3WZKA

Crystal structure of human mps1 catalytic domain in complex with n-cyclopropyl-4-(8-((thiophen-2-ylmethyl)amino)imidazo[1,2-a]pyrazin-3-yl)benzamide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
279
structure length
258
Chain Sequence
b'ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Discovery of Imidazo[1,2-b]pyridazine Derivatives: Selective and Orally Available Mps1 (TTK) Kinase Inhibitors Exhibiting Remarkable Antiproliferative Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzkA01
2ZB1A 4XLVA 4LM5A 5AUYA 4FF8A 3SRVB 3QKLA 3PWYA 4W4VA 2WXVA 3OY3A 4QD6A 4FVRA 3ZFYA 4BI1A 4YGAA 2OZAA 4RZVA 1YXVA 4AOTA 4BCNA 1OBGA 3ZSIA 4CYIA 4O81A 5AR8A 4TYIA 1KE8A 3DBDA 4L9IA 4C0TA 1YI6A 3D0EA 3BV3A 1M7NA 3QLFA 4LUDA 2UW3A 1OUKA 3JUHA 4ANOA 4FGRA 4YZNA 2BRBA 4RX5A 4FV0A 4DBXA 4GG7A 5F9EA 4KS8A 4ZY4A 4DGOA 1VZOA 5AP5A 1T46A 2R9SA 3C9WA 3FLWA 5DHJA 2VWYA 3BBTB 1Q41A 4OTHA 2C68A 4B0GA 2GQRA 5D11A 2NP8A 4EONA 3OTUA 4RSSA 3FMKA 3AC4A 2CJMA 2OIBA 4AA4A 2BAKA 2CKQA 1JVPP 5J9LA 2E9OA 4GJ3A 4ERKA 3PJ8A 3QZHA 2ITVA 4QO9A 3K54A 3NUSA 2VWUA 5B7VA 5L4QA 4WUAA 4IANA 5CEQA 3ZSGA 4E4XA 2XUUA 3FLYA 3FLQA 1OIUA 4L52A 2YJSA 4O84A 5AV3A 4F9BA 5E8VA 3F82A 5FD2A 4EH7A 2W96B 3VF9A 4AU8A 3FMJA 5LMKC 1G5SA 3WE4A 2VO6A 3JPVA 3QRJA 3UOHA 4MAOA 3WF9A 4HCUA 3CGFA 3PPKA 1W7HA 2R3NA 2WIHA 4PWNA 2PE2A 3ZLWA 3V6SA 4XUFA 4Y8DA 2F57A 4DFNA 4NYEA 4WG4A 2NNWB 3D14A 3OMVA 4LL0A 4AZFA 5IU2A 3TG1A 4G6NA 3MPAA 4YPDA 3R02A 3UPZA 1JOWB 4WO5A 3PXYA 2FSMX 4NTTA 4M69A 5GNKA 5AP4A 4AT4A 4ALVA 1OI9A 1ZOGA 3MVJA 3G9LX 5TOZA 4DYMA 4AW1A 5M4UA 1PXNA 4FTCA 4RJ6A 2PUIA 4O0UA 3D4QA 4PDPA 4YBKA 5AWMA 4LOQA 4ZSLA 4BZNA 4HVSA 4BIEA 4GIHA 4AGCA 5AUVA 3RK9A 4WBBB 3VS7A 1UWHA 1Q8UA 4EKKA 1Z57A 3F3ZA 4HZSA 3NUNA 3TCPA 4O21A 4C36A 3TKIA 4X0MA 5K0XA 3FMMA 4I21A 5E91A 1TVOA 3WF8A 4S2ZA 4O0XA 4PX6A 2PZYA 3CGOA 4ZSJA 1VR2A 4AG8A 4FSYA 4JBOA 3Q6WA 4I22A 4R6VA 1S9IA 3RCDA 3RWPA 3PDTA 2UZNA 3GP0A 1H25A 3KRXA 4L8MA 4KSQA 3R63A 4QNAA 1WCCA 2AYPA 4G31A 4QYGA 4O0YA 4YHJA 3H9RA 4M0ZA 3Q4TA 4AW0A 3IOPA 2PMIA 3H9FA 4XG9A 2OH0E 4TW9A 4AN9A 2VO7A 3LMGA 1XKKA 1W82A 3IGGA 3OEZA 5EOLA 4AOIA 4DAWA 3MBLA 4WUNA 4L46A 3BKBA 4DCAA 3BE9A 2IVUA 1X8BA 4O91A 3OHTA 4CD0A 3COHA 3K3IA 2XEZA 3FZTA 3K3JA 4P90A 3SGCA 5AR2A 3ZO2A 4EH8A 2GTNA 4BTJA 4RX7A 3BQRA 5C9CA 4PTGA 4DLIA 2UW5A 4RJ4A 3P08A 4IWOA 3EL7A 2PMOX 5C8NA 3VULA 3GCPA 4X3FC 2WU6A 4Q2AA 4FSMA 4B99A 1VEBA 5E90A 4JIAA 3U9CA 3LOKA 5JFXA 2V7AA 3DDPA 3UQCA 1OL1A 2CLXA 3TUBA 3DNEA 5FTQA 2ZV8A 4C8BA 4O2PA 4ZMEA 4PUZA 3QD2B 3AT4A 4FGBA 4FKPA 5L6PA 1HCLA 1U59A 3C1XA 2HK5A 2PVJA 2HW7A 5KMNA 3QTWA 2XNPA 3BLQA 3CP9A 4IMYA 3VNTA 4EZ3A 5GIOE 5CVGA 2GCDA 2GNGA 1MRUA 1YDSE 1UKIA 2I6LA 2W7XA 1ZYCA 3UDBA 4C62A 5C1QB 2WAJA 1URWA 4FKRA 3FAAA 1H00A 5L8KA 4A06A 3KN5A 3COMA 2WTKB 3S4QA 2R5TA 3CKWA 4W4YA 5L6WL 4I1ZA 4IBMA 4DG0E 5M53A 4QMWA 5DG5A 4O7ZA 3DK3A 3A61A 3RAHA 3A2CA 5E1SA 4YSMA 2WMTA 2XB7A 3POOA 1JPAA 4ZTNA 3CEKA 4JG7A 1S9JA 4D9TA 3RNYA 4QMSA 2C6EA 5ANDA 5IQDA 1XBBA 4JIKA 4FSTA 3EQIA 1DS5A 4G3GA 4O0WA 1F0QA 2YCSA 3RINA 1Q8WA 5K3YA 4I4EA 4H3PA 5E8SA 5AP2A 3BLRA 5AV4A 3CY3A 3GU5A 1IR3A 2PZIA 4FTNA 3ORLA 5HE0A 2O2UA 4L67A 1NVSA 4HNFA 5M55A 5DEWA 3WIKA 3ZHPC 2QHMA 4F63A 2YHVA 3P86A 5AM7A 3PXFA 4KAOA 4V05A 4U43A 2DWBA 2XKFA 2XVDA 4A4LA 5A54A 3BYMA 4FT3A 4D58A 4I92A 4QMLA 4F4PA 5BVNA 2HWPA 4L68A 4FZDB 2BVAA 3Q4UA 4NTSA 3ZDIA 4FTQA 4F9YA 3CD8A 1PXPA 3DS6A 2VWXA 2G01A 2WMQA 3R1QA 2W4KA 5JQ5A 4X3JA 4RJ5A 3ET7A 3G5DA 2BROA 4JX3A 5IA3A 4GYGA 2WQMA 4TT7A 4EJNA 4PTEA 1ZMUA 2Y4IC 2F7XE 2PVMA 4RWLA 5KHXA 4GKIA 5EKOA 5CEKA 1FVVA 3NYXA 2C3LA 4I4FA 5EM8A 1RDQE 3W16A 4O7NA 3LCKA 4H3BA 4Q5EA 3R9NA 4DTBA 3RWQA 1CM8A 5IH4A 1SNXA 2G2HA 3COKA 3DQWA 3ZMMA 4G16A 2H8HA 4FTTA 3F3TA 4M12A 5CI7A 3BU5A 4J71A 4KIPA 4NH1A 3LCSA 3QTIA 5AV2A 3TKHA 1P2AA 2OXYA 1BX6A 4FODA 5CALA 1PXLA 4YZDA 5LJJA 3NW6A 2JDRA 1YW2A 3O2MA 1Q8ZA 2HELA 3QA8A 3V5WA 4TNDA 4XV1A 2UVZA 3BYUA 2UZOA 2G2IA 1E1VA 2XNGA 3ZZEA 3MH3A 3VBQA 4C4EA 2OJGA 4UMTA 4USFA 2UV2A 3KY2A 3PYYA 3DKGA 4BDAA 4TWOA 3U54A 4NK9A 1YXTA 3UOJA 5IKWA 4UV0A 2JDTA 4OR5A 2BDWA 3FV8A 4JBQA 2QKWB 2WZJA 3DDQA 4NM0A 1JKKA 3RJCA 3QQKA 3ORPA 4BTKA 5A6OA 2DUVA 3NUAA 5CZHA 5HTBA 4C4FA 2ITWA 4EK3A 2I1MA 5DYJA 2W5HA 3HKOA 5L8JA 2QOBA 4D9UA 3OG7A 2BIKB 3OF0A 3CE3A 2W05A 5ETAA 2YFXA 3TIZA 4DF3A 4O7YA 2X4FA 2VX0A 3S1HA 5BVKA 3HGKA 4F6UA 2W1HA 4WSQA 4KKHA 4IAIA 5HG8A 4KRCA 4JX7A 4FR4A 4P5ZA 4YU2A 4ALUA 4F1OA 4RFZA 4FKGA 5H8BA 2JKMA 4I5HA 3LE6A 3CY2A 3UYTA 3ZRKA 1J1CA 4CZTA 5CAQA 4DFBA 4EYJA 2ITPA 1Z5MA 2VNYA 2IW6A 4XOZA 5DRBA 3GENA 4CLJA 1J7IA 2HOGA 4YP8A 2BPMA 3KEXA 4WNPA 5HO6A 5KNJA 3FKOA 1XH4A 2C1AA 5EW9A 3A8WA 4QQCA 3VN9A 3QD4A 3F66A 4ZTMA 2HENA 3R1YA 4MBIA 3FLZA 3PA4A 1XJDA 3O50A 2E9UA 3QGWA 2YCFA 2H6DA 5CU4A 3RBWA 1B38A 4E26A 3P7AA 4L45A 3F7ZA 3SW7A 4DGGA 2YDJA 4EK8A 4BCOA 1Z9XA 3AG9A 1PYXA 1KE6A 4D0WA 3K5VA 4J1RA 2QO9A 2DS1A 3NUUA 3ATTA 1H1SA 3DY7A 2R3HA 4AA5A 4AZWA 5AX3A 3WILA 2CMWA 3D5UA 1JSVA 1OZ1A 4JDHA 3R7GA 4OT5A 3EFLA 2XYNA 5FXRA 2PUPA 3RGFA 4CZYB 2R3GA 4X2GA 4TYEA 