3WZKA

Crystal structure of human mps1 catalytic domain in complex with n-cyclopropyl-4-(8-((thiophen-2-ylmethyl)amino)imidazo[1,2-a]pyrazin-3-yl)benzamide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
279
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Discovery of Imidazo[1,2-b]pyridazine Derivatives: Selective and Orally Available Mps1 (TTK) Kinase Inhibitors Exhibiting Remarkable Antiproliferative Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzkA01
3FI2A 3LCOA 2GQSA 3F3TA 2UZEA 1IRKA 5E8ZA 2YJRA 4QMMA 5GHVA 2VTSA 2PE2A 3SKCA 2C6DA 3VBQA 5F4NA 3KRWA 3O0GA 3UODA 4ZSLA 3ZEWA 2FUMA 2X0GA 3UMXA 3UZTA 3QGWA 2BDWA 3V5WA 3FSKA 4AW1A 4H1MA 2EUFB 2WMWA 4XOYA 1LPUA 2UW7A 3OF0A 4CFXA 3OHTA 4CKJA 2X8IA 1W82A 4BI0A 1Q61A 2ZVAA 4YTFA 3ZUTA 1T46A 1ZOHA 2XZSA 5LQFA 1GIHA 3TKIA 1FGIA 1YXVA 3R8MA 5HNBA 3E88A 4H3BA 2R3MA 2PK9A 3W18A 3OTUA 4CEGA 3KMMA 3DZQA 4TNBA 2R3GA 1MUOA 4QP6A 3TIZA 2G15A 2HY0A 2J7TA 2XIZA 5KHWA 5KMIA 3PE1A 3KVXA 3C9WA 5J9YA 5BYZA 2HYYA 1NVRA 3MFRA 1PF8A 2RG5A 3DGKA 4FKTA 1VYWA 3HMIA 4XV9A 4BKYA 2BFYA 4O0TA 4W8EA 1DI8A 3PXZA 4L3PA 1PHKA 3GU7A 3FMLA 3EQHA 4ITIA 4W4WA 1Y91A 4CYJA 4DC2A 4GFGA 2GNGA 4RJ6A 5M09A 4JJRA 3TUCA 5IUGA 4TN6A 4EJNA 5AAEA 3EL8A 3LCTA 4TPTA 3Q4UA 5J87A 3TZ8A 3BV3A 3WZJA 5C4KA 1ERKA 2QOQA 4PP7A 4NFMA 3MB6A 2P55A 4FODA 4FT5A 4F9WA 1DM2A 2J5FA 4LV8A 4ID7A 1OKVA 2OK1A 3W16A 5IQIA 2R7BA 4BBEA 3KRLA 3OXZA 4QYEA 2R3JA 4Y72A 5HORA 5AV1A 4FKPA 3QCQA 4KBCA 3ODYX 3O17A 3NVKI 3LLTA 4DFZE 3EJ1A 4RWKA 1B39A 4ZTRA 5AV4A 1OUYA 5CVHA 5CF4A 4X6QC 3E5AA 4WA9A 2BAKA 3I1AA 3OXIA 2OICA 4QYGA 4FSMA 5BMSA 4IB0A 4AP7A 5AP1A 4EZ3A 5AUYA 5CVFA 4QQJA 5F95A 4GG7A 2FA2A 4JBPA 4R7IA 4ZSJA 3UG1A 2W99B 3OOMA 5HG5A 2JAMA 2C6LA 3R0TA 3BHHA 2XCHA 4XCUA 3P0MA 5BVFA 4B9DA 3KFAA 5DMZA 5HI2A 1W84A 3G5DA 3EZVA 3PVUA 3FI8A 3OFMA 1PMEA 1QMZA 3BRBA 3K3JA 3QD4A 5FP6A 4M7IA 5J1WA 2HY81 4FIJA 1XH5A 2BCJA 2I40A 3F3VA 4FTNA 3FLSA 4FYNA 4RBLA 3RHKA 5AX9A 1UNHA 5I9VA 1ZYDA 5AX3A 4DTBA 4PMSA 3F3WA 5AUXA 5I4NA 2QU6A 2GNHA 3G90X 4DEAA 1OL7A 1AD5A 2ERKA 3ENHA 4YLJA 1M7NA 3ULIA 3KA0A 4O7ZA 4Y73A 2Z8CA 4I0TA 5GIPE 4DGNA 4LGDA 4HZSA 2Q0NA 2Y7JA 5GJGA 2E9PA 3R7UA 4B7TA 2HXLA 3QTUA 4FV3A 2FH9A 4CXAA 3SOAA 3LMHA 2VO0A 3EKNA 5GJDA 3R7GA 3N9XA 4YC3A 1PY5A 3NNUA 3P78A 4JR7A 3LXKA 2VTTA 3TJDA 2VTPA 3VS3A 5HZNA 3JS2A 3FEGA 4F9AA 5AP2A 4RA4A 3ID6C 3LMIA 4LM5A 3P5KA 3JPVA 3PYYA 3GI3A 3R02A 4EH2A 4IAZA 1NT2A 4W4VA 2JLDA 2VTIA 4PDSA 4ZY6A 3DXPA 2YCRA 1PYEA 4RIYB 2XK7A 4FTTA 2GHLA 4JIKA 2W1GA 4O0VA 2V5QA 4H1JA 3U8WA 3DB6A 3FSFA 3COKA 2F7XE 4EUTA 4E20A 3R00A 4QYFA 2O3PA 4ZSAA 4JG8A 4C2VA 3CSVA 3BLRA 1GOLA 4MWHA 1ZZ2A 2DS1A 4QQTA 1H4LA 2C0TA 2XEZA 3GCVA 4IXPA 4R7HA 3TV7A 1URCA 5HESA 2OIQA 1PMVA 1ZXEA 3COHA 3TDWA 1BI7A 4NSTA 3WF9A 4ZS4A 1MRUA 2XJ1A 3NYOA 3DJ7A 2R3HA 1OECA 2W1HA 4LV5A 5CQUA 3QLGA 4F70A 2CCHA 5EW8A 3VUTA 1YI4A 4LG4A 5IQGA 4RZWA 4Y83A 2OG8A 3CCNA 1XQZA 2B1PA 4M0YA 3DFCB 3JUHA 1YHVA 4NT4A 5HVJA 2JFMA 2JKKA 4K11A 2QR7A 3GQLA 4MXXA 2ZMCA 1PRYA 4YO4A 5EG3A 2JAVA 3F5PA 5FXSA 2QU5A 1YWVA 4EOPA 2CN8A 2YCSA 2W5BA 1LUFA 4FTJA 2J0LA 5AP5A 3P08A 4OT5A 1L8TA 5M55A 4D9UA 2C6KA 2YIQA 3FLQA 2WTKB 3OW4A 4AFJA 3ZOSA 4WUAA 3UBDA 1ZLTA 2P0CA 2WTKC 3W2QA 2J0KA 3BE2A 4C59A 2CNUA 3OT8A 3PXYA 4RMZA 4DTKA 1JSUA 3ET7A 3LCSA 3QCSA 4IEBA 4DBXA 4BGHA 4QP9A 1P4FA 3VAPA 4R5SA 3S4QA 3MDYA 3WF8A 4JVGA 3FMMA 4ZEGA 4UMRA 3BHYA 5GZ9A 2CCIA 2CDZA 1P2AA 4O0UA 3N51A 4RJ3A 1UKHA 4F65A 3DXQA 2WEVA 2WQMA 4G1WA 4XP3A 5IA1A 2UVYA 5K9IA 3MI9A 3FI4A 3SV0A 2FSOX 3C4XA 4G16A 2OKRA 5BVEA 3DY7A 5HTBA 4RIXB 4CMTA 4D2SA 4ANQA 4DEIA 4EOIA 1NVSA 2WXVA 1KUTA 2VWXA 4RFZA 3GGFA 3V8WA 2W4JA 1DAWA 3ALOA 4F7JA 4BKJA 3E8NA 4O82A 4GT4A 5KMJA 3PJ3A 4DHFA 4YZNA 3UGCA 4FZFB 2C6IA 3SD0A 4HVHA 3V5PA 2UW8A 4GH2A 1FOTA 3R1NA 4U97A 2P3GX 4ZK5A 2VNWA 1ZMWA 3I5ZA 3IDCA 4I20A 2RFEA 2UW9A 3REPA 3U9NA 4PNKA 4IWPA 2XIRA 4OBOA 3GOPA 3IG7A 4WG4A 3R83A 2HZNA 4YNEA 2JC6A 3MH3A 4FEVA 2UZUE 2O0UA 3FY0A 5DT4A 4I23A 5IQCA 4QP1A 1K9AA 3PXRA 3PY1A 5C8KA 2PVHA 3DFAA 5H9BA 3EN5A 4I0SA 2W5AA 4HOKA 2BVAA 3C13A 4FR4A 4IM0A 1KV2A 2JBPA 4W9XA 4UBAA 1X8BA 2V7AA 4FVQA 5FRIA 2XK9A 4CV9A 5A4QA 3NUAA 3WOWA 3FLZA 2Y0AA 3DBCA 3RBWA 4CCBA 4BRXA 3QWKA 4D2VA 5A4LA 2VX3A 3FWQA 1SNXA 5IA4A 4C02A 4QD6A 4MD9E 4JRNA 4L44A 3T9IA 4KNBA 1YDTE 4BYJA 3UVRA 3BLQA 2QVSE 3MJ2A 3NYNA 1O6LA 3R71A 4K9YA 5CU0A 3LKMA 4S33A 3HMNA 4BR3A 4KKHA 2Y9QA 1SNUA 2ZYBA 3OVVA 4U80A 5J8IA 1AQ1A 2CGXA 4FKUA 1KOAA 1WBSA 1PXKA 4LRMA 2W06A 1BL7A 3OWLA 4D0XA 4F08A 4OTRA 4TRLA 3UO4A 2YAAA 4A4OA 4C38A 5ETCA 1UU8A 5HGIA 5HIEA 1J7IA 4AZVA 4KRCA 2OXYA 4BDIA 2OFUA 2BZKB 4FKSA 3V3VA 5CSVA 1GAGA 3NAXA 4CD0A 2OXDA 5IEYA 3ZTXA 3PLSA 4P5QA 4ZS0A 2XCKA 2LAVA 4HVGA 4RQVA 1YRPA 2BHHA 5AUZA 5ANGA 4GIIA 4QMVA 4ACHA 3SG8A 3D2KA 3HDMA 4II5A 4QP7A 4KS7A 1H28A 5EYCA 5AM6A 2HK5A 4FKIA 4BDEA 4HVIA 4FZ6A 2X6DA 2J9MA 5D1JA 3Q96A 3M1SA 4R3PA 2FYSA 5A4EA 4BZNA 4FV0A 1U5QA 4A06A 4KIPA 5C27A 3ZSGA 4F6SA 4C8BA 5FXRA 4QMTA 3HRFA 5HIBA 4FSZA 3W8QA 2VWVA 3IECA 3R8ZA 3VS2A 3W2PA 4CCUA 4DEEA 1R0EA 3OROA 3GOKA 