4JS8A

Crystal structure of ttk kinase domain with an inhibitor: 401348
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
279
structure length
259
Chain Sequence
NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Crystal structure of TTK kinase domain with an inhibitor: 401348
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 259
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4js8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4js8A01
3GC0A 3UIXA 3KCKA 5M4UA 1WBOA 2GTMA 2WB8A 4BI2A 5CASA 1DM2A 4CV9A 4IM2A 4RA5A 2WQBA 3ANRA 3GC9A 4IVBA 4L45A 3UG1A 1B6CB 3NUSA 2GDOA 3DK3A 3HZTA 3QTUA 1J7UA 2WGJA 5IZFA 2PVMA 4HPUE 5BX0A 5C8NA 4ZXTA 2W1IA 3E7VA 5HGIA 2W4OA 4J99A 5LMAA 5J1VA 2RSVA 3FE3A 5HEZA 4C4EA 4JS8A 4RGJA 3D9VA 3NEWA 3PA5A 4ERWA 2Y9QA 3CKWA 3FSFA 1J1BA 3MIAA 4RBLA 2W1CA 3IW6A 4D5KA 4NW5A 4CLJA 3FC2A 4AOTA 4IW0A 2X6DA 4UWBA 3WF7A 2WTCA 4XOZA 2HZ0A 3FHIA 4Y5QA 3TUBA 5JRQA 1CSNA 2QOHA 2W96B 2JC6A 3FSKA 1YXVA 2GCDA 4FODA 5A4LA 3KMWA 3TDWA 2C3LA 2E2BA 1XH9A 4TXCA 1WVXA 3MFUA 5CF4A 4FKQA 1J7IA 3VBWA 5AX3A 5M44A 5BVFA 2QD9A 3ENMA 3NIZA 1TQMA 3TG1A 1H24A 4M7IA 5E9EA 2ZDTA 4OAUC 4UMTA 3BPRA 4WG4A 3SXFA 4GMYA 3SHEA 3IPHA 2PTKA 3OD6X 4PDSA 4QYGA 5EHLA 2OXYA 3ZC6A 3WZUA 5D9HA 1FINA 4ZTNA 3NZ0A 5CF8A 4IZYA 5J79A 5GIPE 5ANGA 4TWNA 2ZM1A 2GQRA 4O7NA 3W8QA 3MY0A 4CZUA 4RJ5A 4GFMA 3EFWA 4M69B 4BBEA 2X2LA 4YZ9A 2XYUA 5HTIA 5EHOA 4I5CA 3OC1A 3F88A 3LJ1A 4P7EA 4XG2A 2GNJA 5DN3A 2BZIB 3RGFA 1U46A 1GZ8A 3QUPA 3BU3A 4P5ZA 4QP6A 2WQEA 1WBVA 3C4WA 3L9NA 5CY3A 5EK7A 1R3CA 4I23A 4QQ5A 3I7CA 2KTYA 4BWKA 5AAGA 2W06A 1HCLA 2J0MB 4CFVA 3EN9A 4TYIA 5HG5A 5B2LA 2W5BA 5CEOA 4OTRA 4AN3A 4IZ7A 4RVTA 3KY2A 4QP8A 2OLCA 4D4YA 3UVQA 4F4PA 3TZ7A 2BKZA 4ZSAA 2RL5A 3V5QA 2WEVA 3G5DA 4QPAA 3M1SA 3HMIA 4BN1A 3QQKA 4MXOA 2ZAZA 5BVOA 4RVKA 3T9TA 3KKVA 4G31A 3NAXA 4MBLA 4CRSA 4ZLZA 3TWJA 4H39A 4X6QC 1YOMA 3RP9A 3T8OA 3M11A 3P5KA 2OJIA 1KV1A 1IG1A 5CWZA 4YNEA 4A4OA 2ZB1A 4F9AA 3QWJA 1NA7A 3DA6A 3D83A 3MBLA 4XRJA 1XBBA 3A8XA 4TWOA 5J8IA 5D7VA 4OTHA 3A8WA 2JDSA 3MY1A 4W9WA 2OWBA 2PMIA 3MFRA 1MQBA 3NRMA 4J53A 3W2OA 4CLIA 2R5TA 4KIPA 3ORPA 3LFBA 5J9ZA 4EH2A 4P5QA 4EC9A 3IW7A 4USEA 2BKKA 3EB0A 2ITWA 3DK7A 2BTSA 4IB0A 4E8AA 5M53A 3C50A 2BCJA 4U80A 2X2KA 3PFQA 1TQPA 4TNDA 4C4JA 3SV0A 4XV1A 5EW8A 4TPTA 3DB8A 2XJ0A 4MAOA 2R3QA 4QD6A 3QTQA 5CAUA 2ONLA 2RIOA 3FPMA 2E9OA 4BDCA 2PZRA 3GU7A 4PP7A 3GNIB 5IMXA 4B8LA 2WMVA 4NIFA 3QYZA 2HZIA 2PMNX 4K33A 3W2PA 4O82A 3RWPA 5CVGA 1PMVA 4AGWA 4X2JA 2OFVA 5L4QA 4RFZA 4M69A 3UVPA 4YJSA 4O0YA 3IKAA 3CC6A 3UNZA 2PVLA 1JNKA 3O8UA 4S2ZA 4B9DA 4NEUA 2YM6A 3VS3A 2JEDA 4XHKB 3WYXA 3QX2A 1VZOA 1WZYA 3ORXA 4UY9A 4A9UA 2VD5A 1NVRA 2GHLA 3D5WA 4IJPA 4MD9E 4U45A 3VS5A 2R3IA 4J96A 3PXZA 4W4WA 5AA8A 5LMKA 2WAJA 2GS2A 3BRBA 4PTEA 2XNGA 1BL7A 3F61A 3MV5A 4XV3A 2BILB 5AA9A 3ACJA 5E8UA 4II5A 4ZTLA 3R9NA 4UN0C 4OBQA 2R3NA 4B4LA 4DA5A 3ORMA 4BZDA 3DOGA 3FXXA 4CQEA 2BDJA 3ZZWA 4OTGA 4HPTE 4AE6A 4RSSA 1P4OA 3FZ1A 4FVRA 4BKYA 2ESMA 3D94A 1P2AA 2PE2A 4FKPA 4QP2A 4RWIA 4TYEA 5E1EA 5L6WL 3C5IA 2YZAA 5LJJA 3IW5A 4HCVA 4IMYA 4ACDA 3AD4A 4KINA 3LFNA 3AC8A 3C0GA 1ZARA 2XKFA 2EVAA 2BHHA 2JDOA 2QO7A 3CE3A 2VTQA 4FEQA 4JBQA 4U97A 3WZDA 3ZXZA 4PPBA 4AUAA 1R1WA 3IECA 3S4QA 5H2UA 1BMKA 5EDRA 5KUPA 3B8RA 4L8MA 4BCPA 2WU7A 4GEOA 5CEQA 3CSVA 3QKKA 5KMNA 3I1AA 3EQHA 5IH6A 4D0WA 5HO6A 3V3VA 2X39A 4QMNA 5HD4A 3W55A 4UMUA 4BDJA 5JT2A 3COKA 5FG8A 2ITVA 3P79A 3AD6A 2DWBA 3KK8A 4X3FB 4FL1A 4GU9A 3EN6A 4L44A 1V1KA 2O0UA 1P4FA 1IASA 1XHAA 3ZDUA 3PDTA 3OXIA 5JEBA 1YI6A 4LL0A 4ZTQA 4GJ2A 3S95A 4I5PA 4K6ZA 4R5YA 3IONA 3MGYA 4IWQA 5T6KA 4ENXA 4BRXA 2JIIA 3GI3A 4X3JA 1OBGA 4NH1A 4TYJA 3D5VA 4YZBA 1F3MC 2YABA 1SNUA 5EH0A 4Y46A 3VS2A 4DEEA 3ORLA 5CF5A 5IUIA 1XH4A 4CCUA 3MVHA 1CKIA 1QPCA 4BDHA 1RE8A 1UU3A 5L2QA 3I5ZA 1OKZA 5AV3A 3RAHA 5BVNA 4I24A 1UWJA 4A4LA 4LOQA 2XS0A 5EYDA 4WNKA 1TVOA 1PY5A 3ZBFA 2C3IB 4FV4A 2B7AA 3S1HA 2WQMA 4K8AA 1O6KA 3NS9A 2UVXA 4OBOA 4JAJA 4RRVA 2AC5A 4D2RA 3D4QA 4AT5A 4OTPA 4ZIMA 2ONLC 4FIGA 4H36A 5JZNA 2FSMX 4FTQA 4AW5A 4YU2A 2AC3A 4ORKA 4JRNA 2PZPA 4UZHA 5KZIA 4O0TA 3DKFA 4FG8A 4JJRA 4S33A 3S0OA 4DLIA 1PRYA 4ZAUA 4FGBA 3G51A 5IA5A 4H05A 2GHGA 4K9YA 4DH3A 3KXZA 2HY0A 3Q04A 5G1XA 3EKKA 4IC8A 4GH2A 4ZTSA 4YJNA 4ENYA 5TF9A 4AGUA 3KN6A 4GK3A 4Q9SA 4C4HA 1YHWA 3C4CA 5BVKA 1YHVA 4XRLA 3P08A 3A7FA 3RPYA 4KD1A 3SOCA 3VF8A 3ZC5A 1JLUE 4ACCA 3PVGA 3Q4ZA 3R1QA 3S00A 4FGRA 5E4HA 3GUBA 4EWHA 4JBOA 2J51A 3VS0A 3OTVA 4MQ1A 3MH3A 4CRLA 3TEIA 2UZLA 2FH9A 2G01A 4BF2A 5HO8A 4Y72A 4RQVA 5A3XA 3VBTA 3OWJA 3TZ8A 5HOAA 4KA3A 1FGKA 4NWMA 3PIZA 4R1YA 4AZTA 3G2FA 2YFXA 4C7TA 3TUDA 5AR5A 5E8ZA 1LPUA 3P86A 5HZNA 2AYPA 4ID7A 1I09A 4FTCA 3PJ1A 2F4JA 3KXGA 5CAVA 2OU7A 4YHJA 3CP9A 3QALE 3EMGA 3PVBA 4X3FA 1YI4A 5DI1A 4X2GA 3HDMA 3ID6C 4KABA 2BRBA 2GFCA 1JWHA 2HY81 3ODYX 3ULIA 3WZEA 1Q8YA 2QURA 3VJNA 4ZS4A 2IG7A 1QPEA 1E9HA 5BVDA 1GY3A 1B39A 4IB5A 5IQEA 5IG1A 2UZUE 2ERZE 3EFKA 3RCJA 3BLRA 1OM1A 4EHVA 3PXFA 5ANOA 3AQVA 2R3RA 2UUEA 3VNTA 4RC3A 2F9GA 1PXKA 3LJ0A 3PXKA 4H3PA 3B2WA 3E7OA 4L9IA 