4JS8A

Crystal structure of ttk kinase domain with an inhibitor: 401348
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
279
structure length
259
Chain Sequence
NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Crystal structure of TTK kinase domain with an inhibitor: 401348
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 259
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4js8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4js8A01
4ORKA 4D0WA 5CENA 3VHEA 4BKYA 4DT9A 4F9YA 2RSVA 4PL5A 4J53A 3R7UA 1FVRA 3F5GA 4W4WA 4KIKB 3K54A 1WVWA 3OEZA 5AIRA 1UNLA 3F82A 3PE1A 5L8JA 5IA5A 3ZZWA 4RZWA 4MTAA 4ZK5A 3S0OA 3ACJA 2HZ4A 4ZY6A 1QL6A 4E8AA 2JIIA 3KC3A 4IIRA 4L42A 4AE6A 4BCKA 4NM3A 4BHNA 4PDOA 1JKLA 1OBGA 2WQBA 2C6KA 3C4XA 4XYFA 3ZBFA 2HOGA 4ITHA 5AAFA 4GYIA 4BCMA 4OTQA 3HDMA 3VBVA 3TNPC 3R71A 5CSHA 3QYZA 4Q9SA 1V1KA 3A8XA 4I5HA 5BNJA 2DYLA 1IASA 2OJIA 4FIIA 3LFSA 4BICA 3D83A 5H2UA 5AM7A 3UBDA 4BDJA 2IVUA 3EHAA 3LXLA 3ATSA 4DFBA 4W9XA 5K0KA 2FSTX 3HVCA 4C4EA 3NNUA 5C27A 5AR4A 3KA0A 1Y6BA 2PVKA 4FKWA 4O6EA 3ZLYA 4CZYB 4RVLA 1NY3A 5DYJA 1QPCA 3U8WA 5L6WL 3HDNA 4G3CA 5J9YA 4E7WA 4AZEA 3GI3A 4S33A 4CFXA 1UNGA 3SW7A 4ITIA 4C2VA 3LCKA 4G1WA 4D0XA 3MB7A 3FXXA 5I9UA 4D2TA 3HX4A 3W1FA 3ID6C 3H9OA 3O8TA 3UJGA 2W9ZB 3LXKA 4RIXA 4FEUA 1F0QA 2CPKE 4C3FA 4ZJJA 2VO0A 3FJQE 1I09A 2C6MA 4RJ7A 2ZV2A 4R77A 2EXCX 3WARA 4DINA 4ZMEA 4IVDA 2JAVA 3GC0A 4OGRA 3FI8A 2R4BA 4FV3A 4EOKA 4O7ZA 3FHIA 1Q3DA 4HNFA 4O0WA 3BV2A 1ZWSA 4G9RA 5CVHA 1OPKA 2HWPA 5ANKA 4BCNA 4J99A 4EZ3A 4M68A 4TT7A 2X4ZA 4WRGA 3K5UA 3R1QA 3HV3A 1IA9A 4BYIA 4DT8A 1QPDA 2OZOA 2PUPA 4BBMA 3JR1A 2CLXA 1M2PA 5HBJA 4JJRA 4C38A 4D2RA 2NPQA 1KE7A 1CM8A 3MWUA 5FEQA 4RQKA 4F1TA 3BKBA 1L8TA 4MX9A 3A7HA 4MXOA 4F64A 3VS1A 3UOKA 4Z7HA 4LRJA 4EH4A 4XG8A 2A27A 2BCJA 4E26A 4IM0A 3L9NA 1XR1A 4X0MA 4D4RA 5HNBA 4YZNA 4RIOA 4AA5A 3ULIA 4Z9LA 4R5YA 2BDJA 2CHLA 1GJOA 4DBNA 5HO6A 2B7AA 1ZOHA 3OWKA 3QWJA 3KXZA 4FT0A 4Q2AA 4WKQA 5EW9A 4ANNA 3A62A 3FZSA 3F2AA 4WSYA 1Q4LA 2EWAA 1GAGA 2V5QA 4QD6A 3ERKA 1LEZA 3ODYX 1JAMA 4FIHA 4HVHA 4U42A 4WNOA 3RTPA 3LJ2A 4GIHA 4C37A 3UZRA 2R9SA 3L9MA 3NYNA 5AP7A 4NJ3A 3P1AA 3BI6A 3SD0A 4BFMA 3R73A 4GT5A 5JN2A 4G2FA 3GVUA 5F1ZA 5E91A 4MQ1A 4XLIA 4DTKA 3AT3A 4G3GA 4NM5A 4ZS0A 5FP5A 1YQJA 4KS7A 4GT4A 3OS3A 4FZDB 4H1JA 5E8YA 3D9VA 5AP1A 5AUWA 4UX9A 4FTJA 3MH2A 3HEGA 5M09A 1VZOA 4A4XA 3UIBA 2HELA 4BCIA 3RM6A 4USFA 2C0IA 4UZDA 4XS2A 5J7HA 1FOTA 3GGFA 3S3IA 2IVSA 5AM6A 2QD9A 3VF9A 2QONA 5BMSA 5CSVA 2B0QA 2W5BA 4IX6A 3DLSA 4FEWA 2W4OA 3MW1A 3NS9A 4EONA 3NIZA 3W8QA 4CT1A 3WOWA 1R0EA 4TYHA 4JG7A 4IWQA 4BTJA 1AD5A 3GCVA 4F9WA 4M0YA 2XH5A 4GS6A 3AMBA 5KMOA 2ZM1A 4FKUA 4HCUA 4PTCA 2ZDUA 3PA4A 3OY3A 1M7NA 4N0SA 4CRSA 3DAKA 3PZHA 3W2CA 2R7IA 3EQBA 4UZHA 4ZAUA 4GFMA 3SG9A 2Y8OA 2VZ6A 4GEOA 4XG9A 2RIOA 5CAQA 3MV5A 2FSLX 4FTOA 1TQMA 1ZOGA 3OZ6A 4X6RA 3LFAA 4DC2A 1M52A 1PYXA 4E6AA 3WE4A 2JKKA 4PPBA 3OMVA 2YIQA 3CGOA 1YWRA 4U3YA 4RPVA 3MH1A 4CLIA 4DG2E 2CMWA 5JZJA 4KIKA 4O7WA 1VYZA 3TV7A 3EQRA 3ZEPA 3PFQA 3VBYA 4DE4A 4YTCA 2CCIA 2YIXA 2YN8A 4EWHA 4AN9A 4WUAA 3W2QA 4C33A 4R1YA 3WI6A 5AAEA 2HAKA 5AA8A 4WUNA 4MVFA 3O8PA 5TR6A 1FQ1B 5CVGA 2ZM4A 3E62A 4JXFA 1W8CA 4MKCA 3EFLA 1JQHA 1WAKA 3FKOA 4FV6A 2JFLA 4M3QA 4I0RA 4QRCA 2XM8A 1OBDA 1RDQE 4R78A 5T3QA 4W8DA 3M11A 2WAJA 4IC7A 1H1RA 5JRSA 3TNWA 2FB8A 3COHA 2C6EA 5AIKA 4DH1A 5ITAA 3QRTA 3UVQA 1U59A 3C4FA 4O7SA 5ETCA 4ALWA 3BV3A 3KULA 3RPSA 4KIOA 4HVSA 4FEXA 2XB7A 1YDRE 3C0HA 3LM0A 5DVRA 2CKPA 2GNLA 4CKRA 1G8SA 3WZEA 5LMBA 4GG7A 5IH6A 2KTYA 2PY3A 2R3OA 3DJ7A 2F2CB 2QU6A 2BAQA 3H30A 3PXFA 1BUHA 3LQ8A 4IWPA 4Y72A 3ZU7A 4WD5A 4AZWA 3W55A 2FH9A 2ITVA 5BYLA 5E8VA 4ZEGA 3ZHPC 2CJMA 3KCKA 4LQMA 2BZHB 3NNVA 1U46A 5E7RA 3N9XA 4ASDA 3MPTA 4N4SA 4WNKA 3UOLA 2ONLC 2VX3A 3ZDUA 4AACA 3E3PA 3VW6A 4IW0A 4MQ2A 2WMAA 5B2KA 2QLUA 3E63A 3LFCA 4XV2A 5IUIA 4RGJA 3VBXA 4GG5A 2B55A 2B54A 1OKVA 4XG7A 3LCSA 4R1VA 3TCPA 5I4NA 4CCBA 5IQGA 4UMPA 2BKKA 5HLPA 4AUAA 2C4GA 5IQFA 5J5SA 3CJGA 2BHHA 4U40A 3W16A 1YOLA 5LVMA 5CF5A 2VRXA 3DJ5A 2XNGA 5JGAA 3QTQA 3EIDA 2C6IA 3ZTXA 3OW4A 4NL0A 1SZMA 4JI9A 1DI8A 2YJRA 4QTCA 4MXZA 3ITZA 3R8UA 3UG2A 4BKJA 3TDWA 3PA5A 3NVKI 3O8UA 4GU6A 4RQVA 2VWVA 2ITNA 2W06A 5HG7A 4D2SA 2R3LA 3TTJA 2WGJA 3DDPA 5D12A 3R9HA 3V51A 4FUYA 3HAMA 4WSQA 1KE8A 2W1IA 3GBZA 1KWPA 3U9NA 4EUUA 2OXDA 4YZDA 1OIYA 4C36A 4QNAA 1E1XA 3HECA 4PDPA 1M17A 1J91A 5IA4A 2PZPA 3MA3A 4FGBA 4FSUA 1DAWA 2Y9QA 4MCVA 4XOYA 4JDJA 2XEZA 3AMAA 1W84A 1IG1A 4E20A 2A19B 5DR6A 1TQPA 2XM9A 4NUSA 5AR8A 3WBLA 1FMKA 3WF9A 5KMKA 4PNIA 3BIZA 1H1WA 3JVSA 1H01A 3R83A 2UVYA 3TNIA 3WYXA 1PXNA 5I0BA 5KBQA 1QCFA 4R7IA 4X3JA 3FPQA 2JKMA 3P78A 3QC9A 3ANRA 3QAME 5CLPA 5CNNA 4BWPA 3R1SA 3E88A 3HMPA 3QD0A 2AC3A 2PSQA 1X8BA 4ID7A 2QOCA 2J4ZA 4AZVA 2RFDA 1VR2A 1XH9A 3RHKA 3AQVA 4TNDA 3K5VA 4CV9A 5KMLA 3JPVA 4I6FA 2BAJA 4DH5A 4JX7A 4RX5A 3RK7A 3TIYA 4QMMA 2WMSA 1OUKA 5F9EA 3R8VA 3BHVA 1PYEA 3RINA 3TZMA 3HL7A 2C47A 3DK3A 1B38A 4CZTA 1S9JA 4XRJA 5LMKA 3QD2B 2HZIA 5BYZA 4ZSEA 4B8LA 3CD8A 1UU7A 3UIXA 4DCAA 4Y83A 