4EOMA 3BEGA 3MESA 4O7SA 3GCQA 2XYNA 3EQBA 4PL4A 3ZBFA 3LFFA 4AACA 1YQJA 3JVSA 3DKFA 2XIKA 3ZFMA 3WIKA 5EW9A 5F1ZA 1LP4A 1F5QA 2WHBA 2IW9A 3RK5A 2PYWA 3RAHA 3PXQA 3ORLA 1UWJA 5LVLA 1ZYCA 3O8TA 3ORIA 2OZAB 5L4QA 3ORNA 2CPKE 4TYIA 4AS0A 3W2OA 4JQEA 4FKVA 4EOSA 4ZZOA 2JIIA 2PVYA 1T45A 2BZJA 2FSTX 5CX9A 3T3UA 4EK8A 2PZ5A 1R78A 3KCFA 2J0JA 4CG8A 3VW6A 3U4WA 2LGCA 4FEQA 4X6RA 4UWCA 3BV2A 1V1KA 5GJFA 4ZJJA 2DYLA 1F3MC 2O8YA 3VQHA 2X2LA 4QPAA 3V8SA 3KXHA 3BYOA 3MVMA 3BBTB 4MXCA 4RX8A 4E5BA 1SM2A 4MBJA 3VC4A 3TUDA 4AN2A 3VUHA 3AT2A 4FT3A 5ANDA 3DZOA 3FI3A 5HE1A 3FZPA 5L2IA 4BDDA 4C58A 5EKNA 4L7SA 3FL5A 1KE5A 3HP2A 4NM3A 2C68A 2F2UA 4FIEA 4TYHA 2HZ4A 2Z7SA 3THBA 4HYHA 3TXOA 1PXMA 4U5JA 4FKJA 4UV0A 3CQWA 3K54A 4NIFA 5I3OA 1WZYA 3FXWA 3O2MA 5CSWA 3RI1A 3T8OA 4EBVA 4HYUA 5JMSA 1ATPE 1Q97A 4QMLA 4U43A 2XNEA 4DEHA 1WBWA 2VGOA 3FUPA 3PVWA 3TDVA 4EKLA 5GNKA 3FZ1A 2ITQA 3LIJA 4ACCA 4MK0A 2QO7A 2WTJA 2JDTA 3G9NA 4QQCA 3TWJA 4CG9A 2UV2A 4RX9A 4X3FA 5HO6A 3C4WA 2XK3A 3C51A 4L9IA 4CLJA 4BBMA 1GZKA 3UMWA 2GU8A 4M8TA 4O6LA 4BTKA 4JDJA 3EMGA 4GT5A 3VUMA 2UW5A 4AGUA 4X7QA 2NRUA 1IAJA 5CEKA 3BQCA 3MFTA 4UXQA 4GUBA 2WMRA 3CIKA 3PUPA 2P2HA 1W7HA 1J3HA 5KZ0A 5I9ZA 3D0EA 5FM2A 5L3AA 2Y6OA 3OUNB 3ANRA 4G3EA 3RK9A 1U46A 4TYGA 1YWNA 4ZXTA 2OBJA 1PMUA 2PWLA 1PKGA 3FJQE 4UN0C 3UOHA 2IVSA 4TY1A 2YA9A 3RALA 3NUSA 1WBVA 4FNZA 5FTQA 2VN9A 1WBPA 1SMHA 2B9HA 5FEDA 5HD7A 2ZM4A 3PXKA 4Q2AA 5EM7A 5J95A 4YMJA 5IA2A 4NCTA 2QOFA 3Q9WA 3TV4A 4FKWA 5CAPA 4TWNA 4LRKA 2YZAA 4UMTA 5JKGA 4MBIA 3HUCA 5EW3A 1CKPA 5J7BA 1E1VA 2C5YA 2YM3A 1PYXA 3LOKA 3NCZA 3E3PA 4TWOA 3ORTA 4OBQA 2UW6A 1OGUA 3GC7A 1LEWA 2QONA 4QNAA 2F9GA 2J0MB 1VYZA 3RPSA 4ZP5A 4G3GA 2WQEA 3R9RA 5DPVA 5E4HA 5A4TA 3PRFA 4XV2A 3UNJA 3ZM4A 2VV9A 3Q4ZA 3PVGA 4EC9A 2ETMA 5K0KA 2YAKA 3OWJA 4KINA 3E92A 2QHNA 4QTDA 4MNEA 4YTHA 3WZEA 3OEZA 2YM6A 3UIMA 3VIDA 4F1TA 2A2AA 4A4XA 5F94A 3O8UA 3BLHA 3HMOA 4F1OA 3UTOA 1CKIA 5IMEA 1FBNA 4YZBA 3KRXA 2KULA 4MD8E 3F3UA 2YHVA 5EHYA 5FG8A 4RT7A 4BHZA 4IWDA 4XNEA 3EN9A 2HENA 4AAAA 3DXNA 3IDBA 4J52A 4IVCA 4EYMA 2Y6MA 5JQ5A 4MD7E 4XG7A 3UIBA 3UG2A 3HZTA 1O6KA 3V51A 4DEBA 4V0GA 5AIRA 4DFBA 3Q5IA 4B99A 1WAKA 4IX6A 5F9EA 5J9ZA 3PTGA 2NPQA 3BGPA 4NIFB 1A06A 2W1EA 3DNDA 4NU1A 2C6TA 4IB3A 3DPKA 3LHJA 1PXIA 4G9RA 1H0WA 4PTGA 5JGDA 4R78A 1JBPE 3KULA 3CPBA 4FZ7A 3EWHA 1H07A 2WAJA 2UUEA 3BBWA 3PJCA 3RINA 1REJA 4ZMEA 3PA3A 2OJ9A 3QXOA 3Q3BA 3QXPA 4FTOA 5ANOA 5G6VA 5FDPA 2X7OA 1O6YA 1BI8A 2A4LA 3O8PA 3QZHA 3PWDA 4ZSEA 4X3FB 4YJOA 4HGEA 4AT4A 5IPJA 4HGTA 2JIVA 2W1CA 3GP0A 4IB5A 3QKLA 2J51A 2C3JA 4DBNA 3AD4A 4X3FC 5C8NA 4M69B 4ONAA 3UC3A 2YLEA 3WF6A 2C3KA 4BIEA 4E7WA 2QOCA 3O7LB 3RWPA 4GYIA 4NWMA 2F2CB 2XB7A 2QNJA 3GUBA 4CFVA 2QC6A 4BWPA 5EKOA 5BUEA 3P79A 4LQMA 3C0GA 4I5CA 3EQGA 1VJYA 3CP9A 3ERKA 4QNYA 4QTAA 4BCFA 2ZDTA 3KVWA 3IQ7A 4CRSA 4N70A 3FDNA 4G3CA 3BU6A 4HJOA 1BUHA 3EQPA 3H10A 1M2QA 3QF9A 2PUUA 1OI9A 3FBVA 4OTPA 2RIOA 4OT6A 4X2KA 5HG7A 4CLIA 2BRNA 4CTBA 2W5HA 2HAKA 5ETIA 3ROCA 1XBAA 3BYUA 1VR2A 4ZTLA 3VS0A 4PPBA 1IA8A 3OBJA 3MN3A 5HO7A 2X6EA 3AC8A 4NCTC 4UMPA 3NZ0A 1JKTA 2R3KA 3GT8A 2PVMA 2W05A 3MGYA 3QC4A 2UVZA 2P4IA 4BCIA 1YXSA 4YLLA 3SGCA 1OZ1A 3QTZA 4O1OA 5HLPA 4R7BA 3A99A 3FLNC 3R22A 4NEUA 4GK3A 4O86A 3MPAA 3A60A 3G15A 4Y95A 4CFNA 2WMQA 2G1TA 4OR5A 3D7TA 1WMKA 3JY0A 2ETKA 4WSYA 4KIOA 3BIZA 4HYIA 2YM4A 1A9UA 1ZOEA 3QTRA 5ANEA 5KUPA 2IO6A 3I6WA 4MNEB 4OLIA 2VD5A 4FX3A 5CT7A 5FEQA 2IWIA 3RAKA 3FMHA 3VBYA 5AUWA 3RAIA 4RFYA 4GT3A 3VUGA 3QQHA 5DEYA 5E1EA 4DH7A 4C4JA 5DFPA 5CTPA 1MRYA 3ORXA 5AR2A 2PE1A 2OZOA 1KWPA 3KRRA 4FT7A 1UNGA 2YJSA 4B8LA 2REIA 3LXLA 1I44A 5M4UA 4IANA 4ASEA 3HP5A 4FOCA 3ETAA 4D5KA 2C47A 5BYLA 1JNKA 4EI4A 3EQDA 2QR8A 2R3NA 4LUEA 1UV5A 3RVGA 3QA0A 2WU7A 1XWSA 3P86A 4UX9A 3QKKA 4BIBA 5D9HA 2V7OA 4JG6A 3QRIA 5IMXA 4LL5A 4D1ZA 4QMYA 3OCTA 5ACKA 1YDRE 3OY3A 5E90A 2HW6A 5AA9A 5AAGA 3MFSA 4ZSGA 4AOTA 3JXWA 1W8CA 2UZDA 4S32A 3BHUA 2QOOA 4WG3A 4Y46A 3R9DA 5EM5A 4DF3A 4XH6A 4IZAA 3VRZA 5IU2A 5LOHA 4U41A 3BELA 4ANMA 4I5PA 4RIOA 4QMSA 4ZLOA 3COIA 3TL8A 4D0WA 3AC4A 3R8UA 3R73A 5EDQA 3OT3A 4YR8A 3BPRA 3DDQA 5ETFA 2Q0BA 4LL0A 5E9EA 1CKJA 3BGQA 3GVUA 4FIFA 2Z02A 1Q41A 5J1VA 2YWVA 4DFUA 2EXMA 3CE3A 3VF9A 3WIGA 4NFNA 4E73A 4L52A 2QHMA 3RK7A 3DJ6A 4IAKA 5L2SA 4G31A 3MA3A 4A4LA 4EHGA 4P7EA 3R2BA 4NH1A 5FTGA 3ZLSA 3UNZA 1U5RA 3DBDA 3Q4TA 4OTHA 4B4LA 2ZOQA 3BHTA 3ULZA 3ZLWA 4Y85A 4HCUA 5DNRA 1RDQE 2QG5A 4QP8A 1J7UA 5E7RA 3TKUA 4BWXA 5DWRA 3C5IA 2OSCA 5BVNA 4PNIA 1JKLA 4WBBB 1HOWA 2ONLA 4LUDA 2YEXA 3G6HA 4I0RA 4RLKA 3F66A 4I5MA 3NNVA 2X4FA 5CLPA 4AZTA 5JFVA 2WZJA 1L3RE 3QTWA 5FLFA 4NM7A 3ZC6A 3ITZA 4DT9A 3NS9A 2XJ0A 3AC2A 5T68A 3D7TB 4CKIA 1NY3A 3GU5A 3GC0A 4FSYA 4JT3A 4IE9A 3IDPA 1OPJA 4A9SA 2WTDA 2XH5A 4BI2A 4HYSA 4FVPA 4BGQA 3A7IA 1Z5MA 3QQFA 4RIYA 4EQCA 1H27A 4C61A 4DGMA 4LOOA 2XKEA 4O27B 4M67A 3QHRA 3W55A 4A07A 3C7QA 2R3OA 3RNYA 5CYIA 4BDJA 2I1MA 3OCBA 3A7JA 3RKBA 3NLBA 5HCYA 4C4EA 3NVMB 5LMBA 4IACA 5KBRA 3AOXA 2F7ZE 2BKKA 3DK6A 1OKWA 3CGOA 3COMA 2YISA 4AN3A 4C33A 4B6LA 4O22A 3UJGA 4FTCA 4DINA 1OIYA 