3TV4A 4V01A 3BQCA 3ID6C 2YJRA 4BTFA 4YZMA 4UWCA 3IONA 2UZBA 1OIYA 2XBJA 1XH4A 4BC6A 2YACA 3VUIA 4M68A 5IDPA 2VNWA 1WAKA 3MV5A 4H39A 3U9CA 2Z7RA 4ERKA 3KREA 3TZMA 4AOJA 5HO8A 4JG6A 3ZEWA 3QZFA 2Z2WA 5LVMA 3KN6A 3PLSA 2G2FA 3MFTA 4FEUA 3R1YA 1PW2A 2I0YA 5CVHA 5L3AA 2OJJA 4WBBB 2Y9QA 4EL9A 4ANSA 2R3JA 2JC6A 5G6VA 3I5NA 4OTWA 5KNJA 4BYIA 3HKOA 4EONA 4XP0A 3A7JA 3VBXA 4FODA 3KN5A 4FKPA 3ORZA 4I0TA 3NYVA 4XG9A 3FI4A 1H1QA 3CR0A 4D4SA 5A14A 1WBNA 5KMKA 4AGWA 3KQ7A 4FX3A 3C51A 5FEDA 4RWJA 3PPKA 3L9NA 2FGIA 1H8FA 3OCGA 3R1NA 4YO4A 4O0XA 4KABA 1O9UA 5AIKA 4FTAA 1UU7A 3PXFA 5GZ9A 4LRKA 1YWNA 2XK3A 4RMZA 1OITA 3QCXA 5CNOA 3LCTA 4GS6A 2R9SA 4EUUA 3QTXA 3MTLA 4I0SA 3PPJA 3BYUA 3TWJA 4BCPA 5M56A 4IXPA 4D4RA 4O7NA 5JN2A 4I41A 4UMRA 5CI7A 4CGAA 2YN8A 4DFYA 3QUDA 1OPKA 2RG5A 2G2IA 3CEKA 4NCTC 3QFVA 4KRCA 1GIIA 4QYFA 4EKLA 3ZO3A 5FWKK 4AZWA 3ZBXA 1R39A 2XNPA 4YLJA 2WGJA 4PDYA 2ZB0A 3F3TA 2C5OA 4FTTA 4RIXB 4DFLA 4FTJA 3TJCA 1BL7A 3O96A 5ACKA 4PP7A 2X6DA 3TI1A 1RDQE 4YO6A 1SM2A 2VX1A 2F49A 2WEVA 3L9LA 5HKMA 3ZCLA 5K3YA 4NFMA 1ATPE 4E5WA 2PVJA 3C7QA 4PTGA 3ORLA 2GS2A 2W17A 1KE7A 3E93A 5AV0A 3E7VA 5HCYA 5HNGA 1Q41A 3CKWA 4U40A 5DIAA 4AGCA 4MXCA 3P78A 4DBNA 2XKEA 2FSLX 2GS6A 4HVGA 3H9RA 2ZYBA 5HLWA 3G9NA 4RBLA 1QMZA 3GXLA 3OC1A 3R73A 4I20A 2V7OA 5EI8A 3UIBA 5EOLA 5FBOA 4ZZMA 3DK6A 4FTIA 1UKIA 3QTUA 2ZV9A 4Y95A 4DGOA 2EUFB 5AR3A 4X2FA 1KE5A 4RC2A 3GOPA 4IEBA 3DBDA 2F9GA 2PWLA 4U41A 5KBRA 4CV9A 5IQAA 3BEAA 3VBWA 3PUPA 4WO5A 1JWHA 3EN9A 5BVKA 5I3RA 4OTDA 3MA6A 5AP1A 2UZNA 3DCVA 5L6PA 3R7GA 3DTWA 5J95A 3VBYA 3BLRA 4DG0E 2G15A 3K5VA 3VS1A 3EN4A 3F5XA 3D7TB 4BR3A 4D4YA 2ZJWA 4IQ6A 2BMCA 4BIBA 4KBKA 2ZMCA 3Q32A 3QTQA 3COMA 2WTWA 4W4VA 1L8TA 3HZTA 4FT0A 4KIQA 5AWMA 5TOZA 5CX9A 3WIGA 5KUPA 3MH3A 4CZUA 2XJ0A 5BVEA 5CU3A 1NA7A 2IVSA 4GFOA 4TRLA 1FBNA 2OJGA 3JR1A 2UZDA 3LCDA 2GQSA 5IH6A 4II5A 2YAKA 5E8WA 2BAJA 4MYGA 3FQSA 3ZUUA 2OXDA 3VVHA 3HMNA 3NUNA 2E9VA 4FI1A 4TYGA 4BDBA 4D9TA 4O7ZA 3D7ZA 4CD0A 3I60A 2BZHB 5JK3A 4KIKB 2HELA 4TYHB 2XK6A 4O0RA 3F2AA 2FSTX 4ZY4A 4DCEA 2C6KA 5HCZA 4AW5A 5A4QA 3AD6A 1JLUE 2WIPA 4AXAA 1VJYA 3I6UA 3W8QA 2BRNA 2F7ZE 3LFQA 3CQUA 3ZSGA 4I6QA 4O7TA 3HRBA 3NMUF 4H3PA 2O63A 4X7QA 2HXLA 3FLNC 5G1XA 4LL0A 5ANOA 3C5IA 3GT8A 