5DI1A 4HVIA 1ZLTA 5AUZA 3DTWA 4M66A 2E9VA 3VQHA 4DFYA 4F7LA 2PUNA 4K2RA 1YXVA 1F5QA 2YERA 4EOOA 1J7UA 1UKHA 3IOKA 4QP9A 3VRYA 2UVXA 3C1XA 3H0ZA 4DH7A 3UNKA 4G16A 3TNQB 3W10A 4FTUA 5JQ8A 3K2LA 3HZTA 4K8AA 3AC4A 4TYEA 2PK9A 3PXQA 3LVPA 4DGNA 1ZRZA 3ZCLA 4GYGA 5HX8A 3ZUVA 4RIWB 3PJ3A 4FV9A 2C6OA 2ETRA 3HRCA 4NK9A 3UNZA 3CPCA 1Q8YA 3ORMA 3VJOA 3QTWA 3CKWA 4H36A 2UW9A 3IGGA 5T6KA 4XBRA 3ZXZA 2UW5A 1REKA 5CT7A 5HE0A 2BDWA 4MXXA 4R5SA 5F94A 3F5UA 3RPVA 4P90A 1U54B 3C50A 3HA6A 4O91A 3E7OA 2VO6A 4QMWA 5CEKA 2VGPA 4KS8A 4FOCA 5AV3A 2GQGA 1Z5MA 5BVFA 2R3QA 2WPAA 3GU5A 4AAAA 5BVWA 3UOJA 2J90A 3Q53A 4FSYA 4FTCA 4ZZNA 4CFFA 3MY1A 4RJ4A 4TPTA 1G3NA 3L9PA 2QC6A 2R3PA 2I7QA 4O7VA 5IQCA 4IZ5A 2BUJA 2UW3A 2BIYA 4HOKA 4JBVA 4EH9A 2VTIA 4FZAB 3G15A 3P86A 4BC6A 3P4KA 4FVQA 3BZ3A 5JQ5A 1WVYA 4AZFA 2Y4PA 5AUTA 3EJ1A 1MQBA 4PP9A 4OLIA 5HZNA 2IVTA 4P2KA 1ATPE 3R9RA 4LUDA 3LFEA 3W18A 5A54A 3DPKA 4BDEA 1PXLA 2J0JA 2PZRA 2YA9A 3FMMA 1CTPE 3UZTA 4FKRA 4NKSA 2F7EE 4NFNA 3T9IA 3UOHA 4OTGA 4CQGA 4BIEA 5DE2A 4O83A 4K77A 4U41A 3ORLA 3W33A 3SC1A 4E4MA 4GIIA 1OITA 4BYJA 2R3KA 4CYIA 4KIQA 5JK3A 4EOPA 3I60A 3PVWA 2J2IB 5CAVA 5IUHA 2GQSA 1JSTA 2QG5A 4IFGA 2X7FA 4P5QA 4EOSA 1ZYSA 2XNBA 3O23A 5GZ8A 3Q3BA 4EH5A 5KHWA 5IISA 3DKCA 5D10A 4FV1A 3CY3A 1LPUA 2OSCA 3KMUA 4FKVA 4EQMA 3F2RA 4O0TA 4DTBA 4XRLA 1TKIA 4IB1A 3OVVA 4RA4A 3DK7A 5AV0A 2ACXA 4QMNA 4YO4A 1PMVA 2CN5A 3UPZA 4IM2A 2VTTA 4O7TA 3I5ZA 2QO9A 5TE0A 2W0JA 4NFMA 3R7IA 5I9YA 3QTIA 4O84A 1LEWA 3QZIA 1OMWA 5IQHA 2OG8A 4NW6A 2GS7A 3VO3A 3LKMA 2UZVA 3QRJA 4NM7A 3SKCA 4UYNA 2A4LA 3H9FA 2ZAZA 5DNRA 4M13A 5E4HA 3QCXA 5DR2A 4UMRA 3FMJA 4MD7E 3GXLA 1ZMUA 3F3TA 5BVDA 4ZSLA 2GHMA 3RCDA 3W2RA 4YJRA 5J95A 1W0XC 3IW6A 4V01A 5AP5A 3KREA 4BI2A 1Y91A 4YC8A 5HLNA 5GZAA 3GC8A 5C8KA 4IZYA 2QOKA 1JWHA 5C9CA 4BCOA 3E8EA 4KBKA 5B2MA 1WCCA 3UQCA 2WMXA 2XP2A 3CLYA 1YXXA 2I0HA 3FY2A 5IH5A 3NW5A 2C30A 5AR3A 5A3XA 5HVKA 5IH4A 5FUTA 5A4LA 1O6KA 2H6DA 1FVTA 2YCSA 2EB2A 4GCJA 4YTIA 3SW4A 4DGGA 4GK3A 3OUNB 4KIPA 4FTNA 4QT1A 4ZJVA 1OKYA 4IAFA 2CCHA 2GHLA 3HA8A 5CQUA 5IEXA 4TXCA 2WEIA 5D11A 4CCUA 2O65A 2QOFA 4OBOA 4F4PA 4ARKA 2W05A 4CT2A 2WMVA 1JKKA 2BIKB 2WQNA 5EHLA 1RQQA 1BL6A 2QR7A 2V7AA 3OCTA 2UV2A 5CWZA 5TF9A 3TI1A 2RFNA 3HYHA 4UYAA 5K5NA 3MJ1A 3PE2A 3U9CA 3ULZA 5AR5A 5EKOA 4DBXA 1PXMA 3FL5A 5E8UA 5EOLA 4BHZA 3CQUA 3QL8A 3NUPA 3NYVA 1KE9A 4IDTA 4NJDA 3JS2A 4W8EA 1Q41A 3UVPA 5GNKA 4AOTA 3EKKA 4DEGA 1HCLA 3BE2A 1MRUA 1DM2A 3R2BA 3FLNC 1T45A 4FKSA 5ACKA 4FIGA 1Q5KA 5CF4A 3QCQA 3DCVA 2VNWA 1V0BA 4GK4A 3D5UA 4ACDA 3RBWA 3ATTA 2OBJA 4XG6A 3B2WA 2OK1A 5M55A 2BMCA 2VX1A 4O38A 4E73A 4CGAA 3MESA 2NO3A 5CVFA 5E8WA 3LCDA 4X3FB 3ZO1A 4FNZA 4UMUA 5JRQA 5IQIA 3R30A 4BDCA 1WZYA 4C62A 3QQFA 3R7EA 4EYJA 4XJ0A 4RX7A 5J5TA 3AGMA 4AFJA 2ONLA 2P55A 2EXMA 2CDZA 2VTJA 2WTCA 4KD1A 4RIWA 4M0ZA 4QMLA 4GKIA 4F99A 4D1XA 4JG6A 3EN6A 2ZYBA 5HLWA 2JLDA 4NM0A 3MI9A 1YOJA 5EOBA 4JLCA 3D94A 2HCKA 2WO6A 3F69A 5DT4A 4EUTA 1U54A 2VTOA 4M69B 3MBLA 3ZM4A 4QMXA 4H39A 4BCJA 3BHHA 1R0PA 5ANOA 3REPA 4EH7A 1H26A 2G2IA 4CD0A 3FZPA 3NUNA 5AP2A 5ETIA 4GK2A 4QYYA 3DK6A 4UXLA 3EQCA 3IW5A 2H8HA 4X21A 4I3ZA 5EDRA 2WD1A 5JFSA 1WBSA 3QZHA 1H08A 3IECA 2IJMA 1H1PA 4G5PA 4NT4A 2R3MA 1P2AA 3R01A 2VTRA 4O2PA 5CAUA 4MXCA 3NUAA 3WZKA 1KSWA 4M97A 2XK4A 3ZFMA 3CP9A 4QYHA 1ZAOA 2PL0A 2PVHA 4YLJA 3ALOA 3PTGA 4BTKA 2JD5A 3GEQA 2H96A 2XIXA 4TY1A 3TACA 4C35A 3L1SA 4KB8A 4ASXA 2X6EA 4HCTA 1DI9A 2IG7A 4PWNA 4F7SA 3EH9A 2Q0BA 3T8OA 3HMOA 3RKBA 2BR1A 1DAYA 3AG9A 3FI3A 5BYYA 3V01A 4CTBA 4O0XA 5HKMA 2YWPA 4BDHA 3OT3A 5GJDA 4YZMA 4IH8A 4YSMA 3BE9A 3FLQA 4FKLA 3C4EA 2PPQA 3PRIA 2A2AA 3WILA 4I1ZA 4P5ZA 2J5FA 4I92A 1TQIA 4XOZA 4FSTA 4RJ6A 3U54A 2PE2A 5KNJA 1YDSE 4I41A 4CZUA 4M84A 2P4IA 3O50A 1H0VA 2CGUA 3DLZA 3NUSA 4BDGA 1UA2A 1Y8GA 4X7QA 5IA3A 1OIQA 3PDTA 2OU7A 3Q2JA 4YO6A 2OI4X 3KK8A 1I44A 1FBNA 3ZLSA 4XCUA 2UZWE 3R8ZA 5AP6A 2CKOA 5EKNA 4RX8A 3DAJA 5L2WA 4BVUA 3L8SA 3QQLA 5EDQA 5AX9A 5DLSA 4BCPA 4I0TA 4QPAA 2VWUA 4FA2A 3QUEA 3SGCA 3FMEA 3LZBA 1YDTE 1MQ4A 1L3RE 3BLQA 3JYAA 2WHBA 3TUDA 2CNQA 1WVXA 4NKAA 2J9MA 3TKIA 4DAWA 2YDKA 4JS8A 4MXAA 4U43A 1YI3A 4MD9E 4F9BA 4X2FA 4D1ZA 2BZIB 3IDCA 4L3JA 2HY0A 2B9IA 4C8BA 3BYMA 2PMLX 3EQHA 3GCQA 3QTXA 3UIUA 3VRZA 2ITPA 5EYMA 1OL7A 4FTKA 2RG6A 4FSRA 4JR3A 2PMOX 4S31A 5L2QA 4X2NA 1Y6AA 2C1AA 4E4LA 4FE2A 3OXZA 2H34A 4KAOA 4WG4A 2W7XA 2X8EA 4G34A 3GU8A 4AA0A 1JBPE 4FSNA 5DG5A 3RP9A 3RM7A 2WTDA 3DAEA 1W7HA 4RSSA 5CXHA 5LVLA 3VUDA 3RGFA 2YCRA 3A4OX 2W96B 4RWKA 5LMAA 3GOPA 3FMLA 2VV9A 2OFVA 3F3VA 5CAPA 3RCJA 3KGAA 5KKRC 4YMJA 2BPMA 1NT2A 1GZOA 2RFSA 3BHTA 4FTAA 4BIBA 1MRYA 3W2PA 1JKSA 3T3VA 2PVYA 3LFQA 5E92A 3TZ9A 3KFAA 1SVHA 3Q4CA 3MDYA 5D7AA 4XV9A 4J1RA 5KMMA 5L8KA 1ZZ2A 4OUCA 4A7CA 3COMA 3PVGA 3AC2A 3UGCA 4E4NA 5LMKC 3D7TB 3E3BX 3NAXA 2R7BA 4YJOA 3BHUA 5F95A 4KKHA 3U6HA 3JY0A 4WIHA 2YACA 4JBOA 5FP6A 1AQ1A 3DBEA 5HG9A 3IQ7A 3BLHA 4RWLA 4AGCA 3O2MA 1GY3A 4S2ZA 4O27B 5AV1A 1P14A 2C5NA 1U4DA 3ZLWA 3DBQA 2I0EA 4YZCA 4QTDA 1GIIA 4FTMA 3R9OA 4MWIA 4U6RA 5M44A 2VNYA 5HVYA 4APCA 5DBXA 2XJ1A 4EYMA 