1JKKA 3A4PA 3DKCA 5HTCA 5J79A 4JQ8A 5JSMA 5M56A 3KXGA 2JKMA 2QOKA 4LYNA 4QRCA 3SVVA 1WVXA 1YI3A 5KNJA 4J1RA 3AMYA 3A7GA 1CM8A 2ITYA 3BGZA 3QYWA 3CC6A 3TI1A 4EC8A 5HVKA 3C0HA 5IEVA 2BZHB 4ITJA 2OH0E 5IQEA 3LMGA 3PJ8A 3QL8A 4RC2A 4USFA 3LJ0A 2B0QA 4AA5A 3P7AA 3FMNA 4N6ZA 4QYYA 3E7VA 4DLIA 3R2YA 2CJMA 3M42A 2W0JA 5DGZA 3A7HA 4FV1A 4O2PA 4MAOA 2R3FA 4AW5A 4E5WA 4XLVA 3DK3A 5LVMA 2ITNA 3F2NA 2WTIA 3QHWA 3VUKA 5LCJA 2IPXA 3N4UA 2ERZE 2GSFA 3Q6UA 1FGKA 3SXFA 3CY2A 3AXWA 1KV1A 4IX4A 4JR3A 1V0PA 3PP1A 4GK2A 4V01A 5E8WA 4CZUA 4EZ5A 1REKA 2W9ZB 4U79A 4U8ZA 5A4CA 5D7AA 4FZAB 5EDPA 3KC3A 2VZ6A 2X9EA 1OL2A 5AUTA 4GW8A 5FBNC 5E1SA 4X2GA 1HCLA 4IB1A 4M15A 2UZVA 4FNXA 4UZDA 3DDPA 4WO5A 3TUBA 4G17A 4TKSA 5B2LA 3LVPA 1XH4A 4OUCA 1BX6A 4QP3A 3V5QA 4G5JA 4L43A 4LRJA 3FYKX 2QLUA 3F5XA 4BCGA 2YIRA 4ORKA 3WI6A 3Q6WA 5IH6A 4J8MA 3R30A 3ZO4A 1ZYLA 3QZFA 3T3VA 2ONLC 4FTQA 3KN5A 5FBOA 2GHMA 2ITPA 2O65A 2OIBA 3FHIA 3NW5A 4JBQA 5DG5A 3EFLA 4RIXA 3U87A 3UP7A 4BCPA 5A46A 5CEPA 5DLSA 4KRDA 4F64A 4YP8A 5AV2A 3F69A 4O7NA 3EKKA 4YJTA 1M17A 5CEMA 2ZM3A 2ITVA 3GU4A 4D2PA 5C4LA 1JKSA 5BUJA 3DKGA 4L8MA 4E26A 4EOKA 4NTSA 1KE9A 4ACGA 4F1MA 1ZRZA 3D5WA 3IOPA 2BRBA 4M68A 3D5XA 3P4KA 4ZTNA 3OXTA 4MNFA 3ZRMA 4AG8A 4EYJA 4FSRA 3QCXA 1PXOA 2ITXA 3O71A 3HGKA 4IFGA 4IVDA 4YGAA 2YM5A 4D4VA 4HGLA 4G3FA 4FOBA 4E6DA 2QODA 2JFLA 2GQGA 3VW8A 1FVTA 1OVEA 2VX1A 2GTMA 3BZ3A 3DBFA 3UPXA 4JQ7A 3QQKA 5L6WL 4N57A 1Q5KA 5M06A 4IWQA 2RL5A 4QQ5A 1PXPA 5CI6A 3MVJA 3PA4A 3BYVA 4E4LA 4FEXA 3ENMA 4HCVA 1U54A 3SG9A 5ANJA 5HBJA 4Q5EA 2V55A 3RM7A 1XBBA 4UYAA 4Z7HA 4ANBA 3MTLA 3QZIA 3R63A 3Q52A 4RJ8A 4RPVA 1IEPA 1YXUA 3LQ5A 5E8VA 3G6GA 3BQRA 3R21A 4L67A 4KBKA 3ZFXA 4XG2A 3FC2A 4G3DA 5C8MA 3ZO2A 2O64A 4BBFA 1JWHA 5KBQA 1PMNA 1E9HA 2RFNA 1H8FA 3WZUA 4R77A 4I5HA 1PXJA 3UYTA 3L1SA 2QOLA 3IKAA 3TG1A 5DA3A 4IX3A 4O1PA 5CF5A 3QD0A 4R8QA 5AAFA 3HNGA 5KHXA 1H1SA 4L46A 4JX7A 5D11A 3R8PA 4IM3A 4Q9SA 5CAVA 2SRCA 1G5SA 3L9PA 2ZJWA 4UB7A 5J9LA 3HL7A 2CSNA 2J90A 5CI7A 4FKQA 4GL9A 3SAYA 3SXSA 5K4JA 4MXOA 4BTJA 2GNIA 2OU7A 4WSQA 4WOVA 3OC1A 5CANA 3V8TA 2WIPA 4LOQA 4DT8A 4WNMA 3CLYA 4YHTA 4CSVA 4ZLYA 2GDOA 2WB8A 4G6LA 2UZTA 4RWJA 4G2FA 3R7YA 5A6OA 3LQ8A 4EUUA 2QOHA 3VF8A 4FEUA 4O7VA 1YOMA 5DR9A 1VZOA 4C34A 4L3JA 2PZRA 4GU6A 1JQHA 1UU9A 3LZBA 4BDGA 4YJUA 4RVTA 1Q24A 5IQBA 2JIUA 1Q4LA 5HD4A 1Q99A 3NPCA 2C6MA 1NA7A 4XP2A 1BL6A 3DNEA 4L6QA 2DQ7X 4XOZA 1KSWA 3RJCA 1SVHA 2QQ7A 3BU5A 3LFQA 4I24A 4P2KA 3DCVA 4S34A 4XG4A 4Y5HA 2OH4A 5IG1A 3PLAE 4L01A 4C3FA 1B6CB 3DBEA 4AA4A 3NDMA 3QRKA 4FNWA 3KEXA 4YHFA 2BDFA 5IDNA 1FVRA 3FYJX 4EOOA 5JGAA 3DLSA 2W1ZA 3FY2A 2OZAA 2VWWA 2VTAA 2YZLA 5CSXA 5KMLA 2EB3A 5CXHA 3U4UA 4AOJA 5LARA 2I7QA 5F20A 3SHEA 2HZ0A 4IDTA 4X3JA 2JDRA 4FUYA 4YZMA 5CAUA 2BIYA 1H08A 3FL4A 4I4EA 4O0WA 1OIRA 2XNMA 4AFEA 3F5UA 4F7LA 4TW9A 5JFSA 4IWOA 2JBOA 4YZCA 4IW0A 3HV5A 3GFWA 4FSTA 1R1WA 3C5UA 4IAAA 2UZOA 4RWLA 5G1XA 4DCEA 4BCNA 2XEYA 1U54B 3MY0A 4DTAA 4FT0A 4MTAA 2OI4X 5DN3A 3S2PA 2PE0A 3NNWA 4R6VA 3S3IA 2JKOA 1PKDA 2WMUA 2OFVA 3UC4A 4W4XA 1NW1A 3L9LA 4BFMA 3W2CA 2BFXA 4AOIA 2ZV8A 5CU4A 3M2WA 2YIWA 2F4JA 3NX8A 3H9FA 2WEIA 4OTFA 5FQDC 2X81A 4DA5A 4CYIA 2G2FA 2YIYA 3FZOA 2WMSA 4XUFA 3BE9A 2YERA 1H1QA 5EI6A 5HLWA 2I0VA 5HIDA 3RTPA 4QTEA 5M53A 3R9OA 5BVWA 1YXXA 2BTRA 3SDJA 4AU8A 4BVUA 2CMWA 3AGMA 4APCA 2NNWB 3POZA 3ZZEA 3D2IA 1OMWA 5B7VA 3QZGA 3V6SA 4CZYB 3PSCA 5AFVA 3GFEA 3OEFX 4WUNA 4DG3E 1UU3A 5CZIA 4NM5A 3ZONA 3GEQA 1RQQA 1XH8A 4EH5A 2XK6A 3QRUA 1NVQA 2XNOA 5AEPA 2ETRA 3DA6A 2H96A 2VUWA 4U9AA 1GZOA 2X9FA 2X2MA 2XNGA 4WBOA 4PL3A 3VBXA 3DTWA 1GY3A 3W33A 2J5EA 5AR8A 3IW4A 4TYJA 3R6XA 3ZHPC 3ORMA 4BIDA 3KY2A 1CMKE 2NP8A 3D5VA 5IA3A 3GC9A 4QT1A 5JT2A 2VWUA 3C4CA 5BVOA 4M14A 2IZRA 4TYEA 4R3CA 3NAYA 4ZOGA 5JZNA 4YBKA 1GZNA 2VO6A 4CNHA 3DV3A 5TE0A 4I22A 2XBAA 1MRVA 5DRDA 4D58A 4V04A 4EH4A 3BU3A 4JL9A 4BTMA 4EOQA 3C4ZA 2HCKA 5IQDA 4X2JA 3MTFA 5CASA 3HRCA 3E64A 4RIWA 1LEZA 1Q8YA 4GJ2A 4DGLC 4EWHA 5J7HA 3QD3A 1TQIA 2GNJA 3SC1A 4J71A 4ANOA 3ZO1A 4EK6A 3W1FA 4M84A 3D7ZA 3ZXZA 2Y4PA 2V62A 4FSUA 5BUIA 2C6OA 2VX0A 4O0XA 4O96A 2CLXA 4E1ZA 4F63A 5JGBA 3QQGA 5IUIA 3LLAA 1TQPA 2XP2A 3NIZA 3VHEA 4IZYA 3PPZA 2PMLX 3GNIB 4KSPA 4GK4A 4XMOA 2XNNA 2R9SA 3EFKA 2BALA 2F7EE 3PA5A 4JNWA 2FSMX 3BWJA 3H4JA 1KOBA 5EM8A 4UY9A 2VU3A 5IA5A 2PUNA 4PMTA 5H8GA 1OM1A 2OXXA 3GENA 1YHWA 4EK3A 4M66A 4EBWA 3I6UA 4O0RA 4BKZA 3UZRA 5M51A 2B9JA 4IADA 1UWHA 2BAJA 3CD8A 4LFIA 3RPVA 3FQSA 4J98A 3PXFA 3QALE 1H0VA 3E87A 4FG9A 3B2WA 5EM6A 3O50A 4S30A 4FV8A 4O0SA 3IW6A 4ZLZA 3OOGA 4MXZA 3ZBXA 4M69A 3SW7A 4U40A 5CXZA 4GIHA 5CNOA 5JK3A 2W1FA 3AD6A 2XMYA 4I41A 5HE3A 4QMWA 3F82A 4K8AA 4FGBA 5L6PA 2VO3A 4KBAA 1YWRA 1GZ8A 4OTGA 1XBCA 3G2FA 3UDBA 5LCKA 5CEIA 1BLXA 2EVAA 3EOCA 5JRSA 2BUJA 5D41A 2EWAA 3CKWA 4XG8A 4U81A 2EU9A 1Q8WA 2ZV9A 2HWOA 4NK9A 4CGAA 4DE4A 4OGRA 4F09A 2FO0A 3LE6A 4LGHA 4EJ7A 3W2RA 1H1WA 3NWWA 3OTVA 5AP6A 4MEDA 2PZPA 4MF1A 4YLKA 3FMDA 3TEIA 4BCMA 1OKZA 4NM0A 4DH1A 2E9NA 3ZH8A 2ITWA 3C1XA 4AGDA 1H24A 3KL8A 3Q4CA 2WIHA 1H01A 1ZMVA 5M4FA 5CS6A 3HECA 1WBTA 1OIQA 