3RPSA 3WZDA 3D0EA 5LVLA 2CJMA 1Q8ZA 3S4QA 2OFUA 2Y4PA 3SDJA 3DJ7A 4Z55A 5KHWA 4D5HA 3Q2JA 4D58A 3S95A 4NL0A 3TKHA 4IVCA 1DI8A 1H1SA 1WBSA 4YJQA 5LVPA 3DLZA 2ETRA 4BCNA 1UNLA 3R8PA 2VWIA 1FVVA 4IC8A 4E4MA 4FTLA 4BGHA 2OWBA 1PY5A 1UWHA 4NJ3A 4QMUA 5CAVA 4ANMA 4IJ9A 4X3FA 4MBIA 3LFCA 4W4YA 4NEUA 4L7SA 3FXWA 5JRQA 5BNJA 5JH6A 5LCJA 4FT9A 2WMBA 2FVDA 3W10A 5CU4A 4DH5A 4H58A 3FQHA 3KULB 5CXHA 5ETFA 2QURA 4FV2A 1GZOA 5C27A 3QUPA 2IW8A 5HVJA 4G2FA 4LFIA 5HTIA 3VNTA 4APCA 2XUUA 1PMVA 4FEVA 2PVMA 3OWLA 4UY9A 2O8YA 4YUQA 2PZYA 4PMTA 3ELJA 4L3LA 3JYAA 4GK4A 2FSOX 3ZU7A 5AAGA 4ASEA 3NCZA 3OVVA 1BKXA 4JRNA 3TN8A 2R2PA 1PHKA 5EM5A 4MD7E 5IQCA 4GEOA 5HLNA 1WBOA 2XYNA 3I79A 4FT3A 2PUIA 4KBAA 4OT6A 4K33A 3LMGA 2ITPA 3FY0A 2RFEA 1WBTA 3RK9A 3NRMA 3FUPA 1OL6A 3HRCA 3B2WA 5JQ5A 3S00A 2CGVA 4X21A 3FSKA 4BKYA 4F0GA 4O84A 4O81A 5C1QB 3TG1A 3AT2A 1QPDA 4MXYA 3IG7A 5TKDA 4G16A 4CTCA 1XWSA 5EYMA 4QMMA 1SYKA 1WFCA 2C5NA 4B9DA 2C3IB 3EQPA 3G90X 4J95A 4YMJA 3LQ8A 5EM7A 3PXKA 5IDNA 3SVVA 2R0UA 3LFNA 3IW4A 3R9DA 5DR2A 4O21A 4B8LA 4JLCA 3GP0A 3NAYA 3PRIA 4JAIA 3QZIA 1OIQA 1PXOA 4BBEA 4Z3VA 3CLYA 5E7RA 1UVRA 3Q9XA 4AZEA 2FSMX 5CEKA 1WMKA 3PJ3A 4QP7A 2ZM4A 3GGFA 5ANIA 3RCDA 3SXRA 3EYGA 4FKRA 5TE0A 4ASXA 3SXSA 5M08A 5IH4A 4DEGA 4Y5QA 3L8VA 4AWIA 2QQ7A 4ENYA 4A07A 1BX6A 2OF2A 3IOKA 3PA3A 4QTBA 2J5EA 3KXMA 4M69A 2X2KA 4CFWA 3MFRA 1YHSA 1ZXEA 4EH7A 5AAEA 5FGKA 4P4CA 4FIGA 4QPMA 4ZTQA 2X81A 1PF8A 3A2CA 4IWPA 3RP9A 4BDEA 5LJJA 3BBTB 3UIXA 3ALNA 4XJ0A 2PVFA 3I7CA 5CI6A 2WO6A 2CCHA 2Q0BA 3RM7A 3UNKA 5L2IA 4DTAA 3BHTA 1ZMVA 4AQCA 1IAHA 2X4ZA 3CD3A 1ZYCA 2HW6A 1OZ1A 4YZNA 3C0IA 4TWPA 1APME 4X0MA 3E63A 3MY1A 4U42A 1BUHA 3D5WA 5FP5A 5CWZA 2HK5A 4IE9A 3WZJA 1ZY4A 4JQEA 4EH2A 5BMSA 1ERKA 2B54A 3EZVA 5EG3A 4C7TA 3BELA 4NM0A 3CPCA 4TPTA 3VWAA 4UMUA 5JZJA 4OAUC 4L53A 4RRVA 3OXIA 3ZFMA 5BYLA 1KOBA 2OJIA 2WB8A 3LFDA 4UZDA 4D2RA 5KZIA 3AC8A 4U3ZA 3II5A 4QMWA 3FQEA 5FEQA 3PWYA 3R04A 3RZFA 1LUFA 3NAXA 5KMOA 1ZYDA 4LRJA 3V6SA 3ZONA
chains in the Genus database with same CATH superfamily
