3WIGA

Human mek1 kinase in complex with ch5126766 and mgamp-pnp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
278
Chain Sequence
MELKDDDFEKISELGAGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Disruption of CRAF-Mediated MEK Activation Is Required for Effective MEK Inhibition in KRAS Mutant Tumors
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 278
sequence length 288
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wigA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wigA01
3R1NA 4K8AA 5K4JA 5BYZA 1OIQA 4BL1A 4F1OA 5H8EA 2Y0AA 2C68A 3AD6A 3D83A 4O7LA 3DKCA 3KCKA 2IO6A 4UX9A 2OW3A 2OU7A 2W9ZB 2WMQA 3Q32A 3G6GA 3FI3A 4DGMA 4EC9A 5AAGA 4F1MA 2UZEA 2GQRA 3SHEA 4RWJA 5ANEA 4C38A 3LXNA 3CQUA 4USDA 2OWBA 5IQFA 3R04A 5CQWA 3C9WA 2C6EA 3Q4TA 4LFIA 4S31A 5AAEA 2ACXA 3I81A 3PUPA 4IB0A 4WOVA 4ZTLA 4IVAA 4HVGA 4CFFA 4DEIA 4W4WA 4AP7A 3LCSA 2F2CB 3RVGA 3KA0A 3EQIA 4GSBA 4YMJA 2VTNA 5J7HA 2J0KA 3EN7A 4D4RA 4DC2A 4EZ3A 1GY3A 1VZOA 2WOTA 5FTOA 3E5AA 3ENMA 3V8SA 5L4QA 3MPTA 4XBRA 2WPAA 3SV0A 5E92A 2YIRA 4FSWA 3FLNC 3KL8A 1FMKA 4Y95A 5HCYA 1J1CA 2W4KA 2B52A 4J7BA 5GJFA 3VUHA 3DXPA 4IDVA 4NIFA 4WNMA 2BAQA 4QOXA 3PXYA 4GIIA 3HX4A 3GT8A 3I5NA 3EIDA 4KNBA 4PL4A 3R9RA 1Q8TA 4RIWA 5IUGA 4DGGA 2FSOX 5E8WA 4BF2A 5KMIA 1GZOA 4L00A 5KX8A 1UV5A 2QCSA 3E7OA 3GU4A 4G31A 3L8SA 4WA9A 4IM2A 4JI9A 2XKDA 3F7WA 3POOA 3RWQA 4BTJA 5L2WA 3P7BA 2VX1A 1H24A 2YITA 2WKMA 4DINA 4UMUA 3DCVA 1ZMUA 3DAJA 5AUXA 5I3RA 5KCVA 5HNIX 2A27A 5DT0A 3VS1A 2Y4IC 4J99A 4YJQA 4FKVA 2PMOX 3QC4A 4A9UA 4RWKA 3HA8A 4CFMA 3AD5A 4GL9A 4EORA 1H07A 5LWNA 4LUEA 2UV2A 3P4KA 2PZIA 3FMLA 5AP3A 5HX8A 3SW7A 3QRKA 3B8QA 4ITHA 3GBZA 4KIOA 2C3IB 2JFMA 3THBA 4NH1A 5F20A 1EH4A 4BRXA 3LQ5A 2C6KA 3QCSA 4F6WA 3GGFA 4WG4A 4MXOA 3JYAA 4BCMA 4FV7A 3ZBXA 2CNUA 3DLSA 4MKCA 3BBTB 1DAYA 5E8ZA 