4D1SA 2JBPA 1DAYA 4P5QA 5BMSA 3FSFA 4RJ7A 2G2FA 4BF2A 4D1XA 2NRUA 3I7BA 2X8DA 4PDOA 5GJGA 2GTMA 3AC2A 4O0SA 4RQVA 5CEIA 4KABA 4G5PA 3JXWA 4W8EA 3NW5A 3DXPA 5IEXA 1FMKA 3FZRA 3E8CA 4TTHB 5CX9A 4WNOA 1H07A 3CQEA 1UU9A 2WFYA 2PSQA 1Q4LA 5J8IA 1L8TA 4E3CA 3TT0A 3QUDA 3BHHA 3F2AA 4I5CA 1Q61A 4EYMA 3VS1A 2GNFA 2GHLA 3LM0A 2QC6A 4FT5A 2C1BA 4FICA 4A9TA 5CSVA 2W06A 4RVMA 4KUJA 4R78A 5ETIA 5KMKA 1L3RE 4FTJA 5IUIA 4RT7A 4YBJA 1KWPA 3DBEA 4QMZA 5AR7A 4EOJA 3JYAA 1U54B 2UVXA 2W4OA 3MA6A 4DFXE 3BHVA 3QWKA 4E8AA 2CNVA 3DAJA 4CFFA 1I44A 1Y6AA 3QYZA 1YOMA 4IE9A 3TTIA 4ZLYA 3FXXA 5IA1A 4JI9A 5M09A 4ASXA 4ZEGA 2UW7A 3R7UA 4DHFA 3ORNA 2A0CX 2W9FB 5AAGA 5A46A 1QMZA 2VO3A 3DK7A 5FXQA 2V0DA 3W8LA 2OFUA 4DTKA 2BRGA 5F1ZA 4BCKA 3E7OA 3GU7A 5GZAA 2B55A 4AE9A 4MXAA 4II5A 4Y72A 5TR6A 4PQNA 3LAUA 4OBOA 4U3ZA 4FTRA 4MNFA 3NIZA 3TXOA 3PA5A 4G1WA 4BGHA 2EXEA 4R1VA 5ANKA 4ZS0A 3COIA 4PP7A 2J51A 4F9CA 5FRIA 2OIDA 3FI2A 3KXMA 1A06A 3C4EA 3QC9A 5HCZA 4QP3A 2XKDA 4HJOA 3HX4A 3Q9ZA 4N4SA 3OOMA 3C4CA 5JQ8A 5JRSA 4UWBA 1Y8YA 3BGPA 2VO0A 3FZPA 4FVPA 3EQCA 4IAFA 3VC4A 4GG5A 3F5XA 1PXIA 5L3AA 2ZM4A 3DXQA 3H0YA 4F0FA 2R3IA 3LW0A 5IQFA 4YHFA 4DH3A 1G8AA 2XNNA 4I94A 5A6NA 1YOJA 3G51A 3OROA 3FLNC 3PXRA 3W8QA 4AZTA 1CKIA 2QOFA 2I0HA 3SOCA 3WOWA 2WB8A 3MSSA 3FZSA 4YC3A 5LVNA 1A48A 4C4HA 3EN5A 5DT0A 2PULA 4APPA 3LMHA 2CKEA 4GMYA 2OXXA 3BX5A 4LRMA 3E8EA 2H9VA 3TNPC 2I40A 4NSTA 3F5PA 4IFGA 4EH4A 4DFUA 4NCTC 3SHEA 3D5WA 5DE2A 1XH5A 3W18A 3JS2A 5HQ0A 5EW3A 3AMYA 5BX0A 1PXJA 3DAKA 3UVRA 1XWSA 2XIRA 4DH8A 2VTSA 4G3DA 4FVQA 3EKKA 1OPJA 1PMUA 2JAMA 2X0GA 3TV4A 3MVLA 4O27B 5I3OA 2Y7JA 5HBEA 1SZMA 3LXPA 4RIWB 4EC9A 4ENXA 4AACA 3QHWA 5DFPA 2Y0AA 1ZRZA 5AFVA 5EYKA 2ZM3A 4YJUA 5JFSA 4XBRA 4ZSGA 1ND4A 2X8EA 3EQBA 5DN3A 3W10A 4D4VA 3TL8A 5BPYA 1K2PA 3UNZA 1R1WA 3T9IA 2PZ5A 1LUFA 5CF5A 1OKYA 4C2VA 3DB8A 2IW9A 1Q5KA 5EHYA 4W9XA 4DC2A 1CTPE 1PMEA 3CSVA 3FY2A 4O83A 1H1PA 3QRTA 3OWPA 4X7QA 2VX3A 1ZLTA 3E5AA 4XNEA 4NJ3A 2Z8CA 4UZHA 4ACGA 5M07A 3RKBA 3PY1A 3FDNA 3FWQA 3BCEA 1LEWA 3MB7A 3KKVA 5FBNC 2P2HA 3IW6A 4D2SA 5A4EA 1F3MC 1Q3WA 3Q6UA 5IZFA 4BDKA 3ZM9A 2QU6A 2V22A 2EB3A 4MK0A 4FZ6A 5T68A 4BC6A 4C4IA 4F7SA 5C26A 3FY0A 5EQEA 3RM6A 2CN8A 2W4JA 1WBTA 4KINA 3UYSA 3U6JA 3ENMA 5LARA 3PPJA 5CZIA 3ROCA 4ACDA 3QQLA 3ORZA 3P5KA 4CKRA 5JFWA 4XOYA 3QCQA 4EJ7A 3L1SA 3ORXA 3MVHA 3PUPA 4FEQA 5IUHA 4IAAA 5EM6A 5BUIA 4JT3A 2W1GA 4E20A 3AMAA 4EHVA 2VZ6A 4G3FA 2WQOA 3FPMA 3GI3A 3HUCA 3SW4A 5HVKA 2IZTA 4CRLA 3ZCLA 5AJQA 5IQCA 2X7GA 4EUTA 4LV8A 5BVEA 1DI8A 1GZOA 3MY1A 4UALA 3NRMA 4IDTA 4QP1A 5IPJA 4NIFB 3P23A 4ANQA 5KBRA 4BDEA 5HIDA 4O1PA 4Y5HA 4I93A 4ASDA 4C02A 4HYHA 4QPAA 4B8MA 2GS6A 3EFWA 5A9UA 4RVKA 2C6DA 4FI1A 4G2FA 5ETCA 2DQ7X 3WF5A 2HZNA 4FOBA 4UWYA 5FBOA 4DH7A 5ITAA 1Q3DA 3CC6A 1OPKA 4GKHA 3OP5A 4FZ7A 4S30A 2C6LA 2CGWA 3EKNA 1IEPA 4JR7A 2QCSA 2YAAA 4BIBA 3A4PA 4TZRA 3NUPA 1H8FA 4OBQA 3UC4A 3O8TA 3ODYX 1KV1A 4BL1A 3ZRMA 3TNQB 3RTPA 4GH2A 4U97A 4TRLA 5J5SA 1A9UA 3FLSA 4ORKA 4U7ZA 4XRJA 3I6WA 4MYGA 4XJ0A 4AGDA 3PXQA 4BCQA 2PK9A 3ZFMA 5KZ0A 1G3NA 3OCBA 5HX6A 3P7BA 4O22A 5CENA 5J7HA 4CFXA 2VX1A 2C6IA 4JBPA 4WSYA 1RW8A 5M4CA 4IWDA 3NMUF 3LXKA 1GZ8A 3HV4A 3KK9A 3UIBA 2XNOA 2YCRA 2YJRA 3VRZA 4BTFA 4EUUA 2UZBA 4KBAA 4DEEA 4M0YA 4PMPA 5EKNA 5HORA 4IZ7A 3LCOA 4AQCA 1BI7A 5CS6A 2PE0A 3VUHA 2WMSA 4L7FA 5H8GA 3IDPA 4F9WA 4M8TA 3RK7A 2C47A 1CKPA 4OTFA 4L43A 5JZNA 1M52A 1P5EA 2BHEA 2JIVA 3BQCA 3QKKA 4IC7A 3EQFA 5C8MA 3UIXA 4ASZA 4MVFA 1UU3A 4WRGA 3Q4ZA 4LGHA 4AAAA 4IVDA 4O7RA 4HVIA 2RFSA 5TO8A 5IDNA 2BUJA 3WZJA 5AV0A 4A4OA 3BEGA 3PA3A 3QWJA 3QZFA 1WMKA 5DH3A 3W2OA 4L3LA 4AZVA 3SC1A 4FV5A 2ONLA 2XM9A 3E63A 3LHJA 1SNUA 4DINA 4EOIA 4L53A 5L8LA 4JRVA 2IW8A 2C3JA 1FQ1B 2XRWA 5D7AA 2A19B 1SYKA 2YLEA 4TYJA 5G6VA 4YJSA 5DA3A 4HVGA 3LFDA 4CEGA 3I4BA 5L2WA 3A7IA 5A3XA 4XMOA 4UBAA 4EI4A 2YEXA 1J91A 4FIJA 1P4FA 4U5JA 1YHVA 3O23A 2XCHA 3PLSA 1VJYA 4TY1A 2C6OA 5EI6A 4EH6A 3FMHA 1WVYA 4PMTA 5E8XA 4U0IA 4GSBA 4CZUA 5C27A 3OXTA 3C0GA 5B0XA 2J5FA 2QOLA 3F3WA 3R9DA 4HVHA 4FSQA 4ZLOA 2HWOA 5J79A 3C7QA 2SRCA 4JG6A 5J1WA 3QL8A 2CN5A 2WMAA 3R7OA 4OTDA 4XV2A 1ZAOA 5E8WA 5BVDA 3MN3A 1ZYLA 4K2RA 4FOCA 4MBLA 4V04A 3QCYA 1H1RA 5I3RA 3E93A 2XK3A 2Z7SA 4U6RA 4H36A 3TIYA 3TZ8A 5IQHA 4L42A 5E7RA 4B7TA 2VUWA 3C4XA 3EH9A 4JDKA 2IVSA 2UW6A 5CSWA 5J87A 5IQBA 4GJ2A 4JL9A 1W8CA 4QMQA 4FEWA 3MFUA 4RQKA 3IQ7A 4I20A 3L8SA 4E6DA 4RLLA 2OK1A 3MPMA 4FTMA 5D9HA 1HCKA 4HYUA 1PXKA 2R3PA 2BHHA 3ELJA 3HVCA 3KRJA 4IJ9A 4QPSA 3W2SA 3DTWA 2BCJA 2CSNA 4FSZA 5CSXA 5HG5A 1UU8A 1XO2B 5T6KA 5DMZA 5CF6A 1JSTA 2YCQA 4Z3VA 1NT2A 4DH5A 3BU6A 5E8UA 5IMXA 2AC3A 4FKIA 1REKA 3B2WA 1W84A 3UMXA 5JMSA 1IG1A 1BLXA 3FYJX 3L8VA 3T3VA 1WBOA 4BDDA 4E5AX 2UZEA 2X7OA 4O82A 2XJ1A 2YZLA 4ZXTA 3F3UA 5HOAA 4D2PA 1GJOA 4ZTHA 3OT8A 1LR4A 4FT0A 3G0FA 3Q5IA 4XHKB 3EQRA 4NL0A 3LJ2A 4RX8A 4RLKA 2J0JA 5CNOA 4ZZNA 5KE0A 5ACKA 1WBPA 4FZFB 4Y83A 3JY0A 2DYLA 3FMEA 3UNKA 2YITA 1M2QA 2I0YA 2ZM1A 3FMNA 1Q62A 3NX8A 2GMXA 3OS3A 5GZ9A 3H30A 4YJTA 4EOLA 5JGBA 3L9PA 4MQ1A 4CNHA 3BV2A 4DGLC 3MFRA 2BAQA 1J1BA 1XBCA 3HRFA 