2OH0E 5JZNA 2WOUA 4IBMA 3CTHA 3LPBA 5M07A 2YLEA 1OIRA 2AUHA 2X9EA 3D0EA 3DJ6A 4FSWA 4X3FA 3II5A 2GTNA 3DTCA 3PIYA 4JQ8A 5DGZA 2G15A 5TT7A 5DH3A 3TV4A 5BVNA 2VTQA 2IZSA 2QVSE 1ZOEA 3QWKA 5HBHA 4DA5A 1YWNA 4O0SA 2YZLA 3TDVA 4AW5A 2ZV8A 4I93A 3KXHA 3QQHA 3SX9A 2XK8A 4X6QC 4B99A 4F0IA 5DPVA 4YLKA 3RK5A 4DLIA 5M51A 3OEFX 2VWYA 3D2IA 4K11A 3R8LA 4CMOA 4O22A 5CZIA 4IAYA 3KEXA 5ANGA 2E9PA 4FZFB 3UO4A 1PF8A 2WFYA 4S32A 2XMYA 5IDPA 2PE0A 5L2SA 2ZVAA 3IGOA 4UALA 4I20A 5EQEA 2VTLA 3DKFA 5CU2A 3GQLA 1PKGA 4UN0C 4DFNA 4M69A 2WTWA 4ZXTA 2VWZA 3RALA 3WF6A 3EQGA 3PPJA 4CMTA 5KZIA 2PU8A 1W82A 1NA7A 2WZJA 4L67A 3DQXA 4GVJA 3EN5A 3EL7A 4BGGA 3AC1A 3N4VA 5HE2A 4RWJA 2EXEA 1NVRA 5KMJA 2UZEA 2JEDA 3UQGA 4F1MA 5KKRB 3CD3A 2BALA 3C9WA 3CGFA 4YBKA 4YPDA 4DTAA 2OIQA 5A4TA 4JIKA 4CKJA 5EDPA 3N4TA 3ZXTA 4MBJA 1MP8A 4XUFA 2YEXA 5HEZA 2Y4IC 3PA3A 4YNOA 2XIZA 4F09A 4L3LA 2XF0A 2XJ0A 2VWBA 1KV2A 4FBXA 4IQ6A 5CANA 3GC9A 3PXKA 3FI2A 3NGAA 3GC7A 3IW8A 4WO5A 2O63A 3ELJA 3GP0A 3EYGA 3PRFA 4IDVA 3ORTA 4U79A 4V05A 3V8TA 4AGWA 4DGLC 3FZTA 2GPHA 3SAYA 3OCSA 3BYVA 4FTTA 1V0PA 3BHYA 1XJDA 4RBLA 3D4QA 3HP5A 4TKSA 5CT0A 4O7RA 2OXXA 3GUBA 3PY1A 3DKOA 3KVXA 5KBRA 2PYWA 4RWIA 1YHSA 2Y6MA 2LAVA 3IONA 4DH8A 3MPMA 5K9IA 3WZUA 3MB6A 3BX5A 2XKCA 3DKGA 3HLLA 4ZTSA 4I21A 5IEVA 5EHYA 3O0GA 4G6OA 2B9HA 4FSZA 4MBIA 2YM7A 3VQUA 3P7BA 4EOIA 4Q5EA 3QQGA 4C02A 4EORA 3E8NA 4KABA 3TUBA 1BI8A 4UY9A 5JKGA 3BU5A 2FUMA 3H10A 3FL4A 1YHWA 3FQHA 3BRBA 4H58A 3G0EA 5HIEA 2UZBA 4XP3A 3PG1A 4UWBA 4HZRA 4QMYA 1OPJA 4ACGA 3FKNA 4D28A 2WMBA 2OJJA 2YIRA 5CEIA 4RIYB 5J9LA 4RVMA 2ITOA 3DZQA 4XG3A 3UYSA 3QZGA 2X6DA 4RJ3A 2OJ9A 3KMWA 3LFNA 4EI4A 3F2NA 5EH0A 4EKLA 4O1PA 5FRIA 3FDNA 1PMEA 3AXWA 5EI2A 2FGIA 3U6IA 2XRUA 4L43A 2G1TA 4YZBA 4QMZA 4ZLOA 3KRJA 5FTOA 2Z60A 3D14A 3WZJA 3Q52A 2LGCA 5IQBA 3EFWA 3GFEA 3OF0A 3Q6WA 1URCA 5LJJA 3FY0A 4C4JA 5A4CA 2J50A 3WE8A 4A06A 4HNIA 2CNUA 3MVJA 1G5SA 2R5TA 3D5VA 4BZNA 4HYSA 5H8GA 2IPXA 4QP4A 3ZBXA 3FMNA 3PXYA 5GZ9A 3SHEA 5E8SA 3S4QA 2BTSA 3R8PA 4L01A 4FKOA 2Z02A 4C4GA 3HKOA 3D7TA 4GFGA 3R21A 4HPTE 5BUJA 1XO2B 2BILB 2H9VA 3V8WA 2Y4IB 3IPHA 4OT5A 4AX8A 4EOJA 1UU9A 2NRUA 3Q4UA 5CAOA 3UNJA 5DOSA 4YU2A 3CTJA 2C5YA 2NNWB 5HIBA 5LXMA 2WOTA 3U87A 3CE3A 3NUYA 2J7TA 1JKTA 3LFFA 4YNEA 3CTQA 4D55A 3DNDA 4CG9A 3SDJA 5EM5A 2WQEA 3TIZA 4MHAA 4QPMA 3R7GA 3S1HA 4YJPA 2C3LA 4U9AA 3CBLA 3GENA 4RA5A 4ZSJA 2ESMA 2PTKA 3VUKA 1OPLA 3ZH8A 5K0XA 2QI8A 3TEIA 3TWJA 4GT3A 1JOWB 3OXTA 1XH8A 3H3CA 3OCBA 1TVOA 2V0DA 3C7QA 3P5KA 4FYOA 1FVVA 3CY2A 3CIKA 3PXRA 1J7IA 5HGIA 5C8MA 3LXPA 4AF3A 4F63A 2J51A 3SXSA 2C69A 5HIDA 1T46A 1SVGA 3QKLA 2J0KA 1PRYA 3VBTA 4UWCA 4BRXA 5C26A 5I9WA 3QF9A 1MRVA 1SM2A 4RMZA 4YTFA 2J0IA 2QHNA 3L8VA 2UW4A 4IANA 4AT4A 1BMKA 2QURA 3JUHA 4HVDA 4TYJA 4G5JA 4ZLYA 2YM6A 2FO0A 5CU4A 4J71A 5DEYA 2UZNA 1Y57A 3QD3A 2HW6A 3TXOA 3UMWA 3MH3A 5DEWA 5IPJA 3QX4A 2X7GA 4YLLA 4QMQA 2VTNA 3L8XA 5HNIX 5LARA 4IAZA 2B4SB 4JVGA 4TTHB 2ERKA 4FSQA 1GIHA 2GNFA 4MF0A 4TNBA 5BX0A 1CSNA 4I4EA 5IG1A 4AT3A 4D9TA 4IHPA 4HGLA 5CZHA 4BKZA 2W1EA 2GMXA 3GFWA 4IAIA 4CFNA 3FC2A 3FC1X 1RW8A 3PWYA 2F49A 3ORPA 2BKZA 3VUHA 4QPSA 3ORIA 4OTIA 1RJBA 2XEYA 4WRSA 4ZSAA 3UTOA 4ZTNA 4AW1A 3F5PA 2QNJA 2RG5A 4X2KA 2GNGA 3U6JA 4V04A 2ITUA 3UP2A 4HYIA 4YR8A 5T68A 4QP2A 4BI1A 2E2BA 2CNVA 3MH0A 1DS5A 3NWWA 3AD6A 3EN4A 4K33A 3SOCA 3WF7A 3HUBA 4QP7A 5CU6A 4C58A 2QG7A 1UU3A 2F7ZE 3ORZA 4F6SA 2P3GX 2E9OA 3LM5A 3E8DA 4ONAA 3OWJA 2R3HA 5LCJA 3PIXA 3DQWA 5EFQA 4D2WA 1OUYA 4F08A 2CN8A 4BDBA 3ZRKA 1OKWA 4BGHA 5DR9A 3DXPA 2XIRA 5LVPA 2W1ZA 1HCKA 3HMMA 3A99A 5CI6A 1XH6A 1ERKA 3GCUA 1LUFA 3QGYA 3RAHA 5IEYA 3FBVA 4FT7A 2I1MA 5E1SA 2BRBA 4UMQA 2P33A 4ACMA 3BBTB 3M42A 3ZYAA 4JBPA 4AGUA 5JFWA 1WFCA 2BRHA 3G9LX 2R64A 3PIZA 3MJ2A 3Q9WA 3GU4A 2VWIA 1V0OA 4I23A 5B0XA 4IJ9A 1QPJA 3QLGA 2UZLA 4DEBA 4E6CA 5IF1A 4FT5A 4GFOA 1KE6A 3MTFA 3FMDA 1O9UA 3DS6A 4RFYA 4PL4A 4QO9A 4GRBA 3LE6A 4BZOA 4OTWA 4AXAA 4F1OA 5LOHA 1YXTA 2XNOA 4PMTA 5AUUA 3TKUA 3BYUA 4RC2A 5BVEA 2X8IA 2XNNA 3UODA 3LMIA 2XRWA 2R3JA 3KXGA 2PVNA 4A4LA 3BEGA 4GKHA 2C6LA 2YCQA 3U4WA 3EFKA 4RIYA 4I6QA 4PX6A 3R2YA 3UDBA 1Q99A 3G6GA 3I1AA 3F7ZA 3K3IA 2A1AB 4RC4A 2WQOA 3OCGA 1H24A 5HHWA 3MFTA 4QP6A 2HY81 4OR5A 4MYGA 4DEDA 3RNIA 2BROA 5KX8A 1ZMWA 4U0IA 3NX8A 3VUGA 1A48A 4HYUA 3DBFA 4LL5A 2R3NA 2CKEA 4EBVA 4DLJA 2QOHA 3LOKA 3R02A 4IWDA 3ALNA 2R3RA 2UW0A 4UB7A 4Y73A 5FGKA 5M57A 2FYSA 3NRMA 4NWMA 1Z57A 4U81A 3LCOA 4J96A 4IX4A 3AT2A 3RNYA 4V0GB 4DG3E 5EM6A 3F3ZA 2XJ2A 3G9NA 1UWHA 4D1SA 3R7VA 5CF6A 4QNYA 4KUJA 4Z7GA 3KL8A 3Q5IA 4YHTA 3VULA 3N51A 4FKQA 2JKOA 3FQEA 2QOBA 4EJNA 4YGAA 4H05A 2WTIA 2YIWA 2UVZA 4BTMA 3TZ7A 5DA3A 3UMXA 3V5LA 2JDSA 3MIYA 4JG8A 4X3FC 5EYKA 5LCKA 5J9ZA 3V5QA 5JGBA 3C13A 3F66A 3S2PA 5HO7A 1GOLA 4R3CA 4A9RA 3KCFA 4II5A 2Y7JA 4M12A 5IUGA 3PY0A 5DN3A 3TZ8A 4G6NA 2QKRA 2XK6A 5K3YA 3V3VA 3WIKA 5BQ0A 2PVJA 4FG7A 2IW9A 5JH6A 3Q60A 3THBA 3GQIA 5IMEA 2O3PA 4PPAA 3FHRA 2WIHA 3UYTA 5ANEA 3A60A 3MTLA 5HOAA 4LUEA 2GTMA 4OTPA 5FBOA 1GZKA 2OZAB 3B2TA 3RPOA 3NUXA 3VS5A 4B0GA 3EQFA 1XQZA 1FGIA 2ZB1A 2EVAA 