1YDTE 3TWJA 4IX3A 4LGGA 3R22A 1UWHA 2J4ZA 3NAXA 4FKGA 4M84A 3ZBFA 2QU5A 1QCFA 3R00A 1F5QA 4C4EA 3Q5ZA 4F4PA 4A4OA 1BL7A 2VN9A 4J71A 3IECA 4DFXE 5T6KA 3R7YA 3E7VA 4H58A 5HEZA 3QQUA 4PPAA 3EQHA 3G6HA 4ACDA 4J53A 5EW3A 2FH9A 3ANQA 2CSNA 1K9AA 3PRIA 3QTSA 3PWDA 4R1VA 1PMVA 4S33A 5AUYA 4C37A 2QOCA 3BYSA 3C4ZA 4IHPA 4L45A 4L68A 3VHKA 4BB4A 5I4NA 2ETKA 4EQMA 4XHKB 4TKSA 3MBLA 1XH6A 2IW9A 1OBGA 4QYEA 4H3PA 3ZDUA 4ORKA 2PVFA 2QG7A 1UKIA 1APME 2VTIA 4AAAA 1ERKA 1Q97A 1YDRE 1YWNA 2XKEA 3COIA 5I9XA 2VWVA 3BCEA 4IVCA 3UMWA 4DGLC 4I94A 2QKRA 3BGPA 4GT5A 4JVGA 4TRLA 4E4LA 4PMTA 3ZFXA 4BDJA 3UVRA 4FX3A 2VWXA 5LMBA 1JOWB 2X2LA 4X3FA 3EN5A 3OVVA 4G17A 5CEKA 5GJDA 3FLWA 3G0EA 3KXGA 1J91A 1A48A 2W06A 4GIHA 4HNIA 3P78A 2Z7RA 3KRJA 4PDOA 3PVBA 4FKLA 2XEYA 3P7CA 5AR8A 5HBEA 4FL1A 1VYZA 4DCAA 1LPUA 3V6SA 2C6TA 4AS0A 4RFYA 2WZJA 3E8CA 3Q2JA 4CFUA 4TXCA 3LPBA 2QOOA 3VS3A 4EI4A 4QP9A 2WMTA 3MYGA 3UBDA 2F7XE 4JDJA 4EJ7A 2O5KA 2XBAA 1YHVA 3A4OX 4FIJA 3F82A 3C4WA 3R1QA 4YTHA 3SGCA 1TQMA 4F6SA 5FLFA 2WFYA 2PVMA 2PVKA 3FSFA 3GU8A 2H34A 4IB5A 2WMXA 4GKIA 2GMXA 3LM5A 3ZOSA 4TN6A 2REIA 3W2QA 2ZB1A 4OTDA 5KKRB 2RGPA 3B8RA 3ODZX 4NM5A 3PXKA 3BPRA 4RRVA 4BZNA 2YZAA 4BDIA 4PTEA 4XV1A 4ZLZA 2ZMCA 2W1CA 3ZSGA 2ZB0A 3TTJA 4RX5A 3G33A 3LHJA 5ETCA 4EQUA 3FC1X 2YWVA 3KXXA 3N4UA 2W5BA 3O50A 3HMPA 4CEGA 4D2RA 4QTCA 4CLJA 3EZRA 5AV3A 3RAKA 3O7LB 2EB3A 3QTUA 4EOLA 3BLRA 3E87A 4IWPA 2XF0A 5J9ZA 4QPAA 2IVUA 3ZSHA 2UVXA 3I6WA 1JKTA 3EKKA 3HV3A 2QKWB 5ICPA 3UOJA 2J2IB 3W2OA 1M2QA 2B9FA 4B6LA 3ACKA 1KE6A 5HTCA 3C4CA 4YZCA 4FV6A 2WXVA 4BZOA 3LQ8A 5DRDA 3GC9A 5CVFA 3VS5A 4MD9E 3RM7A 5HG7A 2CN5A 3POZA 4RSSA 3OCGA 3QTWA 4K9YA 1IA9A 3TN8A 5FWKK 4RVKA 2Q0NA 5HESA 4AG8A 4FOBA 2W4JA 4FYOA 4R5YA 4XG4A 2YDIA 2G2IA 3SLSA 3DXQA 4DFUA 3PSCA 5CI6A 1H0WA 2AUHA 2QOFA 2XIKA 3D7TA 3QUEA 4FSNA 4OTFA 