3FJQE 2ETRA 4L00A 3U8WA 4BCMA 4C61A 4OTIA 1H26A 3PIZA 2Q83A 1Y6BA 2YM4A 4QYEA 4O86A 2WGJA 4DTAA 2EU9A 2AC5A 4EOKA 1YXXA 5AA8A 5CSPA 4F6WA 5AEPA 4X2NA 5J9ZA 5M4FA 4IB1A 4A9SA 4RWKA 3H4JA 4WNKA 5AR4A 5HI2A 5I9WA 3C51A 5KX8A 2UW8A 4XG2A 1H1WA 2C0TA 3AQVA 3SKCA 3PG3A 4TWCA 3TZMA 4B6LA 4R8QA 3R2YA 5DGZA 4JLCA 3RZBA 4CXAA 4IFCA 4CVAA 3CD3A 3ITZA 5AP7A 3KFAA 3VWAA 2ITQA 5ACBC 4IX6A 1U5RA 2UZLA 2ZMCA 2JKQA 1ZYDA 2VTOA 3GBZA 4PV0A 5C03A 5E8YA 3SLSA 5DR9A 3E7VA 4FNWA 2WTCA 4NZWB 3VUDA 3VF8A 2RG5A 1ZZ2A 3MESA 3QU0A 3KA0A 1R3CA 3R9RA 2UZVA 2PE1A 2Z60A 2E9NA 3R83A 3BEAA 4AT5A 2XM8A 3CXWA 3BPRA 2QR8A 4RIYB 1JWHA 4FBXA 2ACXA 4IB0A 3IDBA 4O6EA 5CY3A 3RAWA 5FG8A 3HLLA 3BWFA 4BWXA 4G3EA 3NEWA 4FTAA 3KCFA 1JKTA 4XBUA 3SQQA 3SRVA 3VQHA 4BN1A 5L6OA 5IA2A 3QRUA 4FV2A 5CQWA 3ZH8A 3V5TA 4UYAA 3OY1A 2X2LA 5C01A 4AUAA 4U79A 4AW2A 2VTLA 3F3VA 1V0OA 4IJPA 3F5UA 4FKOA 2OJJA 4WIHA 2XK8A 4WG5A 4YTIA 5H2UA 4F08A 1YWVA 2GDOA 2W1FA 5BYYA 3PSCA 4UMRA 3POZA 4YTFA 3ORKA 3FL5A 4XG4A 3AC1A 3FEGA 4PTCA 5CAVA 4UX9A 1E9HA 1PXOA 4WRSA 1K9AA 3GC0A 3QQHA 1W0XC 2Y6MA 4J52A 3NIEA 3GC8A 4AFJA 3A99A 4FNZA 3TNHA 2RFEA 2PVNA 4GFGA 4RRVA 5EG3A 2XF0A 4MXCA 2HZ0A 4J8MA 4IW0A 4FX3A 3R9OA 2OFVA 1URCA 3PP0A 2CHLA 2W1ZA 5BMMA 2QD9A 3HA8A 3VO3A 3V8SA 4XG7A 4IZAA 4IACA 3KGAA 1YI4A 1R0PA 2YZAA 3KMWA 4O6LA 3WIGA 4YJVA 2XRUA 4WG3A 4FSWA 2I0VA 2QOHA 4C3RA 3EN7A 4FIEA 4BYJA 5A4QA 4JNWA 2WMXA 4FTIA 5EM5A 1ZMWA 2UZUE 3ULZA 2E9VA 1UA2A 4EOSA 3LMIA 5F20A 1CSNA 2ZVAA 1W98A 1DAWA 1P14A 2XBJA 1UV5A 3B8RA 2F2UA 5HGIA 2VTJA 3IS5A 5AX9A 4QTBA 5HBJA 1OIQA 2W17A 4LG4A 3GNIB 3H0ZA 1XR1A 4EH5A 3BU3A 1M7QA 4EH2A 2JKKA 4CV9A 3KRLA 5JZJA 3P79A 2VTMA 3CTJA 4BBFA 2PVFA 4LL5A 1H01A 4R3PA 2GNLA 5CVFA 3LFFA 2VTIA 2JDOA 5IQGA 2PY3A 3GC9A 3ERKA 3Q9XA 4WA9A 1ZY5A 3DLZA 2FO0A 3F2NA 2XMYA 3GB2A 4RVLA 3BI6A 4FSNA 4ZTRA 1UWJA 4I23A 3KXXA 2J5EA 5HU9A 4BDBA 5HTIA 1GIHA 4IQ6A 2O64A 3ZBFA 4WHZA 3REPA 4C3FA 1JKLA 1KSWA 3R21A 1CMKE 1OL5A 4FKVA 4DFLA 4TPTA 3AXWA 3D9VA 4MXOA 3QQGA 3BHYA 5CXZA 3DBQA 2OJFE 3HMPA 3M2WA 1XQZA 3HP5A 4K33A 4RZWA 3PZHA 2PZPA 2ZV7A 3A8XA 3SAYA 3EFKA 2XYUA 1WZYA 1XH9A 3D7TB 3NDMA 3VVHA 2WOTA 4ACHA 1O6KA 3SXSA 3CCNA 4RWJA 4WNMA 5EQPA 3ZU7A 5B2MA 3A7HA 3KXGA 2IPXA 3UZTA 3N9XA 3CQWA 3PWDA 3ZONA 5HO8A 1F5QA 2X7FA 1OMWA 2YWPA 5I9YA 3SXFA 3F69A 4EOMA 5LQFA 4PNIA 3TM0A 4XCUA 3TEIA 5H9BA 3E3BX 4YSJA 3G15A 4C4JA 4C34A 4GK3A 4BCGA 1B6CB 2R2PA 2VTAA 5IA4A 2HCKA 1PW2A 2WMBA 3NNXA 3PJ2A 3IKAA 3ZUTA 1FMOE 4I41A 5DT3A 3DPKA 4E5BA 3D5VA 2A2AA 3FC2A 4ZMFA 1Y8GA 4KRDA 4YTCA 3NUYA 4RC3A 4W4XA 4FT7A 3IOKA 4NEUA 5LMBA 2QOKA 3VW6A 2YM8A 3DNDA 4ZJIA 4JQ7A 2HY0A 2XJ0A 2C6MA 2GNIA 4ITJA 4M15A 4TYHB 5EOBA 5HIEA 4R7BA 4FEVA 2HAKA 3ZEWA 4FV1A 4C2WA 2YDIA 3PP1A 4YZMA 5FXSA 2FB8A 2J7TA 3MA3A 4JVGA 3CR0A 5CAUA 3MJ2A 3O0GA 3W2PA 1OL6A 4DN5A 3UO5A 2OH4A 2Y6OA 2XKEA 3BIZA 1YXSA 3DFCB 3QZIA 2RGPA 3GC7A 4ZS4A 4YC6A 3PG1A 3KULB 3UODA 1IAHA 1M2RA 5L2QA 4LV5A 4XG6A 4GL9A 3G90X 3QTUA 2B9FA 4GT4A 5ANEA 1UNHA 3C5UA 2X4ZA 1Q97A 1YQJA 4JDIA 4AFEA 5LVLA 2J0IA 3DXNA 2B1PA 2Q0BA 4FIGA 3NNWA 5EYDA 3TNIA 1FOTA 4LRKA 4EH3A 3KRRA 4RJ8A 3NYOA 5BVFA 4U44A 3MH1A 2B4SB 3CJGA 5EQYA 4XYFA 4XV3A 3UE4A 4ANMA 4UWCA 3TV6A 4NWMA 4C33A 5J5TA 3P7CA 3Q60A 3EQGA 3QD0A 2PVKA 5HG7A 3N4TA 5IA0A 4BKJA 2C6KA 4G6LA 4QP7A 5DBXA 4AWIA 4OW8A 2GFSA 1ZWSA 4YC8A 4EOQA 3TKUA 1MUOA 3BE2A 2G15A 3FZ1A 2JDVA 2ZYBA 4QP6A 3PVGA 1UVRA 4BZDA 1PF8A 3VUKA 2ZOQA 2QR7A 4LI5A 4NW6A 5CVHA 5AR5A 4FL2A 3VAPA 2GNJA 5B2LA 4E73A 2F4JA 3KK8A 3QTXA 3OBJA 4WD5A 4BCFA 4WBOA 2IZRA 3LQ5A 1WBSA 1ZY4A 5LCJA 1FINA 3GQIA 1Q8YA 2WEIA 2WEVA 2XK4A 5JKGA 3UZPA 3DV3A 3PVWA 5FEEA 4OTGA 4KA3A 5TE0A 4MQ2A 3KC3A 4ANBA 1P4OA 5JN2A 2W1DA 3N4VA 1ATPE 2WELA 2VGPA 3QALE 4AGWA 1NVQA 4MCVA 4R5YA 2C3KA 4EHZA 4F0IA 2B53A 5AUTA 2OWBA 2XBAA 3KB7A 2VGOA 5I0BA 1APME 4FKLA 4ZTLA 4E4NA 4EC8A 3AOXA 4FKWA 4S34A 4QQJA 2RG6A 1BMKA 3D2IA 3GCVA 4O7WA 3TJDA 3C13A 3EMGA 4TNBA 5I5ZA 2QHNA 3DZOA 3NAXA 3ZXTA 2CDZA 2JC6A 4IDVA 1LP4A 5BYZA 3Q53A 3ZC6A 2FUMA 3UGCA 2YERA 3O17A 3UP7A 4AZEA 3S00A 4YJQA 4JXFA 2OJ9A 2VWBA 2OZOA 4BDJA 3L9MA 5EI2A 4CG8A 4DG3E 4FG9A 4PP9A 4FL1A 1YHSA 2HW6A 2V62A 2V55A 3S2PA 4EEVA 1QPCA 3OWLA 2CLQA 3GU6A 4RIXB 3MIYA 5HD7A 5KKRC 1KE9A 3VIDA 1WBWA 2C0IA 4CMOA 3ZZWA 3I0QA 2LAVA 4KBKA 1IRKA 3PJ1A 2OBJA 2PYWA 5IQIA 4F9AA 3LKMA 3QQUA 3S95A 4BDIA 3PJ3A 5AP3A 4E1ZA 2ETKA 2BZIB 3R7EA 1XH8A 3E88A 5HBHA 5IUGA 3GVUA 5DI1A 4CSVA 2UW4A 5AIRA 1SMHA 3AD5A 4MD8E 2W5AA 3GU4A 4JDJA 5D1JA 3ROYA 3TACA 3WZEA 4BZOA 5BNJA 1UU7A 3TDVA 2GQSA 1U4DA 4UY9A 2W1CA 3HYHA 5DWRA 3P78A 2Y4PA 2B0QA 4HGTA 4IXPA 2JKOA 4PL4A 4CKIA 4QMNA 3WZUA 3I5NA 4ZLZA 5HLPA 5IA5A 3NNVA 5HEZA 3I7CA 3LFBA 5D12A 3RPSA 4BTMA 1YRPA 4ITIA 3NWWA 2C4GA 4M13A 3GCSA 1OL7A 4QTAA 4YJPA 3UJGA 4BRXA 5IMEA 3EQPA 2PMNX 3WE8A 4IWPA 2RKUA 3JY9A 4BCJA 4BBEA 3UZRA 3ID6C 2FSTX 4ANLA 3G2FA 5KCVA 4EOPA 3EYGA 5DT4A 4FKJA 1BUHA 3G0EA 4N57A 4ANNA 3N51A 5I4NA 3HA6A 4DEAA 3MFSA 4TKSA 4F0GA 3FYKX 3V51A 3DKFA 3FBVA 4RVTA 1KOBA 4GYIA 3O8UA 5LCKA 4IX4A 2P4IA 3LFCA 3UOKA 4I6FA 5BQ0A 3BYOA 4I5MA 4QYHA 5CU2A 3V5PA 