4WNPA 3R8MA 5E8UA 1WVXA 3R8ZA 4CT1A 5GIOE 4ZTRA 4I5PA 4BL1A 3SA0A 3PIXA 4E4NA 3GEQA 3F2RA 5LARA 1Q97A 4KINA 4QDEA 2ZV8A 2X0PA 2VTJA 4K11A 3CBLA 4V04A 4PNIA 4M66A 3C0GA 3PFQA 5HE1A 3QKMA 2B52A 2FO0A 3UZTA 3TNWA 4EJNA 3UE4A 1NVSA 3W55A 2C0IA 2UVZA 4M14A 3F69A 4JRVA 4N6YA 4G9CA 3N4VA 3H9FA 3R22A 4F6SA 4BCJA 2JBOA 3HMOA 4J8MA 1AQ1A 1VR2A 2H9VA 5EM8A 4FTUA 3WBLA 3C4CA 5IUGA 3LXNA 1QCFA 4JG8A 3W2QA 1PXJA 4EZ3A 4NKSA 3TNPC 4PTEA 4ZSGA 5ETIA 4E6QA 5D12A 4BGGA 3RVGA 4O2PA 3LZBA 3PXYA 4RFZA 3QD4A 3Q9ZA 4HNFA 2W9ZB 2YITA 2HWPA 2XM9A 5FDPA 2SRCA 3OUKA 2HZ0A 4O0WA 5AP2A 3VUDA 5AUTA 3UVQA 2OW3A 4JT3A 4QMQA 1OM1A 4HCVA 3NNVA 4IZ7A 4ZTLA 4YGAA 5DR6A 3E92A 3ZLXA 2C6LA 2UW0A 3QRJA 1OECA 1MRUA 1YI4A 2QOFA 3JXWA 3QA0A 4LOOA 5E8SA 2CKOA 4F64A 3JUHA 2I0VA 2J50A 3GUBA 1ZOEA 4AU8A 2RG6A 3KXXA 4F1OA 3QAME 2A19B 4Q9SA 3ZO2A 4B7TA 5CF8A 3TKUA 4O27B 1JKLA 1U46A 2XB7A 4CKJA 2E2BA 1M7QA 4FSWA 2R3MA 4HNIA 3THBA 5BUJA 4D0XA 5H8GA 1PXLA 3EKNA 2UVXA 5DI1A 3MVHA 3SXFA 3R7EA 3MVLA 3FZTA 3P7BA 4L00A 5GHVA 2OIBA 1GZKA 4IADA 5C8KA 3WARA 3NR9A 4CT2A 4FNZA 3LFBA 4YJUA 4IFCA 4EZ5A 5M06A 3R00A 1REKA 5L2TA 5L8KA 4PRJA 3GI3A 4I92A 2OLCA 3LMHA 4QOXA 1M7NA 4YTHA 5CEQA 3T3UA 2XCHA 3H0YA 4GT3A 3R71A 4TYIA 4YJPA 4IAAA 5I0BA 1YHVA 4O0UA 4U3YA 4QMOA 2XNEA 4QYGA 3C0HA 5JFWA 3HV5A 5AMNA 3HYHA 5AV2A 5HHWA 4RX5A 3A62A 3CJGA 3OHTA 5CAOA 4DEEA 4AF3A 3DKOA 3GCSA 3ACJA 1Q8WA 3WIKA 3WYYA 1JAMA 2HYYA 1U5QA 3IW8A 3PP1A 3KIOC 4A7CA 3V5WA 5IZFA 4K8AA 2BKKA 1URCA 2OH4A 3A8XA 2QKWB 4A9UA 2C47A 3SGCA 3P5JC 4CFUA 2R3PA 3GNIB 4JDIA 1M17A 1K3AA 5C03A 3W0QA 3LE6A 1ST0A 4I0RA 4ACCA 4H3QA 4R5YA 5DVRA 4RJ7A 4EOSA 4DT8A 3ML1A 4DBXA 3Q60A 5D7VA 5HI2A 4AG8A 4PL3A 1IR3A 5H3QA 2QG5A 4PV0A 4QMYA 4GG7A 4M3QA 3VUMA 2PVYA 3H3CA 5EDRA 3GC9A 2VTLA 4QMLA 2C6DA 3DA6A 4UALA 2V22A 3W0RA 2JD5A 3CTQA 4BB4A 4FZ6A 4GK3A 3G0FA 4AGDA 3S0OA 5DRDA 5B7VA 3LLTA 4I5HA 4ZTNA 4F08A 4FKJA 1YXXA 2VO0A 1BL6A 2CDZA 2X1NA 3IECA 2XEZA 2VTRA 1OKZA 3DB6A 3RKBA 1BI8A 4IAIA 2BRMA 1Q99A 4RSSA 3JS2A 1VYWA 3IW7A 4NK9A 2C6TA 4YPSA 1K2PA 3QD0A 2QO7A 5ANJA 3REPA 2CHLA 2UW7A 3HV7A 4EBVA 5J1WA 4UYNA 3ZTXA 4RJ5A 3SQQA 5A4TA 3TM0A 2A4LA 5IA2A 4PTCA 3U6HA 5ANEA 3KRXA 4HYHA 4ZTMA 1TFFA 4DT9A 4F7NA 4QTCA 5BUIA 3FY2A 4CYIA 4F7JA 1KE6A 4GG5A 4IZ5A 4QMVA 3TUDA 1Q8TA 3PIZA 4FTOA 3GOKA 2CLXA 2JIVA 5AR5A 3V5JA 4O6LA 3WI6A 4B0GA 3BYOA 2ZAZA 4EH6A 4EK5A 5A6OA 3QRIA 4G31A 2W4KA 2WQEA 3AT4A 4WNKA 3UOKA 4O96A 4WNMA 1PMNA 