4YNEA 1GZNA 5EW9A 3R0TA 4QMYA 2EVAA 3FI8A 3HDMA 3MJ2A 4FIHA 4H1JA 3RPSA 1S9JA 2UZVA 4OAUC 3BV2A 4LV5A 3MY0A 2GNGA 4WUNA 2BFXA 4FVQA 3IGGA 3QCYA 4NSTA 5ANDA 4IE9A 3GVUA 4FTJA 3IDPA 2I7QA 5IA1A 4CTBA 3NUNA 2BIYA 3L9LA 3LXPA 3VW8A 4TYEA 4IAIA 1LP4A 4PNKA 4ALVA 1PXKA 3ZCLA 4LGHA 3UYTA 4UMQA 4C3PA 5B0XA 5GIPE 5J79A 4FUYA 3BE9A 2PHKA 4QYGA 3G9NA 1NVSA 3FLQA 4XS2A 1XH9A 3R8LA 4FIFA 5DRBA 4DG2E 1IASA 3NZ0A 5CU4A 4IDTA 2BDWA 3LXKA 3D94A 4ASZA 2X39A 5KBQA 2W0JA 1YXSA 4DTBA 3PJ3A 5M4CA 2V55A 4K6ZA 3DQWA 5IA0A 3V5TA 5FTGA 3W8QA 3U8WA 1PHKA 4YGAA 1OL6A 2NP8A 3I0OA 2XUUA 3O51A 4YPDA 3H10A 3TKHA 4FC0A 4NTSA 3GEQA 5K9IA 3QQHA 4Z55A 3FWQA 4Y83A 4EBWA 2OH0E 2HCKA 4EK3A 1YOMA 4KINA 2PE1A 4ZIMA 2X8IA 1OVEA 4QYFA 3QKKA 4LRKA 1MUOA 2ERZE 4E4XA 1Z5MA 5J5SA 4L52A 4L3PA 4CV9A 4F64A 4HNFA 2J50A 5A9UA 3V8TA 1QPDA 1VEBA 2R3QA 3GQIA 4FTKA 5IKWA 5JT2A 5LMKC 4UYAA 2VUWA 4AOIA 4FEVA 4JBVA 4CFXA 2X7GA 3U9NA 2FA2A 2VWBA 5C01A 3O8TA 5DR6A 1LUFA 3EQPA 2W9FB 3IG7A 3JY9A 3ZFYA 5GHVA 3FYJX 3QLFA 5M06A 1ZMWA 1RJBA 4FGBA 1KOAA 5CVHA 3ORZA 4FKPA 1YKRA 4HPTE 4IZ7A 4RQVA 1G8SA 5L6PA 3EKNA 3C50A 3BV3A 3ZFMA 4ANLA 3WYYA 3QGWA 3EFLA 3BGZA 2XKFA 5FQDC 2WTIA 2VNYA 4UV0A 2W4OA 2YIYA 3MH1A 4BICA 3CD3A 3DK7A 3NYXA 1W8CA 5I9YA 4ZXTA 4FSQA 4GKHA 3DTWA 3IW8A 4ZEGA 4QMQA 2ONLA 2PULA 4XBUA 2C0IA 3VUKA 1KSWA 3CXWA 3Q2MA 3QHWA 4QMXA 4X7QA 4EK6A 1KUTA 3UODA 3TL8A 3OF0A 1JVPP 1FOTA 3ZLSA 4BCHA 2UW3A 4JAIA 5AUVA 5L2IA 5EYDA 1I09A 3T9TA 2IVSA 2YM5A 3ZO1A 5IMEA 3QUPA 4FTQA 1PXOA 3O17A 4O6LA 4TNDA 4FUXA 3F3ZA 1WZYA 1GIJA 3WZUA 3TKIA 1GJOA 3R63A 3AMYA 2OICA 3MN3A 3DPKA 5CSHA 4R7HA 4F7SA 2PU8A 4ENYA 2A4LA 1YDSE 5IEXA 3NMUF 3FQHA 4MXYA 3GCQA 3UIMA 1F0QA 4DFYA 3ZONA 4LQMA 4XOYA 2VX3A 3ZEWA 5I0BA 3JPVA 3BZ3A 1X8BA 1Q99A 4PY1A 3HL7A 3BX5A 4L01A 2GNFA 4E6AA 5CEOA 3QXOA 4Q5HA 4H3QA 5D7VA 2A1AB 1URCA 4YO6A 