3KRWA 3FWQA 4F7JA 2RKUA 2J6MA 3R04A 3O7LB 5D9HA 2F7XE 2WMWA 4NSTA 3ZSIA 3VBWA 4NZWB 2HZ0A 5EYDA 3EZVA 2Z7SA 2YM4A 4DEIA 5CY3A 2QKWB 3R00A 5HESA 4ACHA 2QOLA 2RL5A 2WELA 4J95A 3R63A 2GU8A 2W4KA 3VHKA 4ENXA 4AN2A 4ANMA 5J87A 3F61A 3BQRA 2R3GA 1ZYDA 2W1DA 3LW0A 3HUCA 1XKKA 2X2MA 3H4JA 2BRMA 2YITA 3G90X 3OOMA 4IZAA 5CNOA 3OG7A 4FMQA 4BGQA 5F4NA 1SNUA 5L6OA 2VN9A 3AD5A 3FSFA 2J0LA 5AEPA 5KMIA 5J1WA 4HGSA 4FV2A 4C4HA 3DV3A 1XHAA 2A0CX 2HWOA 3FKLA 4LRMA 3W2OA 5LWNA 3SXRA 4H3QA 4G31A 4R3RA 3KK9A 4ZZMA 4FL2A 3VBQA 4CYJA 1RE8A 3NDMA 3E7VA 5AP0A 2YZAA 4ZJIA 3EN9A 4D4SA 2UW8A 3PP1A 4PQNA 3HAVA 3QTZA 4FKGA 3KY2A 2O2UA 2W1GA 2FSOX 1R3CA 2R0IA 3OFMA 2V62A 2IZRA 1M7QA 2YISA 2IN6A 3ZS5A 4AS0A 2W9FB 4QP3A 4Z16A 2XBAA 4KINA 3ENHA 3FE3A 1Q8ZA 3GU6A 3KQ7A 1E1VA 4WT6A 3MFRA 3VNTA 5HORA 1O6LA 2GNJA 4C0TA 1YOMA 3GU7A 1H27A 5DFPA 4QMTA 4E1ZA 4OTHA 5BMMA 5M4IA 4FKIA 3LCTA 1PY5A 5CQWA 1MUOA 4I5MA 3PP0A 4X2GA 4FYNA 4KNBA 4WA9A 2XIKA 4WHZA 3R9DA 2BFXA 4UXQA 1PMNA 5I5ZA 4CG8A 1M14A 5HCYA 3DDQA 5ETAA 5CASA 4FIEA 3TT0A 4NCTC 2VAGA 2YAAA 3AOXA 4FEQA 1XBAA 4PMMA 3SRVB 3O7LD 4BI0A 4E6QA 1GZNA 3NUUA 2BRGA 4MNFA 5I9XA 4O0VA 5BUEA 4Y5QA 3BBWA 2HXLA 4ANSA 3TV6A 2WNTA 3OTVA 3UP7A 2ITTA 3FMKA 4R7HA 4M7IA 2NP8A 2SRCA 3ZM9A 5LVNA 3EKNA 4LOOA 3TNHA 5FWKK 2IO6A 3P7CA 5H3QA 3FLWA 3PJ2A 4X2JA 4GJ2A 3VN9A 4LGDA 4F9CA 4NEUA 1OZ1A 2JIVA 3OOGA 2VGOA 5HE1A 3ZLXA 1CKPA 4D4VA 3DB8A 2Z7QA 2UW6A 4EZ7A 4ITJA 2YIYA 4FT9A 1NVQA 4GJ3A 3S95A 3HRBA 3PUPA 4I6BA 1URWA 1LR4A 4D9UA 2GS2A 4KSPA 3UVRA 4KA3A 4QYGA 4J97A 5B7VA 1NVSA 4FTIA 5AR2A 3U55A 4FTLA 2I40A 4L6QA 4M8TA 4B8MA 4YBJA 4DITA 2G2FA 3PLAE 2OIBA 3QHRA 4YHFA 5HBEA 3G5DA 4BDKA 4R3PA 4PRJA 1JSUA 3NSZA 2C5XA 1GIJA 2HIWA 3LMGA 4WBOA 3UG1A 4DEAA 2R3IA 5JMSA 5C4LA 3E8CA 3NIEA 3QHWA 3QTSA 4HYHA 3KB7A 4OTDA 3PSDA 3R1YA 4JBQA 2OJGA 4LOPA 3VS4A 3A7JA 3ORNA 5FEEA 4EHEA 4FK6A 5B2LA 3FZ1A 4FUXA 3ZFXA 4DN5A 3MPAA 2HENA 2IVVA 4DEHA 1JVPP 2IZUA 5ETFA 3SOAA 2PMNX 5GIPE 2WKMA 4TRLA 5I9ZA 3TUCA 2XVDA 3SLSA 4N6ZA 4B6LA 3AC8A 3KXNA 3QKKA 3RAKA 2PMIA 1WMKA 2RFEA 3OBGA 2VWXA 2UW7A 5CX9A 5D1JA 2XYUA 3QTUA 4JX3A 4M67A 4OTRA 3V5WA 5CALA 1NXKA 4F70A 4HW7A 1VYWA 2IW6A 1UU8A 4C57A 5IA2A 4DFUA 4I6HA 2RGPA 4I5CA 4CTCA 5HG5A 2JFMA 4BCQA 5AA9A 4IACA 1JNKA 4IE9A 3SA0A 1Z9XA 3COKA 3VWAA 1SYKA 2IW8A 2GCDA 4U44A 3ZRMA 2G01A 3MVLA 4FKTA 4WG3A 3C0GA 2JBPA 4FOBA 3V6RA 1P4OA 4YUQA 2AC5A 3COIA 4C59A 2JGZA 2NRYA 1R1WA 4Y8DA 4EBWA 1Q62A 4I24A 3V5PA 2C6TA 3OC1A 4C4IA 4GW8A 5D7VA 4W9WA 5A14A 2WQMA 4AWIA 3NYXA 2ETKA 1Q61A 3SQQA 4FIJA 3BPRA 3Q9ZA 3KF7A 5HCZA 3MFSA 2OZAA 2VWWA 4EOMA 1NW1A 5GHVA 4NH1A 4OAUC 5I3RA 3FZOA 2E9UA 2UUEA 5GJGA 2GHGA 3DFAA 4CXAA 2C6DA 3QZFA 4GU9A 4O0YA 4FV4A 3LLTA 4FSMA 5ICPA 2OF4A 2WB8A 4E5BA 4AOIA 1FGKA 4L00A 3MY0A 3KF4A 4O7NA 3I7CA 3NW6A 2CKQA 4PV0A 1OIUA 5ANIA 2OKRA 4OBQA 4FV0A 4L7FA 5G1XA 4A07A 1S9IA 3MIAA 3E87A 2F4JA 4GUEA 3ZZEA 4I5PA 4PTEA 1UWJA 4PPCA 3V04A 4ACCA 4B4LA 3DXQA 5IQEA 2QHMA 3IW4A 3R6XA 2C0TA 3R7YA 4DCEA 1ZY4A 1WBPA 3HV5A 5JGDA 3BU6A 3ZFYA 2QOOA 2QQ7A 4EK6A 2V22A 5CXZA 1XH5A 3UQFA 2XKDA 2Z2WA 4K1BA 4UMTA 1H4LA 1CKIA 4PDYA 4RFZA 5HCXA 2PVFA 3FI4A 5CYIA 4EH8A 4QMUA 2O0UA 4AT5A 2PE1A 3IG7A 4JQ7A 3M2WA 4QQJA 4U3ZA 3ZOSA 3EYHA 4W4XA 4DG0E 2BDFA 5CSPA 4UWYA 3KULB 4QMSA 1IR3A 4O21A 4UV0A 4Y46A 3LJ0A 3M1SA 5GJFA 3C4ZA 4AGDA 4G3FA 4XG4A 4USEA 1UV5A 3TTIA 2VX0A 4O7LA 3ORKA 4PNKA 3LQ3A 4ZS4A 3EB0A 5M08A 2DQ7X 4O1OA 4FNYA 5ANDA 3EQIA 1CMKE 4LGGA 3SVVA 4NYEA 4G9CA 4NIFB 3LHJA 4H1MA 4IM3A 2Z8CA 4FTQA 3BU3A 3I0OA 2XBJA 4DFXE 3SRVA 2VD5A 4I0SA 3N4UA 5HD4A 1BI7A 4RZVA 5EI6A 2C0OA 3EQDA 5KE0A 4BIDA 4HGTA 4Q9ZA 4KKEA 4Z3VA 4TN6A 2OH4A 3WZDA 5AADA 4L8MA 3NR9A 4FK3A 2WTKB 4GL9A 4S30A 3ZUTA 4F6WA 1PXOA 4K18A 4YC3A 3C5IA 3RHXA 4F6UA 5DIAA 3QX2A 5CI7A 3JVRA 3CQWA 3AT4A 4DFLA 3LQ5A 3P23A 4AA4A 1YXSA 2FA2A 3BELA 3CQEA 3PG3A 4LG4A 4BBEA 4EHZA 4QP8A 3WF5A 2CGXA 2W4JA 4JQEA 4MBLA 4EQCA 5JT2A 4Z55A 5L2IA 1IRKA 4C7TA 2IWIA 4YJTA 2ZJWA 2VU3A 4O96A 2Z7RA 3A8WA 2JIUA 3ENMA 2PZYA 4AG8A 5IQAA 4YC6A 3I81A 4RLKA 5DRBA 3NCZA 4IMYA 1ZARA 3ZRLA 5A4QA 1M2RA 3A7FA 2YFXA 4KRDA 5D41A 4BDFA 2W1FA 3TKHA 1JLUE 3OTUA 4TYGA 3P0MA 4AQCA 5HTIA 1WBTA 4UEUA 5FXSA 3W2SA 4EL9A 2DS1A 3P79A 3O96A 4DYMA 3OY1A 3BLRA 4UBAA 3WIGA 3ZUUA 4FF8A 4I22A 3MVHA 4E3CA 4DEEA 2Z7LA 1F3MC 2DWBA 2BZJA 2W5AA 4WNPA 3C5UA 4Y5HA 4O82A 3NMUF 3ZO4A 4BCGA 4ZY4A 1ND4A 4HPUE 3IS5A 2W1CA 1H28A 4GH2A 1WBOA 3BGQA 3V6SA 3RZBA 4EC8A 3VUTA 3EMGA 5HICA 1OVEA 2E9NA 1PXJA 2JBOA 3RZFA 3ZDIA 3KMMA 3QU0A 4QTEA 3V5TA 3NZ0A 3QCSA 1Q97A 2O64A 4FG8A 1ZXEA 5EM7A 1B6CB 4ZTRA 2JDTA 4J8NA 3G2FA 2XUUA 2X2KA 3HGKA 3E64A 3TL8A 4DFZE 2ITWA 2PHKA 3UO5A 4N6YA 1ZYLA 2OFUA 4KBCA 4E4XA 3I5NA 4BDAA 5IA0A 4LGHA 3ORXA 3Q96A 5E9EA 4XP2A 3HRFA 4N57A 2WMQA 3KRXA 3AGLA 3FPMA 1K3AA 3QQUA 4AP7A 4EH3A 4FVRA 4YJUA 4Q5HA 5DT0A 4FL3A 3ROYA 1ZYJA 1OL2A 5HX6A 1Q8TA 5I9VA 3L8PA 3PXZA 4NCTA 4BDIA 4F9AA 1YKRA 3RPRA 4TWPA 3IO7A 5KCVA 2PULA 3ZO3A 3PLSA 4L45A 4BCFA 4E93A 4FI1A 3LFDA 4W4YA 4FT3A 3RI1A 1KE5A 3I0QA 3RWPA 3QQKA 1UKIA 1KOBA 2GDOA 3PPZA 4J52A 3NPCA 4L7SA 5HNGA 