3D5UA 4TWPA 4WIHA 1QCFA 2HZ4A 4ANNA 4JDIA 2ZB0A 3HEGA 3NW7A 5D12A 3QLFA 4NU1A 4XCUA 3ANQA 3QF9A 3R9HA 3RPSA 3UIMA 3OWKA 4OUCA 1OI9A 3V8WA 4G5JA 2BVAA 4MVFA 4L67A 2KULA 4U81A 3IDCA 5JFSA 1ZYCA 2OH4A 3O2MA 5BYYA 4EH4A 4DFYA 3DBDA 4R7HA 5HHWA 4I6FA 3NUAA 4U42A 1BI8A 3COIA 2UW8A 2YIRA 3G0FA 1OIQA 4X2KA 5HO7A 1O6YA 2QR7A 3DTWA 4O91A 2ITQA 4F9WA 1H1SA 5IQBA 4HGLA 2QU5A 4QMWA 2YM7A 5DNRA 5E8YA 3C4EA 4GK4A 4BFMA 2PK9A 3FLQA 4XBUA 5ETCA 4RJ4A 3FKOA 4DG0E 5KKRB 3MYGA 5DEYA 1Q99A 4ZSEA 4W4YA 3NAYA 3QGWA 4NCTA 1Y6BA 2W1DA 5L6OA 1K9AA 4K0YA 3LQ3A 4PMSA 4EK3A 2W1ZA 3F69A 2C5OA 3QKLA 2QG7A 3SXRA 1SVHA 5FGKA 4V0GA 4DCEA 3OFMA 2YLFA 3WARA 4QMTA 4FOBA 3ZONA 4S31A 3PPZA 3ETAA 5FXQA 3PIXA 3R30A 3WF8A 3IO7A 3LIJA 5DFPA 2QKWB 3N9XA 1OUKA 3R00A 5CEPA 5AUWA 4FSUA 3TJDA 3BYUA 3CPCA 4IAZA 4R3PA 4C35A 3TUCA 2PMOX 5DT4A 4DG2E 4M97A 3F7ZA 3N51A 4LRJA 4L3LA 4BICA 5I9UA 1T45A 3MI9A 4NZWB 4Q2AA 2J5EA 2JAMA 5IUGA 3QC4A 2YLEA 3K3IA 4MWIA 3I6WA 4MX9A 3EN4A 2ZM4A 3QXPA 4IXPA 5HTBA 4AN9A 3G90X 3CS9A 3QWKA 3HRFA 3EOCA 4BDEA 2J0IA 4X7QA 5I3RA 4JLCA 3E8CA 3QD3A 3W32A 3AC3A 4CMUA 4JBPA 4QP9A 5E1SA 5GJGA 2ITUA 3NNUA 4FT5A 4X3FC 4CFXA 5JKGA 4YSJA 3UGCA 4WNPA 3UMWA 5C27A 2XKDA 1Q8ZA 4P90A 5AP5A 3EFJA 4J52A 1NW1A 2O63A 2XJ2A 1KOBA 5E90A 4AU8A 4BL1A 3OWPA 1UVRA 3AD5A 4FKTA 3U9NA 4KBCA 4APPA 2YWVA 3LQ8A 4L46A 3BELA 3FLWA 4JQ8A 4AW2A 4FNYA 3QUEA 1PW2A 4PMMA 2OXDA 1YWVA 4Z3VA 4GIIA 3LE6A 2J50A 2VWYA 1UU7A 3PG1A 3BZ3A 2CKQA 5HICA 5LVPA 3CD8A 4HYSA 3V8SA 3IGOA 4I6HA 2C5YA 4D4VA 4R1VA 4FKIA 4U0IA 4DBNA 2WFYA 2UZOA 4YPDA 2PE0A 4ZLOA 2DS1A 5HG8A 4L3PA 4E7WA 3V6RA 3DXPA 2WTDA 3FWQA 4FV8A 3BHUA 5HCYA 2F2CB 2IZTA 3UODA 3NUYA 3E92A 3AT2A 3PZEA 4IX3A 4QMPA 5AMNA 2Q83A 4DGLC 3SW7A 4Q9ZA 1O6LA 4YO4A 3ZO2A 3Q4TA 5I9YA 2IW6A 4IWOA 3EQPA 3K5VA 3K5UA 3ZZEA 4FG7A 4QMMA 4BB4A 5FTQA 4X0MA 4FNZA 3EQBA 5L8KA 2BIKB 4EK6A 3QD4A 5L6PA 5LARA 2BTRA 3R8LA 3MJ2A 2EXEA 4RVMA 5TE0A 4X2FA 2LGCA 4NFMA 4CD0A 3ZDIA 4EI4A 3MTFA 3TJCA 4I0RA 2OZAB 3R8UA 5EYMA 2UW7A 3DT1A 3HL7A 2JDVA 1P5EA 4W8EA 3KMMA 4O7VA 4AQCA 3QKMA 3CKXA 3NNXA 3E87A 4FOCA 2R3PA 4QYHA 2XNOA 5AR7A 2ZM3A 4C59A 3ZO3A 2W1FA 5IEXA 4MTAA 4QMVA 3PJCA 4LUDA 4F65A 2GNIA 2RG5A 3AC1A 4M0ZA 3QBNA 1ATPE 4EYJA 2Y8OA 3UYTA 4BDBA 4K1BA 4GL9A 5AUXA 4WSQA 1JKSA 5KNJA 1M17A 3R1NA 3TNHA 3EQFA 1Q3DA 5BUJA 5IQAA 3O96A 3F3VA 4L52A 2X4ZA 3BYOA 3ZEPA 4FI1A 5FBNC 2UZEA 2OICA 4LM5A 4G17A 1GIHA 1AGWA 2FO0A 3FUPA 3G6HA 4ITIA 4CKIA 4F7NA 4BZNA 4FK6A 4IHPA 4GVAA 1Z57A 5KO1A 2W9FB 2O64A 2B55A 3W16A 1W83A 1MQ4A 2HZNA 2FSOX 1V0OA 3CPBA 2WTWA 2R4BA 2QU6A 3G15A 2C0OA 1H1WA 3QUDA 2O2UA 4FTAA 3VUIA 3WBLA 4XG9A 4CZYB 4MH7A 4QTDA 4O7SA 3LJ2A 4FSRA 5M51A 2XA4A 2Y0AA 5ANDA 4C62A 5CSHA 1JBPE 2VV9A 3A2CA 5M4IA 3KRRA 3DTCA 4RIXB 4MD7E 4LGGA 2IVTA 3QYWA 2RFEA 3BBTB 4Y85A 5AUYA 3V5PA 2X2MA 3D15A 4NW6A 3R7IA 2BUJA 2VX3A 4FUXA 5M09A 3NYXA 4EH8A 1GIIA 5CI6A 4XLIA 1UNHA 3VF9A 4NM7A 5IQIA 2JGZA 2VO0A 3AMAA 1WCCA 4L68A 4M12A 4C0TA 3CBLA 3W2QA 3QTXA 5KKRC 2J5FA 2W05A 1U5QA 4AS0A 4BVUA 2IVSA 1G5SA 4AZWA 2JDTA 4NM5A 3OVVA 2OZAA 1WBSA 3UOJA 1MUOA 4HGSA 3Q9XA 5DLSA 2B53A 1KSWA 3RNIA 2IZSA 4YLKA 4F1MA 4NYEA 2J90A 3FI8A 4JDKA 4XP2A 4O84A 3PJ2A 4AZFA 5EQPA 1GNGA 4OTWA 3SDJA 3NYVA 4FT7A 4FR4A 4UBAA 5A54A 3QZGA 1YQJA 5HTCA 4TL0A 4XUFA 4Y5HA 3NDMA 3WE4A 3V5TA 4IZ5A 2C30A 3QHRA 4B8MA 3FYJX 4JG8A 1PYXA 3KFAA 3WYYA 2WMSA 5AWMA 4EK5A 4QRCA 3UVRA 4DEIA 2J7TA 4OLIA 1MRUA 5CU2A 3TTIA 3O0GA 4QP4A 5AR4A 4IANA 4WT6A 3AC2A 5LWMA 4CCBA 2CCIA 4JT3A 5HG7A 3OXZA 1ERKA 4FT3A 5HESA 2VTPA 3R8MA 4C33A 3ZCLA 1M7QA 5CQUA 4HNIA 3HVCA 5H9BA 2VGOA 2B4SB 2HAKA 2OIDA 4WA9A 2OZOA 1X8BA 2C5NA 2I40A 2PE1A 4JNWA 5JFWA 1CTPE 3C0HA 3SAYA 1OIRA 5DIAA 5DA3A 4FZ6A 2VTLA 4C02A 4EJNA 5KMLA 4DGOA 3BWJA 4E6QA 1KUTA 4ANBA 4EHEA 1PXLA 4L43A 1U54A 4MNFA 4PRJA 3FMNA 3HMPA 4NKAA 2RF9A 5A6NA 4Y8DA 2EB2A 3EYHA 4CYJA 4EOOA 1WAKA 3FHRA 2CKEA 4AG8A 3Q5IA 1NXKA 2I1MA 4TNBA 4Z9LA 3VULA 4IBMA 3PVUA 4PMTA 4AE9A 5CALA 3DKCA 4FE2A 1OPJA 4FIJA 1WBWA 4YBJA 2YA9A 4RWJA 4MNEB 2QOBA 1Q4LA 2YIWA 2XVDA 3OCBA 2W1GA 5K0KA 4ZJIA 2QHNA 2B0QA 2XNBA 4KKEA 5DBXA 5HBEA 4CT2A 3FQEA 4NM3A 4QQCA 3AGMA 2Y7JA 3MDYA 3UO5A 3ORIA 4ITJA 4KAOA 3WZKA 2BIYA 3K54A 3F3TA 5IQDA 3NNWA 5EI6A 1ZAOA 2QOOA 1YXSA 2VTHA 2YISA 4FL3A 1G3NA 2QOLA 4WG3A 5HD7A 3GU4A 4AX8A 3GOKA 5C1QB 4YJPA 1R39A 2R3KA 4YGAA 4C3PA 5J9LA 3NUPA 5IH5A 4RVLA 2WMRA 1E1VA 3UQCA 1Z9XA 3E8NA 4DGMA 3E3PA 4X21A 4C61A 2J4ZA 4KKGA 5I3OA 2JFMA 4L53A 2PYWA 3UNJA 2PVFA 1OPLA 4FL2A 2B54A 3FLZA 5KX8A 4FSYA 5CQWA 5KMOA 4KWPA 3LFAA 4KRDA 4UV0A 5E8TA 2C6DA 2XM8A 4EOPA 3ORZA 3P4KA 4DLJA 2CDZA 4C36A 4AP7A 4K77A 4CTCA 1PKDA 4DGGA 5CZIA 3AMYA 4FEWA 1KV2A 3DDQA 4I6BA 4ZTHA 4F09A 3JR1A 5HCXA 4BYJA 3DU8A 4UYNA 1WVYA 3RPVA 3AGLA 5ACBC 3RBWA 5GHVA 2XB7A 2WOTA 3GEQA 4BDKA 4DH1A 4E1ZA 1ZOGA 3D7ZA 1F0QA 4LYNA 4G34A 5GIOE 4L01A 1DI8A 4FKUA 4UYAA 4BCMA 4FV0A 5LVNA 3DZQA 4K11A 1SVGA 4M3QA 4YHTA 3TV6A 2BMCA 4FSTA 5AUVA 3MH2A 3PRFA 4QMXA 1OL2A 3ZM9A 1H26A 3PJ8A 3DDPA 4GIHA 5K0XA 2NO3A 4BDDA 3BX5A 4OTFA 3TNIA 4MK0A 3UOLA 4O0SA 1H1PA 2C6IA 3R22A 4D58A 3NUXA 