4HZRA 1OPJA 1M52A 4ZIMA 4F9BA 4IX5A 3FMKA 4J8NA 4XP2A 3RBWA 2BZIB 3M42A 2E9NA 3OY1A 3FPMA 2FA2A 4X2KA 2PU8A 4EORA 4Y73A 3VS4A 3PUFC 2GS7A 5M53A 3VIDA 4XMOA 4FT5A 5KHXA 1IASA 3TDVA 2W1EA 3K3IA 3NDMA 2PYWA 5CALA 2YLEA 2Y7JA 3BE9A 2ITVA 3JVSA 3KB7A 2F2CB 4FKQA 1YXSA 5AJQA 3A60A 4JBOA 3KA0A 4XG6A 3Q53A 3RJCA 1SNUA 4K6ZA 2OBJA 4R3PA 3WE8A 4D1XA 4Y46A 4MWHA 3I1AA 3RALA 3EMGA 3WZEA 4ASDA 3BYVA 3BYSA 1PXIA 2F2UA 3NSZA 2ITOA 4KAOA 4E93A 4EWHA 1REJA 3SV0A 3DY7A 3RK5A 3FI3A 2X7GA 2VWXA 3MPMA 1Q8YA 4X2JA 4YJOA 5EQPA 2HW7A 2QO9A 1JPAA 4JQ8A 4Y5HA 2XM8A 4TY1A 2ZDTA 4CCUA 3SG8A 2O65A 5F95A 3NNWA 2HIWA 2XNOA 1FOTA 1XHAA 4FKWA 5AP4A 4MNEA 3LFSA 4GT5A 2BCJA 3R9HA 3ZSHA 5KMNA 3FZSA 3UVRA 2WMVA 4FL3A 3N4TA 4BY9E 3KGAA 4DLJA 3OXTA 4K18A 4NWMA 4RPVA 4XH6A 4OTGA 3QRTA 3C1XA 4MD9E 3EZRA 4BYJA 3BI6A 3AOXA 2XVDA 4MF0A 3C50A 2NO3A 3QTZA 4AA5A 4EI4A 5J9LA 4P5QA 3CY2A 4NKAA 2WTIA 4QD6A 5AP0A 2WIHA 1GIHA 4C8BA 1ZRZA 3DKFA 5FEEA 3RPYA 4UMPA 3WYXA 3ZO4A 2VX0A 3EH9A 5IQHA 1KE9A 4ACMA 2Y4IB 4FT7A 4AAYA 5E8XA 3BV3A 3UQCA 4HVSA 4O91A 3A7FA 4FZFB 5CQWA 5FBNC 2X6EA 4C35A 3R83A 1G8SA 2UUEA 3VS5A 3PSDA 4QYHA 1H24A 3Q9YA 1RW8A 2YCRA 5AUYA 1OIRA 4V0GB 4GH2A 5EOBA 5CS6A 3L8XA 3ODYX 3RHKA 4CZYB 3ULZA 3KRRA 3VAPA 1XH5A 4Y72A 3Q4ZA 3NW7A 3MY0A 4NH1A 3UMWA 2IPXA 3TJDA 2R7IA 5KE0A 3NNXA 3O5AA 4FUYA 5HICA 4CYJA 4GUEA 3P0MA 1W83A 3I4BA 3P23A 4HGTA 3FHRA 5EM6A 5KZ0A 4BBMA 5A4LA 3UGCA 4M0ZA 5F9EA 3F5PA 2W1ZA 5BQ0A 4CG9A 4QT1A 1UV5A 4ALVA 3NFGB 2VV9A 1M2RA 3MH2A 3D7TA 2VWUA 4FV3A 4LV8A 3U55A 1WBVA 5HIEA 4IX3A 5IISA 3PVBA 3E7OA 4U8ZA 5CZHA 3VN9A 3NUAA 1FGKA 1TQMA 3HDMA 1XO2B 1YDRE 4DAWA 3D5UA 1UWJA 4EH9A 5HORA 4X3FC 2XJ2A 5D7AA 5HOAA 3ZSIA 1CM8A 3P5KA 1GZNA 4ANLA 4C3PA 1XKKA 4DA5A 4HW7A 4KIPA 3FXZA 4BTMA 3TNIA 5JGBA 5LVOA 3QQHA 4X2GA 1ZOHA 4AXEA 3VBQA 2XNMA 4OTRA 2WU6A 4OAVB 1PMEA 2WD1A 1ZLTA 3OCSA 3EFJA 4PPBA 5IA0A 2OIQA 2PSQA 2VU3A 2WTVA 3FMJA 3SRVB 3F88A 4FTRA 3B8RA 2X0OA 2VTHA 4G6OA 3QQFA 4TXCA 3ZBFA 4DITA 2QOHA 4E20A 4DC2A 5FTGA 4I93A 1P5EA 2UV2A 3OY3A 3QWKA 4RA4A 3UDBA 4JMQA 3LM5A 4JIAA 3SOAA 5CQUA 4QMNA 4FMQA 3NIEA 3ZRKA 2YCSA 4FYOA 4FNXA 2PTKA 3R7VA 4BWXA 4M0YA 4W8DA 3MS9A 3PE2A 5CEOA 2VTQA 5FG8A 4O7WA 4F78A 4IAFA 3FKNA 4QP3A 4F6WA 1TVOA 3CP9A 2QI8A 