2HK5A 5G6VA 1J7LA 5FTGA 2BAKA 2OWBA 4GUBA 2HYYA 3VUMA 1SNXA 4YTHA 1Q8WA 1YI6A 4XEYA 3F6XA 4ALVA 4D5HA 3S00A 4ZMFA 3WF8A 3DFCB 3D5WA 4XNEA 1OL5A 1XBCA 4LM5A 3W8LA 4L9IA 5H8EA 5FXRA 3HV7A 3L9LA 3DBCA 3QFVA 4J7BA 4FKPA 4LL0A 4WNMA 3RAIA 3RAWA 2JC6A 2VTPA 5CU3A 4YHJA 5M4UA 2OGVA 2BZKB 3Q2MA 4IC8A 2WEVA 4AFEA 4EOQA 5FEDA 3R28A 4CNHA 4PP7A 2XK7A 3LMHA 2W17A 4KRCA 5H8BA 3A7IA 5HI2A 2JDOA 4JDKA 4YJSA 5AP4A 4P4CA 1OL6A 3MYGA 3Q4TA 5L4QA 3ZC6A 1IAJA 4XBUA 2CGVA 4EEVA 3LLAA 3VAPA 1FMOE 5BPYA 5KO1A 4FNWA 3ZEWA 2YDJA 4G3EA 2Q83A 1H8FA 2ZMDA 2ZOQA 3FEGA 3TJCA 5GINE 2C3IB 4D4YA 1OI9A 2BHEA 3BYOA 4FV8A 4MF1A 4MWHA 1OM1A 4PL3A 3NVMB 5AV2A 2W1HA 4L68A 1OGUA 2YM8A 3V8SA 3QRUA 4D58A 3BWJA 1H25A 3MS9A 4BF2A 2WU6A 3P9JA 3I4BA 1APME 5E8XA 2YHVA 5EHOA 3QXOA 4QQCA 5EG3A 2ZV9A 1ZY5A 2PUIA 3ACKA 3Q4ZA 4NW5A 1YHVA 3LAUA 3KXMA 2PVRA 3SXFA 4JIAA 3Q04A 4HJOA 3ZO2A 2QCSA 3R1NA 4O81A 4TZRA 4BY9E 3FAAA 2YWVA 4FC0A 4I94A 3LXNA 4ZTQA 3MVMA 5AUXA 4IJPA 3U4UA 4A9TA 3UIMA 4ANQA 4R8QA 5DRDA 3PSCA 1ZMVA 4FG9A 3KN6A 3TN8A 1YXUA 3DB6A 4KKGA 5A6OA 2I6LA 2QODA 5FM3A 4FTRA 1ZZLA 4NIFA 3DY7A 2IZTA 2BVAA 3ETAA 3NNXA 4GV1A 5M56A 2OICA 5FXQA 1BL7A 2WMRA 3CEKA 4GSBA 4K9YA 4E6DA 2YLFA 5FDPA 5L3AA 3FQSA 1Y8YA 3KRLA 4M15A 4HCVA 4MXYA 4HZSA 4PUZA 2GSFA 3POOA 4U45A 3OXIA 4O7YA 3OP5A 3TG1A 3NEWA 2XKEA 3QC4A 4FIFA 3OUKA 5AJQA 4DGMA 2QLQA 4GVAA 2Y0AA 3D7ZA 2EB3A 5HD7A 2EU9A 4Y85A 3QUPA 4WOVA 2VTMA 4G17A 3VS3A 5EYCA 5JFVA 4RC3A 1VJYA 4AE9A 4TWCA 4G3DA 4FVPA 3NNWA 2OLCA 5TO8A 3D15A 3QLFA 5E8ZA 5IU2A 4K0YA 4BDDA 1GNGA 4HVGA 3EFJA 4L53A 2YDIA 1OB3A 5HTBA 3WYYA 3QXPA 3BYSA 5LWMA 4PTGA 4EH2A 2C68A 4KBAA 4EK5A 5HQ0A 1J3HA 4MK0A 3NCGA 2OJFE 4IVBA 3VC4A 4AU8A 2B53A 3IDBA 3F7WA 4M14A 4PMSA 2YM5A 4D2PA 4RVKA 3A7GA 4Y95A 2VTSA 5M4FA 2C3JA 5I3OA 4L46A 4ZTLA 4C4FA 5ANJA 5DT3A 2XS0A 3FLSA 1M2QA 3P7AA 5K5XA 3O51A 4ASEA 2X1NA 2C5OA 4FV7A 3Q32A 1STCE 4RRVA 2F57A 4PMPA 3BGZA 1B39A 1IA8A 1H1QA 3PVBA 4FNXA 3GB2A 4U7ZA 3ROCA 4BCHA 3KKVA 3DNEA 4ZTMA 3KU2A 5ACBC 4JT3A 1OL1A 5AUVA 5C8NA 4QYFA 2XZSA 2V7OA 4FX3A 2P0CA 4FGRA 4O0RA 2B9FA 2O5KA 4RX9A 4USDA 2V55A 3NYOA 4C3RA 2VO3A 2ITZA 3MY5A 3U51A 3DT1A 2XA4A 2JDRA 2WIPA 4L3PA 2BRNA 4MNEB 4R6VA 3VIDA 3R8MA 4CSVA 5JFXA 1PMUA 2B9JA 5TKDA 2ZDTA 4ANOA 3A2CA 4MH7A 3E93A 4BN1A 1H1SA 2ETMA 4L44A 4CFMA 3IDPA 4QP1A 2QU5A 3FSKA 2J0MB 1P5EA 5J79A 2YM3A 4IVAA 1PHKA 5CS6A 4EK4A 2QO7A 3V5JA 3H0YA 4CFUA 4WBBB 4BR3A 5IDNA 1OKZA 4ERWA 4IAKA 1R78A 5EI8A 3FZRA 4A4OA 1A9UA 5DHJA 2YABA 3F3WA 3RK9A 4K6ZA 1QMZA 5FBNC 1BX6A 4LYNA 3C4WA 3Q6UA 5AUYA 3F9NA 2VTAA 5LQFA 4LV8A 4JDHA 2VO7A 4IB0A 4RVTA 3PWDA 3DA6A 4P7EA 4EH6A 5KUPA 2B1PA 4EQUA 3TJDA 3PZEA 4IZ7A 5HVJA 3RVGA 1XBBA 4AW2A 4F7NA 5A4EA 4LRKA 4JOAA 2ZMCA 4TL0A 4LMUA 5BVKA 4YJNA 4EKKA 3HNGA 2X7OA 3CJFA 4KSQA 2J5EA 1K9AA 3I6UA 2JDVA 3R0TA 5DMZA 5FG8A 3LIJA 4JNWA 4EK8A 3IOPA 1Q8UA 3IK3A 4QMPA 2HXQA 3EQPA 3FMHA 3OW3A 2X8DA 5AWMA 4A9SA 5K4IA 4EK3A 3BWFA 2W99B 3A4PA 3PPKA 3FUPA 1XH7A 2F9GA 4XHKB 5CEOA 4ERKA 3R7OA 5IMXA 2FSMX 3EZRA 4L52A 4F65A 1H07A 5J7BA 1PKDA 5BUIA 2HZNA 2YAKA 5K4JA 4IX3A 4ASZA 3Q9XA 1PXPA 4C2WA 4O0UA 4ZLZA 3DXNA 4BWKA 4S34A 4TYIA 4EHVA 3BGPA 3E5AA 1IEPA 3T3UA 3VW8A 4DHFA 4E5AX 1Q3WA 4PY1A 4FKJA 4O6LA 4YZ9A 3I79A 4RT7A 5J8IA 4AOJA 4XMOA 3SG8A 2P2IA 3QCYA 1PXIA 5HG8A 4ZIMA 5C01A 3RWQA 3ZC5A 3ZSGA 2PUUA 2VTHA 3OWPA 2R3FA 3PVUA 4LV5A 4I4FA 2OXYA 3ZMMA 1BYGA 3G6HA 3FYJX 5IZFA 3G0FA 3QQJA 3NLBA 5GIOE 4C34A 3QA0A 2X2LA 3OT8A 3Q9YA 2WMTA 5E8TA 3UPXA 4C61A 4BBFA 3QBNA 4IX5A 2C3KA 2G2HA 4RLLA 4ZOGA 3GT8A 4QMVA 5FM2A 4BTFA 5CSXA 2QOQA 5CSWA 5FD2A 2PVMA 4OT6A 3OWLA 4AW0A 3FYKX 2QOIA 4ALUA 1GZ8A 3Q5ZA 3I7BA 5IA1A 5C4KA 3FXWA 1W83A 1U5QA 4H3BA 1KUTA 2ZV7A 3F3UA 4ZZOA 2PWLA 2XNEA 4JR7A 3TM0A 3C51A 3CPBA 3GNIB 3GOKA 3PJ1A 3HMIA 3IW7A 2I0VA 3LJ1A 2QR8A 4FICA 4QYEA 4U97A 2PZ5A 5JEBA 3LFBA 3VS7A 3QRIA 4BWXA 3HMNA 5JSMA 3MSSA 3BCEA 3QD4A 5AP3A 3DZOA 3EN7A 5AX3A 4CFVA 3IKAA 4EHGA 2CSNA 3C0IA 4QOXA 5TOZA 2JITA 3RJCA 2VUWA 3QTRA 5HTCA 5IQDA 2GS6A 2CGWA 5EQPA 4ZP5A 1R39A 2C5VA 3DGKA 4H3PA 4JAIA 4EWQA 2GQRA 5HO8A 2WTJA 3EL8A 5AAGA 4U5JA 3VVHA 3CR0A 3D5XA 5FDXA 5HU9A 4G6LA 5CEPA 1G8AA 4CV8A 4B7TA 4ANLA 5HU3A 3FV8A 3OROA 3C4CA 1KV1A 2OO8X 4QQTA 2I0YA 1JSVA 1PJKA 1WBWA 2UZDA 2X4FA 2XK3A 3AD4A 3O71A 5C1QB 4B9DA 4BZDA 4GMYA 2C1BA 4IWOA 2ZM3A 4TWOA 1P4FA 4W4VA 3VS2A 4LI5A 4U80A 1BKXA 4D5KA 4ZY5A 3ET7A 4XV1A 3CKXA 3FLZA 1FPUA 2Y6OA 4WG5A 2GNIA 4IADA 2UZOA 4IAAA 4IVCA 2DUVA 2GFCA 3DU8A 2XCHA 2P2HA 2X0GA 2WTVA 4AZSA 4IFCA 4U8ZA 3DOGA 1JPAA 3K3JA 4PDSA 3ANQA 4FV5A 4JRNA 5A6NA 3QKMA 4RJ5A 4J98A 2R2PA 3B8RA 2F2UA 4MAOA 2ERZE 2W5HA 3AC5A 3HP2A 3QGWA 5AMNA 4O2ZA 5J1VA 2XIYA 5H9BA 5F20A 3RPYA 5BVOA 4MNEA 1K2PA 4J8MA 4RIXB 3JY9A 4QQ5A 3UO6A 4ENYA 4A9YA 4ANBA 3HV4A 1WBVA 2YCFA 3VS0A 5C03A 4LOQA 5KZ0A 4AZTA 3RMFA 2WXVA 1EH4A 3PY3A 2FVDA 3W32A 4CFWA 5L2TA 5HE3A 4KWPA 3DBDA 5CU0A 2ITYA 3MFUA 4FR4A 5CEQA 4O86A 2AYPA 2BTRA 2XNMA 5L8LA 5A46A 5CTPA 3PYYA 3VUIA 4CEGA 4ZSGA 5IKWA 2X9FA 2EUFB 1J1CA 3E92A 5M06A 3QRKA 5FTQA 2UZTA 4EZ5A 1Q24A 3MGYA 1A06A 2O8YA 3KXXA 5CF8A 4AN3A 