4UXQA 2XBAA 2C0IA 2YWPA 3QHWA 3SD0A 4AA4A 2PUUA 3CEKA 5CX9A 3LMHA 4FIEA 3M42A 4ZK5A 5FM3A 4IACA 4I22A 3MPAA 3O8PA 4MNEA 3IK3A 3PRIA 4RX5A 4ASEA 1JQHA 1P14A 3F2RA 4EOKA 5HIDA 3RK9A 2VX1A 4JR7A 3F5PA 4JG7A 1OITA 2JBOA 3PTGA 4BTJA 4G6OA 5KCVA 4M13A 3MESA 2BDWA 3W2RA 4ACHA 3QLGA 4FEXA 3MN3A 4CQGA 1DAWA 3FKNA 3P0MA 3UQFA 4M66A 4NK9A 3RHXA 2GNGA 2OJGA 4RWKA 2C6KA 2FA2A 2YAKA 4AXAA 5M07A 4RX7A 3QL8A 4YC6A 3FZRA 3R9OA 3FMLA 5DRDA 2ZYBA 3QAME 1OKVA 4GFOA 2Y4PA 1WBNA 3SW4A 2R3HA 4CG9A 3FI3A 4UMQA 2CPKE 2VNWA 5HIBA 3H0YA 2A19B 4IZAA 3RI1A 4ALUA 4EHGA 2UW9A 5AV1A 4U41A 2C6EA 4G3GA 3SVVA 2OGVA 1UA2A 5BMMA 2PVHA 2JIVA 4KIKB 3ZFMA 2NRYA 3N4UA 4D9TA 2BROA 2XNMA 3EN5A 1ZY4A 3NX8A 4N4SA 5L8JA 5EM6A 3MWUA 3KVXA 1YOLA 4PL4A 4ANOA 2XUUA 3I81A 1ZMVA 1BX6A 3FZTA 3QU0A 4I6QA 3MY5A 2B52A 4C58A 5ITAA 3C4FA 5IQGA 4XOYA 3Q9YA 4O38A 5T68A 2PHKA 1JAMA 3KEXA 4KIQA 4QNAA 2XK8A 3V6SA 3UP7A 4DFUA 4D2TA 3JUHA 2YHVA 1Z5MA 3NGAA 3ROCA 4EEVA 3TIZA 3V8TA 3RZFA 4P2KA 4O83A 2NPQA 4IVAA 1M52A 4DN5A 1R0EA 5FBOA 2QOIA 1IRKA 2PU8A 3H9RA 2VN9A 3ZRLA 4BGGA 3QGYA 5FRIA 1OKYA 5FUTA 4E73A 4Q5HA 3ZS5A 3CCNA 3PLSA 1KE7A 3QRKA 4N6YA 5CSPA 5LVMA 4ZMEA 2QONA 2FUMA 3OT8A 4YJTA 4BCQA 3AT3A 4Z7GA 3PSDA 2B9HA 4I94A 4MXXA 2CN8A 4FSWA 4IDTA 2O65A 2WZJA 4O27B 1PMUA 4BCOA 3DV3A 4HZRA 1JKKA 4O81A 3D0EA 3PA3A 4LGHA 4E5BA 5JZJA 1CKJA 3R28A 4O0XA 4G5PA 5I0BA 4O6EA 2WIPA 4D0XA 1HCKA 4I4EA 4NKSA 2OXXA 4W4VA 2XRWA 4IB1A 1Y8GA 2YJSA 2B9IA 2YCRA 2Z7QA 3Q32A 3R04A 3OS3A 4H3QA 4QTBA 3JYAA 5IEVA 3P7AA 4XP0A 2PZYA 3DZOA 3QQJA 5EHYA 5FTGA 4BZOA 3FYKX 3OOMA 4MXZA 2PL0A 3OG7A 4EH5A 2OF2A 3VRYA 1AD5A 2C3KA 3Q3BA 3A7IA 2C47A 4TRLA 5F1ZA 1OGUA 5LVLA 5AM6A 5D10A 3DS6A 3HRCA 4PDOA 2YIYA 4DEBA 3K2LA 5M4FA 3LZBA 2NNWB 4MF0A 3DK6A 3R71A 3RJCA 2VTJA 3RCDA 3UO4A 4BDFA 4JBVA 2QC6A 3VBYA 3FLNC 4AW0A 2CGUA 4UALA 3LCTA 5JRSA 4AW1A 1FQ1B 4FX3A 4KIKA 2IW9A 3ERKA 3U9CA 3HV7A 2EXCX 3BHYA 4G16A 5KE0A 3RZBA 2OI4X 2J2IB 2W5HA 4QPMA 4E6AA 2GNHA 1U4DA 4FKJA 3BHHA 4I93A 4TY1A 4YP8A 3JS2A 5DMZA 3DBCA 2BPMA 2ZV9A 5EKNA 3HMOA 3OT3A 1CKPA 2JITA 3D7TB 1BI7A 3MIYA 3BKBA 5FEEA 5C9CA 3D5XA 4HVIA 4D9UA 3R2YA 2BHEA 4AFEA 1NVQA 1GZNA 2HXLA 3DJ6A 1Q24A 4XNEA 4E4LA 2R3OA 5J5SA 5LXMA 3VBQA 5HNGA 1WBPA 2X4FA 2FGIA 1OL5A 3FLSA 3FZPA 3O17A 3CD3A 2OJJA 4IX6A 4EHZA 3KXXA 5AV0A 2WTKB 3KVWA 2IZRA 3HDNA 2YERA 2R3GA 5AV4A 4U3ZA 4O0VA 2XIYA 5D7AA 5IA0A 4IJ9A 3ORNA 4OTQA 3ROYA 4DFBA 3Q53A 1UV5A 4BIEA 3IG7A 3ODZX 4JG6A 4XV2A 2OG8A 4FV6A 5CANA 2PULA 2HOGA 3CLYA 3OW4A 5EDPA 5TT7A 2GPHA 1UNLA 2PY3A 4O0WA 4FV1A 4O0UA 4RT7A 3BU5A 1M7NA 4AF3A 3DBFA 4ZSGA 4GT4A 5HE0A 3GXLA 3ZUVA 4QTEA 3ULZA 5CAQA 4YSMA 2I7QA 5CVHA 4S30A 2E9PA 3VUDA 3CGFA 5FXSA 4FEVA 1GAGA 2I0HA 5TOZA 4FEUA 4FF8A 2HW6A 2IJMA 3DNEA 2G2IA 2X7OA 4I4FA 3L9PA 3MVMA 4J8MA 4TW9A 3RALA 4HW7A 5BYZA 4LOOA 4F7JA 1OKWA 4FV5A 4H1MA 5JK3A 4BCFA 3MPMA 3OROA 4F9CA 3IOPA 2PUPA 2GFSA 3ZRMA 5K5XA 3W18A 2CNQA 4RZWA 5DT0A 3EL7A 4IQ6A 3BWFA 5GZAA 2XCKA 3MPTA 4AACA 3AC4A 4XEYA 4B6LA 4DFLA 3RKBA 3NUNA 4DHFA 5AM7A 2Z02A 3DY7A 2YM4A 3FMKA 1ZYDA 4RJ3A 5A4QA 5HX8A 2XF0A 5CVFA 4OW8A 1UKIA 1Q8TA 3Q4UA 4EH6A 5JQ5A 4BDIA 4DTBA 2XJ1A 4DE4A 4O7TA 5AIRA 3IOKA 5GZ8A 3FL5A 2WNTA 3D7TA 4R6VA 5I9VA 3UP2A 2CGWA 3OWLA 2J0LA 4RA4A 2LAVA 4E3CA 4APCA 5DEWA 4BGQA 4U5JA 4DT8A 1H25A 4W8DA 5AP3A 2OO8X 4BBFA 1LEWA 2H8HA 4JL9A 1ZYSA 2G1TA 3BEAA 3PE2A 3NSZA 2BAQA 2GNLA 4MYGA 4R7IA 3FMDA 3BGQA 2VWVA 2CMWA 3SKCA 3NVKI 1JKTA 4O22A 4Z16A 4QP3A 4CFFA 1ZZ2A 3QRIA 4FICA 1REJA 2GNFA 3ALNA 3OY3A 5HLPA 3VVHA 3JVRA 3ZEWA 4RX9A 3ZOSA 2ETRA 5CTPA 5FEQA 1XBCA 4RG0A 3UZRA 2BZKB 4BWPA 4JDJA 4A7CA 2ZV8A 3BLQA 3FI4A 3FZSA 3SG9A 3GVUA 3KRJA 2BFXA 3E5AA 1VR2A 1V0PA 3KN5A 4I5MA 2VO7A 3L9MA 2QOCA 4FKOA 1W82A 2JKKA 4CT1A 3JPVA 4ZLYA 1M14A 4QMOA 4XV9A 4FTOA 3DBQA 3FAAA 4S34A 1HOWA 3HP2A 3QRJA 2IW8A 2YITA 1PKGA 3C4XA 2QG5A 3ORTA 4HNFA 3DPKA 3QQLA 4JX3A 2CNVA 3COHA 3U4UA 3GCSA 5DR6A 4PQNA 4FKWA 3BE2A 3W33A 2VGPA 4PL5A 3BIZA 4MEDA 4QOXA 2UW3A 4KBKA 5TO8A 2V55A 4UMPA 4BDGA 3RWQA 5B2MA 2XK3A 3RTPA 2QCSA 3CTJA 4GCJA 4MBJA 4ZZNA 4FV9A 4ASZA 4IAIA 4Z7HA 4LL5A 4XG6A 1K3AA 3FZOA 3CQEA 2CGXA 3C13A 4RWLA 4USDA 2PZIA 1XJDA 4GV1A 4PP9A 3T3VA 2VU3A 4C2VA 3R6XA 3LQ5A 4WBOA 3ZXTA 5M4CA 1W8CA 4V04A 5FDPA 1JOWB 2Z60A 4I3ZA 3I0QA 4RX8A 4TKSA 4BY9E 4CFMA 2VWWA 2YDIA 2IVVA 2OW3A 4B0GA 3CGOA 5EQEA 3EHAA 3FMHA 2CLQA 4IH8A 1YXTA 5K4IA 3PXQA 3I79A 4HYIA 3HAMA 4D55A 4LRMA 3Q2MA 4K2RA 1H0WA 4WG5A 2XEZA 3UC3A 4YTCA 5AP0A 4B7TA 3NCZA 4CEGA 1OIYA 1YOJA 5HLWA 1WVWA 2VTOA 4IFCA 4JX7A 5EKOA 4AZEA 3EQGA 4DEAA 1WBTA 3DXNA 3O71A 3PPJA 4BTMA 3BBWA 4FYNA 4BHNA 2QR8A 2YIXA 3HRBA 4ACGA 5KMKA 4IEBA 4YJRA 5M06A 3PJ3A 4RLLA 3R7OA 4C57A 4QQTA 3OCSA 2VO6A 3KRWA 5A46A 5AAFA 3FXWA 4CVAA 3NYOA 2YIQA 3ALOA 5J9YA 3OZ6A 2W1HA 2QI8A 4FSQA 3ZSHA 5HE1A 4FBXA 2J9MA 2R3MA 3EQIA 2CN5A 4DCAA 4KSQA 5CI7A 5FWKK 2PSQA 2R9SA 4ZY4A 2C6LA 1YDRE 3QA0A 3R7GA 5E8WA 2B9JA 3MFTA 2WTKC 2IVUA 3LMIA 1CDKA 4O7WA 5EM5A 5K3YA 5CU6A 2ITYA 3UG2A 2ZMDA 3HLLA 4EZ5A 1IA9A 3COMA 3G9NA 3N4VA 5AJQA 1ZRZA 5C8MA 2HIWA 2ITXA 4D1SA 4JQEA 2R3JA 3OUKA 3ZTXA 