4DH3A 3DXNA 1Q3WA 1JKSA 2RFSA 4XOZA 3BELA 3KEXA 4RJ3A 4EHEA 4FBXA 4ZSEA 3CSVA 4PPBA 1TKIA 4MNEB 2GHMA 3FKOA 3ZO2A 3OMVA 4ZSLA 4CKRA 3OXZA 4O7WA 3O0GA 3VF9A 4G5PA 2RFDA 3MH3A 3VUIA 3R28A 2X2MA 2XRUA 3DDQA 3AMBA 1V0PA 4D58A 3P23A 4U43A 3OEFX 3W16A 3P0MA 4S2ZA 3Q6WA 1OL2A 4QTBA 4ZJIA 3VBTA 4L42A 5C1QB 4TT7A 5HLWA 4FV0A 2BPMA 1FGIA 3F5GA 4I6BA 4JDHA 2R3NA 2J9MA 4G3FA 2CLXA 4IEBA 4AT3A 3JVSA 4CRLA 3RPRA 3TNQB 3BWFA 4D0WA 4KSPA 2WTDA 5HE3A 2HXQA 5AUTA 3FV8A 4WSQA 3A2CA 1URWA 3V04A 2XRWA 1ZY5A 3Q3BA 4OT6A 4FZ7A 3R9HA 2WEVA 4TYHB 4KIKB 3FKLA 2PYWA 2C5NA 3EJ1A 3FMKA 5IA5A 5AAFA 4G6NA 3ZS5A 4UXLA 5IEYA 3DV3A 3IW7A 3OTVA 3RPYA 1R78A 5JFVA 4RGJA 1CTPE 2JKMA 4AX8A 5IQCA 3GCVA 4WNPA 4ZMFA 2HWOA 4AW1A 4X3FC 4DG3E 3VIDA 3TG1A 4KS8A 4N6ZA 2YM6A 3DJ5A 2CJMA 2EB2A 2HZ0A 5FEDA 2PUIA 4NZWB 2BTSA 3WIKA 3HMNA 4U40A 2QQ7A 4FG7A 4JX3A 1TQPA 3I7BA 4I6HA 5H8GA 4I6QA 4D1ZA 2YCSA 2G2FA 2YLFA 3EYGA 2VV9A 2Y6MA 3G90X 2VNWA 3PJ8A 4ZS0A 3TDWA 1AQ1A 5J7BA 2JLDA 2OIQA 2QURA 3VS6A 1Q3DA 3HYHA 4DT9A 3OWKA 1MP8A 2R9SA 3R9OA 1XBBA 4BCJA 4QMSA 1KV2A 2WMVA 3HP2A 5B2KA 3TIZA 3V5WA 2IVTA 3CTQA 1BL6A 3LVPA 2XIXA 4BDGA 2ERKA 2VTJA 4FK3A 5FDPA 2XJ2A 4D0XA 2IZUA 4IB3A 4MBIA 5KUPA 3U9CA 2YAKA 5DT3A 3HECA 3F2RA 1JWHA 2XNBA 3JVRA 2VTOA 4G3CA 5JMSA 3COMA 2QHMA 4GCJA 1RQQA 1AGWA 4YLJA 4CKIA 2UZUE 2W99B 5CEMA 4M13A 3WZKA 4K1BA 1IRKA 3TZ8A 3L1SA 4FEQA 4FVRA 2O2UA 1ZYJA 3PTGA 2ZDUA 3GC7A 1M52A 2GQSA 4GJ3A 4ANSA 2XVDA 4EZ5A 4ALWA 5A54A 3OCTA 1DI8A 3DS6A 1YI4A 3AC2A 3QQKA 4ZY5A 1Y8GA 3KN5A 2AYPA 3N9XA 4A4LA 4CG8A 3NUUA 5AV4A 3K5UA 2XNPA 4ZTNA 3KULA 1Q24A 3LE6A 4DH1A 3PY3A 3EYHA 3K3JA 2XA4A 3P1AA 2ITYA 2J0IA 2FSTX 2X7OA 3DFAA 5AV0A 4QQTA 1U54B 2Y9QA 5EOBA 3TV4A 5M57A 2B9JA 5EYMA 5EKNA 3ZDIA 4IZ5A 5HE1A 3DBFA 4CCUA 2HELA 4YC3A 5E1EA 3BYOA 1R3CA 4EOQA 4BFMA 3T8OA 5KE0A 4BY9E 1Q61A 1PKGA 4NFMA 