1OECA 2Q0NA 4IEBA 4YPSA 4FZ6A 4XX9A 1ZYCA 3T9TA 1SVEA 2XK9A 3POZA 3ZSHA 4YURA 3UZPA 2GNHA 2XKFA 2G9XA 3R22A 3NAYA 4BL1A 1FINA 5M4CA 4XP0A 5E90A 1O6YA 4DGOA 1LP4A 2X81A 1IAHA 1UNHA 1WBNA 5EM8A 1PXKA 4YSJA 1YW2A 3QYWA 2RF9A 4CLJA 5EQYA 4HGEA 2WU7A 2X39A 3G33A 4QMOA 3PJ8A 3QALE 1HOWA 3R9NA 4CVAA 4IB3A 3A61A 4CMUA 4APPA 3H9RA 2BFYA 4IXPA 3NW7A 4N70A 4FODA 3ZONA 2GFSA 5AV4A 3EOCA 1REJA 1W98A 4A9UA 4E5WA 4EJ7A 3QUDA 3G51A 4BB4A 3OD6X 3FLYA 4OAVB 2JKQA 1UVRA 4PF4A 2XYNA 3PJCA 5KMNA 1BLXA 3AC3A 3MA6A 5EW3A 3UC4A 1QPEA 2ITQA 4FEVA 5M53A 4CQEA 3F88A 3UC3A 2B52A 1VEBA 1YI4A 2JAMA 4V0GA 5L6PA 2CLQA 3CXWA 3VJNA 1YRPA 2OIDA 4FZ7A 1SMHA 4XG2A 5KHXA 3OHTA 5EW8A 4CRLA 3CCNA 1H0WA 1YWVA 2ZB0A 4IB5A 3VF8A 4NTTA 1XH4A 4YJVA 4D2VA 4DH3A 1E9HA 3EWHA 4YJQA 5FLFA 4YP8A 2REIA 4EC9A 4RG0A 3MN3A 4NTSA 1J1BA 5EK7A 3FXZA 3UE4A 4EOLA 3CSVA 3BQCA 2PZIA 3F5XA 3VS6A 1PW2A 3SV0A 2PVLA 3GCSA 3KN5A 3HV6A 4QTAA 4R7BA 1KOAA 3JXWA 4QTBA 5A9UA 4NU1A 1H00A 2OF2A 3KVWA 2UZUE 3QA8A 2XCKA 3P08A 2QO2A 4MD8E 2YJSA 3I6WA 4RFMA 4LMNA 1CDKA 4OBPA 2XNPA 3D2KA 4DF3A 2WTKC 5E1EA 5LVOA 3KRRA 5AFVA 4JRVA 4C3PA 2HW7A 5CEMA 2OW3A 4TYHB 1AGWA 4LFIA 1CKJA 4XV3A 4JDIA 4F0FA 4FL1A 4XLVA 5AR7A 1U5RA 1XWSA 3CS9A 1YVJA 2WMUA 3BEAA 4JAJA 2ITXA 4OTFA 4F0GA 5FQDC 4MEDA 4ZTHA 3CC6A 4CKIA 3AMYA 3OBJA 4TWNA 4TW9A 5DWRA 3B8QA 4JL9A 3PSBA 2R0UA 3GCPA 3ODZX 4RJ8A 4XH6A 2KULA 3O17A 4OW8A
chains in the Genus database with same CATH superfamily
4ORKA 4D0WA 5CENA 3VHEA 4BKYA 4DT9A 4F9YA 2RSVA 4PL5A 4J53A 3R7UA 1FVRA 3F5GA 4W4WA 4KIKB 3K54A 1WVWA 3OEZA 5AIRA 1UNLA 3F82A 3PE1A 5L8JA 5IA5A 3ZZWA 4RZWA 2X0PA 4MTAA 4ZK5A 3ACJA 3S0OA 2HZ4A 4ZY6A 1QL6A 4E8AA 2JIIA 3KC3A 4IIRA 4L42A 4AE6A 4BCKA 4NM3A 4BHNA 4PDOA 1JKLA 1OBGA 2WQBA 2C6KA 3C4XA 4XYFA 3ZBFA 2HOGA 4ITHA 5AAFA 4GYIA 4BCMA 4OTQA 3HDMA 3VBVA 3TNPC 3R71A 5CSHA 3QYZA 4Q9SA 1V1KA 3A8XA 4I5HA 5BNJA 2DYLA 1IASA 2OJIA 4FIIA 3LFSA 4BICA 3D83A 5H2UA 5AM7A 3UBDA 4BDJA 2IVUA 3EHAA 3LXLA 3ATSA 4DFBA 4W9XA 5K0KA 2FSTX 3HVCA 4C4EA 3NNUA 5C27A 5AR4A 3KA0A 1Y6BA 2PVKA 4FKWA 4O6EA 3ZLYA 4CZYB 4RVLA 1NY3A 5DYJA 1QPCA 3U8WA 5L6WL 3HDNA 4G3CA 5J9YA 4E7WA 4AZEA 3GI3A 4S33A 4CFXA 1UNGA 3SW7A 4ITIA 4C2VA 3LCKA 4G1WA 4D0XA 3MB7A 3FXXA 5I9UA 4D2TA 3HX4A 3W1FA 3ID6C 3H9OA 3O8TA 3UJGA 2XANA 2W9ZB 3LXKA 4RIXA 4FEUA 1F0QA 2CPKE 4C3FA 4ZJJA 2VO0A 3FJQE 1I09A 2C6MA 4RJ7A 2ZV2A 4R77A 2EXCX 3WARA 4DINA 4ZMEA 4IVDA 2JAVA 3GC0A 4OGRA 3FI8A 2R4BA 4FV3A 4EOKA 4O7ZA 3FHIA 1Q3DA 4HNFA 4O0WA 3BV2A 1ZWSA 4G9RA 5CVHA 1OPKA 2HWPA 5ANKA 4BCNA 4J99A 4EZ3A 4M68A 4TT7A 2X4ZA 4WRGA 3K5UA 3R1QA 3HV3A 1IA9A 4BYIA 4DT8A 1QPDA 2OZOA 2PUPA 4BBMA 3JR1A 2CLXA 1M2PA 5HBJA 4JJRA 4C38A 4D2RA 2NPQA 1KE7A 1CM8A 3MWUA 5FEQA 4RQKA 3BL9A 4F1TA 3BKBA 1L8TA 4MX9A 3A7HA 2AQXA 4MXOA 4F64A 3VS1A 3UOKA 4Z7HA 4LRJA 4EH4A 4XG8A 2A27A 2BCJA 4E26A 4IM0A 3L9NA 1XR1A 4X0MA 4D4RA 5HNBA 4YZNA 4RIOA 4AA5A 3ULIA 4Z9LA 4R5YA 2BDJA 2CHLA 1GJOA 4DBNA 5HO6A 2B7AA 1ZOHA 3OWKA 3QWJA 3KXZA 4FT0A 4Q2AA 4WKQA 5EW9A 4ANNA 3A62A 3FZSA 3F2AA 4WSYA 1Q4LA 2EWAA 1GAGA 2V5QA 4QD6A 3ERKA 1LEZA 3ODYX 1JAMA 4FIHA 4HVHA 4U42A 4WNOA 3RTPA 3LJ2A 4GIHA 4C37A 3UZRA 2R9SA 3L9MA 3NYNA 5AP7A 4NJ3A 3P1AA 3BI6A 3SD0A 4BFMA 3R73A 4GT5A 5JN2A 4G2FA 3GVUA 5F1ZA 5E91A 4MQ1A 4XLIA 4DTKA 3AT3A 4G3GA 4NM5A 4ZS0A 5FP5A 1YQJA 4KS7A 4GT4A 3OS3A 4FZDB 4H1JA 5E8YA 3D9VA 5AP1A 5AUWA 1TFFA 4UX9A 4FTJA 3MH2A 3HEGA 5M09A 1VZOA 4A4XA 3UIBA 2HELA 4BCIA 3RM6A 4USFA 2C0IA 4UZDA 4XS2A 5J7HA 1FOTA 3GGFA 3S3IA 2IVSA 5AM6A 2QD9A 3VF9A 2QONA 5BMSA 5CSVA 2B0QA 2W5BA 4IX6A 3DLSA 4FEWA 2W4OA 3MW1A 3NS9A 4EONA 3NIZA 3W8QA 4CT1A 3WOWA 1R0EA 4TYHA 4JG7A 4IWQA 4BTJA 1AD5A 3GCVA 4F9WA 4M0YA 2XH5A 4GS6A 3AMBA 5KMOA 2ZM1A 4FKUA 4HCUA 4PTCA 2ZDUA 3PA4A 3OY3A 1M7NA 4N0SA 4CRSA 3DAKA 3PZHA 3W2CA 2R7IA 3EQBA 4UZHA 4ZAUA 4GFMA 3SG9A 2Y8OA 2VZ6A 4GEOA 4XG9A 2RIOA 5CAQA 3MV5A 2FSLX 4FTOA 1TQMA 1ZOGA 3OZ6A 4X6RA 3LFAA 4DC2A 1M52A 1PYXA 4E6AA 3WE4A 2JKKA 4PPBA 3OMVA 2YIQA 3CGOA 1YWRA 4DHIB 3TMOA 4U3YA 4RPVA 3MH1A 4CLIA 4DG2E 2CMWA 5JZJA 4KIKA 4O7WA 1VYZA 3TV7A 3EQRA 3ZEPA 3PFQA 3VBYA 4DE4A 4YTCA 2CCIA 2YIXA 2YN8A 4EWHA 4AN9A 4WUAA 3W2QA 4C33A 4R1YA 3WI6A 5AAEA 2HAKA 5AA8A 4WUNA 4MVFA 3O8PA 5TR6A 1FQ1B 5CVGA 2ZM4A 3E62A 4JXFA 1W8CA 4MKCA 3EFLA 1JQHA 1WAKA 3FKOA 4FV6A 2JFLA 4M3QA 4I0RA 4QRCA 2XM8A 1OBDA 1RDQE 4R78A 4AXDA 5T3QA 4W8DA 3M11A 2WAJA 4IC7A 1H1RA 5JRSA 3TNWA 2FB8A 3COHA 2C6EA 5AIKA 4DH1A 5ITAA 3QRTA 3UVQA 1U59A 3C4FA 4O7SA 5ETCA 4ALWA 3BV3A 3KULA 3RPSA 4KIOA 4HVSA 4FEXA 2XB7A 3NFFB 1YDRE 3C0HA 3LM0A 5DVRA 2CKPA 2GNLA 4CKRA 1G8SA 3WZEA 5LMBA 4GG7A 5IH6A 2KTYA 2PY3A 2R3OA 3DJ7A 2F2CB 2QU6A 2BAQA 3H30A 3PXFA 1BUHA 3LQ8A 4IWPA 4Y72A 3ZU7A 4WD5A 4AZWA 3W55A 2FH9A 2ITVA 5BYLA 5E8VA 4ZEGA 3ZHPC 2CJMA 3KCKA 4LQMA 2BZHB 3NNVA 1U46A 5E7RA 3N9XA 4ASDA 3MPTA 4N4SA 4WNKA 3UOLA 2ONLC 2VX3A 3ZDUA 4AACA 3E3PA 3VW6A 4IW0A 4MQ2A 2WMAA 5B2KA 2QLUA 3E63A 3LFCA 4XV2A 5IUIA 4RGJA 3VBXA 4GG5A 2B55A 2B54A 1OKVA 4XG7A 3LCSA 4R1VA 3TCPA 5I4NA 4CCBA 5IQGA 4UMPA 2BKKA 5HLPA 4AUAA 2C4GA 5IQFA 5J5SA 3CJGA 2BHHA 4U40A 