3R00A 4Y73A 2RFNA 4X6QC 4O38A 2C5OA 2FVDA 4MX9A 3UO6A 4BFMA 2BMCA 3AC8A 3UIUA 2H34A 4PL5A 4QMOA 4EHEA 5C4LA 4FSRA 1OBDA 2B7AA 3PTGA 4FV3A 4BCIA 4MEDA 4IADA 4M67A 4GS6A 5E92A 4BI0A 3EQDA 1XH7A 2C6TA 2RFDA 3I1AA 4FKTA 4JRNA 4S31A 4EQUA 5AADA 4ZOGA 3JR1A 2J90A 2R3MA 3THBA 4CRSA 4JR3A 5IQAA 3HMIA 1GY3A 2VTRA 4IB3A 4O0VA 3KVXA 4FA2A 3GUBA 2ITXA 2UW0A 2WPAA 4IZ5A 1WVXA 4BDGA 3CQUA 4RJ3A 2QOIA 3RPRA 5KMMA 3GGFA 3NCZA 3SDJA 2PVHA 4FIIA 3IDCA 1WBVA 4IWQA 4F64A 3E87A 2B54A 4G9CA 3DJ7A 2QOQA 3UC3A 2R3LA 1U54A 3PIYA 1WVWA 2W1EA 3Q5ZA 3HMOA 4M84A 5I9VA 1QPDA 3M42A 3BBWA 4F6SA 3T8OA 4C57A 4JQ8A 4OT6A 3R0TA 2BZJA 3RVGA 3QXPA 4NFNA 5K4IA 1RE8A 2H96A 2WTIA 5A4LA 3TUDA 4QYFA 2PZRA 4O1OA 4NM5A 2JD5A 5AP6A 2QLUA 2RL5A 4V0GB 1ZARA 2X6EA 5CT7A 2HYYA 4X3FB 3WYYA 3ZEPA 5FEQA 1JBPE 2PHKA 2XKCA 3UPXA 4R3CA 5HLWA 3FI8A 3QTZA 3A60A 2HY81 2ITTA 3UMWA 5CEPA 5IDPA 1V0PA 3LQ3A 3L9LA 4EQCA 1YHWA 2E9PA 3UOLA 4CCUA 3UVQA 3F5GA 3QA0A 3PRFA 3R71A 4M68A 2NPQA 4MXXA 5GJDA 3VJOA 3MV5A 2YAKA 4QOXA 4C37A 2A27A 4FG7A 2X6DA 4NM3A 2R0UA 5CU6A 2FH9A 4IB5A 4Z9LA 5EH0A 3MS9A 3NSZA 4OTQA 5CLPA 3RCJA 2UUEA 2ZV9A 4QMVA 3TNWA 5IQEA 4HPTE 3RK5A 2CKPA 4G3CA 4ZTSA 2WD1A 3VBVA 3T3UA 3EZRA 4ZK5A 3QX2A 2ITUA 4FNYA 2UVYA 4ZJVA 4QTCA 2CPKE 4MD7E 4BCPA 5HHWA 4G34A 4GFOA 1FGKA 3WZKA 5LMKA 4P2KA 2VAGA 3ZSHA 4M66A 5DLSA 4D4SA 2YIXA 4HNIA 1PKGA 2C69A 2UZTA 5FDXA 2ZV2A 3DLSA 3FE3A 4BDFA 3TN8A 2RF9A 3VS6A 3D94A 4H05A 4LGGA 2B9IA 2F49A 3GQLA 4PF4A 4ZY6A 3AGLA 4BKZA 1Y57A 4A4XA 5DIAA 4Y46A 4ZSAA 1TQPA 3R01A 3RM7A 4R3RA 3DJ5A 3QUPA 2QQ7A 5A4TA 1QPJA 4PNKA 4RC4A 2OZAB 4F7NA 3SX9A 5T3QA 3OWJA 3UG2A 3V8TA 2QNJA 5HNBA 3SV0A 4Y5QA 3SD0A 5LWMA 3OEFX 4O0RA 2X9FA 5HKMA 2ITYA 4RA4A 3I79A 1OUYA 4MBJA 5TKDA 2WMRA 1H1QA 1SM2A 2JLDA 2O65A 3L9NA 4NJDA 4NT4A 4MWIA 5E1EA 5E9EA 3C0HA 2BDJA 4PMMA 2Y8OA 1GOLA 4S33A 5M44A 5EDQA 4RIWA 3H9OA 3P0MA 2XZSA 4MNEB 4YLKA 4CT2A 5JT2A 5BVWA 2JDSA 3NS9A 4TN6A 3V04A 4C3PA 4GU9A 3LVPA 3G33A 3DQXA 3CS9A 5I9XA 4LOOA 1YDRE 2OGVA 2CCHA 2Y4IB 3LFSA 3W55A 4IM2A 5C4KA 3AT2A 3BHUA 2WTJA 3PJCA 4Z16A 3KCKA 4RGJA 4D2TA 3G6HA 5HCXA 3NR9A 4E6AA 2PUUA 3HL7A 2VWZA 3KQ7A 4H39A 4KB8A 4MXYA 3RAKA 1YKRA 1J3HA 4GW8A 3PSDA 3R8MA 3R7IA 4KIQA 4EK4A 4N70A 3VUTA 3P4KA 3IW7A 3QXOA 5FM2A 2ITZA 4BKYA 4NM7A 4ACCA 4CQEA 3BGZA 2CGUA 5M08A 5J7BA 4UXLA 1IAJA 1PRYA 4QTEA 3VQUA 4O7VA 2VU3A 4MXZA 3W32A 5C8KA 4TWPA 2J9MA 4UMQA 3GFEA 1R39A 2VWIA 5ICPA 4KKGA 1GAGA 4XLIA 4RMZA 1ZOHA 4YNOA 4M69B 3KMMA 3PZEA 1FGIA 4HOKA 1YWNA 2XIXA 3HDNA 2XK9A 5KMJA 4FK6A 5EHLA 3UQGA 3QCSA 5IH6A 3ALNA 3MB6A 2HXLA 2JGZA 3AT3A 5HLNA 4UEUA 2Z7RA 1BL6A 4D2WA 2JAVA 2EXMA 5CAOA 2RIOA 2BAJA 2R4BA 1SVHA 2HXQA 2QKRA 4R1YA 4XG3A 5KMLA 3B2TA 3NZ0A 2Z2WA 1FBNA 2UZWE 4FIHA 4F7JA 2FA2A 1IA8A 4QTDA 1OPLA 3OW4A 4Q9ZA 5E8ZA 4FKQA 2JEDA 2JITA 4NIFA 3R30A 5HO7A 1Q24A 4E7WA 2J4ZA 3MY5A 3W2RA 1BKXA 4F1TA 4U81A 3RAIA 3F88A 4GUBA 5EI8A 3ZXZA 5M51A 2QG7A 2X2MA 4TXCA 3R8ZA 4OGRA 2YIQA 5CF8A 4ANSA 4DH1A 4RPVA 4USEA 3AMBA 3Q9WA 1XBAA 1O6LA 4XP0A 5CASA 1UNLA 5J9YA 4GT3A 3FXZA 3MYGA 5AP0A 3OCGA 3U55A 4XP2A 2B52A 5ANJA 4J97A 5D10A 3AD4A 3NGAA 4N6ZA 3ZFXA 5EFQA 3U6IA 1ZZLA 5K9IA 4BGQA 4GV1A 3LLAA 2BIYA 3MIAA 4IHPA 2PWLA 3AC5A 3R73A 4MD9E 3L8XA 5F95A 4D2RA 5HX8A 4FUXA 3UNJA 4D1ZA 4EORA 5M4IA 3QFVA 4YTHA 4RC2A 5HE3A 4ZAUA 1MP8A 3FI3A 2V5QA 2F2CB 4CKJA 2QG5A 3MJ1A 3OT3A 4N0SA 3RHKA 3RNIA 5LVMA 3VHEA 4JOAA 3W1FA 4D4YA 4O0TA 4OLIA 1YI3A 2WKMA 3MDYA 1GNGA 2ZDUA 4I0RA 5H3QA 3W2CA 2WNTA 1IA9A 2BKKA 1ZOEA 1OIYA 4MNEA 4DEBA 5M06A 3ZO3A 4EZ5A 2J0LA 4BDCA 4QQTA 2X2KA 3UO4A 4RFYA 4CMTA 5AV1A 3IPHA 4CTCA 3A62A 3V5JA 3UBDA 3PY0A 2ESMA 2EWAA 1PHKA 4BGGA 3U6HA 5HE1A 1R0EA 4NKSA 2A4LA 3PFQA 5EYMA 2OW3A 4LOPA 4FV7A 5AAEA 2BTRA 4S32A 2AUHA 3EWHA 4YJRA 3MPTA 4BICA 4AZSA 4FTUA 3PVUA 3RMFA 4FYOA 3D5XA 2XIZA 4ALWA 3OCTA 5BVOA 4MHAA 3FPQA 5AIKA 1AQ1A 3HV7A 5HVYA 2GU8A 3UG1A 3DJ6A 2VN9A 3OUKA 2QI8A 4PPAA 1VYWA 3OW3A 3PSBA 4QMYA 3TI1A 3VUIA 4LRJA 4FUYA 4O2ZA 3C0IA 3Q2JA 3OCSA 3ZLXA 5GHVA 4X6RA 2EB2A 2P33A 3DFAA 4FIFA 4FV6A 3O7LB 4J99A 5AUWA 3D7ZA 5JSMA 4H1MA 5KMOA 1I09A 2EVAA 3RALA 2O3PA 3U9NA 4DT9A 1QPEA 3ZTXA 4LUEA 3BZ3A 3Q96A 4GU6A 5HVJA 4ZIMA 5JEBA 4IX3A 3HZTA 5KKRB 2IN6A 1PJKA 2OIQA 3QRKA 4GFMA 5H8EA 2GHGA 2WIPA 3R2BA 5HTCA 4C4GA 5HU3A 1VYZA 2I7QA 2GSFA 2YWVA 4LYNA 5CXHA 3ZS5A 4DCEA 1JNKA 3RPYA 4EBWA 4ONAA 1YOLA 2EXCX 3QUEA 3TZ9A 3RI1A 3O8PA 4XRLA 3LQ8A 3R1NA 4PDSA 2YM5A 1GIIA 2GPHA 3R7YA 4Z7GA 2UZDA 4QMUA 4JJRA 4IAYA 5DR6A 5F4NA 1QCFA 3TJCA 5JFVA 4ZJJA 5K5NA 2OLCA 4FEUA 2JFMA 2G1TA 2VWWA 4B9DA 4FZAB 4J96A 2IVTA 4JAJA 1H0WA 3ZLSA 2C5VA 3F9NA 5AUUA 4RFMA 4RA5A 3TZ7A 3O51A 3R7VA 2IWIA 2R3QA 2R3OA 3GEQA 5HZNA 4CGAA 5B2KA 3P9JA 5HCYA 3FQSA 2ONLC 2C5NA 2HZIA 2R7IA 3IW5A 3GU8A 3O96A 3PY3A 3QC4A 4ACMA 5LWNA 1JAMA 3V3VA 4C58A 3NUXA 3Q32A 3ZUVA 4FC0A 2W5BA 5CI6A 5FWKK 4K8AA 3DAEA 5JGAA 3OTVA 1MRVA 3CTQA 3Q3BA 4GK4A 3BWJA 4CMUA 3ANRA 4FG8A 4IVCA 3G9NA 5CU3A 3TV7A 4I5PA 3EN4A 4YPSA 1GZNA 5ANOA 3EB0A 4CYJA 2YM6A 5J1VA 2WQBA 1FVRA 4YUQA 2WMUA 2CNQA 4U80A 4KBCA 5HNGA 4HGEA 4L6QA 1G8SA 3FMLA 1JSUA 3C50A 