4CKRA 3NCGA 4YJVA 3VQUA 3ZSIA 3LFQA 4U40A 4E4NA 5HIEA 2F2UA 4AN2A 3KRLA 4DGNA 2O8YA 4C34A 4CFWA 2C1AA 5DG5A 3JVSA 4DYMA 2V7OA 1H00A 3QFVA 4GUEA 2R3FA 4O2PA 5CXHA 2X7GA 5AIKA 4YC8A 2CKOA 4R8QA 3UDBA 3FBVA 5T3QA 4PL3A 4CFNA 2J0KA 4OBPA 3EQRA 4OAVB 2EU9A 4DC2A 1AQ1A 5ETIA 3VHKA 4D1XA 4WHZA 4OGRA 1STCE 5E8XA 1YXXA 4JXFA 3QC9A 2C5XA 3HMMA 4NTTA 5F94A 5L2SA 2JKQA 3PXYA 4KB8A 1Y57A 3ZBXA 4IWPA 1SYKA 2UZNA 2RFSA 3ELJA 4R7BA 5HBJA 2AUHA 3MW1A 4GG7A 3CJGA 2YZLA 3DKGA 3F5XA 5A14A 3EFLA 5EG3A 4GT3A 4ANMA 1IAJA 4DITA 3KGAA 4YTIA 5IISA 3FLYA 4QTAA 2YCSA 3BI6A 3O7LD 1H0VA 2ZDUA 3L8VA 5CSXA 3OUNB 3HV6A 3C4ZA 2V22A 3IDBA 4FKSA 3U87A 4YMJA 4E5WA 2XZSA 2WEIA 2WELA 3DAKA 2VWUA 2YCFA 4RC4A 5JSMA 3UPZA 2XK4A 3HUBA 3OP5A 4LUEA 3ZM4A 3QQUA 4GK2A 5JFVA 1YXUA 3E8DA 2RG6A 5IQFA 1Q62A 2V62A 3KCFA 5HI2A 4HCUA 4CKJA 3E3BX 1KE9A 4EK4A 1IEPA 1GJOA 3VUMA 4H58A 3F2AA 3PWDA 2VTIA 4ZEGA 2P0CA 3TXOA 3BGPA 2BDFA 1MP8A 3R8VA 4F70A 3RK7A 3H30A 5KHWA 5EM8A 2CSNA 3LHJA 4YZMA 1ZXEA 3ZH8A 3PWYA 4FVPA 3EQDA 2E9UA 4D2PA 2QO9A 1U59A 3L9LA 2O5KA 3EL8A 3ZFYA 3GU5A 4FTRA 2XKCA 4PUZA 2HENA 1M2PA 4QP7A 1WFCA 4QT1A 3NNVA 4U6RA 5H8GA 3TNWA 3PYYA 3EKNA 4PPAA 4XG7A 2JD5A 5TKDA 5JQ8A 1ND4A 1OL6A 3DBEA 1OBDA 1RW8A 1H28A 2H9VA 3KXMA 4MXAA 5HNBA 1XH6A 4D4RA 4DFZE 5HVJA 2WO6A 4PWNA 4D28A 4FNXA 3SXSA 4CTBA 4U79A 4L7SA 5IPJA 2WMTA 2X0GA 4EC8A 2GQSA 4YJQA 3KXNA 4BCIA 3OW3A 4ARKA 3ET7A 4MQ2A 5E8SA 4IC7A 3ZO1A 4RJ6A 2C6MA 3V5WA 4ANLA 3SRVB 4GYGA 5CT0A 5I9ZA 1M2QA 3QTWA 5CNOA 3CY3A 2QHMA 5AV2A 3E63A 4EH9A 1SNXA 4EBWA 4FTKA 5ANJA 4XYFA 3WILA 1Q8WA 2R0IA 1VJYA 3FMJA 5KHXA 3TTJA 3FMEA 3KK9A 4J7BA 3DLZA 3GP0A 4L00A 5DR2A 3VBVA 4E20A 3GGFA 5EFQA 3UTOA 2QNJA 4J97A 3PZHA 3PPKA 3DQXA 5GJDA 2W7XA 4E5AX 2H34A 4IB3A 5CSWA 2JFLA 5IA4A 4FVQA 5A4EA 5FP6A 3R1YA 1BKXA 1Q61A 4AAAA 5BYLA 4F9YA 4F0IA 3L8SA 3FJQE 4HVDA 3T9IA 3NUUA 4CGAA 4FT9A 1ZOHA 4KIOA 4I20A 4F08A 2UW5A 3LFEA 3TKUA 2WQOA 3FXZA 3GQLA 4PX6A 4P4CA 2YN8A 3GC8A 4LI5A 2W4JA 4TYHB 4WRSA 4BIDA 4M15A 4FIFA 4BGHA 4ERKA 5KMJA 4EQMA 2WMAA 2PVKA 5GINE 5IF1A 3ZUUA 4H1JA 4RLKA 3VC4A 3RM7A 4F1OA 5J7BA 2PPQA 1ZLTA 2XM9A 5ICPA 1YWRA 4G6LA 1OVEA 1U5RA 5KZ0A 1W7HA 2XCHA 2XMYA 2ZOQA 2YJRA 3QRUA 3IW4A 4ZTRA 1Q3WA 4BC6A 4G9RA 3H3CA 4N0SA 4TTHB 4JVGA 4QO9A 2C3JA 5CT7A 5CU3A 2YM3A 4UZDA 3MS9A 3LM0A 5B0XA 5CEIA 4D1ZA 2WTVA 4GJ3A 5CLPA 1Q41A 1LP4A 1PXMA 2R7BA 2G9XA 3QZHA 3A7GA 4AA0A 1PXOA 4RIXA 2BZHB 3NYNA 3F3ZA 3MVLA 3VUHA 2B1PA 2UW4A 1SZMA 5ANKA 2H96A 4UX9A 2HELA 4JIAA 3ZUTA 4CSVA 4CG8A 3QZIA 5GZ9A 3VWAA 3VUKA 4GSBA 1FOTA 2R2PA 5KMIA 4DAWA 2HXQA 5LWNA 2X8DA 4WRGA 3TT0A 2BFYA 4YJUA 5IDPA 3DAEA 3TV7A 2XP2A 3GFWA 1JVPP 3KF7A 4U8ZA 4Y83A 5FDXA 3UC4A 4C38A 2EUFB 4C4IA 2BZJA 4U7ZA 4NJ3A 1EH4A 3PY1A 5AR3A 3R1SA 4F0GA 5LCJA 3SRVA 1CM8A 2OJFE 3VS7A 2IWIA 4ANQA 1YHSA 4D2SA 3F3UA 1FMOE 2QOFA 5DGZA 4E6CA 4FYOA 3RAWA 4V01A 3VS4A 4GS6A 1ZOEA 5HU9A 4GW8A 4E26A 1H01A 3A7HA 2FVDA 3ZLSA 5M56A 3KU2A 4LOPA 5H3QA 1H8FA 2VTNA 5IA1A 1FVTA 4DH5A 5HE2A 3O7LB 2UZDA 3Q2JA 1ZYJA 2XNNA 2XIXA 4IAAA 1FVRA 2REIA 3QTRA 4GFGA 4U3YA 4YNOA 4M68A 2CNUA 5FQDC 3ZO4A 3QCYA 4LGDA 4JIKA 2IPXA 4RIWB 3QQHA 3R7UA 4A4XA 3UOHA 4HOKA 3ZFXA 2Y4IB 1XQZA 4XBRA 4IIRA 4ZP5A 4A06A 3EZVA 4N6ZA 2ZMCA 4FV7A 4TYHA 2HWPA 4WUNA 3DLSA 4DINA 4IDVA 3T3UA 4I21A 5C03A 2WMBA 4HYHA 1M2RA 4BI1A 2ITTA 2VRXA 5HQ0A 2WPAA 5CU0A 2QVSE 5F95A 3UOKA 3R9RA 5J87A 3OBGA 1OB3A 3BGZA 4NIFB 2WMQA 4EL9A 3GT8A 4TN6A 1A06A 2VWXA 3Q9WA 4QP1A 5J5TA 4H3BA 4F1TA 1PMEA 2X1NA 5BQ0A 5HKMA 5LVOA 3ACKA 2X8IA 5FP5A 2QLQA 5E92A 2XEYA 3CR0A 1OZ1A 5CAPA 5E91A 1R0PA 2ERKA 2WMUA 2XIRA 3Q6WA 4ZY5A 2ETMA 5ANIA 4F6UA 3SGCA 1NY3A 3CJFA 3O50A 4NM0A 2UW0A 4BKZA 3LW0A 3R8PA 3P7CA 4B99A 4D5HA 4PNKA 3OMVA 2XBJA 2BRHA 5EI2A 2HCKA 2YEXA 3LXKA 4UMRA 5CENA 3WF6A 4L7FA 1S9IA 1Y6AA 4ACMA 4DFXE 5AR2A 4CYIA 4QMYA 2RKUA 4DH8A 4BWXA 2XKEA 4F6WA 4DEDA 4XG4A 3MVJA 2CLXA 4BCJA 2W17A 1YW2A 2XYNA 3LKMA 4YLLA 3OOGA 3HECA 3F66A 4QMQA 3V51A 3GCVA 3LFSA 5EQYA 3QX4A 1O9UA 3O8TA 4PDPA 4KS8A 3LPBA 3PIYA 3GCPA 4C4FA 5BPYA 1G8SA 2V5QA 3KQ7A 4A9TA 1GOLA 2OJ9A 3ZHPC 3UE4A 2QLUA 3BQCA 5D11A 4KKHA 2Z7LA 4HVSA 3I60A 5DOSA 1J7LA 1PJKA 3R21A 1KE5A 4OT5A 3RAKA 3THBA 4GYIA 4EQUA 5IU2A 3E93A 3C1XA 4G2FA 1SVEA 1KE8A 2RFNA 4RQKA 2YM8A 3KREA 5I9WA 3H0ZA 4FTLA 3WZJA 3ZLXA 4RIWA 4HJOA 4M8TA 1GZOA 3UJGA 4AT4A 3F82A 3PY0A 4UXLA 3EZRA 3U51A 2O3PA 3HGKA 3D2IA 3W2CA 3M2WA 3F3WA 4EOSA 3U6JA 3MTLA 3NVMB 5F20A 4NT4A 3TKIA 1PXIA 3OXTA 1A9UA 2W99B 3ZLWA 4HGEA 3E8EA 4ZSLA 3DNDA 3WE8A 5IA3A 2F57A 4CFUA 4RC2A 3IQ7A 5B2KA 2RFDA 2C6TA 2Y6OA 3L1SA 4HGTA 1GIJA 2ZV2A 3DAJA 1ZYLA 2PWLA 1ZMWA 3FY2A 1RQQA 3KMUA 3TDVA 3R9DA 2P3GX 3ATSA 3WI6A 3R02A 4M0YA 3KULB 3RMFA 3P9JA 4GRBA 1SMHA 4FSNA 4L3JA 3TN8A 4YTFA 4LMUA 4DEGA 5B7VA 2C6OA 4XH6A 3O51A 5H8BA 4EOIA 1FBNA 2Q0BA 4QNYA 3LAUA 2X9FA 4R3RA 3VIDA 3F9NA 2EB3A 4TT7A 4UB7A 3KXHA 1URCA 3P1AA 4QMLA 5BMSA 2C4GA 4WNMA 2Q0NA 4KS7A 3HA8A 1BLXA 2X9EA 2X6EA 3PSBA 4FIHA 2NP8A 4YZDA 4EZ7A 4YC3A 2Z2WA 2DQ7X 4ALWA 1OMWA 3QTIA 3PG3A 1WMKA 2F7EE 2BR1A 3A99A 1IAHA 4N57A 4YZCA 1A48A 3LXNA 2Z7SA 4MF1A 3R7YA 