3W16A 1YOLA 5LVMA 5CF5A 2VRXA 3DJ5A 2XNGA 5JGAA 3QTQA 3EIDA 2C6IA 3ZTXA 3OW4A 4NL0A 1SZMA 4JI9A 1DI8A 2YJRA 4QTCA 4MXZA 3ITZA 3R8UA 3UG2A 4BKJA 3TDWA 3PA5A 3NVKI 3O8UA 4GU6A 4RQVA 2VWVA 2ITNA 2W06A 5HG7A 4D2SA 2R3LA 3TTJA 2WGJA 3DDPA 5D12A 3R9HA 3V51A 4FUYA 3HAMA 4WSQA 1KE8A 2W1IA 3GBZA 1KWPA 3U9NA 4EUUA 2OXDA 4YZDA 1OIYA 4C36A 4QNAA 1E1XA 3HECA 4PDPA 1M17A 1J91A 5IA4A 2PZPA 3MA3A 4FGBA 4FSUA 1DAWA 2Y9QA 4MCVA 4XOYA 4JDJA 2XEZA 3AMAA 1W84A 1IG1A 2IEWA 4E20A 2A19B 5DR6A 1TQPA 2XM9A 4NUSA 5AR8A 3WBLA 1FMKA 3WF9A 5KMKA 4PNIA 3BIZA 1H1WA 3JVSA 1H01A 3R83A 2UVYA 3TNIA 3WYXA 1PXNA 5I0BA 5KBQA 1QCFA 4R7IA 4X3JA 3FPQA 2JKMA 3P78A 3QC9A 3ANRA 3QAME 5CLPA 5CNNA 4BWPA 3R1SA 3E88A 3HMPA 3QD0A 2AC3A 2PSQA 1X8BA 4ID7A 2QOCA 2J4ZA 4AZVA 2RFDA 1VR2A 1XH9A 3RHKA 3AQVA 4TNDA 3K5VA 4CV9A 5KMLA 3JPVA 4I6FA 2BAJA 4DH5A 3O5AA 4JX7A 4RX5A 3RK7A 3TIYA 4QMMA 2WMSA 1OUKA 5F9EA 3R8VA 3BHVA 1PYEA 3RINA 3TZMA 3HL7A 2C47A 3DK3A 1B38A 4CZTA 1S9JA 4XRJA 5LMKA 3QD2B 2HZIA 5BYZA 4ZSEA 4B8LA 3CD8A 1UU7A 3UIXA 2NYAA 4DCAA 4Y83A 5DI1A 4HVIA 1ZLTA 5AUZA 3DTWA 4M66A 2E9VA 3VQHA 4DFYA 4F7LA 2PUNA 4K2RA 1YXVA 1F5QA 2YERA 4EOOA 1J7UA 4QDVA 1UKHA 3IOKA 4QP9A 3VRYA 2UVXA 3C1XA 3H0ZA 4DH7A 3UNKA 4G16A 3TNQB 3W10A 4FTUA 5JQ8A 3K2LA 3UDTA 3HZTA 4K8AA 3AC4A 4TYEA 2PK9A 3PXQA 3LVPA 4DGNA 1ZRZA 3ZCLA 4GYGA 5HX8A 3ZUVA 4RIWB 3PJ3A 4FV9A 2C6OA 2ETRA 3HRCA 4NK9A 3UNZA 3CPCA 1Q8YA 3ORMA 3VJOA 3QTWA 3CKWA 4H36A 2UW9A 3IGGA 5T6KA 4XBRA 3ZXZA 2UW5A 1REKA 5CT7A 5HE0A 2BDWA 4MXXA 4R5SA 5F94A 3F5UA 3RPVA 4P90A 1U54B 3C50A 3HA6A 4O91A 3E7OA 2VO6A 4QMWA 5CEKA 2VGPA 4KS8A 4FOCA 5AV3A 2GQGA 1Z5MA 5BVFA 2R3QA 2WPAA 3GU5A 4AAAA 5BVWA 3UOJA 2J90A 3Q53A 4FSYA 4FTCA 4ZZNA 4CFFA 3MY1A 4RJ4A 4TPTA 1G3NA 3L9PA 2QC6A 2R3PA 2I7QA 4O7VA 5IQCA 4IZ5A 2BUJA 2UW3A 2BIYA 4HOKA 4JBVA 4EH9A 2VTIA 4FZAB 3G15A 3P86A 4BC6A 3P4KA 4LDTA 4FVQA 3BZ3A 5JQ5A 1WVYA 4AZFA 2Y4PA 5AUTA 3EJ1A 1MQBA 4PP9A 4OLIA 5HZNA 2IVTA 4P2KA 1ATPE 3R9RA 4LUDA 3LFEA 3W18A 5A54A 3DPKA 4BDEA 1PXLA 2J0JA 2PZRA 2YA9A 3FMMA 1CTPE 3UZTA 4FKRA 4NKSA 2F7EE 4NFNA 3T9IA 3UOHA 4OTGA 4CQGA 4BIEA 5DE2A 4O83A 4K77A 4U41A 3ORLA 3W33A 3SC1A 4E4MA 4GIIA 3W0MA 1OITA 4BYJA 2R3KA 4CYIA 4KIQA 5JK3A 4EOPA 3I60A 3PVWA 2J2IB 5CAVA 5IUHA 2GQSA 1JSTA 2QG5A 4IFGA 2X7FA 4P5QA 4EOSA 1ZYSA 2XNBA 3O23A 5GZ8A 3Q3BA 4EH5A 5KHWA 3UDSA 5IISA 3DKCA 5D10A 4FV1A 3CY3A 1LPUA 2OSCA 3KMUA 4FKVA 4EQMA 3F2RA 4O0TA 4DTBA 4XRLA 1TKIA 4IB1A 3OVVA 4RA4A 3DK7A 5AV0A 2ACXA 4QMNA 4DHZA 4YO4A 1PMVA 2CN5A 3UPZA 4IM2A 2VTTA 4O7TA 3I5ZA 2QO9A 5TE0A 2W0JA 4NFMA 3R7IA 5I9YA 3QTIA 4O84A 1LEWA 3QZIA 1OMWA 5IQHA 2OG8A 4NW6A 2GS7A 3VO3A 3LKMA 2UZVA 3QRJA 4NM7A 3SKCA 4UYNA 2A4LA 3H9FA 2ZAZA 5DNRA 4M13A 5E4HA 3QCXA 5DR2A 4UMRA 3FMJA 4MD7E 3GXLA 1ZMUA 3F3TA 5BVDA 4ZSLA 2GHMA 3RCDA 3W2RA 4YJRA 5J95A 4DDIA 1W0XC 3IW6A 4V01A 5AP5A 3KREA 4BI2A 1Y91A 4YC8A 2XALA 5HLNA 5GZAA 3GC8A 5C8KA 4IZYA 2QOKA 1JWHA 5C9CA 4BCOA 3E8EA 4KBKA 5B2MA 1WCCA 3UQCA 2WMXA 2XP2A 3CLYA 1YXXA 2I0HA 3FY2A 5IH5A 3NW5A 2C30A 5AR3A 5A3XA 5HVKA 5IH4A 5FUTA 5A4LA 1O6KA 2H6DA 1FVTA 2YCSA 2EB2A 4GCJA 4YTIA 3SW4A 4DGGA 4GK3A 3OUNB 4KIPA 4FTNA 4QT1A 4ZJVA 1OKYA 4IAFA 2CCHA 2GHLA 3HA8A 5CQUA 5IEXA 4TXCA 2WEIA 5D11A 4CCUA 2O65A 2QOFA 4OBOA 4F4PA 4ARKA 2W05A 4CT2A 2WMVA 1JKKA 2BIKB 2WQNA 5EHLA 1RQQA 1BL6A 2QR7A 2V7AA 3OCTA 2UV2A 5CWZA 5TF9A 3TI1A 2RFNA 3HYHA 4UYAA 5K5NA 3MJ1A 3PE2A 3U9CA 3ULZA 5AR5A 5EKOA 4DBXA 1PXMA 3FL5A 5E8UA 5EOLA 4BHZA 3CQUA 3QL8A 3NUPA 3NYVA 1KE9A 4IDTA 4NJDA 3JS2A 3W0QA 4W8EA 1Q41A 3UVPA 5GNKA 4AOTA 3EKKA 4DEGA 1HCLA 3BE2A 1MRUA 3BLAA 1DM2A 3R2BA 3FLNC 1T45A 4FKSA 5ACKA 4FIGA 1Q5KA 5CF4A 3QCQA 3DCVA 2VNWA 1V0BA 4GK4A 3D5UA 4ACDA 3RBWA 3ATTA 2OBJA 4XG6A 3B2WA 2OK1A 5M55A 2BMCA 2VX1A 4O38A 4E73A 4CGAA 3MESA 2NO3A 5CVFA 5E8WA 3LCDA 4X3FB 3ZO1A 4FNZA 4UMUA 5JRQA 5IQIA 3R30A 4BDCA 1WZYA 4C62A 3QQFA 3R7EA 4FJVA 4EYJA 4XJ0A 4RX7A 5J5TA 3AGMA 4AFJA 2ONLA 2P55A 2EXMA 2CDZA 2VTJA 2WTCA 4KD1A 4RIWA 4M0ZA 4QMLA 4GKIA 4F99A 4D1XA 4JG6A 3EN6A 2ZYBA 5HLWA 2JLDA 4NM0A 3MI9A 1YOJA 5EOBA 4JLCA 3D94A 2HCKA 2WO6A 3F69A 5DT4A 4EUTA 1U54A 2VTOA 4M69B 4I6LA 3MBLA 3ZM4A 4QMXA 4H39A 4BCJA 3BHHA 1R0PA 5ANOA 3REPA 4EH7A 1H26A 2G2IA 4CD0A 3FZPA 3NUNA 5AP2A 5ETIA 4GK2A 4QYYA 3DK6A 4UXLA 3EQCA 3IW5A 2H8HA 4X21A 4I3ZA 5EDRA 2WD1A 5JFSA 1WBSA 3QZHA 1H08A 3IECA 2IJMA 1H1PA 4G5PA 4NT4A 2R3MA 1P2AA 3R01A 2VTRA 4O2PA 5CAUA 4MXCA 3NUAA 3WZKA 1KSWA 4M97A 2XK4A 3ZFMA 3CP9A 4QYHA 1ZAOA 2PL0A 2PVHA 4YLJA 3ALOA 3PTGA 4BTKA 2JD5A 3GEQA 2H96A 2XIXA 4TY1A 3TACA 4C35A 3L1SA 4KB8A 4ASXA 2X6EA 4HCTA 1DI9A 2IG7A 4PWNA 4F7SA 3EH9A 2Q0BA 3T8OA 3HMOA 3RKBA 2BR1A 1DAYA 3AG9A 3FI3A 5BYYA 3V01A 4CTBA 4O0XA 5HKMA 2YWPA 4BDHA 3OT3A 5GJDA 4YZMA 4IH8A 4YSMA 3BE9A 3FLQA 4FKLA 3C4EA 2PPQA 3PRIA 2A2AA 3WILA 4I1ZA 4P5ZA 4MUQA 2J5FA 4I92A 1TQIA 4XOZA 4FSTA 4RJ6A 3U54A 2PE2A 5KNJA 1YDSE 4I41A 4CZUA 4M84A 2P4IA 3O50A 1H0VA 2CGUA 3DLZA 3NUSA 4BDGA 1UA2A 1Y8GA 4X7QA 5IA3A 1OIQA 3PDTA 2OU7A 3Q2JA 4YO6A 2OI4X 3KK8A 1I44A 1FBNA 3ZLSA 4XCUA 2UZWE 3R8ZA 5AP6A 2CKOA 5EKNA 4RX8A 3DAJA 5L2WA 