5B0XA 2OJ9A 3GENA 4FGRA 3O51A 4L8MA 4L68A 3QTSA 4R3CA 4EOMA 2RSVA 4C02A 5IH5A 3I81A 1TQIA 4YZ9A 4KNBA 3DAJA 1J1BA 4YSMA 2ONLC 5ICPA 4L44A 2R3HA 3W16A 2QD9A 2VTSA 4UBAA 4LL5A 5CAQA 1YDTE 1QPEA 3R8VA 3UMXA 3BKBA 4O4EA 4YZBA 5J8IA 4J96A 2PHKA 4F1TA 2B9IA 3SKCA 2YDIA 4RIWB 4F7LA 4O86A 2YAAA 1A48A 4KWPA 5JRSA 3OCBA 2WMXA 4MVFA 3O50A 2HWOA 5LMBA 2Y6MA 4FOCA 1ZMWA 1E1XA 3KULA 4HGSA 4O0SA 3V5TA 1H0WA 4CEGA 3R63A 3AKKA 1PKGA 1H28A 2RKUA 4BDHA 4BDIA 3LXLA 2IEWA 5DOSA 2JDSA 4FTCA 2QO2A 4S31A 4X6QC 1TKIA 3L1SA 1Y6BA 4FGBA 3O7LD 4IH8A 4AACA 2PUPA 1H1WA 1LP4A 2W1GA 2XCKA 1OIUA 3E8DA 3A7GA 4MD8E 4IMYA 4E4LA 4EBWA 1Z9XA 4IZYA 5EKNA 3F9NA 5BX0A 2PMLX 3U54A 1NVQA 4LV5A 3NYNA 2YIWA 3MH0A 5BUEA 5KCVA 3VHKA 4WG5A 3EWHA 2C6IA 4OR5A 4RVKA 3MB7A 4JJRA 2IW9A 3KC3A 3LW0A 1H4LA 5D1JA 3UYSA 4MAOA 2P3GX 4O82A 2V0DA 3BLHA 1G8AA 5FXSA 2AQXA 3M1SA 3NS9A 1XH6A 2JIUA 4RQKA 4BBFA 4FIJA 3DGKA 4WOVA 5HQ0A 4JG7A 3EKKA 3IKAA 3LAUA 5JEBA 2F7EE 3G5DA 2C6EA 2ITTA 2IZRA 4L52A 2WMUA 3MN3A 3UBDA 2BDJA 4AA0A 3OUNB 4NM5A 2GHMA 1IRKA 1DM2A 1RQQA 3AGLA 2QKRA 3ANQA 3CJFA 3U8WA 3VQUA 1W2FA 2C3KA 3QHRA 2VN9A 3D14A 3R9RA 3OROA 4D9UA 1JQHA 4CCBA 3FWQA 4FSMA 3OG7A 2GDOA 2V7AA 2AC5A 3OEZA 4GVAA 5C01A 4BKZA 2G9XA 3LM0A 3QUEA 4MUQA 5L2QA 1J3HA 3CD8A 3GBZA 4TWNA 2VTAA 3HMIA 5FP6A 5L4QA 4BJJB 4QYYA 5F4NA 4D2TA 5CT0A 3DQWA 3KY2A 4K1BA 4G17A 5JZNA 4A4OA 3NUXA 3OFMA 4BDFA 4DEIA 4DH3A 5CANA 5J9YA 2EB2A 4XV9A 2CLQA 3BGPA 3P79A 5LXMA 1CDKA 3QA8A 4ZSLA 2P4IA 4QQJA 2ZV2A 4DEDA 2O3PA 4RIOA 3QGYA 3FHIA 4J99A 4H05A 3O71A 4ANBA 1FMOE 3HEGA 2J0IA 2PVHA 2Q0NA 3PWDA 4IBMA 4JQ7A 1YI3A 3R2YA 2UW6A 4U0IA 4UYAA 3VUKA 1OL7A 4IVAA 4MXXA 4ENXA 4KSQA 3I7BA 4ZSJA 3RMFA 4DG2E 3FEGA 2OZOA 4D2VA 2C3LA 1ZMUA 4U79A 4QMZA 2CKQA 2R3GA 4NIFB 3HGKA 4AFJA 2G01A 2VO7A 3V8WA 2CGUA 4ACGA 3PRFA 3Q6UA 5K0XA 3P7AA 2E9UA 3ZFXA 3QCSA 2X8EA 3QRUA 4HVIA 4BWPA 3ZMMA 3BLQA 5HTBA 2H34A 3D15A 3PA4A 2JAVA 4PPCA 4C62A 4FEXA 3P86A 4AA4A 2B4SB 3PA5A 5K4IA 3PZEA 3W0SA 3ZLYA 4IACA 3W2RA 2C68A 4YLKA 1Q3DA 1QPCA 3DBCA 4NUSA 1OKWA 4AN9A 2XKFA 4FZ7A 3C4ZA 4AZSA 3F66A 3FKLA 3QXPA 3PY1A 2Y4IC 4M67A 3JY9A 4C37A 4TNBA 1H01A 4JX7A 4FKUA 4AGUA 3F61A 3EFLA 5JQ8A 2GFCA 5KMLA 2CNQA 5AR7A 3R9OA 3HV6A 3I0QA 3QQUA 4CTBA 2BIKB 3OS3A 4AFEA 