3SRVA 2JAVA 1H8FA 5CVGA 5JRSA 2ZM3A 3R1SA 4AT5A 4W9XA 5ANKA 3I0QA 1H1RA 1YOLA 1PYEA 4CQGA 4EOSA 4JIAA 3DGKA 4RIXA 4APPA 2JDTA 3QUDA 4TW9A 2HZIA 4FSTA 4ACGA 4ANNA 4RG0A 2B4SB 3DZQA 3ZUUA 3FZRA 2JKOA 3OXTA 3QZHA 4L43A 4I0SA 4AACA 4ZJVA 3KQ7A 3OD6X 5E4HA 1BX6A 1KE8A 2FO0A 2BHHA 3AC3A 3DKFA 4DF3A 5CLPA 3CTJA 3QX4A 3S0OA 4OTWA 5CTPA 4QP1A 2XIZA 3OWLA 1K3AA 4CT2A 5JSMA 4QMOA 4P2KA 3QXPA 4M3QA 5FD2A 3IOPA 4K77A 4BCOA 4O7RA 5EM8A 4II5A 4QTEA 2BRMA 4G3DA 3HRCA 1RE8A 3F3TA 4YZ9A 5I3OA 3CPCA 4E6CA 1M17A 2GNLA 4X6QC 4MXAA 5L3AA 3WZJA 4I92A 2E9PA 5A6NA 2VWUA 1Q5KA 3MPMA 4WO5A 4CD0A 3SXFA 3UO4A 2HZNA 3PSBA 5C8NA 4C57A 1YWRA 3FMNA 5G6VA 3MGYA 5ANOA 4EUTA 3LJ1A 4RBLA 4YURA 4U3YA 3CS9A 4NIFB 4L7FA 4RFZA 3OWJA 5L8JA 2I0VA 2J0MB 5ANJA 1OIRA 1WVYA 4BTKA 2UZLA 2XH5A 2O0UA 4RIWB 1YOJA 2VGOA 5LVPA 4FZDB 4FZAB 2PPQA 5F1ZA 4O84A 4UBAA 2XM8A 4HYSA 2PY3A 3FKNA 5CYIA 3FPMA 1H00A 2G01A 4F09A 3DZOA 3QL8A 4D2WA 1XBCA 4QMWA 5CT7A 2OXYA 3VNTA 4ANBA 2I0HA 3A7GA 4GFGA 4WSYA 4YHJA 2RSVA 4W8EA 3Q4UA 1TQIA 5H8BA 3QKLA 2J5EA 2R3KA 4D5HA 4XRJA 5DHJA 4AE6A 5D11A 3NUXA 4C3RA 4M69A 4PL5A 4EH3A 3PIZA 4O0XA 4S34A 2ZOQA 2IJMA 4AZWA 3FDNA 2BDFA 3QKMA 2F49A 5CU6A 3CQWA 3SW4A 3C5IA 2NRUA 4IW0A 1SVGA 3C4FA 1FVRA 4AT4A 4N0SA 4JG8A 4MYGA 2JKKA 4DBXA 3A7IA 2VD5A 2Z7SA 2OKRA 2YHVA 4QTAA 3RTPA 1MQ4A 3UG1A 3UPZA 3A4PA 1OZ1A 5EQYA 4BDDA 4XV3A 1OKVA 4UMRA 3P86A 5HTIA 4YBKA 2UW9A 4KKEA 4DGOA 5HLPA 4ZZMA 5LVNA 3R21A 4TNBA 4W4VA 2XK3A 4GG7A 4R3RA 3F5XA 4F1TA 5IA3A 1WAKA 1UU7A 2JBPA 5EK7A 4FT7A 4QT1A 2HW6A 1GNGA 2X7FA 4O0TA 3I6UA 4DFZE 1ZWSA 3EZVA 3R6XA 5GINE 3VQHA 2PZPA 4M0ZA 3IDCA 5EHOA 3CE3A 4TL0A 3CGFA 1CMKE 4DFNA 5HVKA 4FIGA 1WCCA 3UG2A 4B0GA 2WTWA 3NLBA 2BKKA 3WBLA 5LMKA 3OHTA 3PJCA 5M55A 5BUEA 3HRBA 1H0VA 3G51A 2ONLC 4JXFA 4XUFA 3R7EA 3FI4A 4KKHA 5HKMA 2PUNA 3LIJA 2YLEA 5AADA 4CGAA 