2P2HA 2FB8A 4L6QA 3V5LA 5AADA 2ZV7A 3U55A 3A60A 3B8QA 4PTGA 3II5A 4F99A 3W8LA 2EWAA 3PSCA 5CEKA 3EYGA 1LEZA 3LCKA 2PVNA 1PXPA 2OFUA 4XJ0A 2Z7RA 3V5JA 3ENHA 2VO3A 3U6HA 1L8TA 2CHLA 2H6DA 2UZWE 1J3HA 3OHTA 4KSPA 5C4KA 4D2VA 3A7JA 2OK1A 2OSCA 2R3LA 3CQUA 2BRNA 5AAEA 5BVWA 4FKGA 2UV2A 4BYIA 5IDNA 1B38A 2PVYA 4J95A 3VO3A 1FMKA 3HUCA 4AT3A 3UPXA 5FLFA 1UU9A 2YDKA 4NUSA 4E93A 5I9XA 3V01A 5IEYA 3GOPA 2BRGA 2NRUA 3E64A 3QRTA 3FPQA 4ASXA 3G6GA 2DYLA 1DAYA 3HV5A 3DXQA 3DKOA 3H9FA 3R7VA 3VN9A 2HYYA 3R73A 3UIUA 4A9RA 1Y8YA 3ZRKA 5IQHA 4FTMA 4G3EA 5A9UA 4BBMA 4ZOGA 2VTTA 4X6RA 4HVGA 1W98A 3SOAA 4EH3A 3OBJA 4AZSA 4QTCA 1I44A 1YKRA 2UZVA 3LCOA 3FDNA 3NW5A 1UNGA 3BYSA 4MKCA 4C37A 4FZ7A 4QYEA 3VHEA 4GT5A 3POOA 3SA0A 5LCKA 4QPSA 5IQCA 3A4PA 3C0IA 3EJ1A 3GFEA 2XRUA 5K9IA 2ZJWA 3U4WA 4FTNA 3QXOA 4XG8A 5E7RA 4FNWA 2SRCA 2A27A 3BV3A 4JAIA 3S2PA 3TIYA 3BU6A 5EI8A 3TI1A 1Q97A 4IAKA 5E8VA 4EK8A 4ZMFA 4AFJA 4BKJA 5HVYA 2R0UA 5L2WA 3LFCA 3FY0A 2UZBA 3AC5A 1XKKA 3E88A 3QTSA 1Q8UA 4XS2A 4C4GA 5AP7A 4YR8A 4XX9A 3R8ZA 5C26A 2Y4IC 3KULA 1LUFA 4U9AA 1NVSA 4LRKA 3PLAE 1H1RA 4EKKA 3HV4A 2C68A 3FQHA 4GVJA 4D4SA 2XK7A 2YACA 1W0XC 4DTKA 2B9FA 3Q96A 1JKLA 2PUIA 1MRVA 2HK5A 3KA0A 5ACKA 3UBDA 4WO5A 4YBKA 3JY0A 1H07A 4R78A 4WUAA 4RIYB 3KL8A 5FEDA 3PY3A 1TQIA 5EYCA 4MXYA 1OUYA 4Y95A 4MWHA 4EBVA 5FD2A 4DH7A 4CMOA 5I4NA 3IGGA 1PF8A 2WMWA 4RIOA 5EW9A 2GU8A 5C01A 3LM5A 4OT6A 4FK3A 5J7HA 3GU6A 4GU6A 3VUTA 4KNBA 2ITZA 3LFFA 2JAVA 3A61A 2WIHA 1TKIA 4F6SA 4F9BA 3TZ9A 3FEGA 3UZPA 1KWPA 5HNIX 3OEFX 5LMKC 3OCGA 3G9LX 3TACA 5GJFA 1JSTA 2VNYA 1Q5KA 3TL8A 4J1RA 4V05A 4V0GB 2GTNA 2YM5A 4QMZA 4ZTMA 5GNKA 5KBRA 3PP0A 5J1WA 3A62A 5KBQA 1PMNA 5AP2A 3S3IA 3SLSA 1VEBA 5BUIA 3MSSA 4EH7A 1QMZA 1UKHA 2X8EA 3HNGA 3VS6A 1JPAA 3QCSA 4QMUA 3C51A 2V0DA 4NL0A 3WIKA 2W5AA 1VYWA 4DEHA 1G8AA 2WHBA 1FVVA 1YVJA 1YWNA 2G2HA 3Q52A 3QCQA 2WKMA 1YDSE 3CQWA 3HKOA 4IAFA 4XG3A 4YZNA 4A9SA 3IS5A 2WTIA 4CZTA 1H27A 3FMMA 4PV0A 4ZS0A 4EYMA 4AOJA 3I5NA 3Q60A 1OL1A 2GHMA 5AP6A 4CV8A 4O86A 4ANSA 3TCPA 4XMOA 3BE9A 2W4KA 4MXCA 4OR5A 3GBZA 3ZSGA 3P7BA 3P78A 2C1BA 1UU8A 1BUHA 2W9ZB 2XIZA 4FIIA 3WF5A 3F2NA 4EQCA 4N70A 3FI2A 2C5VA 3MH1A 5L3AA 2V7AA 3FL4A 2IN6A 2XIKA 4O7YA 2PVRA 3EN7A 3RK5A 3MB7A 4IE9A 5DRBA 5L2IA 5CF6A 2X81A 4BI0A 3W2SA 5IMEA 4FZFB 3LCDA 5C4LA 1QL6A 3HYHA 3U54A 5LOHA 3ORKA 2C69A 1UWHA 1LR4A 3VUGA 4C2WA 4O7RA 3CTQA 1XWSA 2J0JA 4FSMA 1FPUA 2I0YA 4F7LA 3MB6A 5JGDA 4I41A 4HZSA 1QPJA 1KE6A 3IDPA 2HW7A 4YJOA 5FXRA 5DH3A 1MRYA 3BCEA 3JY9A 5AUZA 4O2ZA 1YI3A 2WOUA 2I6LA 4IWDA 4IM0A 4BDAA 4ZJVA 4O7LA 5IA2A 4RIYA 2VTAA 4EOQA 2CJMA 2X7FA 4BIBA 4FA2A 2GQGA 3BHTA 5CYIA 4CNHA 2I0VA 3NMUF 3WOWA 3Q6UA 3R83A 5LMBA 4BCHA 3BYMA 2CKPA 3RHKA 3HP5A 1SM2A 4I1ZA 2HWOA 1XH7A 2I0EA 3RM6A 5ETFA 5L8LA 3NPCA 4MHAA 3F5GA 5JMSA 4ZZMA 3E62A 3VW6A 2Z8CA 4EOMA 3CTHA 3LXLA 4WOVA 2G15A 3TNPC 3QD0A 4ASDA 5EW3A 2OKRA 5M57A 4J71A 4WNOA 2P2IA 5LQFA 4NTSA 5HVKA 3ITZA 4JRVA 3C5UA 4LFIA 1YDTE 3FV8A 2QQ7A 3RVGA 3F7WA 3LLAA 3NR9A 4PMPA 3P23A 4TWCA 2BAKA 4WBBB 4CXAA 2VAGA 5K5NA 2WXVA 4I92A 1JSUA 3TV4A 4O21A 2UW6A 3GENA 4JDHA 5DHJA 4HVHA 5DT3A 1QPDA 5DWRA 5AFVA 3R7EA 4ZZOA 2F7ZE 4MD8E 5DPVA 3L8XA 4PTCA 4AZVA 1DI9A 3OF0A 4C3FA 4E4XA 4EUTA 1KOAA 4EORA 5HORA 2QOKA 4DF3A 3BQRA 2VTSA 3AXWA 5DE2A 5CSVA 3GCUA 2PVJA 4WD5A 3TKHA 2GS7A 3LVPA 4DTAA 5M55A 4PDYA 3H9OA 4RMZA 5CAOA 4JR3A 4G3CA 2WMXA 5AX9A 2QODA 1NT2A 1APME 5AP4A 4FV2A 2JKOA 4FUYA 4BCKA 4J98A 4F64A 4HYUA 2P55A 4W4XA 2RGPA 4ZJJA 4X2NA 1J91A 2OIQA 3HV3A 4IM3A 2ITNA 4EWQA 4C3RA 4DT9A 2WQNA 2ITOA 2XNEA 2PMLX 3MA3A 5EOBA 2FSLX 4GG5A 2GMXA 4I5HA 4NSTA 3K3JA 3VW8A 1RJBA 2F7XE 3AT4A 4RJ7A 4AWIA 2BAJA 3AG9A 3CIKA 4PNIA 2OF4A 3OY1A 4FMQA 3F6XA 3WF9A 2A2AA 4IADA 4ALVA 4U44A 1URWA 4R5SA 2YCQA 1J1CA 4S32A 4WKQA 3V04A 4PF4A 4GKHA 2JIUA 5HE3A 4AGCA 1T46A 5H8EA 3Q5ZA 4BR3A 2QOQA 2A0CX 3PVWA 1PXJA 2IO6A 2VWZA 3G0EA 3GU8A 4ITHA 4QYYA 5EDQA 2VWBA 5FTOA 3AMBA 1GZKA 1PXNA 3D2KA 1XH5A 3RAIA 3ATTA 4FTTA 4FSZA 2EXMA 3MFSA 3VRZA 4EZ3A 4A07A 2W1EA 4Z55A 1CMKE 5A4TA 3QD2B 2C0TA 5TR6A 1OIUA 3BV2A 3EWHA 5G6VA 3VBXA 3UQGA 3NWWA 5D41A 4F0FA 1V0BA 5HCZA 3BYVA 3CXWA 2ACXA 3FC1X 4K18A 4CMTA 3H10A 3PE1A 3NIEA 4IX4A 3KC3A 4YLJA 3EH9A 3ZYAA 5J95A 4ZSJA 4DG3E 3DB6A 5BNJA 4FTUA 4RJ8A 1JSVA 3D14A 4IVCA 1XH8A 4USFA 3QQFA 2PUNA 4C8BA 4NFNA 2GSFA 1REKA 2OBJA 3LOKA 2J6MA 4F63A 4LMNA 4UWYA 3SX9A 3IW8A 3LCSA 4NCTC 1K2PA 4FKLA 4ONAA 2Y6MA 3RPRA 2VTRA 4FT0A 4AGDA 1PHKA 3GC7A 4FTJA 5D1JA 4O7ZA 4FZDB 2XK9A 3R63A 2WU6A 4LG4A 3EQCA 4G1WA 4EOLA 4RPVA 1IA8A 3W10A 4JI9A 2IZUA 4TYGA 3R01A 1F5QA 4U43A 1R78A 4M14A 5A6OA 2WTJA 3LLTA 3VS1A 3BHVA 4FKRA 4GKIA 3GB2A 5AP1A 4F7SA 3Q9ZA 3I0OA 5IUHA 3G33A 3KF4A 3VJOA 3QQGA 4YTHA 5BVEA 3ZMMA 2UVZA 3AOXA 1H4LA 1XR1A 4EJ7A 3HA6A 5CEMA 3UNKA 4AA5A 4RZVA 5AUUA 5JN2A 2ZVAA 5K4JA 3POZA 3GQIA 2XH5A 3NW6A 1FGIA 5CU4A 5DR9A 3VQHA 5A4CA 4EUUA 4AOIA 5EOLA 1OECA 3WIGA 3MA6A 4IX5A 4KRCA 2XK6A 4NJDA 4BTKA 3VAPA 5F9EA 4JOAA 4EOJA 5IKWA 2CCHA 4FG9A 3DCVA 3O23A 4FTIA 3HMNA 1DS5A 4QMSA 5HG9A 1ZY5A 4O0RA 3PA4A 4XP3A 4DBXA 2QKRA 1ZWSA 2P33A 