4KIKB 4DBNA 2YDKA 4Z7HA 3HV5A 4L3PA 1OKWA 4HW7A 2ITOA 4PDYA 4KSPA 4YZCA 3BYSA 2PVYA 3EN6A 4GUEA 4FTKA 2VWVA 3DCVA 1ZYSA 4PY1A 2OO8X 4L3JA 3PXKA 4FSUA 4UB7A 3A4OX 5AM6A 4RWIA 3GCQA 1ZMVA 3RPVA 5LXMA 2XNEA 1YXUA 4ZZOA 3MW1A 4AGUA 3ZM4A 4U8ZA 4R77A 4P7EA 2XIKA 4BYIA 4ZTQA 3I0OA 1KOAA 3H10A 3IG7A 4JG8A 5CNNA 4M3QA 3ZO1A 4BB4A 2X1NA 4R7IA 4F7LA 4XX9A 1E1XA 1PYEA 2BILB 2PMLX 1FPUA 1SVGA 4QMPA 3O7LD 5JH6A 3VS0A 4DLJA 5GINE 5CSHA 4I6HA 2R3FA 3RPOA 4EBVA 4F65A 3MH2A 1LPUA 3EZVA 2YLFA 4JS8A 5FUTA 1PXMA 4E6CA 4F99A 3R1SA 4FMQA 4I24A 5CWZA 3GFWA 3FQEA 2O0UA 3ORTA 4RIYA 4F1MA 4C7TA 4D28A 2ETMA 1REJA 5D41A 3PE1A 4F70A 4U3YA 2PVRA 1BL7A 3JVRA 4LMUA 2NO3A 3E8DA 2IVVA 3UTOA 4CTBA 5I9UA 5FQDC 4PL3A 4ZZMA 4HPUE 3Q04A 4DEDA 4O7LA 2Z02A 2J6MA 1XH6A 4HYIA 2R0IA 5DVRA 4XG8A 2FSOX 1PKDA 4AF3A 3BLHA 1V1KA 4Y85A 1ZYJA 3BRBA 4UZDA 3R8UA 3QD3A 4QP2A 4YNEA 5AUZA 2Z7LA 1PMVA 2WMVA 4J98A 3DKCA 3QLGA 4GT5A 4Q5HA 4QMXA 3OBGA 5AAFA 5ANIA 4KIOA 3FQHA 5AR3A 1H08A 5GZ8A 1OKVA 3QRIA 5HNIX 1KE7A 1YDTE 1RQQA 4E6QA 2BFXA 3HAMA 4CFMA 4P4CA 3C4FA 1H24A 2F9GA 2J0MB 2BALA 3OD6X 4CFWA 2WQEA 3DT1A 3LFAA 4ZSEA 3E3PA 2I0EA 3ZC5A 2JIIA 2O5KA 5KHWA 3EHAA 5EYCA 3SA0A 2OKRA 3DK6A 3U51A 2IZSA 4A07A 2PVLA 2PPQA 4BR3A 4G6OA 2X8IA 3PE2A 3EOCA 1K3AA 4IAKA 4QMMA 4YHTA 3VBXA 5DR2A 2HIWA 3ENHA 3W2QA 4G17A 1KUTA 1OGUA 3ATSA 2OF4A 3FI4A 2RSVA 4XS2A 3KRWA 2YA9A 2YIWA 3FKNA 4J53A 4D4RA 2WTWA 1WBNA 3ALOA 4NCTA 3QX4A 2XS0A 5CAPA 3ZUUA 3D83A 4KIKA 4YLJA 4M97A 4IZYA 4QT1A 3PRIA 3ZLYA 3CIKA 2WTDA 4DFZE 4Q9SA 5GIPE 4BY9E 5FTGA 4MH7A 2QODA 3KREA 3IW4A 2QOCA 2XK6A 4KD1A 2VTQA 3MWUA 2XCKA 5FM3A 1SVEA 3WF6A 4D55A 4DA5A 1QL6A 3R8LA 3DB6A 4IIRA 4B8LA 3ZOSA 3TTJA 4GIIA 3CTHA 4QP9A 2OU7A 4YZBA 3II5A 1OITA 3EN9A 3WARA 4HYSA 1J7UA 2CKOA 3NNUA 4YMJA 4X2JA 2P2IA 2QONA 3KF4A 4YR8A 3R28A 3OOGA 1GIJA 2XP2A 2GFCA 4LGDA 4ASEA 1FVTA 4NU1A 2YABA 4BCHA 4X2KA 3VBYA 2VTNA 1W83A 2YM7A 3ZO4A 3D2KA 3SG8A 4FKSA 3QYWA 4E4LA 4CQGA 3AGMA 3MGYA 5CYIA 4RX9A 5IEYA 1TQMA 4KWPA 5IISA 2V7OA 4BVUA 4CFVA 5F94A 1MQBA 2C3IB 3F6XA 3NYVA 3TWJA 4C59A 3D7TA 3GT8A 3VW8A 4BHNA 3HP2A 4CCBA 4LMNA 4ZP5A 3FC1X 4K18A 3ZDUA 2LGCA 2CNUA 3MY0A 3G6GA 4RBLA 4E93A 3CJFA 3NCGA 2C0OA 2P0CA 5LVPA 2WMWA 5J95A 3KXHA 3R8PA 3QAME 4A7CA 3FMDA 3K2LA 2IO6A 4QNYA 4TL0A 3DGKA 4HCTA 3ANQA 3IW8A 4G9RA 5HICA 2VTPA 3E8NA 2JFLA 3QQFA 1DI9A 4IH8A 4UXQA 2VD5A 4AN3A 2YM3A 2C5YA 3UVPA 2ERKA 1BYGA 1BI8A 3S3IA 3LM5A 2XJ2A 4FL3A 5G1XA 2BFYA 4K9YA 2VRXA 4TWNA 5L2TA 3ORMA 4J7BA 4ID7A 1WAKA 2XA4A 4I0SA 3HRBA 4BHZA 4AS0A 4D2VA 3DBCA 4IM0A 4OTPA 3F7WA 4O7SA 3QTQA 3H3CA 5EK7A 3OZ6A 4UYNA 4W9WA 4DGNA 4CLIA 5K4JA 1U46A 4FTLA 4B4LA 5I9ZA 5IG1A 2VV9A 4DEGA 3ORIA 4YZ9A 4QMTA 2WU7A 4EQMA 2IG7A 4EKLA 1RJBA 1TQIA 4TYHA 2XIYA 4HGLA 5K5XA 1PY5A 2B9HA 2C30A 3FKLA 4H58A 3VS4A 3C5IA 3NAYA 1Q99A 2BRHA 2YIRA 3BELA 3OFMA 1MRYA 4OUCA 3A7GA 5GJFA 4BDHA 1STCE 3I81A 4FNXA 4IM3A 2QO2A 2W99B 3AD6A 4EK5A 4J8NA 4GK2A 3HNGA 4HVDA 5BYLA 1CDKA 4I0TA 4QP8A 4ERWA 5CANA 1DM2A 1TKIA 2WTVA 1ERKA 3HRCA 1ZXEA 3KULA 4APCA 4BWPA 2F7ZE 2X81A 5TT7A 3PVBA 3KU2A 4NUSA 5DPVA 5KO1A 4HZRA 3FSKA 3NLBA 4FYNA 3I5ZA 1JQHA 3NVMB 3JVSA 3VRYA 2YIYA 5EW8A 1NXKA 3OUNB 3WYXA 4FKUA 4ITHA 2IJMA 3U87A 5IF1A 1T45A 2FYSA 4NFMA 4GEOA 4MF1A 3I6UA 2WOUA 3EIDA 3CBLA 3OXIA 4QRCA 3HAVA 3LXLA 5AP1A 3IK3A 3EJ1A 3ACJA 1M2PA 2CCIA 3IO7A 2ZAZA 3R22A 4YJOA 3U4WA 5LMAA 4CT1A 4HCVA 1R78A 3FXWA 2WO6A 1OIRA 5AA9A 5CQUA 3KVWA 3LJ0A 3GOPA 4AA0A 3DA6A 1O9UA 2QOOA 5BUJA 2BRNA 2E2BA 2JIUA 1OECA 1UNGA 5JRQA 4EWHA 3VS5A 3SVVA 2GS2A 3LFQA 5CEOA 3HECA 4EHGA 4QPMA 1OL2A 2QLQA 3VBTA 4EH9A 4DT8A 3HUBA 5HIBA 4IVBA 3MI9A 4XP3A 2ZB0A 3LJ1A 3PIXA 4MF0A 2BTSA 3NVKI 4XH6A 3OC1A 5FEDA 2O8YA 2GNHA 4YJNA 3AC3A 4AN2A 2R64A 4EOOA 3BGQA 2WTKC 3KXNA 4K77A 5LVOA 3HV6A 4U42A 3F61A 3VS2A 4OTWA 4C38A 4DEHA 3GXLA 3IECA 3VUMA 4GRBA 5FP6A 5KMIA 2KULA 1M14A 3LZBA 4GVAA 3QBNA 4I6BA 2J0KA 4JAIA 4D5KA 3V5LA 2G9XA 3BHTA 4K0YA 4EK6A 2FGIA 2QURA 4OAVB 3LLTA 1OKZA 3SOAA 2R3KA 2VTTA 3CLYA 4M7IA 4YO6A 4FV8A 3ZYAA 4KKEA 3DU8A 3HV3A 3KF7A 4ZY5A 2YACA 1XHAA 3DZQA 3A7JA 1OB3A 1YWRA 3RHXA 4E5WA 4GCJA 2YN8A 4CFUA 2IZUA 4XEYA 3WI6A 5KBQA 3OVVA 2XK7A 3ACKA 4C35A 2BDFA 4F09A 3R04A 5TF9A 1GZKA 3TDWA 2W1IA 2R3RA 1B39A 3Q2MA 3GOKA 3Q4CA 3EL8A 3CPBA 4RIXA 2VTHA 3ETAA 3C4ZA 5CEMA 5ANGA 3VUGA 2OSCA 2PUNA 4EZ7A 3OXZA 1H4LA 4AE6A 4A9YA 5K0KA 3PXZA 2ERZE 4FTOA 4IC8A 2BRMA 4NW5A 4QP4A 4AP7A 4BWKA 4D5HA 4DE4A 1JLUE 4U45A 4CV8A 4KS7A 4MKCA 4PPCA 3GCUA 3R6XA 4PPBA 5EDPA 2YISA 4CFNA 2OICA 4DFYA 1Y91A 2O63A 3IONA 5BUEA 4DGMA 1KV2A 3VS3A 1U5QA 2CGXA 3QHRA 3MFTA 3VJNA 1AGWA 3U4UA 2PU8A 4W4WA 3SG9A 3HDMA 5EM7A 4HGSA 4WT6A 4OAUC 3R8VA 3QF9A 4EWQA 4G5JA 3L8PA 4AT3A 4AOJA 4AXAA 1MQ4A 3RP9A 4JBVA 4KNBA 5M56A 2BZKB 1H0VA 4DEIA 3V6RA 3VHKA 2CGVA 3N4UA 1Q8TA 3DTCA 3HEGA 3O71A 3I60A 2OF2A 3S0OA 4WKQA 2BZHB 1OVEA 4TYGA 5CF4A 2NRYA 4O96A 3LFEA 4I3ZA 2Y9QA 3KMUA 2ZMDA 4QQ5A 4L01A 2X39A 2XNMA 3LCDA 2ZJWA 3LCTA 4LQMA 4D0XA 4IAZA 3EQHA 3FL4A 4YO4A 1O6YA 5FGKA 3P1AA 4H1JA 4J95A 4RG0A 4AX8A 5E4HA 3Q52A 4M14A 4MTAA 4DG2E 3V5QA 2P3GX 2W9ZB 1V0BA 