1GOLA 3W0PA 3N9XA 4EHGA 3UP2A 2YM3A 2B9JA 3RI1A 3VUTA 4FC0A 3ORNA 3PDTA 4HVHA 4FV5A 3TNHA 3EIDA 4KKGA 4QPSA 3S2PA 4FZDB 3W32A 4AX8A 3PZHA 4S32A 3KMWA 4QMTA 4FV7A 4GJ2A 4GCJA 3LFEA 2UZOA 3AKLA 4LOPA 2IZUA 4ACHA 3C4EA 5L6OA 2YIQA 4AOIA 4F0FA 4DFXE 3EJ1A 4BGQA 4EYMA 3VW6A 2VWVA 2V62A 2X7OA 3OWPA 5HO6A 5CASA 5IU2A 1J7LA 5I9YA 3VS2A 1NVRA 3ZUVA 4MBLA 2DQ7X 3C9WA 2VNYA 1GNGA 2B9HA 4FRFA 1EH4A 3COHA 3DZQA 4YJTA 4BIDA 2CGXA 1F5QA 2EWAA 1WVYA 4OTIA 4BRXA 3QTWA 3ZH8A 3MESA 4LM5A 3DFAA 5EDPA 3FI2A 4C4EA 2RGPA 3H10A 3SW7A 4DH8A 5DFPA 3AG9A 3F3VA 2PZ5A 2Y8OA 4FUXA 3R7UA 4IJPA 5M09A 2YABA 1YXTA 3MVJA 4OLIA 4GU6A 2A27A 4GK2A 1P4OA 3U4WA 4P5ZA 2Z7QA 3FLSA 3ERKA 4DINA 2BRGA 4AT4A 2ITQA 3NUYA 3DLSA 3CQEA 4L3JA 3M11A 2X2MA 3DAEA 2ITUA 1GZ8A 5JMSA 4DFBA 2W4JA 4CMOA 3KCFA 2W0JA 1YKRA 1Y8YA 2CCIA 2YM7A 3A61A 3GCPA 4L46A 3RINA 1CKPA 3N51A 4TTHB 4AP7A 3ZYAA 4KD1A 3S3IA 4F0IA 3UP7A 4N0SA 3AC3A 4U7ZA 3UOJA 2W7XA 5DPVA 5I9ZA 3UDTA 4FTNA 4U44A 5FTQA 2OJFE 4QP4A 4G6NA 4ORKA 4WIHA 1YDSE 3TZ8A 3UQFA 4D5KA 3V51A 3PP0A 2IJMA 4AZFA 5B2LA 5E1SA 5CVFA 1FINA 2C1BA 3QALE 2WMTA 4QNYA 4N57A 2VTNA 4FV1A 4TWCA 4RVMA 4PDPA 4FV4A 4MEDA 2JKQA 3FYJX 4PUZA 2BRHA 2R3KA 2ACXA 4PF4A 4YC6A 4NYEA 2E9PA 1OGUA 3P4KA 4J97A 2BDFA 3MW1A 4RIYA 4F63A 5AR2A 3QQKA 5E8VA 1PXKA 4LOQA 3V8SA 5I9WA 5E9EA 5DN3A 3TV6A 4FTQA 3UO6A 1UNGA 4RJ3A 2OGVA 3L8SA 3NW6A 5DT4A 3RAHA 5JT2A 2CPKE 3NPCA 3Q4CA 4GYIA 2GU8A 3FL4A 5M07A 3LFFA 3COKA 4YTIA 2VO3A 5ANDA 3TCPA 4EK6A 4EJ7A 3ORIA 4HPUE 5ANKA 2CNVA 1YOMA 2YISA 3QKKA 3OD6X 2JKOA 5EH0A 5A46A 1FVTA 2VWBA 3QZGA 1SMHA 4WG3A 1J7UA 3KEXA 4KBCA 3RCJA 3Q52A 4O7RA 3BQRA 2RIOA 3PXQA 3UPZA 1CSNA 3TTIA 3KXGA 4FV8A 4FOBA 5IA5A 5FM2A 3LQ5A 4RC3A 3ZHPC 2W05A 2ITNA 4ZZOA 3RAWA 4UXQA 2A1AB 3IW6A 2IO6A 5HNIX 1T45A 3LIJA 4RJ8A 3FXXA 3LJ1A 3PY3A 4QMXA 4XS2A 5EHLA 2OXYA 4E7WA 1IA9A 4WBOA 5L2WA 3EL8A 3CGFA 4U5JA 2F4JA 2OZAA 3MBLA 3BHUA 3UPXA 1I44A 2OF4A 5M4IA 4BTKA 3ZRMA 2R4BA 3HUBA 5AUVA 3G33A 4OTQA 3MIAA 4FBXA 2QNJA 4L42A 2WFYA 4XOZA 2QVSE 2IZTA 4FKVA 5E90A 5T6KA 3WOWA 2W4OA 2I7QA 4L01A 3BHHA 3MI9A 5K5XA 1YOJA 5JGAA 2QOOA 4HYSA 3JPVA 4M15A 2YM6A 3MB6A 4FR4A 1SZMA 3A7IA 3EQBA 3D4QA 1DAWA 5DG5A 5M4FA 3FLZA 2VGOA 5HG9A 4L45A 2XBAA 4BDKA 4ERWA 2YM4A 5DHJA 4BI2A 