4BVUA 3L8SA 3QQLA 5EDQA 5AX9A 5DLSA 4BCPA 4I0TA 4QPAA 2VWUA 4FA2A 3QUEA 3SGCA 3FMEA 3LZBA 1YDTE 1MQ4A 1L3RE 4QDEA 3BLQA 3JYAA 2WHBA 3TUDA 2CNQA 1WVXA 4NKAA 2J9MA 3TKIA 4DAWA 2YDKA 4JS8A 4MXAA 4U43A 1YI3A 4MD9E 4F9BA 4X2FA 4D1ZA 2BZIB 3AKJA 3IDCA 4L3JA 2HY0A 2B9IA 4C8BA 3BYMA 2PMLX 3EQHA 3GCQA 3QTXA 3UIUA 3VRZA 2XAMA 4F78A 2ITPA 5EYMA 1OL7A 4FTKA 2RG6A 4FSRA 4JR3A 2PMOX 4S31A 5L2QA 4X2NA 1Y6AA 2C1AA 4E4LA 4FE2A 3OXZA 2H34A 4KAOA 4WG4A 2W7XA 2X8EA 4G34A 3GU8A 4AA0A 1JBPE 4FSNA 5DG5A 3RP9A 3RM7A 2WTDA 3DAEA 1W7HA 4RSSA 5CXHA 5LVLA 3VUDA 3RGFA 2YCRA 3A4OX 2W96B 4RWKA 5LMAA 3GOPA 3FMLA 2VV9A 2OFVA 3F3VA 5CAPA 3RCJA 3KGAA 5KKRC 4YMJA 2BPMA 1NT2A 1GZOA 2RFSA 3BHTA 4FTAA 4BIBA 1MRYA 3W2PA 1JKSA 3T3VA 2PVYA 3LFQA 5E92A 3TZ9A 3KFAA 1SVHA 3Q4CA 3MDYA 5D7AA 2AEGA 4XV9A 3AKKA 4J1RA 5KMMA 5L8KA 1ZZ2A 4OUCA 4A7CA 3COMA 3PVGA 3AC2A 3UGCA 4E4NA 5LMKC 3D7TB 3E3BX 3NAXA 2R7BA 4YJOA 3BHUA 5F95A 4KKHA 3U6HA 3JY0A 4WIHA 2YACA 4JBOA 5FP6A 4BJJB 1AQ1A 3DBEA 5HG9A 3IQ7A 3BLHA 4RWLA 4AGCA 3O2MA 1GY3A 4S2ZA 4O27B 5AV1A 1P14A 2C5NA 1U4DA 3ZLWA 3DBQA 2I0EA 4YZCA 4QTDA 1GIIA 4FTMA 3R9OA 4MWIA 4U6RA 5M44A 2VNYA 5HVYA 3PUFC 4APCA 5DBXA 2XJ1A 4EYMA 2OH0E 5JZNA 2WOUA 4IBMA 3CTHA 3LPBA 5M07A 2YLEA 1OIRA 2AUHA 2X9EA 3D0EA 3DJ6A 4FSWA 4X3FA 3II5A 2GTNA 3DTCA 3PIYA 4JQ8A 5DGZA 2G15A 5TT7A 5DH3A 3TV4A 5BVNA 2VTQA 2IZSA 2QVSE 1ZOEA 3QWKA 5HBHA 4DA5A 1YWNA 4O0SA 2YZLA 3TDVA 4AW5A 2ZV8A 4I93A 3KXHA 3QQHA 3SX9A 2XK8A 4X6QC 4B99A 4F0IA 5DPVA 4YLKA 3RK5A 4DLIA 5M51A 3OEFX 2VWYA 3D2IA 4K11A 3R8LA 4CMOA 4O22A 5CZIA 4IAYA 3KEXA 5ANGA 2E9PA 4FZFB 3UO4A 1PF8A 2WFYA 4S32A 2XMYA 5IDPA 2PE0A 5L2SA 2ZVAA 3IGOA 4UALA 4I20A 5EQEA 2VTLA 3DKFA 5CU2A 3GQLA 1PKGA 4UN0C 1G8KA 4DFNA 4M69A 2WTWA 4ZXTA 2VWZA 3RALA 3WF6A 3EQGA 3PPJA 4CMTA 4DDGA 5KZIA 3TYKA 2PU8A 1W82A 1NA7A 2WZJA 4L67A 3DQXA 4GVJA 3EN5A 3W0NA 3EL7A 4BGGA 3AC1A 3N4VA 5HE2A 4RWJA 2EXEA 1NVRA 5KMJA 1OGYA 3W0SA 2UZEA 2JEDA 3UQGA 4F1MA 5KKRB 3CD3A 2BALA 3C9WA 3CGFA 4YBKA 4YPDA 4DTAA 2OIQA 5A4TA 4JIKA 4CKJA 5EDPA 3N4TA 3ZXTA 4MBJA 1MP8A 2IF8A 2YEXA 4XUFA 5HEZA 2Y4IC 3PA3A 4YNOA 2XIZA 4F09A 4L3LA 2XF0A 2XJ0A 2VWBA 1KV2A 4FBXA 4IQ6A 5CANA 3GC9A 3PXKA 3FI2A 3NGAA 3GC7A 3IW8A 4WO5A 2O63A 3ELJA 3GP0A 3EYGA 3PRFA 4IDVA 3ORTA 4U79A 4V05A 3V8TA 4AGWA 4DGLC 3FZTA 2GPHA 3SAYA 3OCSA 3BYVA 4FTTA 1V0PA 3BHYA 1XJDA 4RBLA 3D4QA 3HP5A 4TKSA 5CT0A 4O7RA 2OXXA 3GUBA 3PY1A 3DKOA 3KVXA 5KBRA 2PYWA 4RWIA 1YHSA 2Y6MA 2LAVA 3PFYA 3IONA 4DH8A 3MPMA 5K9IA 3WZUA 3MB6A 3BX5A 2XKCA 3DKGA 3HLLA 4ZTSA 4I21A 5IEVA 5EHYA 3O0GA 4G6OA 2B9HA 4FSZA 4MBIA 2YM7A 3VQUA 3P7BA 4EOIA 4Q5EA 3QQGA 4C02A 4EORA 3E8NA 4KABA 3TUBA 1BI8A 4UY9A 5JKGA 3BU5A 2FUMA 3H10A 3FL4A 1YHWA 3FQHA 3BRBA 4H58A 3G0EA 5HIEA 2UZBA 4XP3A 3PG1A 4UWBA 4HZRA 4QMYA 1OPJA 4ACGA 3FKNA 4D28A 2WMBA 2OJJA 2YIRA 5CEIA 2A98A 4RIYB 5J9LA 4RVMA 2ITOA 3DZQA 4XG3A 3UYSA 3QZGA 2X6DA 4RJ3A 2OJ9A 3KMWA 3LFNA 4EI4A 3F2NA 5EH0A 4EKLA 4O1PA 5FRIA 3FDNA 1PMEA 3AXWA 5EI2A 2FGIA 3U6IA 2XRUA 4L43A 2G1TA 4YZBA 4QMZA 4ZLOA 3KRJA 5FTOA 2Z60A 3D14A 3WZJA 3Q52A 2LGCA 5IQBA 3EFWA 3GFEA 3OF0A 3Q6WA 1URCA 5LJJA 3FY0A 4C4JA 5A4CA 2J50A 3WE8A 4A06A 4HNIA 2CNUA 3MVJA 1G5SA 2R5TA 3D5VA 4BZNA 4HYSA 5H8GA 2IPXA 4QP4A 3ZBXA 3FMNA 3PXYA 5GZ9A 3SHEA 5E8SA 3S4QA 2BTSA 3R8PA 4L01A 4FKOA 2Z02A 4C4GA 3HKOA 3D7TA 4GFGA 3R21A 1XMMA 4HPTE 5BUJA 1XO2B 2BILB 2H9VA 4BJJA 3V8WA 2Y4IB 3IPHA 4OT5A 4AX8A 4EOJA 1UU9A 2NRUA 3Q4UA 5CAOA 3UNJA 5DOSA 4YU2A 3CTJA 2C5YA 2NNWB 5HIBA 5LXMA 2WOTA 3U87A 3CE3A 3NUYA 2J7TA 1JKTA 3LFFA 4O4CA 4YNEA 3CTQA 4D55A 3DNDA 4CG9A 3SDJA 5EM5A 2WQEA 3TIZA 4MHAA 4QPMA 3R7GA 3S1HA 4YJPA 2C3LA 4U9AA 3CBLA 3GENA 4RA5A 4ZSJA 2ESMA 2PTKA 3VUKA 1OPLA 3ZH8A 5K0XA 2QI8A 3TEIA 3TWJA 4GT3A 1JOWB 3OXTA 1XH8A 3H3CA 3OCBA 1TVOA 2V0DA 3C7QA 3P5KA 4FYOA 1FVVA 3CY2A 3CIKA 3PXRA 1J7IA 5HGIA 5C8MA 3LXPA 4AF3A 4F63A 2J51A 3SXSA 3W0RA 2C69A 5HIDA 1T46A 1SVGA 3QKLA 2J0KA 1PRYA 3VBTA 4UWCA 4BRXA 5C26A 5I9WA 3QF9A 1MRVA 1SM2A 4RMZA 4YTFA 2J0IA 2QHNA 3L8VA 2UW4A 4IANA 4AT4A 1BMKA 2QURA 3JUHA 4HVDA 4TYJA 4G5JA 4ZLYA 2YM6A 2FO0A 5CU4A 4J71A 5DEYA 2UZNA 1Y57A 3QD3A 2HW6A 3TXOA 3UMWA 3MH3A 5DEWA 5IPJA 3QX4A 2X7GA 4YLLA 4QMQA 2VTNA 3L8XA 5HNIX 5LARA 4IAZA 2B4SB 4JVGA 4TTHB 2ERKA 4FSQA 1GIHA 2GNFA 4MF0A 4TNBA 5BX0A 1CSNA 4I4EA 5IG1A 4AT3A 4D9TA 4IHPA 4HGLA 5CZHA 4BKZA 2W1EA 2GMXA 3GFWA 4IAIA 4CFNA 3FC2A 3FC1X 1RW8A 3PWYA 2F49A 3ORPA 2BKZA 3VUHA 4QPSA 3ORIA 4OTIA 1RJBA 2XEYA 4WRSA 4ZSAA 3UTOA 4ZTNA 4AW1A 3F5PA 2QNJA 2RG5A 4X2KA 2GNGA 3U6JA 4V04A 2ITUA 3UP2A 4HYIA 2XAOA 4YR8A 5T68A 4QP2A 4BI1A 2E2BA 2CNVA 3MH0A 1DS5A 3NWWA 3AD6A 3EN4A 4K33A 3SOCA 3WF7A 3HUBA 4QP7A 5CU6A 4C58A 2QG7A 1UU3A 2F7ZE 3ORZA 4F6SA 2P3GX 2E9OA 3LM5A 3E8DA 4ONAA 3OWJA 2R3HA 5LCJA 4DHJA 3PIXA 3DQWA 5EFQA 4D2WA 1OUYA 4F08A 4AXEA 2CN8A 4BDBA 3ZRKA 1OKWA 4BGHA 5DR9A 3DXPA 2XIRA 5LVPA 2W1ZA 1HCKA 3HMMA 3A99A 5CI6A 1XH6A 1ERKA 3GCUA 1LUFA 3QGYA 3RAHA 5IEYA 3FBVA 4FT7A 2I1MA 5E1SA 2BRBA 4UMQA 2P33A 4ACMA 3BBTB 3M42A 3ZYAA 4JBPA 4AGUA 5JFWA 1WFCA 2BRHA 3G9LX 2R64A 3PIZA 3MJ2A 3Q9WA 3GU4A 2VWIA