4JS8A 3D15A 4JOAA 4FTIA 3T3VA 4ASEA 5C26A 2DS1A 3MESA 4FKUA 4QMPA 1GZ8A 2R64A 1H1PA 2JIVA 2UW4A 2UW6A 5F9EA 2YM7A 3KVWA 5M07A 4RIYA 3E64A 2J5FA 4N70A 3VBXA 3ELJA 4FV8A 2X9EA 3BHTA 2PL0A 4IJPA 3T9IA 3AC8A 4FL2A 3EQCA 4HYUA 2BZJA 2R3LA 4FSZA 2J0LA 4O0UA 4E26A 5KMJA 4LOOA 1VJYA 3RI1A 4KD1A 5AIRA 4CFWA 4RX8A 3RK7A 2ZAZA 3TIYA 4C0TA 4G6OA 4QQ5A 5D12A 4RZVA 3R7OA 5A4TA 5AP6A 3WF9A 2I6LA 4YTFA 3IO7A 3WILA 4ENXA 3C51A 4E3CA 5E8TA 2G1TA 2UZOA 4RJ7A 2VWIA 4NWMA 4OUCA 4MQ1A 2W05A 2E9OA 1BKXA 3WF5A 2F9GA 3DT1A 3NNXA 5TOZA 1WBOA 3QTZA 2YISA 3VN9A 2ZYBA 3SA0A 4NYEA 4E4NA 5H3QA 4IFCA 4XP2A 5BX0A 4AOJA 3LFDA 5E9EA 5DA3A 2Z60A 3FQSA 2VTTA 4FOCA 4EH5A 5IA2A 5JK3A 3NUAA 4FKOA 4U9AA 3ET7A 4UY9A 4DLJA 1NVRA 4LYNA 2WTJA 4YJSA 4NT4A 3V3VA 3E93A 4MHAA 5EDQA 4AZFA 3AC1A 4MD8E 3LJ0A 5C4KA 1JNKA 3SQQA 4C02A 2J90A 5B7VA 5K5NA 4XEYA 1H25A 3O7LD 3L8VA 4ZTSA 4FIEA 2OZAB 4JT3A 4BIDA 4DE4A 3QFVA 3I1AA 3BI6A 5HD7A 1LR4A 4Q5EA 5CU3A 5TE0A 3QRJA 3RGFA 3MFUA 2PZ5A 3E92A 2C6OA 4C4GA 4AW0A 3U51A 3SC1A 3O8UA 2WNTA 4FZFB 4X0MA 4DH8A 4EYMA 1SNXA 4RMZA 1O6KA 4Y5HA 3RHXA 2XYNA 5CQUA 4BKYA 3IW4A 4EK8A 4HVIA 4GUBA 4PP7A 2VRXA 4Y85A 1G5SA 4EQCA 5KBRA 1DM2A 3WZEA 3PY1A 2UW7A 2CGWA 3GB2A 3QWJA 3KB7A 4CLIA 3GUBA 2HY81 3SX9A 4ZY4A 3Q53A 2C3LA 4J8NA 1Q8ZA 4V0GB 2OF4A 4Y8DA 3UOLA 4YO4A 3RAWA 4K18A 4QYHA 3H9RA 2I0YA 2W1EA 3UVPA 4R3PA 2OZOA 1ZLTA 4E73A 5HICA 3H0ZA 5CF5A 3PWYA 2RG6A 3AC4A 3IOKA 1E9HA 4AOTA 4BI0A 3PLAE 2PVYA 4RZWA 5HO6A 2WMAA 4YZBA 3IGOA 4MF1A 3DDPA 3SVVA 2W5HA 2ITTA 3MB7A 3LLTA 3O8PA 2CGUA 3ETAA 3PP0A 4UALA 4TYIA 5JKGA 4O27B 4ASDA 4HPUE 4YLLA 2C6DA 3RJCA 3KF7A 4K2RA 1NXKA 3CPBA 3FL4A 3NVMB 3OFMA 3F5UA 4EONA 5E1SA 2QOQA 5CT0A 4ZJJA 3BEAA 2C4GA 3L9MA 2WO6A 3FSKA 2Z2WA 3TUBA 4XV9A 3PVWA 5TR6A 5HBJA 4ZOGA 2C6MA 4UWYA 3RCJA 4BDCA 3W2PA 3M1SA 4R5SA 2WMRA 3RK5A 4NM0A 5ANIA 2OI4X 