5C8KA 1H1QA 4G3FA 2BRMA 4R77A 5ETAA 4YPSA 2R64A 4M84A 2JDRA 3KB7A 4PY1A 5HBHA 3BEGA 4O1OA 4O6LA 1XBAA 2BALA 2ETKA 3ZU7A 5JGBA 3QA8A 4MCVA 3MJ1A 5JGAA 2VWIA 2FSTX 1U54B 3UMXA 3QCXA 4YURA 1L3RE 4I0SA 1PYEA 2JKMA 4OTDA 4QQJA 4IVDA 4I0TA 4KUJA 3C9WA 5JH6A 3DJ7A 1S9JA 3PP1A 4LQMA 4RFMA 4O96A 5CXZA 2A1AB 2JLDA 5CZHA 5DYJA 4M67A 1IR3A 2A4LA 4IAYA 5CS6A 2W0JA 3QTZA 5I5ZA 4RFYA 1XO2B 3EIDA 4LV8A 3FKLA 4BTFA 2CGVA 3SC1A 4Y73A 5FM2A 5IH4A 4TZRA 3R0TA 4W9XA 5BUEA 4E6DA 2PZ5A 4MBIA 5DVRA 3JXWA 2YDJA 4PPCA 3FQSA 4G9CA 3UO6A 4JQ7A 3TM0A 4Q5EA 2OH0E 4J8NA 2DUVA 2VX0A 2VTMA 1E1XA 4FC0A 2WD1A 1BL6A 4HCTA 3OEZA 4LV5A 4GUBA 4UWCA 4YHFA 5EM7A 4FZAB 3BLHA 3CY2A 1OL7A 1OPKA 4YUQA 3H4JA 4XLVA 5HU3A 3DJ5A 3SQQA 1W84A 3F5UA 1BYGA 3OCTA 3C7QA 1ZZLA 5HLNA 4IFGA 2F49A 3I7BA 3LFDA 3GCQA 1VYZA 3Q4CA 3LMGA 1RDQE 3DFAA 4OTIA 1ZMUA 5AR8A 5EYKA 3U8WA 5AEPA 5L2TA 3OTUA 3PUPA 2VZ6A 3RNYA 2XNPA 3W1FA 2VUWA 3MH0A 4FV3A 3UIBA 4L42A 3A4OX 3I4BA 4A9YA 3I6UA 4BHZA 3ZLYA 3KRXA 3U6IA 2E9VA 5F4NA 4D2WA 5HX6A 3HAVA 3DGKA 4EONA 3R2BA 2QO2A 2R7IA 4EKLA 4YO6A 2YAAA 2E9NA 3QZFA 2JBPA 4R3CA 2FYSA 5JFXA 2UZTA 3DFCB 3PXRA 1YRPA 2P4IA 1H08A 3UZTA 4UEUA 3L8PA 3TNQB 4O1PA 1Y91A 3SG8A 2GS6A 4ZY6A 3UYSA 4BCGA 4E4MA 4BCNA 5M08A 4DFNA 3HX4A 4G3DA 3RPOA 3RINA 4G6NA 2ITPA 5KMMA 5ANEA 2OIBA 4FKVA 2G2FA 3N4TA 4KBAA 3TZMA 4WSYA 5CNNA 2UVYA 4QYFA 3LXPA 5AUTA 3NLBA 3DQWA 3B2TA 3REPA
chains in the Genus database with same CATH superfamily
3GC0A 3UIXA 3KCKA 5M4UA 1WBOA 2GTMA 2WB8A 4BI2A 5CASA 1DM2A 4CV9A 4IM2A 4RA5A 2WQBA 3ANRA 3GC9A 4IVBA 4L45A 3UG1A 1B6CB 3NUSA 2GDOA 3DK3A 3HZTA 3QTUA 1J7UA 2WGJA 5IZFA 2PVMA 4HPUE 5BX0A 5C8NA 4ZXTA 2W1IA 3PUFC 3E7VA 5HGIA 1VLRA 2W4OA 4J99A 5LMAA 5J1VA 2RSVA 3FE3A 5HEZA 4C4EA 4JS8A 4RGJA 1G8JA 3D9VA 3NEWA 3PA5A 4ERWA 2Y9QA 3CKWA 3FSFA 1J1BA 3MIAA 4RBLA 2W1CA 3IW6A 4D5KA 4NW5A 4CLJA 3FC2A 4AOTA 4IW0A 2X6DA 4UWBA 3WF7A 2WTCA 4XOZA 1ST0A 2HZ0A 3FHIA 4Y5QA 3O5AA 3TUBA 5JRQA 1CSNA 2QOHA 2W96B 2JC6A 3FSKA 1YXVA 2GCDA 4FODA 5A4LA 3KMWA 3TDWA 2C3LA 4DDIA 2E2BA 1XH9A 4TXCA 1WVXA 3MFUA 5CF4A 4FKQA 1J7IA 3VBWA 5AX3A 5M44A 5BVFA 2QD9A 3ENMA 3NIZA 1TQMA 3TG1A 1H24A 4M7IA 5E9EA 2ZDTA 4OAUC 4UMTA 3BPRA 4WG4A 3SXFA 4GMYA 3SHEA 3IPHA 2PTKA 3OD6X 4PDSA 4QYGA 5EHLA 2OXYA 3ZC6A 3WZUA 5D9HA 1FINA 4ZTNA 3NZ0A 5CF8A 4IZYA 5J79A 5GIPE 5ANGA 4TWNA 2ZM1A 2GQRA 4O7NA 3W8QA 3MY0A 4CZUA 4RJ5A 4GFMA 3EFWA 3BLAA 4M69B 4BBEA 2X2LA 4YZ9A 2XYUA 5HTIA 5EHOA 4I5CA 3OC1A 3F88A 3LJ1A 4P7EA 4XG2A 2GNJA 5DN3A 2BZIB 3RGFA 1U46A 1GZ8A 3QUPA 3BU3A 4LV7A 4P5ZA 4QP6A 2WQEA 1WBVA 3C4WA 3L9NA 5CY3A 5EK7A 1R3CA 4I23A 4QQ5A 3I7CA 2KTYA 4BWKA 5AAGA 2W06A 1HCLA 2J0MB 4CFVA 3EN9A 4TYIA 4AAYA 5HG5A 5B2LA 2W5BA 5CEOA 4OTRA 4AN3A 4IZ7A 4RVTA 3KY2A 4QP8A 2OLCA 4D4YA 3UVQA 4F4PA 3TZ7A 2BKZA 4ZSAA 2RL5A 3V5QA 2WEVA 3G5DA 4QPAA 3M1SA 3HMIA 4BN1A 3QQKA 4MXOA 2ZAZA 5BVOA 4RVKA 3T9TA 3KKVA 4G31A 3NAXA 4MBLA 4CRSA 4ZLZA 3TWJA 4H39A 4X6QC 4O4EA 1YOMA 3RP9A 3T8OA 3M11A 3P5KA 2OJIA 1KV1A 1IG1A 5CWZA 4YNEA 4A4OA 2ZB1A 4F9AA 3QWJA 1NA7A 3DA6A 3D83A 3MBLA 4XRJA 1XBBA 3A8XA 4TWOA 5J8IA 5D7VA 4OTHA 3A8WA 2JDSA 3MY1A 4W9WA 2OWBA 2PMIA 3MFRA 1MQBA 3NRMA 4J53A 3W2OA 4CLIA 2R5TA 4KIPA 3ORPA 3LFBA 5J9ZA 4EH2A 4P5QA 4EC9A 3IW7A 4USEA 2BKKA 3EB0A 2ITWA 3DK7A 2BTSA 4IB0A 4E8AA 5M53A 3C50A 2BCJA 4U80A 2X2KA 3PFQA 1TQPA 4TNDA 4C4JA 3SV0A 4XV1A 5EW8A 4TPTA 3DB8A 2XJ0A 4MAOA 2R3QA 4QD6A 3QTQA 3W0RA 5CAUA 2ONLA 2RIOA 3FPMA 2E9OA 4BDCA 2PZRA 3GU7A 4PP7A 3GNIB 5IMXA 4B8LA 2WMVA 4NIFA 3QYZA 2HZIA 2PMNX 4K33A 3W2PA 4O82A 3RWPA 5CVGA 1PMVA 4AGWA 4X2JA 2OFVA 5L4QA 4RFZA 4M69A 1TZDA 3UVPA 4YJSA 4O0YA 3IKAA 3CC6A 3UNZA 2PVLA 1JNKA 3O8UA 4S2ZA 4B9DA 4NEUA 2YM6A 3VS3A 2JEDA 4XHKB 3WYXA 3P5JC 3QX2A 1VZOA 1WZYA 3ORXA 4UY9A 4A9UA 2VD5A 1NVRA 2GHLA 3D5WA 4IJPA 4MD9E 4U45A 3VS5A 2R3IA 4J96A 3PXZA 4W4WA 5AA8A 5LMKA 2WAJA 2GS2A 3BRBA 4PTEA 2XNGA 1BL7A 3F61A 3MV5A 4XV3A 2BILB 5AA9A 3ACJA 5E8UA 4II5A 4ZTLA 3R9NA 4UN0C 4OBQA 2R3NA 4B4LA 4DA5A 3ORMA 4BZDA 3DOGA 3FXXA 4CQEA 2BDJA 3ZZWA 4OTGA 4HPTE 4AE6A 4RSSA 1P4OA 3FZ1A 4FVRA 4BKYA 2ESMA 3D94A 1P2AA 2PE2A 4FKPA 4QP2A 4RWIA 4TYEA 5E1EA 5L6WL 3C5IA 2YZAA 5LJJA 3IW5A 4HCVA 4IMYA 4ACDA 3AD4A 4KINA 3LFNA 3AC8A 3C0GA 1ZARA 2XKFA 2EVAA 2BHHA 2JDOA 2QO7A 3CE3A 2VTQA 4FEQA 4JBQA 4U97A 3WZDA 3ZXZA 4PPBA 4AUAA 1R1WA 3IECA 3S4QA 5H2UA 1BMKA 5EDRA 5KUPA 3B8RA 4L8MA 4BCPA 2WU7A 4GEOA 5CEQA 3CSVA 3QKKA 5KMNA 3I1AA 3EQHA 5IH6A 4D0WA 5HO6A 3V3VA 2X39A 4QMNA 5HD4A 4BJJB 3W55A 4UMUA 4BDJA 5JT2A 3COKA 5FG8A 2ITVA 3P79A 3AD6A 2DWBA 3KK8A 4X3FB 4FL1A 1W2DA 4GU9A 3EN6A 4L44A 1V1KA 2O0UA 1P4FA 1IASA 1XHAA 3ZDUA 3PDTA 3OXIA 5JEBA 1YI6A 4LL0A 4ZTQA 4GJ2A 3S95A 4I5PA 4K6ZA 4R5YA 3IONA 3MGYA 4IWQA 5T6KA 4ENXA 4BRXA 2JIIA 3GI3A 4X3JA 1OBGA 4NH1A 4TYJA 3D5VA 4YZBA 1F3MC 2YABA 1SNUA 5EH0A 4Y46A 3VS2A 4DEEA 3ORLA 5CF5A 5IUIA 1XH4A 4CCUA 3MVHA 1CKIA 1QPCA 4BDHA 3TYKA 1RE8A 1UU3A 5L2QA 3I5ZA 1OKZA 5AV3A 3RAHA 5BVNA 4I24A 1UWJA 4A4LA 4LOQA 2XS0A 5EYDA 4WNKA 1TVOA 1PY5A 3ZBFA 2C3IB 4FV4A 2B7AA 3S1HA 2WQMA 4K8AA 1O6KA 3NS9A 2UVXA 4OBOA 4JAJA 4RRVA 