2YDKA 5DT0A 5ACBC 3PG3A 2O5KA 3DLZA 3R8LA 4MYGA 4CFFA 3LQ3A 2C69A 2J4ZA 4X21A 4FICA 4NUSA 4KWPA 5H8EA 4BDAA 3E3BX 4H05A 3TNIA 4E8AA 3R9NA 5GZ8A 1HCKA 3UPZA 5AR3A 3B2TA 5HKMA 1B38A 5HU3A 3F9NA 4N4SA 1ZZLA 2WELA 4RIWB 2CGVA 4WD5A 4AE6A 2E9OA 4W9WA 4C7TA 5EHLA 2GTNA 3VS7A 3OWPA 3MIAA 4IMYA 4R5YA 4Z9LA 3MH0A 5HNIX 1Y8YA 4C57A 4C36A 4FSNA 4TWCA 1H26A 2VTOA 4HZRA 4DLJA 4CMUA 3QRJA 3F61A 2O2UA 2Z7RA 3MPTA 3Q2JA 2BILB 4IBMA 2DWBA 3WARA 3FAAA 1OUKA 5CZHA 3ZU7A 5JEBA 4O38A 4MKCA 4UEUA 1MQBA 3DKOA 5KX8A 3PSBA 4YJVA 1ZARA 2YIXA 2CKOA 4PV0A 4FEWA 1H00A 2R0IA 3GC8A 3ZUVA 4FL1A 3LXNA 1VEBA 4HPTE 4LMUA 4OTDA 4C2WA 4EHEA 3PZEA 3PRIA 1OIUA 4Q9ZA 4IH8A 4DFYA 2XBJA 4GSBA 1FQ1B 2PVJA 4CV8A 3HAVA 4WNOA 2PMIA 4FK3A 4YUQA 4DEGA 5I5ZA 4QP4A 2JGZA 2EB2A 3DAEA 4GV1A 4IZ7A 2A27A 3U6HA 2Y8OA 1TVOA 3D83A 4XEYA 1DAYA 5LVPA 3DJ5A 3ZDIA 2W1IA 3A8WA 3EZRA 3QC9A 5I9WA 5M08A 5BX0A 3MH2A 1S9IA 2R3IA 3KXZA 4FKRA 2ACXA 3QU0A 4L45A 4ZIMA 4J96A 3RPYA 3FQEA 3PY3A 5KMKA 2OJGA 2QO9A 1K3AA 1R3CA 4D4YA 4DFLA 3C50A 4EL9A 3HEGA 2XIYA 4KAOA 3GXLA 2W9FB 3WILA 2JEDA 3PVBA 4CQEA 3W2SA 2WQOA 3BKBA 2IW8A 1SVEA 4TWPA 4WNPA 3PWYA 3FKOA 3VS4A 2XKDA 4RZVA 5D12A 4GKIA 2P2IA 4YJNA 4CKRA 2H6DA 4MF0A 1SYKA 4AZWA 3I81A 5HU9A 4QTCA 1Q3DA 2RFDA 4BGGA 3JVRA 3ZRKA 2BDJA 2BIKB 4BF2A 3P7CA 5IEXA 2VTQA 5B0XA 2QKRA 3MV5A 3KMWA 4WRSA 4FG8A 4HW7A 5KZIA 5CU3A 4N0SA 5BQ0A 2JDSA 5BYYA 4ANLA 4C4IA 1H1PA 4U7ZA 4PPAA 4B8MA 5B2KA 4IAYA 3K3IA 1QCFA 1BMKA 4QO9A 3D5UA 4JDHA 3Q32A 3NGAA 4J99A 5IDPA 2WMVA 4G9CA 4O21A 1YDSE 4IM2A 3UZPA 4MVFA 3ZM9A 4GEOA 2PTKA 3KF7A 5AV3A 2WTWA 2XRUA 4TXCA 3S95A 4U44A 2C5OA 2PMNX 3LJ2A 1M7QA 1M2PA 3ALNA 3I7CA 4FYOA 4YZDA 5AWMA 4U0IA 5C03A 4V05A 4EOLA 3S0OA 2BMCA 4G34A 3G33A 1FPUA 2G2HA 5EI8A 2QI8A 3HLLA 4XYFA 3R7VA 3ELJA 3UYSA 3E63A 4K0YA 5EHOA 2DUVA 3QFVA 5EYKA 4CT1A 3AC5A 3JYAA 3VS5A 5M44A 4F7SA 3WE4A 2C5NA 3B8RA 3F3ZA 4AT5A 3HV3A 4GKHA 4C4HA 3AG9A 5AP4A 4LGGA 3GCPA 3PPJA 4YPSA 5AUVA 3E8EA 5JZJA 4BN1A 3FZTA 2QG7A 1XHAA 4J53A 4DGGA 5B2MA 4H58A 5E8YA 4BHNA 4O91A 3OCGA 1DI9A 4X2FA 4K1BA 3FLYA 2J6MA 4TT7A 5AA8A 5JH6A 1WBNA 2R2PA 3KMUA 1Y57A 3QGYA 3NUXA 1URWA 2B55A 4KB8A 3RP9A 4E6CA 4H3QA 2B9FA 3KXNA 4EKKA 1IAHA 2ITOA 3CEKA 4BCQA 3EQCA 2X1NA 4S2ZA 4RVKA 1PXNA 3UQCA 4FV4A 3K2LA 3ORZA 4OTIA 2CKPA 4L42A 5L2QA 4XJ0A 4O7WA 5LMAA 1YOJA 2YABA 5CEOA 4HVSA 5JN2A 5TF9A 4DYMA 2VTRA 2Z7QA 5TT7A 2ZDUA 3SRVB 2ZMDA 5CALA 2BRGA 4XG6A 3NNXA 1FVVA 3VJOA 4YJRA 3TNPC 5L6OA 2VWBA 3R7IA 2QCSA 4C35A 2IVUA 4FV9A 3FZSA 2YM7A 3OZ6A 3MYGA 3UO5A 4I1ZA 4XG9A 2X8DA 4RC4A 2XM8A 1QPJA 2WMTA 3AD5A 3F5GA 1OPLA 3IK3A 3FHRA 3QAME 3TCPA 3TZMA 3U55A 3KK9A 3NMUF 1BKXA 5AV0A 3DS6A 5KMOA 3QCYA 1DS5A 2GPHA 5FWKK 2BPMA 1O9UA 4HNIA 4YJSA 4I6HA 5H3QA 4FZDB 3ZRLA 2PPQA 2XM9A 2PZIA 4D4SA 3ZMMA 4YC6A 4WRGA 5DBXA 3A61A 4IJPA 4YZ9A 3WF5A 4XV1A 2O63A 5HNGA 4L7FA 5HG8A 3I5NA 4I6FA 5AMNA 4EH7A 1XH7A 2PVLA 2R3RA 4TTHB 3I0OA 5EQEA 2W4KA 3HMMA 4PL5A 3FQHA 3PP0A 4UMUA 3RMFA 3ZDUA 4NW5A 2HELA 3VJNA 3ZSHA 2PULA 4O81A 2KTYA 5I9UA 2C1BA 1APME 4MWIA 4IX5A 3VWAA 3WYXA 4BDBA 5GINE 2XRWA 5HLNA 3N4TA 2W4OA 3EFJA 3PE2A 5E8TA 3ZEPA 4ZJIA 4JDIA 4F4PA 2OW3A 1XH6A 2ZM1A 3BYSA 1KE7A 3QBNA 4K2RA 2UZNA 5FM3A 4K6ZA 3UIXA 3HX4A 2GS2A 5BVKA 3IGOA 3VBWA 4DAWA 4Z3VA 4ZTHA 1ND4A 2YCQA 3L9NA 1JSVA 4L53A 3WZKA 1A48A 4JDKA 4PQNA 5K0XA 4O84A 3MS9A 2QD9A 3LJ1A 4EHZA 3BWFA 1G3NA 4FTKA 5DE2A 1MQ4A 2FVDA 1AGWA 3F2AA 4LOPA 1Q8ZA 2IW6A 4FTUA 3MA6A 3QTIA 4QMZA 4PDOA 5CT0A 3I0QA 3RCJA 5HX8A 3LFAA 1Q3WA 3O96A 2PHKA 2VWZA 1XR1A 2Z7LA 5DVRA 4ANNA 5BPYA 2QURA 2GNLA 4BZOA 3R01A 5GZAA 4JLCA 3UOJA 1ZY4A 3D14A 1J1BA 4Z7GA 2CKQA 4E4NA 1TKIA 4JRVA 1OPKA 4IIRA 4OBPA 3F88A 5CEQA 4BC6A 3QYZA 4I93A 4D4RA 5AADA 3I4BA 5A54A 1YKRA 3TM0A 1M2RA 2UW0A 3CTQA 3HMPA 4N6YA 4RG0A 4EWQA 1I09A 4F0GA 2PY3A 3FKNA 3L8SA 4PF4A 3HA8A 4X2NA 4ARKA 5J5TA 2VAGA 1ZWSA 2WD1A 1JOWB 1RW8A 4M12A 2Z2WA 4XP0A 5DI1A 4NYEA 3PDTA 3AMAA 4MX9A 3GCUA 2RG6A 3VULA 2BRHA 4MQ2A 5L2TA 4JS8A 2PVFA 4Y5QA 3G9LX 3ZSIA 1WVYA 2X2KA 3ACKA 3CXWA 3NUUA 5E8UA 3G0EA 5HHWA 4U3ZA 3TACA 5LMKC 4OAUC 3E62A 4YNOA 4ASDA 2EXCX 3PJ1A 5EI2A 5IUHA 2PVRA 2CKEA 3QKMA 3II5A 4AXAA 4FTAA 4HPUE 4X0MA 5IISA 2XF0A 4OTWA 5ANKA 4YBJA 3PIZA 4D2WA 4WG5A 4K77A 5A9UA 4YHJA 1Q8UA 4O0YA 1JLUE 5CWZA 4YURA 2X7FA 2AYPA 2ITTA 3NRMA 5FEEA 4D1XA 4S31A 2CNVA 4IVBA 4FMQA 3JR1A 2AC3A 4YC8A 2PSQA 3QTXA 4R3RA 3VRYA 4BWKA 4GVAA 2OJFE 4ERKA 1KE8A 2HW7A 3DQWA 3C0IA 3TKHA 4C62A 2PU8A 3ODZX 4RGJA 4XLIA 3VBVA 3QD2B 3V5JA 4YU2A 1U59A 3NUYA 4EEVA 3BYMA 4JX3A 3V5LA 3DTCA 4XG3A 5HBEA 3A8XA 3MY5A 4CRLA 4MXYA 1WVWA 4GJ3A 2JITA 4NZWB 4EK4A 5I0BA 4J7BA 1XH9A 3UVQA 2I0HA 3AT4A 2BHEA 3EN7A 4F99A 4YTIA 4ZTSA 3VBTA 3ANQA 5EYMA 4ALWA 4NTTA 3VHKA 5EYDA 4FTLA 4GVJA 4C4GA 3E8CA 3ACJA 5A3XA 5ICPA 2R64A 4FKLA 3FPQA 2PVNA 3RHXA 2EXEA 2FGIA 3MWUA 4QYHA 2R3QA 3FXXA 4CTCA 2ZV7A 2ZB1A 2XNPA 4PUZA 4HGSA 3IOKA 2B9IA 3P7BA 1Z9XA 4DH8A 4A9RA 2R3PA 1IA9A 3KQ7A 3LCDA 3OWKA 3R04A 2YDIA 4WIHA 3VS6A 1W83A 3RZFA 4C0TA 2H8HA 2A0CX 4CFUA 4BDHA 1UKIA 2OWBA 2A19B 2B52A 4KD1A 4CFWA 4U45A 4MXAA 5HVYA 3FXZA 4F9YA 