1OPLA 5JGBA 4ZTRA 4GW8A 2B54A 4J8MA 3OW4A 3RBWA 4EH2A 4R78A 4JDIA 3BHVA 2GS6A 4W4YA 4DEEA 1OKWA 3FLSA 5M44A 2HK5A 1ZYCA 3VULA 1NVQA 3G0FA 1H28A 5CXZA 1Z57A 4EC8A 3LMGA 5J9LA 4DHFA 2H9VA 5K4IA 4TWNA 5GZ8A 4O7SA 2F7ZE 4QMMA 2E9VA 2C5YA 5ANGA 5KMKA 3O23A 3N4TA 4ASXA 4I3ZA 5A4LA 4EUUA 5DR9A 3KFAA 4CFVA 2GFCA 5L2SA 4CZTA 1VYWA 2JD5A 5EHLA 3RM6A 3MVMA 2Z02A 3QYWA 1L3RE 1W98A 2ZM1A 5A4QA 3NS9A 3QYZA 4U41A 2EXEA 2YACA 3WIGA 3L8PA 3RHKA 3A7HA 4YJVA 1KWPA 4OTQA 4FKQA 4TWPA 3V01A 3DNEA 5KO1A 3F3WA 3GQLA 3AGMA 3AC5A 3NSZA 4IB1A 4EHZA 3PXFA 1BLXA 2XK9A 2IVVA 4KSQA 5DVRA 4FIIA 3LFCA 3S2PA 3K5VA 3IK3A 4E5AX 4FSRA 4ITJA 3PE1A 4G3EA 5C4LA 5I5ZA 4FTNA 5A4CA 4OGRA 2BALA 4D2TA 3UIXA 2F2UA 3RNYA 1PXJA 5BQ0A 3R73A 1PXIA 5DYJA 1UNLA 3R1YA 4R8QA 1YW2A 4YJNA 3UOKA 4TWCA 1P4FA 1B6CB 2KULA 3OUNB 4HCTA 2R3HA 5BUJA 2W96B 1IR3A 3CQEA 2VTRA 2W1FA 3QA8A 3ZO3A 1UA2A 4MEDA 4XRLA 3DOGA 3HZTA 3KRXA 4G16A 4L53A 3QX2A 5JRQA 3TM0A 3GI3A 3V5LA 2O65A 3II5A 3RZBA 3DKOA 2X8EA 2V7OA 4JG7A 2V62A 4HCUA 4U8ZA 3VQUA 2V5QA 2O3PA 4K0YA 4MXZA 1OL5A 2VTQA 2PMLX 4UWBA 4WG5A 3NNVA 4R3CA 4PMMA 3TEIA 3Q5IA 5IDNA 1A9UA 3HMIA 3TTIA 4F7NA 2OJGA 4DFLA 4YC6A 3LXLA 4UZHA 1REJA 2GNIA 2GQGA 2UVYA 4BDEA 3DK3A 2X81A 4QNAA 5HIBA 5IQHA 4QYYA 1LEZA 3UP7A 4PV0A 3QD4A 4CZYB 1WBSA 4I5MA 3EQGA 3KVXA 5E91A 1MRVA 2WOUA 3OBJA 2YCRA 4FKWA 4JDKA 3N4VA 3FEGA 3NCGA 3SAYA 1J7LA 4E20A 4WBBB 4G5JA 2WTKC 1V0BA 2WGJA 5CEIA 5HQ0A 2VTAA 2CKEA 1H26A 2PUUA 1Z9XA 2GS7A 5DOSA 3U6JA 3ORIA 1JQHA 2XK4A 4I5HA 4RIOA 2WQOA 3LFFA 4USFA 2WU6A 4G34A 2XZSA 4IX5A 4QTDA 3FYKX 3E8DA 4E5WA 4O0RA 4FTRA 4FKTA 4QO9A 3DB8A 1T46A 3BIZA 3GU6A 3Q4ZA 4U0IA 1PXNA 4KABA 1H1SA 3E3PA 3KCFA 5EI6A 3PXQA 5EM6A 2OJ9A 4J96A 1G8AA 2BAKA 1PYXA 4FYNA 3SOAA 1ZZ2A 1W84A 3D0EA 3L9PA 4GVJA 1FINA 2Y4IB 4FSYA 4QP6A 1H08A 4FKSA 3S4QA 2QG5A 5J9YA 2JIIA 3HAMA 