2AC5A 4D2RA 3D4QA 4AT5A 4OTPA 4ZIMA 2ONLC 4FIGA 4H36A 5JZNA 2FSMX 4FTQA 4AW5A 4YU2A 2AC3A 4ORKA 4JRNA 2PZPA 4UZHA 5KZIA 4O0TA 3DKFA 4FG8A 4JJRA 4S33A 3S0OA 4DLIA 1PRYA 4ZAUA 4FGBA 3G51A 5IA5A 4H05A 2GHGA 2XANA 4K9YA 4DH3A 3KXZA 2HY0A 3Q04A 5G1XA 3EKKA 4IC8A 4GH2A 4ZTSA 4YJNA 4ENYA 5TF9A 4AGUA 3KN6A 4GK3A 4Q9SA 4C4HA 1YHWA 3C4CA 5BVKA 1YHVA 4XRLA 3P08A 3A7FA 3RPYA 4KD1A 3SOCA 3VF8A 3ZC5A 1JLUE 4ACCA 3PVGA 3Q4ZA 3R1QA 3S00A 4FGRA 5E4HA 3GUBA 4EWHA 4JBOA 2J51A 3VS0A 3OTVA 4MQ1A 3MH3A 4CRLA 3TEIA 2UZLA 2FH9A 2G01A 4BF2A 5HO8A 4Y72A 4RQVA 5A3XA 3VBTA 3OWJA 3TZ8A 5HOAA 4KA3A 1FGKA 4NWMA 3PIZA 4R1YA 4AZTA 3G2FA 2YFXA 4C7TA 3TUDA 5AR5A 5E8ZA 1LPUA 3P86A 5HZNA 2AYPA 4ID7A 1I09A 4FTCA 4BJJA 3PJ1A 2F4JA 3KXGA 5CAVA 2OU7A 4YHJA 3CP9A 3QALE 3EMGA 3PVBA 4X3FA 1YI4A 5DI1A 4X2GA 3HDMA 3ID6C 4KABA 2BRBA 2GFCA 1JWHA 2HY81 3ODYX 3ULIA 3WZEA 1Q8YA 2QURA 3VJNA 4ZS4A 2IG7A 1QPEA 1E9HA 5BVDA 1GY3A 1B39A 4IB5A 5IQEA 5IG1A 2UZUE 2ERZE 3EFKA 3RCJA 3BLRA 4QDEA 1OM1A 4EHVA 3PXFA 5ANOA 3AQVA 2R3RA 2UUEA 3VNTA 4RC3A 2F9GA 1PXKA 3LJ0A 3PXKA 4H3PA 3B2WA 3E7OA 4L9IA 3D5UA 4TWPA 4WIHA 1QCFA 2HZ4A 4ANNA 4JDIA 2ZB0A 3HEGA 3NW7A 5D12A 3QLFA 4NU1A 4XCUA 3ANQA 3QF9A 3R9HA 3RPSA 3UIMA 3OWKA 4OUCA 1OI9A 3V8WA 4G5JA 2A98A 2BVAA 4MVFA 4L67A 2KULA 4U81A 3IDCA 5JFSA 1ZYCA 2OH4A 3O2MA 5BYYA 4EH4A 4DFYA 3DBDA 4R7HA 5HHWA 4I6FA 3NUAA 4U42A 1BI8A 3COIA 2UW8A 2YIRA 3G0FA 1OIQA 4X2KA 5HO7A 1O6YA 2QR7A 3DTWA 4O91A 2ITQA 4F9WA 4O4CA 1H1SA 5IQBA 4HGLA 2QU5A 4QMWA 2YM7A 5DNRA 5E8YA 3C4EA 4GK4A 4BFMA 2PK9A 3FLQA 4XBUA 5ETCA 4RJ4A 3FKOA 4DG0E 5KKRB 3MYGA 5DEYA 1Q99A 4ZSEA 4W4YA 3NAYA 3QGWA 4NCTA 1Y6BA 2W1DA 5L6OA 1K9AA 4K0YA 3LQ3A 4PMSA 4EK3A 2W1ZA 3F69A 2C5OA 3QKLA 2QG7A 3SXRA 1SVHA 5FGKA 4V0GA 4DCEA 3OFMA 2YLFA 3WARA 4QMTA 4FOBA 3ZONA 4S31A 3PPZA 3ETAA 5FXQA 3PIXA 3R30A 3WF8A 3IO7A 3LIJA 5DFPA 2QKWB 3N9XA 1OUKA 3R00A 5CEPA 5AUWA 4FSUA 3TJDA 3BYUA 3CPCA 4IAZA 4R3PA 4C35A 3TUCA 2PMOX 5DT4A 4JMQA 4DG2E 4M97A 3F7ZA 3N51A 4LRJA 4L3LA 4BICA 5I9UA 1T45A 3MI9A 4NZWB 4Q2AA 2J5EA 2JAMA 5IUGA 3QC4A 2YLEA 3K3IA 4MWIA 3I6WA 4MX9A 3EN4A 2ZM4A 3QXPA 4IXPA 5HTBA 4AN9A 3G90X 3CS9A 3QWKA 3HRFA 3EOCA 4BDEA 2J0IA 4X7QA 5I3RA 4JLCA 3E8CA 3QD3A 3W32A 3AC3A 4CMUA 4JBPA 4QP9A 5E1SA 5GJGA 2ITUA 3NNUA 4FT5A 4X3FC 4CFXA 5JKGA 4YSJA 3UGCA 4WNPA 3UMWA 5C27A 4AQKA 2XKDA 1Q8ZA 4P90A 5AP5A 3EFJA 3AKJA 4J52A 1NW1A 2O63A 2XJ2A 1KOBA 5E90A 4AU8A 4BL1A 3OWPA 3VONA 1UVRA 3AD5A 4FKTA 3U9NA 4KBCA 4APPA 2YWVA 3LQ8A 4L46A 3BELA 3FLWA 4JQ8A 4AW2A 4FNYA 3QUEA 1PW2A 4PMMA 2OXDA 1YWVA 4Z3VA 4GIIA 3LE6A 2J50A 2VWYA 1UU7A 3PG1A 3BZ3A 2CKQA 5HICA 5LVPA 3CD8A 4HYSA 3V8SA 3IGOA 4I6HA 2C5YA 4D4VA 4R1VA 4FKIA 4U0IA 4DBNA 2WFYA 2UZOA 4YPDA 2PE0A 4ZLOA 2DS1A 5HG8A 4L3PA 4E7WA 3V6RA 3DXPA 2WTDA 3FWQA 4FV8A 3BHUA 5HCYA 2F2CB 2IZTA 3UODA 3NUYA 3E92A 3AT2A 3PZEA 4IX3A 4QMPA 5AMNA 2Q83A 4DGLC 3SW7A 4Q9ZA 1O6LA 4YO4A 3ZO2A 3Q4TA 5I9YA 2IW6A 4IWOA 3EQPA 3K5VA 3K5UA 3ZZEA 4FG7A 4QMMA 4BB4A 5FTQA 4X0MA 4FNZA 3EQBA 5L8KA 2BIKB 4EK6A 3QD4A 5L6PA 5LARA 2BTRA 3R8LA 3MJ2A 2EXEA 4RVMA 5TE0A 4X2FA 2LGCA 4NFMA 4CD0A 3ZDIA 4EI4A 3MTFA 3PFYA 3TJCA 4I0RA 2OZAB 3R8UA 5EYMA 2UW7A 5BV3A 3DT1A 3HL7A 2JDVA 1P5EA 4W8EA 3KMMA 4O7VA 4AQCA 1W2CA 3QKMA 3CKXA 3NNXA 3E87A 4FOCA 2R3PA 4QYHA 2XNOA 5AR7A 2ZM3A 4C59A 3ZO3A 2W1FA 5IEXA 4MTAA 4QMVA 3PJCA 4LUDA 4F65A 2GNIA 2RG5A 3AC1A 4M0ZA 3QBNA 1ATPE 4EYJA 2Y8OA 3UYTA 4BDBA 4K1BA 4GL9A 5AUXA 4WSQA 1JKSA 5KNJA 1M17A 3R1NA 3TNHA 3EQFA 1Q3DA 5BUJA 5IQAA 3O96A 3F3VA 4L52A 2X4ZA 3BYOA 3ZEPA 4FI1A 5FBNC 2UZEA 2OICA 4LM5A 4G17A 1GIHA 1AGWA 2FO0A 3FUPA 3G6HA 4ITIA 4CKIA 4F7NA 4BZNA 4FK6A 4IHPA 4GVAA 1Z57A 5KO1A 2W9FB 2O64A 2B55A 3W16A 1W83A 1MQ4A 2HZNA 2FSOX 1V0OA 3CPBA 2WTWA 2R4BA 2QU6A 3G15A 2C0OA 1H1WA 3QUDA 2O2UA 4FTAA 3VUIA 3WBLA 4XG9A 4CZYB 4MH7A 4QTDA 4O7SA 3LJ2A 4FSRA 5M51A 2XA4A 2Y0AA 5ANDA 4C62A 5CSHA 1JBPE 2VV9A 3A2CA 5M4IA 1XMLA 2ZFYA 3KRRA 3DTCA 4RIXB 4MD7E 4LGGA 2IVTA 3QYWA 2RFEA 3BBTB 4Y85A 5AUYA 3V5PA 2X2MA 3D15A 4NW6A 3R7IA 2BUJA 2VX3A 4FUXA 5M09A 3NYXA 4EH8A 1GIIA 5CI6A 4XLIA 1UNHA 3VF9A 4NM7A 5IQIA 2JGZA 2VO0A 3AMAA 1WCCA 4L68A 4M12A 4C0TA 3CBLA 3W2QA 3QTXA 5KKRC 2J5FA 2W05A 1U5QA 4AS0A 4BVUA 2IVSA 1G5SA 4AZWA 2JDTA 4NM5A 3OVVA 2OZAA 1WBSA 3UOJA 1MUOA 4HGSA 3TMOA 3Q9XA 5DLSA 2B53A 1KSWA 3RNIA 2IZSA 4YLKA 4F1MA 4NYEA 2J90A 3FI8A 4JDKA 4XP2A 4O84A 3PJ2A 4AZFA 5EQPA 1GNGA 4OTWA 3SDJA 3NYVA 4FT7A 4FR4A 4UBAA 5A54A 3QZGA 1YQJA 5HTCA 4TL0A 4XUFA 4Y5HA 3NDMA 3WE4A 3V5TA 4IZ5A 2C30A 3W0NA 3QHRA 4B8MA 3FYJX 4JG8A 1PYXA 3KFAA 3WYYA 2WMSA 5AWMA 4EK5A 4QRCA 3UVRA 4DEIA 2J7TA 4OLIA 1MRUA 5CU2A 3TTIA 3O0GA 4QP4A 5AR4A 4IANA 4WT6A 3AC2A 5LWMA 4CCBA 2CCIA 4JT3A 5HG7A 3OXZA 1ERKA 4FT3A 5HESA 2VTPA 3R8MA 4C33A 3ZCLA 1M7QA 5CQUA 4QEBA 4HNIA 3HVCA 5H9BA 2VGOA 2B4SB 2HAKA 2OIDA 4WA9A 2OZOA 1X8BA 2C5NA 2I40A 2PE1A 4JNWA 5JFWA 1CTPE 3C0HA 3SAYA 1OIRA 5DIAA 5DA3A 4FZ6A 2VTLA 4C02A 4EJNA 5KMLA 4DGOA 3BWJA 4E6QA 1KUTA 4ANBA 4EHEA 1PXLA 4L43A 1U54A 4MNFA 4PRJA 3FMNA 3HMPA 4NKAA 2RF9A 5A6NA 4Y8DA 2EB2A 3EYHA 4CYJA 4EOOA 1WAKA 3FHRA 2CKEA 