4WNKA 3DAKA 4GRBA 4RX7A 5HG9A 2IZUA 4UWBA 4KIQA 3NUPA 2OO8X 3ATSA 3R9HA 3A62A 4ZJVA 2YM8A 2X8EA 3KGAA 4O7TA 4GYGA 4PTEA 3TJCA 3D15A 3KXXA 3POOA 1P5EA 3CGFA 4RFMA 4GUEA 3FPMA 4JI9A 1GNGA 4RA5A 3TNHA 3NEWA 4P90A 3QQLA 3S1HA 4BY9E 5CF8A 4FK6A 4JXFA 3PPKA 4U42A 1P14A 4NKSA 5IQHA 2RFSA 2QO2A 4ENXA 4E4MA 4E3CA 5EH0A 5K4IA 4RJ4A 4E5AX 3QQUA 4CT2A 4BCOA 4QPSA 4NJ3A 3WYYA 2CNQA 2OGVA 4M3QA 1J91A 3SLSA 3U51A 1JVPP 5IKWA 3Q04A 4FV7A 4O7LA 2BTSA 3ZC5A 2BAQA 2WOUA 3BX5A 2WTVA 3QX2A 3KK8A 2H9VA 1IR3A 5IA0A 1NXKA 1UA2A 3W8LA 4AT3A 3QQJA 3DQXA 4WT6A 3KXMA 4CFMA 4D2RA 4FSQA 2GCDA 4KKEA 3LAUA 4Y8DA 1PW2A 4BDFA 3MVLA 4AZEA 4EQMA 5LJJA 4EORA 4F0FA 2XKCA 2J2IB 3JY9A 3QWJA 2ITZA 4F9BA 2W1DA 4ASXA 3ZZWA 4HVDA 4ZTQA 5DR6A 4MHAA 3ORPA 3M11A 4NJDA 4Z16A 3EH9A 4USDA 4ZY4A 3U54A 3ZLXA 5EOLA 5KMNA 5HTIA 2HWPA 2JDVA 3E7OA 3IGGA 3IONA 5E91A 5HCXA 4D5HA 4OAVB 2B54A 2B7AA 4U3YA 3C4FA 4YJQA 5H8BA 5FP5A 5JRQA 1ZAOA 3CPCA 3NW6A 2YFXA 5DHJA 4FC0A 5LWMA 3MBLA 3L8XA 4I4FA 2E9UA 3WZDA 4CZTA 5IH4A 2C5VA 1R39A 4RVMA 4W4YA 4DH5A 4O7YA 4BDCA 3Q2MA 3H0YA 4EH9A 4XHKB 4W8DA 4ZY5A 2GFCA 4JAIA 5FTOA 4FSWA 4JIAA 4E93A 4FI1A 3OMVA 4UMQA 2C0IA 4QMUA 4HCTA 3R1YA 2VO7A 1PJKA 5H2UA 3FLWA 2VTNA 1WBOA 4UALA 4WKQA 3OCSA 2VRXA 5ANIA 4RX5A 1YVJA 3FKLA 3ZS5A 1G8AA 4EK5A 4PMPA 5KO1A 3ZXTA 3CJFA 3LFSA 2B4SB 1RE8A 2E9VA 3CJGA 4ASZA 1YOLA 2HZIA 1H25A 2WFYA 4CVAA 1QPEA 3IW8A 2FSLX 3KRJA 4BZDA 4XBUA 4XRJA 2P33A 3H30A 3PG1A 4YSMA 5AP3A 3QUPA 5CAQA 3H9RA 3O51A 2GS6A 4NL0A 2YWPA 4O83A 4JBOA 5D7VA 2CGUA 5BMMA 3ZFYA 1ZY5A 2YDJA 3NR9A 4YJPA 2WGJA 1QL6A 2WPAA 3A2CA 3MB7A 4PRJA 5TR6A 3MIYA 4ALVA 4BB4A 4M0ZA 1YHSA 3O23A 2BROA 4FT9A 4E6AA 5LVNA 4BDKA 4I92A 2VTHA 3EIDA 5EFQA 3LCKA 3AC3A 4APPA 4IVAA 4K33A 1ZOGA 2UW3A 3VVHA 5HQ0A 4GFOA 2IN6A 2XNBA 3QTQA 5FD2A 2XK8A 5I9YA 5KCVA 4FIHA 2XK4A 4FA2A 1YW2A 5DIAA 4J95A 4E6QA 1ZMUA 1K2PA 3MJ1A 4AA0A 1CDKA 2UZWE 1ZYSA 5AR7A 3I79A 4TL0A 5AUUA 2F49A 1OBDA 4QMXA 1UVRA 3PJ2A 2PUIA 2Y4IB 5EOBA 4ENYA 2OLCA 2CN5A 5AR4A 2Y4IC 3V04A 2PMOX 5M4CA 4D9TA 4Z55A 4BCKA 2AC5A 3NUNA 3IW7A 1BYGA 1M14A 2HIWA 3MFUA 3MVHA 4ANSA 4FL2A 3MH1A 4QMQA 3IO7A 4G6OA 5TKDA 2IZSA 3QA8A 1J7LA 3DB8A 4G6NA 4EONA 3CQEA 2VWYA 4UWYA 4DFNA 2NRYA 3F7ZA 3SW4A 3UO6A 3L8PA 3DK7A 3VUDA 3CY3A 5ETAA 4GG5A 1YI6A 2VGPA 1KE6A 1EH4A 4QTBA 4J97A 3A4OX 1FMKA 3LPBA 5CNNA 3HRBA 1FINA 5CENA 1J1CA 3QX4A 2X39A 4MCVA 4ZAUA 5A6NA 2ZV2A 4USEA 5K5XA 3P1AA 4I94A 4LI5A 4LMNA 4M13A 3NSZA 3UVPA 4EHVA 5C1QB 2OF4A 1Z57A 5IZFA 4FIGA 4AZFA 4GU9A 3UP2A 2A1AB 4XX9A 3NYXA 4H3PA 4AN9A 2IJMA 2JD5A 3RGFA 5HEZA 4CMOA 3UOKA 4EH8A 1TQMA 2WO6A 2F57A 4RRVA 4FIIA 5DT3A 3R1SA 2XS0A 5FXQA 4ACMA 2YLFA 1Y6BA 3FV8A 4BI1A 1SVGA 2WQBA 3MPMA 5CY3A 4PP9A 5C9CA 5IQAA 2XYUA 4YSJA 1JAMA 4K18A 3U9CA 3OS3A 1Y8GA 1OL1A 4L68A 3K5VA 5DH3A 4AF3A 3GB2A 3OD6X 3RNIA 4IFCA 4L00A 3VUIA 5CU2A 3LFEA 3EHAA 2W96B 3DAJA 4D28A 4NW6A 3GU8A 4JAJA 4AWIA 3SX9A 3SA0A 3DT1A 4PMMA 3OW3A 4ERWA 4FVRA 4FUXA 3EYHA 3WBLA 4H36A 3TZ9A 3H3CA 2XVDA 3KKVA 1OKYA 2UZBA 2X7GA 3AGLA 2XIXA 3PZHA 4HNFA 2Z60A 3TT0A 4AZSA 4IC8A 2GNFA 4PDYA 2YN8A 4C3PA 5K5NA 1OB3A 2G2IA 3EQFA 3BI6A 1OL6A 2UVXA 5AP0A 3UOLA 5L8LA 2VTJA 5I9XA 4ZTMA 5DRBA 4IJ9A 3RAWA 1PXLA 2HOGA 4PDPA 2C4GA 4TZRA 4ZZMA 4IQ6A 5L8KA 4F6WA 3HYHA 2QOBA 5HICA 2WNTA 1GIIA 4FE2A 4IAFA 4FG7A 3V5TA 4QMPA 3HKOA 3CS9A 4E4XA 3QUDA 3P23A 4AW2A 5TO8A 5BNJA 1S9JA 3UNKA 5JQ8A 3HAMA 4XV3A 4A9YA 2ESMA 2OJJA 5EK7A 3EN6A 4PX6A 4JG7A 4JOAA 1CSNA 2PUPA 4CQGA 3AQVA 4BICA 3WE8A 4FBXA 3F2RA 3MW1A 2GHGA 5KMMA 2XA4A 3FZRA 2CHLA 1XKKA 2G9XA 5L2WA 4YPDA 3ROYA 3R8VA 1FMOE 1GIJA 2W17A 3D4QA 3CKXA 4I21A 5E92A 3EYGA 3ATTA 4RJ7A 4F9CA 4IZ5A 3H0ZA 4F6UA 3CTJA 1H1RA 3EQRA 4BL1A 4D2TA 3AC1A 4DG2E 2IG7A 3RPRA 4FTIA 2JDOA 5C26A 2C30A 2E2BA 3IS5A 3KF4A 3TN8A 4I6QA 4P4CA 5DR2A 2OIDA 1ZYJA 4YTCA 5DYJA 4FL3A 5IH5A 2R5TA 2VWIA 4UZHA 5JFWA 3TIYA 5EQYA 3BHVA 2JKQA 2WMBA 2YACA 3ZLYA 3WF7A 3RZBA 4DN5A 3TNWA 4ZZNA 2C0OA 2G01A 5E8SA 5KE0A 4M97A 3PSDA 5HO8A 2WMXA 4FV5A 2CGWA 5IQFA 1W98A 1U4DA 2J50A 3FE3A 2AUHA 3TV6A 3CD3A 5CSPA 1E1XA 3MY1A 5E8XA 3V6RA 4DFXE 4C3RA 3KCKA 3L9MA 3UE4A 5CSHA 2PZYA 3FMKA 4KIKA 4BYIA 4GMYA 2RGPA 4GFMA 4FTMA 4GS6A 1SZMA 1Q8TA 4WHZA 3BEAA 2C1AA 3QTSA 4G5PA 4RVLA 2HXQA 3LFNA 2RF9A 5K3YA 3W32A 3L8VA 5IF1A 5AR5A 4AUAA 4RWIA 3HUBA 1OITA 3PY0A 4FV6A 4TYHB 1CTPE 3AT3A 2GQRA 3SRVA 2ZAZA 3ZUUA 4DEDA 2XUUA 3R28A 4AE9A 4J8NA 3HVCA 4IAIA 1LR4A 1RJBA 2QLQA 4XBRA 4XS2A 3FC1X 4AX8A 3QUEA 2C6EA 2PVKA 4KSQA 3ORKA 3W10A 4KABA 5C01A 3TTIA 1V0BA 2Q83A 3VN9A 4I3ZA 4MH7A 3OP5A 5LWNA 3CQUA 1V0OA 3PFQA 5KKRB 2R0UA 3C4EA 2RSVA 4FF8A 3H9OA 3LFCA 3U6IA 3VS1A 4FKGA 2GMXA 1UNLA 2WU6A 3DBQA 5DOSA 5KKRC 5JFXA 1P4OA 4RJ5A 5CQWA 4GCJA 2W7XA 3RPOA 4FKOA 3GCSA 3LFBA 4O6EA 2I0YA 1W0XC 3AMBA 3CBLA 3CR0A 2YCFA 4JBVA 4NKAA 4PTCA 3CTHA 5FGKA 3RM6A 3SXRA 3UIUA 5M07A 5M57A 4PWNA 3SOCA 1XO2B 2WOTA 3R7OA 3Q60A 3R7EA 4FNYA 3EB0A 3LXPA 3NCGA 3MSSA 3KN6A 3NIEA 2YITA 4RQKA 3DU8A 5CVGA 2C3LA 4QOXA 3HV4A 2R3LA 3IW5A 2V22A 3OUKA 1Y6AA 4RC3A 4EZ7A 1JSTA 5L8JA 2I6LA 1IG1A 2QKWB 4DG0E 1JPAA 4O7RA 4DCAA 3NYVA 5AM7A 