2OI4X 2OG8A 4V01A 1KE5A 4NKAA 1H27A 5FP5A 3LXNA 1UKHA 5FLFA 4BIDA 2XEYA 1AD5A 3BYVA 3UP2A 4PRJA 4FE2A 5KUPA 3DKOA 3Q9YA 4UN0C 1H28A 4I6QA 3LPBA 5IH5A 3V8WA 5DOSA 5FDPA 1NA7A 4OBPA 1M17A 3M11A 2P55A 3IGOA 2ITNA 4MWHA 4R7HA 3WBLA 4FT9A 2JBOA 4LFIA 3LFNA 5HESA 5HG9A 2C5XA 2J50A 3KL8A 5DNRA 1EH4A 3QZGA 5ETFA 4EL9A 5IEVA 2J2IB 3E64A 1OM1A 4L7SA 3FHIA 3PLAE 5CTPA 4DITA 4FEXA 4U40A 5A14A 1JKSA 1LEZA 1WFCA 4X2FA 3E92A 3ZRLA 5L2SA 3UQFA 2BKZA 4W8DA 3NYNA 3PPZA 1PMNA 4JQEA 4UMUA 2PTKA 1IASA 2PL0A 2OJIA 4A9RA 3ZBXA 5JK3A 4OTRA 5D7VA 3QQJA 5DRDA 5CU0A 5L2IA 2BR1A 4X21A 5JGDA 1NW1A 3LIJA 3TUCA 3QTRA 4BI2A 5EHOA 5E8TA 3RZFA 2XNBA 3T9TA 3EYHA 4IX5A 2B9JA 3HMNA 2GHMA 3ODZX 4K6ZA 2QU5A 2W0JA 4O7TA 4BBMA 2X9EA 4QYYA 4YLLA 3SXRA 4ARKA 3WF7A 4FK3A 2R7BA 3A7FA 5EDRA 1NVRA 2A1AB 3E62A 2Q0NA 4PMSA 3QGYA 3MTLA 4V0GA 3B8QA 4XV9A 4X3FA 5HE2A 3F2RA 4ENYA 1YVJA 4L44A 4H3QA 4IVAA 4K1BA 4UMPA 3UIMA 4A9UA 1HOWA 2F7EE 2UW9A 4WOVA 2WQNA 3M1SA 2FSLX 3QKMA 4K11A 5CT0A 2HZ4A 5AUXA 3MVMA 5LOHA 3FUPA 5M57A 3EFJA 3D15A 5FTOA 3C4WA 5A4CA 5KZIA 2EUFB 3MTFA 2OXDA 3NPCA 4FV9A 3K5UA 3KXZA 3QTSA 3CPCA 4USDA 3V01A 3OWKA 3R9HA 3KN6A 4U41A 3ULIA 3WZDA 5AMNA 3CKXA 2XH5A 2KTYA 3DOGA 5DEYA 3HMMA 3FZOA 5HD4A 2R3JA 1NY3A 4R5SA 4AW5A 1J7LA 3W33A 2WHBA 4GVJA 4Y95A 4YURA 1CKJA 2GQGA 2ZDTA 4FV4A 4IEBA 4E4MA 4U9AA 4RIOA 2VNWA 4N6YA 3FHRA 4Z55A 2REIA 3NW7A 3VBWA 2Z7QA 3DBFA 2QO7A 2QVSE 3MH0A 4CG9A 3QCXA 2GS7A
chains in the Genus database with same CATH superfamily
2ZB1A 4XLVA 1W2CA 4LM5A 5AUYA 4FF8A 3SRVB 3QKLA 3PWYA 4W4VA 2WXVA 3OY3A 4QD6A 4FVRA 3ZFYA 4BI1A 4YGAA 2OZAA 4RZVA 1YXVA 4AOTA 4BCNA 1OBGA 3ZSIA 4CYIA 4O81A 5AR8A 4TYIA 1KE8A 3DBDA 4L9IA 4C0TA 1YI6A 3D0EA 3BV3A 1M7NA 3QLFA 4LUDA 2UW3A 1OUKA 3JUHA 4ANOA 4FGRA 4YZNA 2BRBA 4RX5A 4FV0A 4DBXA 4GG7A 5F9EA 4KS8A 4ZY4A 4DGOA 1VZOA 5AP5A 1T46A 2R9SA 3C9WA 3FLWA 5DHJA 2VWYA 3BBTB 1Q41A 4OTHA 2C68A 4B0GA 2GQRA 5D11A 2NP8A 4EONA 3OTUA 4RSSA 3FMKA 3AC4A 2CJMA 2OIBA 4AA4A 2BAKA 2CKQA 1JVPP 5J9LA 2E9OA 4GJ3A 4ERKA 3PJ8A 3QZHA 2ITVA 4QO9A 3K54A 3NUSA 2VWUA 5B7VA 5L4QA 4WUAA 4IANA 5CEQA 3ZSGA 4E4XA 2XUUA 3FLYA 4I6LA 3FLQA 4DHZA 1OIUA 4L52A 2YJSA 4O84A 5AV3A 4F9BA 5E8VA 3F82A 5FD2A 4EH7A 2W96B 3VF9A 4AU8A 3FMJA 5LMKC 1G5SA 3WE4A 2VO6A 3JPVA 3QRJA 3UOHA 4MAOA 3WF9A 4HCUA 3CGFA 3PPKA 1W7HA 2R3NA 2WIHA 4PWNA 2PE2A 3ZLWA 3V6SA 4XUFA 4Y8DA 2F57A 4DFNA 4NYEA 4WG4A 2NNWB 3D14A 3OMVA 4LL0A 4AZFA 5IU2A 3TG1A 4G6NA 3MPAA 4YPDA 3R02A 3UPZA 1JOWB 4WO5A 3PXYA 2FSMX 4NTTA 4M69A 5GNKA 5AP4A 4AT4A 4ALVA 1OI9A 1ZOGA 3MVJA 3G9LX 5TOZA 4DYMA 4AW1A 5M4UA 1G8JA 1PXNA 4FTCA 4RJ6A 5BV3A 2PUIA 4O0UA 3D4QA 4PDPA 4YBKA 5AWMA 4LOQA 4ZSLA 4BZNA 4HVSA 4BIEA 4GIHA 4AGCA 5AUVA 3RK9A 4WBBB 3VS7A 1UWHA 1Q8UA 4EKKA 1Z57A 3F3ZA 4HZSA 3NUNA 3TCPA 4O21A 4C36A 3TKIA 4X0MA 5K0XA 3FMMA 4I21A 5E91A 1TVOA 3WF8A 4S2ZA 4O0XA 4PX6A 2PZYA 3CGOA 4ZSJA 1VR2A 4AG8A 4FSYA 4JBOA 3Q6WA 4I22A 4R6VA 1S9IA 3RCDA 3RWPA 3PDTA 2UZNA 3GP0A 1H25A 3KRXA 4L8MA 4KSQA 3R63A 4QNAA 1WCCA 2AYPA 4G31A 4QYGA 4O0YA 4YHJA 3H9RA 4M0ZA 3Q4TA 4AW0A 3NFFB 3IOPA 2PMIA 3H9FA 4XG9A 2OH0E 4TW9A 4AN9A 2VO7A 3LMGA 1XKKA 1W82A 3IGGA 3OEZA 5EOLA 4AOIA 4DAWA 1ST4A 3MBLA 4WUNA 4L46A 3BKBA 4DCAA 3BE9A 2IVUA 1X8BA 4O91A 3OHTA 4CD0A 3COHA 3K3IA 2XEZA 3FZTA 3K3JA 4P90A 3SGCA 5AR2A 3ZO2A 4EH8A 2GTNA 4QDVA 4BTJA 4RX7A 3BQRA 5C9CA 4PTGA 4DLIA 2UW5A 4RJ4A 3P08A 4IWOA 3EL7A 2PMOX 5C8NA 3VULA 3GCPA 4X3FC 2WU6A 4Q2AA 4FSMA 4B99A 1VEBA 5E90A 1XMMA 4JIAA 3U9CA 3LOKA 5JFXA 2V7AA 3DDPA 3UQCA 1OL1A 2CLXA 3TUBA 3DNEA 5FTQA 2ZV8A 4C8BA 4O2PA 4ZMEA 4PUZA 3QD2B 3AT4A 4FGBA 4FKPA 5L6PA 1HCLA 1U59A 3C1XA 2HK5A 2PVJA 2HW7A 5KMNA 3QTWA 2XNPA 3BLQA 3CP9A 4IMYA 3VNTA 4EZ3A 5GIOE 5CVGA 2GCDA 2GNGA 1MRUA 1YDSE 1UKIA 2I6LA 2W7XA 1ZYCA 3UDBA 4C62A 5C1QB 2WAJA 1URWA 4FKRA 3FAAA 1H00A 5L8KA 4A06A 3KN5A 3COMA 2WTKB 3S4QA 2R5TA 3CKWA 4W4YA 5L6WL 4I1ZA 4IBMA 4DG0E 5M53A 4QMWA 5DG5A 4O7ZA 3DK3A 3A61A 3RAHA 3A2CA 2XANA 5E1SA 4YSMA 2WMTA 2XB7A 3POOA 1JPAA 4ZTNA 3CEKA 4JG7A 1S9JA 4D9TA 3RNYA 4QMSA 2C6EA 5ANDA 5IQDA 1XBBA 4JIKA 4FSTA 3EQIA 1DS5A 4G3GA 4O0WA 1F0QA 2YCSA 3RINA 1Q8WA 5K3YA 4I4EA 4H3PA 5E8SA 5AP2A 3BLRA 5AV4A 3CY3A 3GU5A 1IR3A 2PZIA 4FTNA 3ORLA 5HE0A 2O2UA 4L67A 1NVSA 4HNFA 5M55A 5DEWA 3WIKA 3ZHPC 2QHMA 4F63A 2YHVA 3P86A 5AM7A 3PXFA 4KAOA 4V05A 4U43A 2DWBA 2XKFA 2XVDA 4A4LA 5A54A 3BYMA 4FT3A 4D58A 4I92A 4QMLA 4F4PA 5BVNA 4AXDA 2HWPA 4L68A 4FZDB 2BVAA 3Q4UA 4NTSA 3ZDIA 4FTQA 4F9YA 3CD8A 1PXPA 3DS6A 2VWXA 2G01A 2WMQA 3R1QA 2W4KA 5JQ5A 4X3JA 4RJ5A 3ET7A 3G5DA 2BROA 4JX3A 5IA3A 4GYGA 2WQMA 4TT7A 4EJNA 4PTEA 1ZMUA 2Y4IC 2F7XE 2PVMA 4RWLA 5KHXA 4GKIA 5EKOA 4AQKA 5CEKA 1FVVA 3NYXA 2C3LA 4I4FA 5EM8A 1RDQE 3W16A 1OGYA 4O7NA 3LCKA 4H3BA 4Q5EA 3R9NA 4DTBA 3RWQA 1CM8A 5IH4A 1SNXA 2G2HA 3COKA 3DQWA 3ZMMA 4G16A 2H8HA 4FTTA 3F3TA 4M12A 5CI7A 3BU5A 4J71A 4KIPA 4NH1A 3LCSA 3QTIA 5AV2A 3TKHA 1P2AA 2OXYA 1BX6A 4FODA 5CALA 1PXLA 4YZDA 2XALA 4AAYA 5LJJA 3NW6A 2JDRA 1YW2A 3O2MA 1Q8ZA 2HELA 3QA8A 3V5WA 4TNDA 4XV1A 2UVZA 3BYUA 2UZOA 2G2IA 3W0NA 1E1VA 2XNGA 3ZZEA 3MH3A 3VBQA 4C4EA 