4AG8A 3Q5IA 1NXKA 2I1MA 4TNBA 4Z9LA 3VULA 4IBMA 3PVUA 4PMTA 4AE9A 5CALA 3DKCA 4FE2A 1OPJA 4FIJA 1WBWA 4YBJA 2YA9A 4RWJA 4MNEB 2QOBA 1Q4LA 2YIWA 2XVDA 3OCBA 2W1GA 5K0KA 4ZJIA 2QHNA 2B0QA 2XNBA 4KKEA 5DBXA 5HBEA 4CT2A 3FQEA 4NM3A 4QQCA 3AGMA 3UDZA 2Y7JA 3MDYA 3UO5A 3ORIA 4ITJA 4KAOA 3WZKA 2BIYA 3K54A 3F3TA 5IQDA 4DHJA 3NNWA 5EI6A 1ZAOA 2QOOA 1YXSA 2VTHA 2YISA 4FL3A 2XARA 1G3NA 2QOLA 4WG3A 1W2FA 3GU4A 5HD7A 4AX8A 3GOKA 5C1QB 4YJPA 1R39A 2R3KA 4O4FA 4YGAA 4C3PA 3NUPA 5IH5A 5J9LA 4RVLA 2WMRA 1E1VA 3UQCA 1Z9XA 3E8NA 4DGMA 3E3PA 4X21A 4C61A 2J4ZA 4KKGA 5I3OA 2JFMA 4L53A 2PYWA 3UNJA 2PVFA 1OPLA 4FL2A 2B54A 3FLZA 5KX8A 4FSYA 5CQWA 5KMOA 4KWPA 3LFAA 4KRDA 4UV0A 5E8TA 2C6DA 2XM8A 4EOPA 3ORZA 3P4KA 4DLJA 2CDZA 4C36A 4AP7A 4K77A 4CTCA 1PKDA 4DGGA 5CZIA 3AMYA 4FEWA 1KV2A 3DDQA 4I6BA 4ZTHA 4F09A 3JR1A 5HCXA 4BYJA 3DU8A 4UYNA 4AXDA 1WVYA 3RPVA 3AGLA 5ACBC 3RBWA 5GHVA 2XALA 2XB7A 2WOTA 3GEQA 4BDKA 4DH1A 4E1ZA 1ZOGA 3D7ZA 1F0QA 4LYNA 4G34A 5GIOE 4L01A 1DI8A 4FKUA 4UYAA 4BCMA 4FV0A 5LVNA 3DZQA 4K11A 1SVGA 4M3QA 4YHTA 3TV6A 2BMCA 4FSTA 5AUVA 3MH2A 3PRFA 4QMXA 1OL2A 3ZM9A 1H26A 3PJ8A 3DDPA 4GIHA 5K0XA 2NO3A 4BDDA 3BX5A 4OTFA 3TNIA 4MK0A 3UOLA 4O0SA 1H1PA 2C6IA 3R22A 4D58A 3NUXA 4UXQA 2XBAA 2C0IA 2YWPA 3QHWA 3SD0A 2AQXA 4AA4A 2PUUA 3CEKA 5CX9A 3LMHA 4FIEA 3M42A 4ZK5A 5FM3A 4IACA 4I22A 3MPAA 3O8PA 4MNEA 3IK3A 3PRIA 4RX5A 4ASEA 1JQHA 1P14A 3F2RA 4EOKA 5HIDA 3RK9A 2VX1A 4JR7A 3F5PA 4JG7A 1OITA 2JBOA 3PTGA 4BTJA 4G6OA 5KCVA 4M13A 3MESA 2BDWA 3W2RA 4ACHA 3QLGA 4FEXA 3MN3A 4CQGA 1DAWA 3FKNA 3P0MA 3UQFA 4M66A 4NK9A 3RHXA 2GNGA 2X0OA 2OJGA 4RWKA 2C6KA 2FA2A 2YAKA 4AXAA 5M07A 4RX7A 3QL8A 4YC6A 3FZRA 3R9OA 3FMLA 5DRDA 2ZYBA 3QAME 1OKVA 4GFOA 2Y4PA 1WBNA 3SW4A 2R3HA 4CG9A 4O4DA 3FI3A 4UMQA 2CPKE 2VNWA 5HIBA 3H0YA 2A19B 4IZAA 3RI1A 4ALUA 4EHGA 2UW9A 5AV1A 4U41A 2C6EA 4G3GA 3SVVA 3AKKA 2OGVA 1UA2A 5BMMA 2PVHA 2JIVA 4KIKB 3ZFMA 2NRYA 3N4UA 4D9TA 2BROA 2XNMA 3EN5A 1ZY4A 3NX8A 4N4SA 5L8JA 5EM6A 3MWUA 3KVXA 1YOLA 4PL4A 4ANOA 2XUUA 3I81A 1ZMVA 1BX6A 3FZTA 3QU0A 4I6QA 3MY5A 2B52A 4C58A 5ITAA 3C4FA 5IQGA 4XOYA 3Q9YA 4O38A 5T68A 2PHKA 1JAMA 3KEXA 4KIQA 4QNAA 2XK8A 3V6SA 3UP7A 4DFUA 4D2TA 3JUHA 2YHVA 1Z5MA 3NGAA 3ROCA 4EEVA 3TIZA 3V8TA 3RZFA 4P2KA 4O83A 2NPQA 4IVAA 1M52A 4DN5A 1R0EA 5FBOA 2QOIA 1IRKA 2PU8A 3H9RA 2VN9A 3ZRLA 4BGGA 3QGYA 5FRIA 1OKYA 5FUTA 4E73A 4Q5HA 3ZS5A 3CCNA 3PLSA 1KE7A 3QRKA 4N6YA 5CSPA 5LVMA 4ZMEA 2QONA 2FUMA 3OT8A 4YJTA 4BCQA 3AT3A 4Z7GA 3PSDA 2B9HA 4I94A 4MXXA 2CN8A 4FSWA 4IDTA 2O65A 2WZJA 4O27B 1PMUA 4BCOA 3DV3A 4HZRA 1JKKA 4O81A 3D0EA 3PA3A 4LGHA 4E5BA 5JZJA 1CKJA 3R28A 4O0XA 4G5PA 5I0BA 4O6EA 2WIPA 4D0XA 1HCKA 4I4EA 3BL9A 4NKSA 2OXXA 4W4VA 2XRWA 4IB1A 1Y8GA 2YJSA 2B9IA 2YCRA 2Z7QA 3Q32A 3R04A 3OS3A 4H3QA 4QTBA 3JYAA 5IEVA 3P7AA 4XP0A 2PZYA 3DZOA 3QQJA 5EHYA 5FTGA 4BZOA 3FYKX 3OOMA 4MXZA 2PL0A 3OG7A 4EH5A 2OF2A 3VRYA 1AD5A 2C3KA 3Q3BA 3A7IA 2C47A 4TRLA 5F1ZA 1OGUA 5LVLA 5AM6A 5D10A 3DS6A 3HRCA 4PDOA 2YIYA 4DEBA 3K2LA 5M4FA 3LZBA 2NNWB 4MF0A 3DK6A 3R71A 3RJCA 2VTJA 3RCDA 3UO4A 4BDFA 4JBVA 2QC6A 3VBYA 3FLNC 4AW0A 2CGUA 4UALA 3LCTA 5JRSA 4AW1A 1FQ1B 4FX3A 4KIKA 2IW9A 3ERKA 3U9CA 3HV7A 2EXCX 3BHYA 4G16A 5KE0A 3RZBA 2OI4X 2J2IB 3W0PA 2W5HA 4QPMA 4E6AA 2GNHA 1U4DA 4FKJA 3BHHA 4FRFA 4I93A 4TY1A 3JS2A 4YP8A 5DMZA 3DBCA 2BPMA 2ZV9A 5EKNA 3HMOA 3OT3A 1CKPA 2JITA 3D7TB 1BI7A 3MIYA 3BKBA 5FEEA 5C9CA 3D5XA 4HVIA 4D9UA 3R2YA 2BHEA 4AFEA 1NVQA 1GZNA 2HXLA 3DJ6A 1Q24A 4XNEA 4E4LA 2R3OA 5J5SA 5LXMA 3VBQA 5HNGA 1WBPA 2X4FA 2FGIA 1OL5A 3FLSA 3FZPA 3O17A 3CD3A 2OJJA 4IX6A 4EHZA 3KXXA 5AV0A 2WTKB 3KVWA 2IZRA 3HDNA 2YERA 2R3GA 5AV4A 4U3ZA 4O0VA 2X0PA 2XIYA 5D7AA 5IA0A 4IJ9A 3ORNA 4OTQA 3ROYA 4DFBA 3Q53A 1UV5A 4BIEA 3IG7A 3ODZX 4JG6A 4XV2A 2OG8A 4FV6A 5CANA 2PULA 2HOGA 3CLYA 3OW4A 5EDPA 5TT7A 2GPHA 1UNLA 2PY3A 4O0WA 4FV1A 4O0UA 4RT7A 3BU5A 1M7NA 4AF3A 3DBFA 4ZSGA 4GT4A 5HE0A 3GXLA 3ZUVA 4QTEA 3ULZA 5CAQA 4YSMA 2I7QA 5CVHA 4S30A 2E9PA 3VUDA 3CGFA 5FXSA 4FEVA 1GAGA 2I0HA 5TOZA 4FEUA 4FF8A 2HW6A 2IJMA 3DNEA 2G2IA 2X7OA 4I4FA 3L9PA 3MVMA 4J8MA 4TW9A 3RALA 4HW7A 5BYZA 4LOOA 4F7JA 1OKWA 4FV5A 4H1MA 5JK3A 4BCFA 3MPMA 3OROA 4F9CA 3IOPA 2PUPA 2GFSA 3ZRMA 5K5XA 3W18A 2CNQA 4RZWA 5DT0A 3EL7A 4IQ6A 3BWFA 5GZAA 2XCKA 3MPTA 4AACA 3AC4A 4XEYA 4B6LA 4DFLA 3RKBA 3NUNA 4DHFA 5AM7A 2Z02A 3DY7A 2YM4A 3FMKA 1ZYDA 4RJ3A 5A4QA 5HX8A 2XF0A 5CVFA 4OW8A 1UKIA 4AXCA 1Q8TA 3Q4UA 4EH6A 5JQ5A 4BDIA 4DTBA 4AXEA 2XJ1A 4DE4A 4O7TA 5AIRA 3IOKA 5GZ8A 3FL5A 2WNTA 3D7TA 4R6VA 5I9VA 3UP2A 2CGWA 3OWLA 2J0LA 4RA4A 2LAVA 4E3CA 4APCA 5DEWA 4BGQA 4U5JA 4DT8A 1H25A 4W8DA 5AP3A 2OO8X 4BBFA 1LEWA 2H8HA 4JL9A 1ZYSA 3NFFB 2G1TA 3BEAA 3PE2A 3NSZA 2BAQA 2GNLA 4MYGA 4R7IA 3FMDA 3BGQA 2VWVA 2CMWA 3SKCA 3NVKI 1JKTA 4O22A 4Z16A 4QP3A 4CFFA 1ZZ2A 3QRIA 4FICA 1REJA 2GNFA 3ALNA 3OY3A 5HLPA 3VVHA 3JVRA 3ZEWA 4RX9A 3ZOSA 2ETRA 5CTPA 5FEQA 1XBCA 4RG0A 3UZRA 2BZKB 4BWPA 4JDJA 4A7CA 2ZV8A 3BLQA 3FI4A 3FZSA 3SG9A 3GVUA 3KRJA 2BFXA 3E5AA 1VR2A 1V0PA 3KN5A 4I5MA 2VO7A 3L9MA 2QOCA 4FKOA 1W82A 2JKKA 4CT1A 3JPVA 4ZLYA 1M14A 4QMOA 4XV9A