3P9JA 3EFWA 4BCJA 3F7WA 5EQPA 3QLFA 3KB7A 5LVOA 1F0QA 3DOGA 2GFSA 4UYNA 3VQUA 3LFDA 3F6XA 4C4FA 4FV2A 1R0PA 3O7LD 4MBLA 2UW4A 3Q9ZA 3A7FA 1WFCA 4TNDA 2VNYA 4QMOA 5D10A 3T9TA 5I3RA 4F7NA 2GS7A 4ITHA 4I6BA 3R1QA 3G51A 4DH3A 3EQIA 2IZTA 4ACDA 5ITAA 5GIOE 3LM5A 5HOAA 4QPMA 4C37A 2H34A 3BCEA 2NO3A 2RKUA 2VTLA 3ZYAA 3OBGA 2BR1A 5A14A 3KREA 3GU6A 4FGRA 3UQGA 3V01A 1QPDA 3G0FA 3KU2A 4OTQA 4R1VA 3NW7A 4RSSA 2BKZA 2IVVA 2R7IA 4BCHA 5AJQA 4B0GA 2X4ZA 1Q62A 3E8DA 1G8SA 4BTFA 3PIYA 3Q5ZA 2BRMA 5DEWA 3VNTA 1OL5A 4YO6A 4AQCA 2QOIA 3FMJA 4KIKB 5FDXA 5FUTA 3SQQA 4Q5HA 4A7CA 3ZO3A 3LM0A 5HX6A 2I0EA 3QRTA 4A9UA 1WCCA 4O2ZA 4ZMFA 3E93A 4AGWA 3TZ7A 4EOJA 4IDVA 4D1SA 4V0GB 4PPCA 2WTCA 4KA3A 1STCE 1YXTA 4QP2A 4DGOA 4R1YA 3TTJA 3FMEA 4RLLA 4XRLA 1UU7A 5J5SA 3Q9YA 4KUJA 2B53A 2V0DA 2XJ2A 3I60A 5LXMA 5M4IA 4UXLA 3KULB 5HBHA 3UQFA 4PY1A 2PL0A 3LW0A 2XKFA 4AGCA 2ITUA 3EL7A 3B8QA 5LMKA 2WQNA 4MQ1A 3HA6A 3D94A 4KKGA 2WKMA 5HE2A 5T3QA 5CAOA 4EQUA 3ZCLA 5BVDA 3OG7A 2UZLA 3TNQB 3RWQA 3HV7A 2OJIA 3PIXA 4IHPA 4QMNA 3HDNA 3HV6A 2FB8A 5HCZA 5AIKA 5TOZA 1XJDA 2BZIB 2WMAA 3S00A 3Q53A 1GJOA 3D9VA 1QPCA 4FTRA 3RCDA 2C5XA 1OBGA 2CLQA 2IVTA 4EH3A 2J0IA 3GBZA 5HE0A 3IPHA 4AW0A 3I7BA 4D55A 4H39A 5T6KA 2OF2A 5AP7A 3EN4A 2ZB0A 3OY1A 5EDRA 5CU6A 3K5UA 4KS8A 4L3LA 4DITA 3U6JA 4EH6A 1M52A 4U6RA 4ALUA 3Q9XA 4IC7A 4OW8A 4P5ZA 3N4VA 1IASA 2C3IB 2R4BA 5CF6A 2VTMA 4F0IA 4A9TA 1MP8A 3VO3A 3GQIA
chains in the Genus database with same CATH superfamily
3FI2A 3LCOA 2GQSA 3F3TA 2UZEA 1IRKA 5E8ZA 2YJRA 4QMMA 5GHVA 2VTSA 2PE2A 3SKCA 2C6DA 3VBQA 5F4NA 3KRWA 3O0GA 3UODA 4ZSLA 3ZEWA 2FUMA 2X0GA 3UMXA 3UZTA 3QGWA 2BDWA 3V5WA 3FSKA 4AW1A 4H1MA 2EUFB 2WMWA 4XOYA 1LPUA 2UW7A 3OF0A 4CFXA 3OHTA 4CKJA 2X8IA 1W82A 4BI0A 1Q61A 2ZVAA 4YTFA 3ZUTA 1T46A 1ZOHA 2XZSA 5LQFA 1GIHA 3TKIA 1FGIA 1YXVA 3R8MA 5HNBA 3E88A 4H3BA 2R3MA 2PK9A 3W18A 1G8JA 3OTUA 4CEGA 3KMMA 3DZQA 4TNBA 2R3GA 1MUOA 4QP6A 3TIZA 2G15A 2HY0A 2J7TA 2XIZA 5KHWA 5KMIA 3PE1A 3KVXA 3C9WA 5J9YA 5BYZA 2HYYA 1NVRA 1TFFA 3MFRA 1PF8A 2RG5A 3DGKA 4FKTA 1VYWA 3HMIA 4XV9A 4BKYA 2BFYA 4O0TA 4W8EA 1DI8A 3PXZA 4L3PA 1PHKA 3GU7A 3FMLA 3EQHA 4ITIA 4W4WA 3PFYA 1Y91A 4CYJA 4DC2A 4GFGA 2GNGA 4RJ6A 5M09A 4JJRA 3TUCA 5IUGA 4TN6A 4EJNA 5AAEA 3EL8A 3LCTA 4TPTA 3Q4UA 5J87A 3TZ8A 3BV3A 3WZJA 5C4KA 1ERKA 2QOQA 4PP7A 4NFMA 3MB6A 2P55A 4FODA 4FT5A 4F9WA 1DM2A 2J5FA 4LV8A 4ID7A 1OKVA 2OK1A 4O4BB 3W16A 5IQIA 2R7BA 4BBEA 3KRLA 3OXZA 4QYEA 2R3JA 4Y72A 5HORA 5AV1A 4FKPA 3QCQA 4KBCA 3ODYX 3O17A 3NVKI 3LLTA 4DFZE 3EJ1A 4RWKA 1B39A 4ZTRA 5AV4A 1OUYA 5CVHA 5CF4A 4X6QC 3E5AA 4WA9A 2BAKA 3I1AA 3OXIA 2OICA 4QYGA 4FSMA 5BMSA 4IB0A 4AP7A 5AP1A 4EZ3A 5AUYA 5CVFA 4QQJA 5F95A 4GG7A 2FA2A 4JBPA 4R7IA 4ZSJA 3UG1A 2W99B 3OOMA 5HG5A 2JAMA 2C6LA 3R0TA 3BHHA 2XCHA 4XCUA 3P0MA 5BVFA 4B9DA 3KFAA 5DMZA 5HI2A 1W84A 3G5DA 3EZVA 3PVUA 3FI8A 3OFMA 1PMEA 1QMZA 3BRBA 3K3JA 3QD4A 5FP6A 4M7IA 5J1WA 2HY81 4FIJA 1XH5A 2BCJA 2I40A 3F3VA 4FTNA 3FLSA 4FYNA 4RBLA 3RHKA 5AX9A 1UNHA 5I9VA 1ZYDA 5AX3A 4DTBA 4PMSA 3F3WA 5AUXA 5I4NA 2QU6A 2GNHA 3G90X 4DEAA 1OL7A 1AD5A 2ERKA 3ENHA 4YLJA 1M7NA 3ULIA 3KA0A 4O7ZA 4Y73A 2Z8CA 4I0TA 5GIPE 4DGNA 4LGDA 4HZSA 2Q0NA 2Y7JA 5GJGA 2E9PA 3R7UA 4B7TA 2HXLA 3QTUA 4FV3A 2FH9A 4CXAA 3SOAA 3LMHA 2VO0A 3EKNA 5GJDA 3R7GA 3N9XA 4YC3A 1PY5A 3NNUA 3P78A 4JR7A 3LXKA 2VTTA 3TJDA 2VTPA 3VS3A 5HZNA 3JS2A 3FEGA 4F9AA 5AP2A 4RA4A 3ID6C 3LMIA 4LM5A 3P5KA 3JPVA 3PYYA 3GI3A 3R02A 3W0NA 4EH2A 4IAZA 1NT2A 1TZDA 4W4VA 2JLDA 2VTIA 4PDSA 4ZY6A 3DXPA 2YCRA 1PYEA 4RIYB 2XK7A 4FTTA 2GHLA 4JIKA 2W1GA 4O0VA 2V5QA 4H1JA 3U8WA 3DB6A 3FSFA 3COKA 2F7XE 4EUTA 4E20A 2XARA 4AXEA 3R00A 4QYFA 2O3PA 4ZSAA 4JG8A 4C2VA 3CSVA 3BLRA 1GOLA 4MWHA 1ZZ2A 2DS1A 4AXFA 4QQTA 1H4LA 2C0TA 2XEZA 3GCVA 4IXPA 4R7HA 2X0PA 3TV7A 1URCA 5HESA 2OIQA 1PMVA 1ZXEA 3COHA 3TDWA 1BI7A 4NSTA 3WF9A 4ZS4A 1MRUA 2XJ1A 4AAYA 3NYOA 3DJ7A 2R3HA 1OECA 2W1HA 4LV5A 5CQUA 3QLGA 4F70A 2CCHA 5EW8A 3VUTA 3W0OA 1YI4A 4LG4A 5IQGA 4RZWA 4Y83A 2OG8A 3CCNA 1XQZA 2B1PA 4M0YA 3DFCB 3JUHA 1YHVA 4NT4A 5HVJA 2JFMA 2JKKA 4K11A 2QR7A 3GQLA 4MXXA 2ZMCA 1PRYA 4YO4A 5EG3A 3W0MA 2JAVA 3F5PA 5FXSA 2QU5A 1YWVA 4EOPA 2CN8A 2YCSA 2W5BA 1LUFA 4FTJA 2J0LA 5AP5A 3P08A 4OT5A 1L8TA 5M55A 4D9UA 2C6KA 2YIQA 3FLQA 2WTKB 3OW4A 4AFJA 3ZOSA 4WUAA 3UBDA 1ZLTA 2P0CA 2WTKC 3W2QA 2J0KA 1VLRA 3BE2A 4C59A 2CNUA 3OT8A 3PXYA 4RMZA 4DTKA 1JSUA 3ET7A 3LCSA 3QCSA 4IEBA 4DBXA 4BGHA 4QP9A 1P4FA 3VAPA 4R5SA 3S4QA 3MDYA 3WF8A 4JVGA 3FMMA 4ZEGA 4UMRA 3BHYA 5GZ9A 2CCIA 2CDZA 1P2AA 4O0UA 3N51A 4RJ3A 1UKHA 4F65A 3DXQA 2WEVA 2WQMA 4G1WA 4XP3A 5IA1A 2UVYA 5K9IA 3MI9A 3FI4A 3SV0A 2FSOX 3C4XA 4G16A 2OKRA 5BVEA 3DY7A 5HTBA 4RIXB 4CMTA 4D2SA 4ANQA 4DEIA 4EOIA 1NVSA 2WXVA 1KUTA 2VWXA 4RFZA 3GGFA 3V8WA 2W4JA 1DAWA 3ALOA 4F7JA 4BKJA 3E8NA 4O82A 4GT4A 5KMJA 3PJ3A 4DHFA 4YZNA 3UGCA 4FZFB 2C6IA 3SD0A 4HVHA 3V5PA 2UW8A 4GH2A 1FOTA 3R1NA 4U97A 2P3GX 4ZK5A 2VNWA 1ZMWA 3I5ZA 3IDCA 4I20A 2RFEA 2UW9A 3REPA 3U9NA 4PNKA 4IWPA 2XIRA 4OBOA 3GOPA 3IG7A 4WG4A 3R83A 2HZNA 4YNEA 2JC6A 3MH3A 4FEVA 2UZUE 2O0UA 3FY0A 5DT4A 4I23A 