2OJGA 4UMTA 4USFA 2UV2A 3KY2A 3PYYA 3DKGA 4BDAA 4TWOA 3U54A 4NK9A 1YXTA 3UOJA 5IKWA 4UV0A 2JDTA 4OR5A 2BDWA 3FV8A 4JBQA 2QKWB 2WZJA 3DDQA 4NM0A 1JKKA 3RJCA 3QQKA 3ORPA 4BTKA 5A6OA 2DUVA 3NUAA 5CZHA 5HTBA 4DHJA 4C4FA 2ITWA 4EK3A 2I1MA 5DYJA 2W5HA 3HKOA 5L8JA 2QOBA 4D9UA 1TFFA 3OG7A 2BIKB 3OF0A 3CE3A 2W05A 5ETAA 2YFXA 3TIZA 4DF3A 4O7YA 2X4FA 2VX0A 3S1HA 5BVKA 3HGKA 4F6UA 2W1HA 4WSQA 3BLAA 4KKHA 4IAIA 5HG8A 4KRCA 4JX7A 3W0OA 4FR4A 4P5ZA 4YU2A 4ALUA 4F1OA 4RFZA 4FKGA 5H8BA 2JKMA 4I5HA 3LE6A 3CY2A 3UYTA 3ZRKA 1J1CA 4CZTA 5CAQA 4FJVA 4DFBA 4EYJA 2ITPA 1Z5MA 2VNYA 2IW6A 4XOZA 5DRBA 3GENA 4CLJA 1J7IA 2HOGA 4YP8A 2BPMA 3KEXA 4WNPA 5HO6A 5KNJA 3FKOA 1XH4A 2C1AA 5EW9A 3A8WA 4QQCA 3VN9A 3QD4A 3F66A 4ZTMA 2HENA 3R1YA 4MBIA 3FLZA 3PA4A 3W0RA 1XJDA 3O50A 2E9UA 3QGWA 2YCFA 2H6DA 5CU4A 3RBWA 1B38A 4E26A 3P7AA 4L45A 3F7ZA 3SW7A 4DGGA 2YDJA 4EK8A 4BCOA 1Z9XA 3AG9A 1PYXA 1KE6A 4D0WA 3K5VA 4J1RA 2QO9A 2DS1A 3NUUA 3ATTA 1H1SA 3DY7A 2R3HA 4AA5A 4AZWA 5AX3A 3WILA 2CMWA 3D5UA 1JSVA 1OZ1A 4JDHA 3R7GA 4OT5A 3EFLA 2XYNA 5FXRA 2PUPA 3RGFA 4CZYB 2R3GA 4X2GA 4TYEA 4D1SA 2JBPA 1DAYA 4P5QA 5BMSA 3FSFA 4RJ7A 2G2FA 4BF2A 4D1XA 2NRUA 3I7BA 2X8DA 4PDOA 5GJGA 2GTMA 3AC2A 4O0SA 4RQVA 5CEIA 4KABA 4G5PA 3JXWA 4W8EA 3NW5A 3DXPA 5IEXA 1FMKA 3FZRA 3E8CA 4TTHB 5CX9A 4WNOA 1H07A 3CQEA 1UU9A 2WFYA 2PSQA 1Q4LA 5J8IA 1L8TA 4E3CA 3TT0A 3QUDA 3BHHA 3F2AA 4I5CA 1Q61A 4EYMA 4LDTA 3VS1A 2GNFA 2GHLA 3LM0A 2QC6A 4FT5A 2C1BA 4FICA 4A9TA 5CSVA 2W06A 4RVMA 4KUJA 4R78A 5ETIA 5KMKA 1L3RE 4FTJA 5IUIA 4RT7A 4YBJA 1KWPA 3DBEA 4QMZA 5AR7A 4EOJA 3JYAA 1U54B 2UVXA 2W4OA 3MA6A 4DFXE 3BHVA 3QWKA 4E8AA 2CNVA 3DAJA 4CFFA 1I44A 1Y6AA 4LV7A 3QYZA 1YOMA 4IE9A 3TTIA 4ZLYA 3FXXA 5IA1A 4JI9A 5M09A 4ASXA 4ZEGA 2UW7A 3R7UA 4DHFA 3ORNA 2A0CX 2W9FB 5AAGA 5A46A 1QMZA 2VO3A 3DK7A 5FXQA 2V0DA 3W8LA 2OFUA 4DTKA 2BRGA 5F1ZA 3W0MA 4BCKA 3E7OA 3GU7A 5GZAA 2B55A 4AE9A 4MXAA 4II5A 4Y72A 5TR6A 4PQNA 3LAUA 4OBOA 4U3ZA 4FTRA 4MNFA 3NIZA 3TXOA 4O4DA 3PA5A 4G1WA 4BGHA 2EXEA 4R1VA 5ANKA 4ZS0A 3COIA 4PP7A 2J51A 4F9CA 5FRIA 2OIDA 3FI2A 3KXMA 1A06A 3C4EA 3QC9A 5HCZA 4QP3A 2XKDA 4HJOA 3HX4A 3Q9ZA 4N4SA 3OOMA 3C4CA 5JQ8A 5JRSA 4UWBA 1Y8YA 3BGPA 2VO0A 3FZPA 4FVPA 3EQCA 4IAFA 3VC4A 4GG5A 3F5XA 1PXIA 5L3AA 2ZM4A 3DXQA 3H0YA 4F0FA 2R3IA 3LW0A 5IQFA 4YHFA 4DH3A 1G8AA 1W2FA 2XNNA 4I94A 5A6NA 1YOJA 3G51A 3OROA 3FLNC 3PXRA 3W8QA 4AZTA 1CKIA 2QOFA 2I0HA 3SOCA 3WOWA 2WB8A 3MSSA 3FZSA 4YC3A 5LVNA 1A48A 4C4HA 3EN5A 5DT0A 2PULA 4APPA 3LMHA 2CKEA 4GMYA 2OXXA 3BX5A 4LRMA 3E8EA 2H9VA 3TNPC 2I40A 4NSTA 3F5PA 4IFGA 4EH4A 4DFUA 4NCTC 3SHEA 3D5WA 5DE2A 1XH5A 3W18A 3JS2A 5HQ0A 5EW3A 3AMYA 5BX0A 1PXJA 3DAKA 3UVRA 1XWSA 2XIRA 4DH8A 2VTSA 4G3DA 4FVQA 3EKKA 1OPJA 1PMUA 2JAMA 2X0GA 3TV4A 4BJJB 3MVLA 4O27B 5I3OA 2Y7JA 5HBEA 1SZMA 3LXPA 4RIWB 4EC9A 4ENXA 4AACA 3QHWA 5DFPA 2Y0AA 1ZRZA 5AFVA 5EYKA 2ZM3A 4YJUA 5JFSA 4XBRA 4ZSGA 1ND4A 2X8EA 3EQBA 5DN3A 3W10A 4D4VA 3TL8A 5BPYA 1K2PA 3UNZA 1R1WA 3T9IA 2PZ5A 1LUFA 5CF5A 1OKYA 4C2VA 3DB8A 2IW9A 1Q5KA 5EHYA 4W9XA 4DC2A 1CTPE 1PMEA 3CSVA 3FY2A 4O83A 1H1PA 3QRTA 3OWPA 4X7QA 2VX3A 1ZLTA 3E5AA 4XNEA 4NJ3A 2Z8CA 4UZHA 4ACGA 5M07A 3RKBA 3PY1A 3FDNA 3FWQA 3BCEA 1LEWA 3MB7A 3KKVA 5FBNC 2P2HA 3IW6A 4D2SA 5A4EA 1F3MC 1Q3WA 3Q6UA 5IZFA 4BDKA 3ZM9A 2QU6A 2V22A 2EB3A 4MK0A 4FZ6A 5T68A 4BC6A 4C4IA 4F7SA 5C26A 3FY0A 5EQEA 3RM6A 2CN8A 2W4JA 1WBTA 4KINA 3UYSA 3U6JA 3ENMA 5LARA 3PPJA 5CZIA 3ROCA 4ACDA 3QQLA 3ORZA 3P5KA 4CKRA 5JFWA 4XOYA 3QCQA 4EJ7A 3L1SA 3ORXA 3MVHA 3PUPA 4FEQA 5IUHA 4IAAA 5EM6A 5BUIA 4JT3A 2W1GA 4E20A 3AMAA 4EHVA 2VZ6A 4G3FA 2WQOA 3FPMA 3GI3A 3HUCA 3SW4A 5HVKA 2IZTA 4CRLA 3ZCLA 5AJQA 5IQCA 2X7GA 4EUTA 4LV8A 5BVEA 1DI8A 1GZOA 3MY1A 4UALA 3NRMA 4IDTA 4QP1A 5IPJA 4NIFB 3P23A 4ANQA 5KBRA 4BDEA 5HIDA 4O1PA 4Y5HA 4I93A 4ASDA 4C02A 4HYHA 4QPAA 4B8MA 2GS6A 3EFWA 5A9UA 4RVKA 2C6DA 4FI1A 4G2FA 5ETCA 2DQ7X 4O4FA 2HZNA 4FOBA 4UWYA 5FBOA 3WF5A 4DH7A 5ITAA 1Q3DA 3CC6A 1OPKA 4GKHA 3OP5A 4FZ7A 4S30A 2C6LA 2CGWA 3EKNA 1IEPA 4JR7A 2QCSA 2YAAA 4BIBA 3A4PA 4TZRA 3NUPA 1H8FA 4OBQA 3UC4A 3O8TA 3ODYX 1KV1A 4BL1A 3ZRMA 3TNQB 3RTPA 4GH2A 4U97A 4TRLA 5J5SA 1A9UA 3FLSA 4ORKA 4U7ZA 4XRJA 3I6WA 4MYGA 4XJ0A 4AGDA 3AKKA 3PXQA 4BCQA 2PK9A 3ZFMA 5KZ0A 1G3NA 3OCBA 5HX6A 3P7BA 4O22A 5CENA 5J7HA 4CFXA 2VX1A 2C6IA 4JBPA 4WSYA 1RW8A 5M4CA 4IWDA 3NMUF 3LXKA 1GZ8A 3HV4A 3KK9A 3UIBA 2XNOA 2YCRA 2YJRA 3VRZA 4BTFA 4EUUA 2UZBA 4KBAA 4DEEA 4M0YA 4PMPA 5EKNA 5HORA 4IZ7A 2A98A 3LCOA 4AQCA 1BI7A 5CS6A 2PE0A 3VUHA 2WMSA 4L7FA 5H8GA 3IDPA 4F9WA 4M8TA 3RK7A 2C47A 1CKPA 4OTFA 4L43A 5JZNA 1M52A 1P5EA 2BHEA 2JIVA 3BQCA 3QKKA 4IC7A 3EQFA 5C8MA 3UIXA 4ASZA 4MVFA 3ML1A 1UU3A 4WRGA 3Q4ZA 4LGHA 4AAAA 4IVDA 4O7RA 4HVIA 2RFSA 5TO8A 5IDNA 2BUJA 3WZJA 5AV0A 4A4OA 3BEGA 3PA3A 3QWJA 3QZFA 1WMKA 5DH3A 3W2OA 4L3LA 4AZVA 3SC1A 4FV5A 2ONLA 2XM9A 3E63A 3LHJA 1SNUA 4DINA 4EOIA 4L53A 5L8LA 4JRVA 2IW8A 2C3JA 1FQ1B 2XRWA 5D7AA 2A19B 1SYKA 2YLEA 4TYJA 5G6VA 4YJSA 5DA3A 4HVGA 3LFDA 4CEGA 3I4BA 5L2WA 3A7IA 1G8KA 5A3XA 4XMOA 4UBAA 4EI4A 2YEXA 1J91A 4FIJA 1P4FA 4U5JA 1YHVA 3O23A 2XCHA 3PLSA 