1SVHA 5HG8A 3T9IA 4JL9A 3TIZA 2RF9A 2X0QA 3Q4UA 5AV1A 4O4BB 4QTEA 4FG8A 2BILB 3MPTA 2KULA 2CKEA 2XZSA 1UKHA 2PMOX 2C69A 4X3FB 3UIUA 5C26A 4CZTA 3KMMA 3PJ2A 4CMTA 1NT2A 2XIXA 3PE1A 2X9EA 1B6CB 3BBWA 3RAKA 3KK8A 1YVJA 5AP7A 2C1AA 5EW9A 4EEVA 3OT3A 1U54A 3FMMA 2WMQA 2YIYA 4RX8A 4CRSA 4JR3A 4PDOA 4EK8A 4BIEA 4AXDA 5CF4A 3DFCB 4PDSA 5DWRA 3HUCA 1OB3A 3I5ZA 3OOGA 2J6MA 3ETAA 4IB1A 5HBHA 4BCFA 5I9UA 4BDAA 4ACDA 4YR8A 4NTSA 3D5XA 3DPKA 3Q3BA 3TDWA 3RWPA 2BAQA 2VWWA 4O1PA 4XV1A 1KV1A 2WU7A 3NVMB 3BU3A 3BRBA 2OG8A 2GFSA 3KXNA 2W1FA 4KS7A 4QMPA 4YHTA 3PLAE 3UVPA 2WMWA 3T3VA 4JR7A 2R3FA 4C4GA 4I4EA 4KKHA 4ZZNA 4USEA 2HY0A 3D2KA 1WBPA 3R21A 2XKDA 2IW6A 2YM5A 3EN6A 4JBPA 3UG2A 5KKRC 1Y57A 4EH5A 4BCGA 4LGHA 4XCUA 4G3CA 4OTFA 4Y85A 3FZOA 1MP8A 1PYEA 5IEYA 5BVWA 3AXWA 3D83A 4EH8A 1F3MC 2CN8A 2JEDA 3OEFX 4EYJA 5FRIA 2J51A 5CNNA 4CQGA 4C4IA 3EL7A 2PZPA 3EQIA 3QTIA 4ZS0A 4UMQA 5C9CA 3ZXTA 2JKMA 3OWJA 1IEPA 4E5BA 2WQNA 3EB0A 4I23A 3HAVA 3E3PA 5HE3A 3ZZEA 4EKKA 4MCVA 3OWKA 3IDPA 2Z7SA 2WTKB 4A9SA 4E6CA 4DHFA 3OZ6A 3C5UA 4E8AA 3WZUA 1IAJA 5C4KA 2YZLA 4YBJA 5I4NA 4R5SA 3EQDA 4HJOA 4APPA 3L8PA 5LOHA 5IQDA 3ZUTA 4IWDA 1P14A 4QMSA 2GNHA 3R28A 5CU6A 5J87A 4F1MA 3TXOA 4A9RA 2H6DA 1R0PA 1R1WA 1YW2A 2R5TA 2W99B 2XS0A 4GKIA 5C8MA 4QQ5A 2YCQA 4CV8A 3SHEA 1OVEA 2BVAA 3DKCA 4EQMA 5FLFA 1Q4LA 4NSTA 4DDGA 4RX9A 4HCTA 1JOWB 3PJCA 4PL4A 3V01A 4M69B 4YTCA 3BYMA 4E4XA 5EDQA 3DZOA 3FLYA 3GU6A 3R0TA 5CEMA 4BDCA 4RZWA 4WNOA 2IN6A 4XBUA 3F3WA 1LPUA 2P0CA 4CLJA 4F99A 4I6LA 1UU8A 2EB3A 4IIRA 3DXNA 1CKJA 3HDNA 4BDGA 4Q5EA 4I6HA 4YURA 4AS0A 4Q9ZA 3O2MA 2RFNA 3DB8A 4GJ3A 3ZLWA 3QBNA 4WT6A 2XNBA 3MGYA 4GIHA 5LVNA 3MSSA 5IEVA 4CFMA 2CKPA 4QYEA 5AIRA 2QODA 4WSYA 3ZFYA 3OBJA 3QC9A 4LMUA 2PULA 5BVDA 5K9IA 2C0OA 2OO8X 3UQGA 2EXCX 4X6RA 4YHJA 4E1ZA 4F65A 4D1ZA 2YDKA 2C5YA 1CMKE 4WD5A 3S1HA 3BLAA 4IX4A 1U5RA 4HYIA 4WHZA 3I6WA 4XP3A 3TACA 3OW4A 4N6ZA 5A4EA 5DYJA 1H25A 4TYEA 4XBRA 4S2ZA 3BGZA 3F82A 3TZ9A 4IC7A 4BHNA 3FMLA 2BFXA 3E5AA 4B8MA 3HL7A 4XG3A 4E5AX 3WF5A 3ZDIA 3TIYA 4G3FA 2WMSA 1FMKA 3R02A 2ZFYA 2XK7A 3AC4A 3EHAA 3E8CA 2YWVA 4DN5A 4I4FA 4L67A 4HPTE 2BDWA 3LCKA 1O6YA 2AC3A 5CYIA 1YWVA 4C4FA 5J7HA 4HYUA 5CEPA 4R77A 3ZM9A 3EQCA 4AW2A 4O7LA 4LRMA 1JSUA 4QP8A 