4DHJA 4QP1A 1K9AA 3PXRA 3PY1A 5IQCA 5C8KA 2PVHA 3DFAA 5H9BA 3EN5A 4I0SA 2W5AA 4HOKA 2BVAA 3C13A 4FR4A 4IM0A 1KV2A 2JBPA 4W9XA 4UBAA 1X8BA 2V7AA 4FVQA 5FRIA 2XK9A 4CV9A 5A4QA 3NUAA 3WOWA 3FLZA 2Y0AA 3DBCA 3RBWA 4CCBA 4BRXA 3QWKA 4D2VA 5A4LA 2VX3A 3FWQA 1SNXA 5IA4A 4C02A 4QD6A 4MD9E 4JRNA 4L44A 3T9IA 4KNBA 1YDTE 4BYJA 3UVRA 3BLQA 2QVSE 3MJ2A 3NYNA 4FJVA 1O6LA 3R71A 4K9YA 5CU0A 3LKMA 4S33A 3HMNA 4BR3A 4KKHA 2Y9QA 1SNUA 2ZYBA 3OVVA 4U80A 5J8IA 1AQ1A 2CGXA 4FKUA 1KOAA 1WBSA 1PXKA 4LRMA 2W06A 1BL7A 3OWLA 4D0XA 4F08A 4OTRA 4TRLA 3UO4A 2YAAA 4A4OA 4C38A 5ETCA 1UU8A 5HGIA 5HIEA 1J7IA 4AZVA 4KRCA 2OXYA 4BDIA 2OFUA 2BZKB 4FKSA 3V3VA 5CSVA 1GAGA 3NAXA 4CD0A 2OXDA 5IEYA 3ZTXA 3PLSA 4P5QA 4ZS0A 2XCKA 2LAVA 4HVGA 4RQVA 1YRPA 2BHHA 5AUZA 5ANGA 4GIIA 4QMVA 4ACHA 3SG8A 3D2KA 3HDMA 4II5A 4QP7A 4KS7A 1H28A 5EYCA 5AM6A 2HK5A 4FKIA 4BDEA 4HVIA 4FZ6A 2X6DA 2J9MA 5D1JA 3Q96A 3M1SA 4R3PA 2FYSA 5A4EA 4BZNA 4FV0A 1U5QA 4A06A 4KIPA 5C27A 3ZSGA 4F6SA 4C8BA 5FXRA 4QMTA 3HRFA 5HIBA 4FSZA 3W8QA 2VWVA 3IECA 3R8ZA 3VS2A 3W2PA 4CCUA 4DEEA 1R0EA 3OROA 3GOKA 4EOMA 3BEGA 3MESA 4O7SA 3GCQA 2XYNA 3EQBA 4PL4A 3ZBFA 3LFFA 4AACA 1YQJA 3JVSA 3DKFA 2XIKA 3ZFMA 3WIKA 4BJJB 5EW9A 5F1ZA 1LP4A 1F5QA 2WHBA 2IW9A 3RK5A 2PYWA 3RAHA 3PXQA 3ORLA 1UWJA 5LVLA 1ZYCA 3O8TA 3ORIA 2OZAB 5L4QA 3ORNA 2CPKE 4TYIA 4AS0A 3W2OA 4JQEA 4FKVA 4EOSA 4ZZOA 2JIIA 2PVYA 1T45A 2BZJA 2FSTX 5CX9A 3T3UA 4EK8A 2PZ5A 1R78A 3KCFA 2J0JA 4CG8A 3VW6A 3U4WA 2LGCA 4FEQA 4X6RA 4UWCA 3BV2A 1V1KA 5GJFA 4ZJJA 2DYLA 1F3MC 2O8YA 3VQHA 2X2LA 4QPAA 3V8SA 3KXHA 3BYOA 3MVMA 3BBTB 4MXCA 4RX8A 4E5BA 1SM2A 4MBJA 3VC4A 3TUDA 4AN2A 3VUHA 3AT2A 4FT3A 5ANDA 3DZOA 3FI3A 5HE1A 3FZPA 5L2IA 4BDDA 4C58A 5EKNA 4L7SA 3FL5A 1KE5A 3HP2A 4NM3A 2C68A 2F2UA 4FIEA 4TYHA 2HZ4A 2Z7SA 3THBA 4HYHA 3TXOA 1PXMA 4U5JA 4FKJA 4UV0A 3CQWA 3K54A 4NIFA 5I3OA 1WZYA 3FXWA 3O2MA 5CSWA 3RI1A 3T8OA 4EBVA 4HYUA 5JMSA 1ATPE 1Q97A 4QMLA 4U43A 2XNEA 4DEHA 1WBWA 2VGOA 3FUPA 3PVWA 3TDVA 4EKLA 5GNKA 3FZ1A 2ITQA 3LIJA 4ACCA 4MK0A 2QO7A 2WTJA 2JDTA 3G9NA 4QQCA 3TWJA 4CG9A 2UV2A 4RX9A 4X3FA 5HO6A 3C4WA 2XK3A 3C51A 4L9IA 4CLJA 4BBMA 1GZKA 3UMWA 2GU8A 4M8TA 4O6LA 4BTKA 4JDJA 3EMGA 4GT5A 3VUMA 2UW5A 4AGUA 4X7QA 2NRUA 1IAJA 5CEKA 3BQCA 3O5AA 3MFTA 4UXQA 4GUBA 2WMRA 3CIKA 3PUPA 2P2HA 1W7HA 1J3HA 5KZ0A 5I9ZA 3D0EA 5FM2A 5L3AA 2Y6OA 3OUNB 3ANRA 4G3EA 3RK9A 1U46A 4TYGA 1YWNA 4ZXTA 2OBJA 1PMUA 2PWLA 1PKGA 3FJQE 4UN0C 3UOHA 2IVSA 4TY1A 2YA9A 3RALA 3NUSA 1WBVA 4FNZA 5FTQA 2VN9A 1WBPA 1SMHA 2B9HA 5FEDA 5HD7A 2ZM4A 3PXKA 4Q2AA 5EM7A 5J95A 4YMJA 5IA2A 4NCTA 2QOFA 3Q9WA 3TV4A 4FKWA 5CAPA 4TWNA 4LRKA 2YZAA 4UMTA 5JKGA 4MBIA 3HUCA 5EW3A 1CKPA 5J7BA 1E1VA 2C5YA 2YM3A 1PYXA 3LOKA 3NCZA 3E3PA 4TWOA 3ORTA 4OBQA 2UW6A 1OGUA 3GC7A 1LEWA 2QONA 4QNAA 2F9GA 2J0MB 1VYZA 3RPSA 4ZP5A 4G3GA 2WQEA 3R9RA 5DPVA 5E4HA 5A4TA 3PRFA 4XV2A 3UNJA 3ZM4A 2VV9A 3Q4ZA 3PVGA 4EC9A 2ETMA 5K0KA 2YAKA 3OWJA 4KINA 3E92A 2QHNA 4QTDA 4MNEA 4YTHA 3WZEA 3OEZA 2YM6A 3UIMA 3VIDA 4F1TA 2A2AA 4A4XA 5F94A 3O8UA 3BLHA 3HMOA 4F1OA 3UTOA 1CKIA 5IMEA 1FBNA 4YZBA 3KRXA 2KULA 4MD8E 3F3UA 2YHVA 5EHYA 5FG8A 4RT7A 4BHZA 4IWDA 4XNEA 3EN9A 2HENA 4AAAA 3DXNA 3IDBA 4J52A 4IVCA 4EYMA 2Y6MA 5JQ5A 4MD7E 4O4CA 3UDTA 4XG7A 3UIBA 3UG2A 3HZTA 1O6KA 3V51A 4DEBA 4V0GA 5AIRA 4DFBA 3Q5IA 4B99A 1WAKA 4IX6A 5F9EA 5J9ZA 3PTGA 2NPQA 3BGPA 4NIFB 1A06A 2W1EA 3DNDA 4NU1A 2C6TA 4IB3A 3DPKA 3LHJA 1PXIA 4G9RA 1H0WA 4PTGA 5JGDA 4R78A 1JBPE 3KULA 3CPBA 4FZ7A 3EWHA 1H07A 2WAJA 2UUEA 3BBWA 3PJCA 3RINA 1REJA 4ZMEA 3PA3A 2OJ9A 3QXOA 3Q3BA 3QXPA 4FTOA 5ANOA 5G6VA 5FDPA 2X7OA 1O6YA 1BI8A 2A4LA 3PUFC 3O8PA 3QZHA 3PWDA 4ZSEA 4X3FB 4YJOA 4HGEA 4AT4A 5IPJA 4HGTA 2JIVA 2W1CA 3GP0A 4IB5A 3QKLA 2J51A 2C3JA 4DBNA 3AD4A 4X3FC 5C8NA 4M69B 4ONAA 3UC3A 2YLEA 3WF6A 2C3KA 4BIEA 4E7WA 2QOCA 3O7LB 3RWPA 4GYIA 4NWMA 2F2CB 2XB7A 2QNJA 3GUBA 4CFVA 2QC6A 4BWPA 5EKOA 5BUEA 3P79A 4LQMA 3C0GA 4I5CA 3EQGA 1VJYA 3CP9A 3ERKA 4QNYA 4QTAA 4BCFA 2ZDTA 3KVWA 3IQ7A 4CRSA 4N70A 3FDNA 4G3CA 4AXDA 3BU6A 4HJOA 1BUHA 3EQPA 3H10A 1M2QA 3QF9A 2PUUA 1OI9A 3FBVA 4OTPA 2RIOA 4OT6A 4X2KA 5HG7A 4CLIA 2BRNA 4CTBA 2W5HA 2HAKA 5ETIA 3ROCA 1XBAA 3BYUA 1VR2A 4ZTLA 3VS0A 1ST0A 4PPBA 1IA8A 3OBJA 3MN3A 5HO7A 2X6EA 3AC8A 4NCTC 4UMPA 1G8KA 3NZ0A 1JKTA 2R3KA 3GT8A 2PVMA 2W05A 3MGYA 3QC4A 2UVZA 2P4IA 4BCIA 1YXSA 4YLLA 3SGCA 1OZ1A 3QTZA 4O1OA 5HLPA 4R7BA 3A99A 3FLNC 3R22A 4NEUA 4GK3A 4O86A 3MPAA 3A60A 3G15A 4Y95A 4CFNA 2WMQA 2G1TA 4OR5A 3D7TA 1WMKA 3JY0A 2ETKA 4WSYA 4KIOA 3BIZA 4HYIA 2YM4A 1A9UA 1ZOEA 3QTRA 5ANEA 5KUPA 2IO6A 3I6WA 4MNEB 4OLIA 2VD5A 4FX3A 5CT7A 5FEQA 2IWIA 3RAKA 3FMHA 3VBYA 5AUWA 3RAIA 4RFYA 4GT3A 3VUGA 3QQHA 5DEYA 5E1EA 4DH7A 4C4JA 5DFPA 5CTPA 1MRYA 3ORXA 5AR2A 2PE1A 2OZOA 1KWPA 3KRRA 4FT7A 1UNGA 2YJSA 4B8LA 2REIA 3LXLA 1I44A 5M4UA 4IANA 4ASEA 3HP5A 4FOCA 3ETAA 4D5KA 2C47A 5BYLA 1JNKA 4EI4A 3EQDA 2QR8A 2R3NA 4LUEA 1UV5A 2AEGA 3RVGA 3QA0A 2WU7A 1XWSA 3P86A 4UX9A 3QKKA 4BIBA 5D9HA 2V7OA 4JG6A 3QRIA 5IMXA 4LL5A 4D1ZA 4QMYA 3OCTA 5ACKA 1YDRE 3OY3A 5E90A 2HW6A 5AA9A 5AAGA 3MFSA 4ZSGA 4AOTA 3JXWA 1W8CA 2UZDA 