1VJYA 4TY1A 2C6OA 5EI6A 4EH6A 3FMHA 1WVYA 4PMTA 5E8XA 4U0IA 4GSBA 4CZUA 5C27A 3OXTA 2X0PA 3C0GA 5B0XA 2J5FA 2QOLA 3F3WA 3R9DA 4HVHA 4FSQA 4ZLOA 2HWOA 5J79A 3C7QA 2SRCA 4JG6A 5J1WA 3QL8A 2CN5A 2WMAA 3R7OA 4OTDA 4XV2A 1ZAOA 5E8WA 5BVDA 3MN3A 1ZYLA 4K2RA 4FOCA 4MBLA 4V04A 3QCYA 1H1RA 5I3RA 3E93A 2XK3A 2Z7SA 4U6RA 4H36A 3TIYA 3TZ8A 5IQHA 2OLCA 4L42A 5E7RA 4B7TA 2VUWA 3C4XA 3EH9A 4JDKA 2IVSA 2UW6A 5CSWA 5J87A 5IQBA 4GJ2A 4JL9A 1W8CA 4QMQA 4FEWA 3MFUA 4RQKA 3IQ7A 4I20A 3L8SA 4E6DA 4RLLA 2OK1A 3MPMA 4FTMA 5D9HA 1HCKA 4HYUA 1PXKA 2R3PA 2BHHA 3ELJA 3HVCA 3KRJA 4IJ9A 4QPSA 3W2SA 3DTWA 2BCJA 2CSNA 4FSZA 5CSXA 5HG5A 1UU8A 1XO2B 5T6KA 5DMZA 5CF6A 1JSTA 2YCQA 4Z3VA 1NT2A 4DH5A 3BU6A 5E8UA 5IMXA 2AC3A 4FKIA 1REKA 3B2WA 1W84A 3UMXA 5JMSA 1IG1A 1BLXA 3FYJX 3L8VA 3T3VA 1WBOA 4BDDA 4E5AX 2UZEA 2X7OA 4O82A 2XJ1A 2YZLA 4ZXTA 3F3UA 5HOAA 4D2PA 1GJOA 4ZTHA 3OT8A 1LR4A 4FT0A 3G0FA 3Q5IA 4XHKB 3EQRA 4NL0A 3LJ2A 4RX8A 4RLKA 2J0JA 5CNOA 4ZZNA 5KE0A 5ACKA 1WBPA 4FZFB 4Y83A 3JY0A 2DYLA 3FMEA 3UNKA 2YITA 1M2QA 2I0YA 2ZM1A 3FMNA 1Q62A 3NX8A 2GMXA 3OS3A 5GZ9A 3H30A 4YJTA 4EOLA 5JGBA 3L9PA 4MQ1A 4CNHA 3BV2A 4DGLC 3MFRA 2BAQA 1J1BA 1XBCA 3HRFA 3FJQE 2ETRA 4L00A 3U8WA 4BCMA 4C61A 4OTIA 1H26A 3PIZA 2Q83A 1Y6BA 4AXFA 2YM4A 4QYEA 4O86A 2WGJA 4DTAA 2EU9A 2AC5A 4EOKA 1YXXA 5AA8A 5CSPA 4F6WA 5AEPA 4X2NA 5J9ZA 5M4FA 4IB1A 4A9SA 4RWKA 3H4JA 4WNKA 5AR4A 5HI2A 5I9WA 3C51A 5KX8A 2UW8A 4XG2A 1H1WA 2C0TA 3AQVA 3SKCA 3PG3A 4TWCA 3TZMA 4B6LA 4R8QA 3R2YA 5DGZA 4JLCA 3RZBA 4CXAA 4IFCA 4CVAA 3CD3A 3ITZA 5AP7A 3KFAA 3VWAA 2ITQA 5ACBC 4IX6A 1U5RA 2UZLA 2ZMCA 2JKQA 1ZYDA 2VTOA 3GBZA 4PV0A 5C03A 5E8YA 3SLSA 5DR9A 3E7VA 4FNWA 2WTCA 4NZWB 3VUDA 3VF8A 2RG5A 1ZZ2A 3MESA 3QU0A 3KA0A 1R3CA 3R9RA 2UZVA 2PE1A 2Z60A 2E9NA 3R83A 3BEAA 4AT5A 2XM8A 3CXWA 3BPRA 2QR8A 4RIYB 1JWHA 4FBXA 2ACXA 4IB0A 3IDBA 4O6EA 5CY3A 3RAWA 5FG8A 3HLLA 3BWFA 4BWXA 4G3EA 3NEWA 4FTAA 3KCFA 1JKTA 4XBUA 3SQQA 3SRVA 3VQHA 4BN1A 5L6OA 5IA2A 3QRUA 4FV2A 5CQWA 3ZH8A 3V5TA 4UYAA 3OY1A 2X2LA 5C01A 4AUAA 4U79A 4AW2A 2VTLA 3F3VA 1V0OA 4IJPA 3F5UA 4FKOA 2OJJA 4WIHA 2XK8A 4WG5A 4YTIA 5H2UA 4F08A 1YWVA 2GDOA 2W1FA 5BYYA 3PSCA 4UMRA 3POZA 3UDTA 4YTFA 3ORKA 3FL5A 4XG4A 3AC1A 3FEGA 4PTCA 5CAVA 4UX9A 1E9HA 1PXOA 4WRSA 1K9AA 3GC0A 3QQHA 1W0XC 2Y6MA 4J52A 3NIEA 3GC8A 4AFJA 3A99A 4FNZA 3TNHA 2RFEA 2PVNA 4GFGA 4RRVA 5EG3A 2XF0A 4MXCA 2HZ0A 4J8MA 4IW0A 4FX3A 3R9OA 2OFVA 1URCA 3PP0A 2CHLA 2W1ZA 5BMMA 2QD9A 3HA8A 3VO3A 3V8SA 4XG7A 4IZAA 4IACA 3KGAA 1YI4A 1R0PA 2YZAA 3KMWA 4O6LA 3WIGA 4YJVA 2XRUA 4WG3A 4FSWA 2I0VA 2QOHA 4C3RA 1XMLA 3EN7A 4FIEA 4BYJA 5A4QA 4JNWA 2WMXA 4FTIA 5EM5A 1ZMWA 2UZUE 3ULZA 2E9VA 1UA2A 4EOSA 3LMIA 5F20A 1CSNA 2ZVAA 1W98A 1DAWA 1P14A 2XBJA 1UV5A 3B8RA 2F2UA 5HGIA 2VTJA 3IS5A 5AX9A 4QTBA 5HBJA 1OIQA 2W17A 4LG4A 3GNIB 3H0ZA 1XR1A 4EH5A 3BU3A 1M7QA 4EH2A 2JKKA 4CV9A 3KRLA 5JZJA 3P79A 2VTMA 3CTJA 4BBFA 2PVFA 4LL5A 1H01A 4R3PA 2GNLA 5CVFA 3LFFA 2VTIA 2JDOA 5IQGA 2PY3A 3GC9A 3ERKA 3Q9XA 4WA9A 1ZY5A 3DLZA 2FO0A 3F2NA 2XMYA 3GB2A 4RVLA 3BI6A 4FSNA 4ZTRA 1UWJA 4I23A 3KXXA 2J5EA 5HU9A 4BDBA 5HTIA 1GIHA 4IQ6A 2O64A 3ZBFA 4WHZA 3REPA 4C3FA 1JKLA 1KSWA 3R21A 1CMKE 1OL5A 4FKVA 4DFLA 4TPTA 3AXWA 3D9VA 4MXOA 3QQGA 3BHYA 5CXZA 3DBQA 2OJFE 3HMPA 3M2WA 1XQZA 3HP5A 4K33A 4RZWA 3PZHA 2PZPA 2ZV7A 3KIOC 3A8XA 3SAYA 3EFKA 2XYUA 1WZYA 1XH9A 3D7TB 3NDMA 3VVHA 2WOTA 4ACHA 1O6KA 3SXSA 3CCNA 4RWJA 4WNMA 5EQPA 3ZU7A 5B2MA 3A7HA 3KXGA 2IPXA 3UZTA 3N9XA 3CQWA 3PWDA 3ZONA 5HO8A 1F5QA 2X7FA 1OMWA 2YWPA 5I9YA 3SXFA 3F69A 4EOMA 5LQFA 4PNIA 3TM0A 4XCUA 3TEIA 5H9BA 3E3BX 4YSJA 3G15A 4C4JA 4C34A 4GK3A 4BCGA 1B6CB 2R2PA 2VTAA 5IA4A 2HCKA 1PW2A 2WMBA 3NNXA 3PJ2A 3IKAA 3ZUTA 1FMOE 4I41A 5DT3A 3DPKA 4E5BA 3D5VA 2A2AA 3FC2A 4ZMFA 1Y8GA 4KRDA 4YTCA 3NUYA 4RC3A 4W4XA 4FT7A 3IOKA 4NEUA 5LMBA 2QOKA 3VW6A 2YM8A 3DNDA 4ZJIA 4JQ7A 2HY0A 2XJ0A 2C6MA 2GNIA 4ITJA 4M15A 4TYHB 5EOBA 5HIEA 4R7BA 4FEVA 2HAKA 3ZEWA 4FV1A 4C2WA 2YDIA 3PP1A 4YZMA 5FXSA 2FB8A 2J7TA 3MA3A 4JVGA 3CR0A 5CAUA 3MJ2A 3O0GA 3W2PA 1OL6A 4DN5A 3UO5A 2OH4A 2Y6OA 2XKEA 3BIZA 1YXSA 3DFCB 3QZIA 2RGPA 3GC7A 4ZS4A 4YC6A 4MUQA 3O5AA 3PG1A 3KULB 3UODA 1IAHA 1M2RA 5L2QA 4LV5A 4XG6A 4GL9A 3G90X 3QTUA 2B9FA 4GT4A 5ANEA 1UNHA 3C5UA 2X4ZA 1Q97A 1YQJA 4JDIA 4AFEA 5LVLA 2J0IA 3DXNA 2B1PA 2Q0BA 4FIGA 3NNWA 5EYDA 3TNIA 1FOTA 4LRKA 4EH3A 3KRRA 4O4EA 4RJ8A 3NYOA 5BVFA 4U44A 3MH1A 2B4SB 3CJGA 5EQYA 4XYFA 4XV3A 3UE4A 4ANMA 4UWCA 3TV6A 4NWMA 4C33A 5J5TA 3P7CA 3Q60A 3EQGA 3QD0A 2PVKA 5HG7A 3N4TA 5IA0A 4BKJA 2C6KA 4G6LA 4QP7A 5DBXA 4AWIA 4OW8A 2GFSA 1ZWSA 4YC8A 4EOQA 3TKUA 1MUOA 3BE2A 2G15A 3FZ1A 3BL7A 2JDVA 2ZYBA 4QP6A 3PVGA 1UVRA 4BZDA 1PF8A 2XAOA 3VUKA 2ZOQA 2QR7A 4LI5A 4NW6A 5CVHA 5AR5A 4FL2A 3VAPA 2GNJA 5B2LA 4E73A 2F4JA 3KK8A 3QTXA 3OBJA 4WD5A 4BCFA 4WBOA 2IZRA 3LQ5A 1WBSA 1ZY4A 5LCJA 1FINA 3GQIA 1Q8YA 2WEIA 2WEVA 2XK4A 5JKGA 3UZPA 3DV3A 3PVWA 5FEEA 4OTGA 4KA3A 5TE0A 4MQ2A 3KC3A 4ANBA 1P4OA 5JN2A 2W1DA 3N4VA 1ATPE 2WELA 2VGPA 3QALE 4AGWA 1NVQA 4MCVA 4R5YA 2C3KA 4EHZA 4F0IA 2B53A 5AUTA 2OWBA 2XBAA 3KB7A 2VGOA 5I0BA 1APME 4FKLA 4ZTLA