3Q4TA 4QP6A 1FQ1B 2XIKA 2GMXA 4G1WA 2QC6A 4DTKA 4A4XA 2G1TA 3FJQE 1UU9A 4JBQA 4MHAA 3U51A 4I21A 5AR4A 2B53A 3P08A 4ZMFA 1G5SA 4C3FA 5ETAA 3PG1A 4IHPA 4ITHA 4TNDA 5CY3A 3AT3A 1BLXA 3GU7A 4BDJA 3VBTA 3FMHA 4ALUA 5A3XA 3E8EA 1AGWA 1OGYA 4LGDA 2WNTA 4FSZA 2YLFA 3KF4A 3MFSA 1V0PA 3PXZA 3QCQA 4FIIA 4FV0A 4X2NA 1GY3A 4YNOA 5LCKA 3WF6A 2VGPA 3NVKI 1M2PA 4J7BA 2KTYA 3LXKA 4U43A 1KSWA 5DR9A 5TT7A 5AFVA 4IFGA 4C58A 2FH9A 3CIKA 4R78A 3RAIA 4FG7A 5AV4A 2OKRA 1MRYA 2YERA 2C6MA 4YZCA 4HCUA 3ROCA 4EOPA 3EOCA 4R7IA 2XKCA 4C3RA 4DFUA 3MH1A 2REIA 4ZMEA 5T3QA 4RIXA 2UZUE 3HP5A 4EZ7A 4I6FA 4RA5A 4ZSEA 1J1CA 1H27A 2DUVA 3W18A 5EQYA 3FDNA 3UYTA 3UG1A 2QLUA 4CG8A 3PXRA 2ERZE 3ULIA 4WKQA 2JDTA 1PXNA 4Z16A 2W96B 2WTDA 3UIMA 5K5NA 4JX3A 3IK3A 3ORPA 2BTSA 1IA8A 4DDIA 5GZAA 4ZXTA 3C13A 4PQNA 3ZEPA 4ZTHA 2GHGA 1R78A 1WBWA 5FQDC 5IKWA 3EQRA 5CSPA 4MXAA 4C61A 1G3NA 2NRUA 4YJRA 2W1CA 5D41A 5ETCA 3NWWA 3TUCA 3ZDUA 5B2KA 1XMLA 1JKTA 2R3OA 3FLQA 4HZSA 3W1FA 2WXVA 4ZS4A 4DGLC 1J91A 4LI5A 1F0QA 4U6RA 2PUUA 4GL9A 4C36A 2GNIA 4O83A 4KB8A 4C59A 4O6EA 3PVUA 4DFNA 5IUHA 5M4UA 4LV7A 2UZTA 2XK9A 4A9TA 2VTPA 2HZIA 1PKDA 4RT7A 2O64A 4FSTA 5KMIA 4YC8A 3RM6A 3BE2A 3ATSA 3BV2A 2WQBA 1V0OA 3ORXA 1XBAA 3BCEA 4XG2A 2PVRA 2NPQA 5HIDA 4BF2A 1OMWA 2CGWA 3MWUA 5GJDA 3H9OA 3PPZA 4MH7A 2IVUA 2UW8A 5FUTA 4A06A 5I9VA 4LUEA 3GC0A 2WTJA 3IQ7A 4FL1A 4LMNA 3ORKA 3DK7A 4HVDA 4FG9A 3NUUA 3AGMA 3P7CA 3R01A 2VX3A 2BFYA 2AYPA 2QCSA 3H0ZA 4O0TA 4WRGA 2HCKA 2YEXA 3HP2A 3D94A 4FSNA 3QCYA 5EW3A 3HV3A 2ZOQA 3KL8A 5AR8A 3TNQB 3VS3A 4W4XA 4BICA 4ZTSA 3AMYA 3CKXA 4RJ4A 5CSHA 4KIKA 1R3CA 4FEQA 4TYHA 2EXMA 2YZAA 4CNHA 1H07A 3D2IA 4LGGA 5L6WL 3NZ0A 3NLBA 1KV2A 2YDJA 5FTOA 3Q9WA 5FD2A 3FMEA 3R7IA 2CN5A 3QX2A 4FNYA 2QLQA 2BIYA 4AW0A 1V1KA 2WELA 5CLPA 4TT7A 4UWBA 3K2LA 1KOAA 5AA8A 5CU0A 3RZBA 4GKHA 1W8CA 2GTMA 4GIIA 3R8UA 2IG7A 3Q5ZA 4JXFA 2OIDA 4UV0A 3NNUA 4ANNA 5IA4A 3RPOA 1M14A 4HOKA 4XRLA 5LWMA 3OTUA 3OTVA 3WZKA 4G9RA 3MTFA 4DGNA 1PXMA 1JVPP 2XK4A 4J1RA 5A4CA 2WTCA 3GB2A 3HNGA 1AD5A 2J9MA 4BZDA 4Z7GA 3FBVA 3F7ZA 4C0TA 2XYUA 3BZ3A 2XK8A 4CFXA 5HD7A 3IS5A 1ZY5A 3QQLA 2ZMDA 4NTTA 3GU5A 3R9NA 4ZJIA 3ZO1A 2XJ1A 2B9FA 2QHNA 3EFWA 4E3CA 4D2PA 4DHIB 2X0GA 4FV9A 1ZYJA 4P2KA 3ANRA 1JNKA 5F94A 3ROYA