4S32A 3BHUA 2QOOA 4WG3A 4Y46A 3R9DA 5EM5A 4DF3A 4XH6A 4IZAA 4O4FA 3VRZA 5IU2A 5LOHA 4U41A 3BELA 4ANMA 4I5PA 4RIOA 4QMSA 4ZLOA 3COIA 3TL8A 4D0WA 3AC4A 3R8UA 3R73A 5EDQA 3OT3A 4YR8A 3BPRA 3DDQA 5ETFA 2Q0BA 4LL0A 5E9EA 1CKJA 3BGQA 3GVUA 4FIFA 2Z02A 1Q41A 5J1VA 2YWVA 4DFUA 2EXMA 3CE3A 3VF9A 3WIGA 4NFNA 4E73A 4L52A 2QHMA 3RK7A 3DJ6A 4IAKA 5L2SA 4G31A 3MA3A 4A4LA 4EHGA 4P7EA 3R2BA 4NH1A 5FTGA 3ZLSA 3UNZA 1U5RA 3DBDA 3Q4TA 4OTHA 4B4LA 2ZOQA 3BHTA 3ULZA 3ZLWA 4Y85A 4HCUA 5DNRA 1RDQE 2QG5A 4QP8A 1J7UA 5E7RA 3TKUA 4BWXA 5DWRA 3C5IA 2OSCA 5BVNA 4PNIA 1JKLA 4WBBB 1HOWA 2ONLA 4LUDA 2YEXA 3G6HA 4I0RA 4RLKA 3F66A 4I5MA 3NNVA 2X4FA 5CLPA 4AZTA 5JFVA 2WZJA 2X0OA 1L3RE 3QTWA 5FLFA 4NM7A 3ZC6A 3ITZA 4DT9A 3NS9A 2XJ0A 3AC2A 5T68A 3D7TB 4CKIA 1NY3A 3GU5A 3GC0A 4FSYA 4JT3A 4IE9A 3IDPA 1OPJA 4A9SA 2WTDA 2XH5A 4BI2A 4HYSA 4FVPA 4BGQA 3A7IA 1Z5MA 3QQFA 4RIYA 4EQCA 1H27A 4C61A 4DGMA 4LOOA 2XKEA 1W2CA 4M67A 3QHRA 4O27B 3W55A 4A07A 3C7QA 2R3OA 3RNYA 5CYIA 4BDJA 2I1MA 3OCBA 3A7JA 3RKBA 3NLBA 5HCYA 4C4EA 3NVMB 5LMBA 4IACA 5KBRA 3AOXA 2F7ZE 2BKKA 3DK6A 1OKWA 3CGOA 3COMA 2YISA 4AN3A 4C33A 4B6LA 4O22A 3UJGA 4FTCA 4DINA 1OIYA 1JKKA 3A4PA 3DKCA 5HTCA 5J79A 4JQ8A 5JSMA 5M56A 3KXGA 2JKMA 2QOKA 4LYNA 4QRCA 3SVVA 1WVXA 1YI3A 5KNJA 4LDTA 4J1RA 3AMYA 3A7GA 1CM8A 2ITYA 3BGZA 3QYWA 3CC6A 3TI1A 4EC8A 5HVKA 3C0HA 5IEVA 3W0PA 2BZHB 4ITJA 2OH0E 5IQEA 3LMGA 3PJ8A 3QL8A 4RC2A 4USFA 3LJ0A 2B0QA 4AA5A 3P7AA 3FMNA 4N6ZA 4QYYA 3E7VA 4DLIA 3R2YA 2CJMA 3M42A 2W0JA 5DGZA 3A7HA 4FV1A 4O2PA 4MAOA 2R3FA 4AW5A 4E5WA 4I6LA 4XLVA 3DK3A 5LVMA 2ITNA 3F2NA 2WTIA 3QHWA 3VUKA 5LCJA 2IPXA 3BL7A 3N4UA 2ERZE 2GSFA 3Q6UA 1FGKA 3SXFA 3CY2A 3AXWA 1KV1A 4IX4A 4JR3A 1V0PA 3PP1A 4GK2A 4V01A 5E8WA 4CZUA 4EZ5A 1REKA 2W9ZB 4U79A 4U8ZA 5A4CA 5D7AA 4FZAB 5EDPA 3KC3A 2VZ6A 2X9EA 1OL2A 5AUTA 4GW8A 5FBNC 5E1SA 4X2GA 1HCLA 4IB1A 4M15A 2UZVA 4FNXA 4UZDA 3DDPA 4WO5A 3TUBA 4G17A 4TKSA 5B2LA 3LVPA 1XH4A 4OUCA 1BX6A 4QP3A 3V5QA 4G5JA 4L43A 4LRJA 3FYKX 2QLUA 3F5XA 4BCGA 2YIRA 4ORKA 3WI6A 3Q6WA 5IH6A 4J8MA 3R30A 3ZO4A 1ZYLA 3QZFA 3T3VA 2ONLC 4FTQA 3KN5A 5FBOA 2GHMA 2ITPA 2O65A 2OIBA 3FHIA 3NW5A 4JBQA 5DG5A 3EFLA 4RIXA 3U87A 2IEWA 3UP7A 4BCPA 5A46A 5CEPA 5DLSA 4KRDA 4F64A 4YP8A 5AV2A 3F69A 4O7NA 3EKKA 4YJTA 1M17A 5CEMA 2ZM3A 4FRFA 2ITVA 3GU4A 4D2PA 5C4LA 1JKSA 5BUJA 3DKGA 4L8MA 4E26A 4EOKA 4NTSA 1KE9A 4ACGA 4F1MA 1ZRZA 3D5WA 3IOPA 2BRBA 4M68A 3D5XA 3P4KA 4ZTNA 3OXTA 4MNFA 3ZRMA 4AG8A 4EYJA 4FSRA 3QCXA 1PXOA 2ITXA 3O71A 3HGKA 4IFGA 4IVDA 4YGAA 2YM5A 4D4VA 4HGLA 4G3FA 4FOBA 4E6DA 2QODA 2JFLA 2GQGA 3VW8A 1FVTA 1OVEA 2VX1A 2GTMA 3BZ3A 3DBFA 3UPXA 4JQ7A 3QQKA 5L6WL 4N57A 3W0RA 1Q5KA 5M06A 4IWQA 2RL5A 4QQ5A 1PXPA 5CI6A 3MVJA 3PA4A 3BYVA 4E4LA 4FEXA 3ENMA 4HCVA 1U54A 3SG9A 5ANJA 5HBJA 4Q5EA 2V55A 3RM7A 1XBBA 4UYAA 4Z7HA 4ANBA 3MTLA 3QZIA 3R63A 4DHZA 3Q52A 4RJ8A 4RPVA 1IEPA 1YXUA 3LQ5A 5E8VA 3G6GA 4DDIA 3BQRA 3R21A 4L67A 4KBKA 3ZFXA 4XG2A 3FC2A 4G3DA 5C8MA 3ZO2A 2O64A 4BBFA 1JWHA 5KBQA 1PMNA 1E9HA 4F78A 2RFNA 1H8FA 3WZUA 4R77A 4I5HA 1PXJA 3UYTA 3L1SA 2QOLA 3IKAA 3TG1A 5DA3A 4IX3A 4O1PA 5CF5A 3QD0A 4R8QA 5AAFA 3HNGA 5KHXA 1H1SA 4L46A 4JX7A 5D11A 3R8PA 4IM3A 4Q9SA 5CAVA 2SRCA 1G5SA 3L9PA 2ZJWA 4UB7A 5J9LA 3HL7A 2CSNA 2J90A 5CI7A 4FKQA 4GL9A 3SAYA 3SXSA 5K4JA 4MXOA 4BTJA 2GNIA 2OU7A 4WSQA 4WOVA 3OC1A 5CANA 3V8TA 2WIPA 4LOQA 4DT8A 4WNMA 3CLYA 4YHTA 4CSVA 4ZLYA 2GDOA 2WB8A 4G6LA 2UZTA 4RWJA 4G2FA 3R7YA 5A6OA 3LQ8A 4EUUA 2QOHA 3VF8A 4FEUA 4O7VA 1YOMA 5DR9A 1VZOA 4C34A 4L3JA 2PZRA 4GU6A 1JQHA 1UU9A 3LZBA 4BDGA 4YJUA 4RVTA 1Q24A 5IQBA 2JIUA 1Q4LA 5HD4A 1Q99A 3NPCA 2C6MA 1NA7A 4XP2A 1BL6A 3DNEA 4L6QA 2DQ7X 4XOZA 1KSWA 3RJCA 1SVHA 2QQ7A 3BU5A 3LFQA 4I24A 4P2KA 3DCVA 4S34A 4XG4A 4Y5HA 2OH4A 5IG1A 3PLAE 4L01A 4C3FA 1B6CB 4BJJA 3DBEA 4AA4A 3NDMA 3QRKA 4FNWA 3KEXA 4YHFA 2BDFA 5IDNA 1FVRA 3FYJX 4EOOA 5JGAA 3DLSA 2W1ZA 3FY2A 2OZAA 2VWWA 2VTAA 2YZLA 5CSXA 5KMLA 2EB3A 5CXHA 3U4UA 4AOJA 5LARA 2I7QA 5F20A 3SHEA 2HZ0A 4IDTA 4X3JA 2JDRA 4FUYA 4YZMA 5CAUA 2BIYA 1H08A 3FL4A 4I4EA 4O0WA 1OIRA 2XNMA 4AFEA 3F5UA 4F7LA 4TW9A 5JFSA 4IWOA 2JBOA 4YZCA 4IW0A 3HV5A 3GFWA 4FSTA 1R1WA 3C5UA 4IAAA 2UZOA 4RWLA 5G1XA 4DCEA 4BCNA 2XEYA 1U54B 3MY0A 4DTAA 4FT0A 4MTAA 2OI4X 5DN3A 3S2PA 2PE0A 3NNWA 4R6VA 3S3IA 2JKOA 1PKDA 2WMUA 2OFVA 3UC4A 4W4XA 1NW1A 3L9LA 4BFMA 3W2CA 2BFXA 4AOIA 2ZV8A 5CU4A 3M2WA 2YIWA 2F4JA 3NX8A 3H9FA 2WEIA 4OTFA 5FQDC 2X81A 4DA5A 4CYIA 2G2FA 2YIYA 3FZOA 2WMSA 4XUFA 3BE9A 2YERA 1H1QA 5EI6A 5HLWA 2I0VA 5HIDA 3RTPA 4QTEA 5M53A 3R9OA 5BVWA 1YXXA 2BTRA 3SDJA 4AU8A 4BVUA 2CMWA 3AGMA 4APCA 2NNWB 3POZA 3ZZEA 3D2IA 3P5JC 1OMWA 5B7VA 3QZGA 3V6SA 4CZYB 3PSCA 5AFVA 3GFEA 3OEFX 4WUNA 4DG3E 1UU3A 5CZIA 4NM5A 3ZONA 3GEQA 1RQQA 1XH8A 4EH5A 2XK6A 3QRUA 1NVQA 2XNOA 5AEPA 2ETRA 3DA6A 2H96A 2VUWA 4U9AA 1GZOA 2X9FA 2X2MA 2XNGA 4WBOA 4PL3A 3VBXA 3DTWA 1GY3A 3W33A 2J5EA 2NYAA 5AR8A 3IW4A 4TYJA 3R6XA 3ZHPC 3ORMA 4BIDA 3KY2A 1CMKE 2NP8A 3D5VA 5IA3A 3GC9A 4QT1A 5JT2A 2VWUA 3C4CA 5BVOA 4M14A 2IZRA 4TYEA 4R3CA 3NAYA 4ZOGA 5JZNA 4YBKA 1GZNA 2VO6A 4CNHA 3DV3A 5TE0A 4I22A 2XBAA