1PXPA 1ZOGA 4F65A 3KU2A 4IAKA 4GJ2A 3KREA 1OITA 3PRFA 4QQCA 4R6VA 1M2PA 3DLZA 2JC6A 4MAOA 4DEAA 5D1JA 4QP4A 3FMMA 3W18A 3BGQA 4P90A 4X6RA 3JXWA 4XG3A 3DAKA 4ZP5A 4YTIA 4MD7E 4O7YA 4JR3A 4XV2A 5AP2A 1UU8A 5JGDA 3LM0A 3W2CA 1E1XA 2ETRA 3BE2A 3RALA 3ZZWA 2WTVA 3OROA 4JQ8A 4FTCA 1XBAA 3DQXA 3TJDA 3RK9A 4AFEA 3WARA 2Q0BA 2YJRA 4FNZA 3FMEA 3SOCA 1O6LA 3VO3A 5CASA 1NW1A 5BMMA 4GVAA 3A8WA 3VF8A 4ZLYA 4F7JA 5J87A 4LUDA 3SG9A 5HTBA 4RQKA 1HOWA 3Q9XA 3RZFA 2JDOA 1JPAA 3NNWA 4BCNA 1XH8A 5GZAA 3TKUA 2FB8A 2R3RA 5HO7A 4GT4A 4EOIA 3HP5A 4NFNA 1ZYDA 2QOHA 4A06A 5BVFA 2WU7A 4ALUA 4XCUA 5HIEA 4RLKA 5D10A 4Y73A 3ZC5A 2B53A 2ZV7A 5IMXA 3I7CA 1XH4A 3VVHA 4ZZNA 4GU9A 1OL7A 5IQAA 3OT3A 2XNEA 2GCDA 4JRNA 2VO3A 1U59A 3AD4A 4LGDA 4XP3A 3REPA 3UQCA 1RDQE 4Q9SA 3A7FA 2BVAA 5AP7A 5JGAA 5KNJA 2XK8A 3PPJA 3QRIA 4P4CA 5AP4A 2RKUA 3ITZA 5KMMA 3RPOA 5EQEA 1P2AA 3VBWA 2IW6A 2ITWA 4WRGA 5DMZA 2XCKA 3G2FA 5AUWA 2ZM4A 2ZJWA 3NYVA 5E8XA 3R30A 3NIEA 2W17A 3OW3A 2X0GA 3ALNA 4ZSJA 3PIYA 4FV9A 5L2TA 4U3ZA 1HCKA 5A6OA 4K11A 4BBMA 2VWWA 3NGAA 4B8LA 5F95A 3GC0A 1KE5A 1YVJA 4IAFA 4EWQA 2YIQA 3ZXTA 2X1NA 4HW7A 5BNJA 4FICA 3MS9A 5I9VA 3GC8A 4C61A 4EH7A 4CCBA 3H30A 1ATPE 3BLQA 4WHZA 1IG1A 3SKCA 3GXLA 3UJGA 3UIUA 5EKOA 5CY3A 2YDJA 4ERWA 3HMOA 1JSVA 3AXWA 4HGTA 3R02A 4AZSA 3DBDA 3GNIB 4QMUA 3UDBA 3QQFA 4QMTA 4YZMA 2C0TA 3E8NA 1BI7A 3UQFA 3MIYA 4MX9A 4AWIA 1R0EA 3PA3A 2VTLA 3NW7A 2BR1A 3V51A 3R7GA 4M66A 2AC5A 4C4HA 4FF8A 3EL8A 3QD0A 2XYUA 4ZK5A 4AGUA 3FQEA 3VJOA 2XP2A 4IWQA 3MPAA 4CG9A 2VX0A 4JL9A 4EEVA 4MTAA 3QBNA 1YWVA 1H1QA 5F4NA 4OTHA 3LLAA 2JIUA 2OK1A 2P3GX 3DBCA 4K33A 1TVOA 3DY7A 3ZRKA 4ERKA 3NEWA 3EN6A 1OKYA 1Y57A 2FSLX 1J7IA 2VU3A 4JX7A 4BDHA 5GZ9A 3LCKA 4PUZA 5HU3A 5FDXA 4FKRA 5DH3A 4PTGA 4J97A 4FEUA 3QD3A 3KXMA 2RG5A 4MQ2A 2VZ6A 4FG8A 3R2YA 5AMNA 4IQ6A 5DWRA 1WVXA 4FL3A 4P5ZA 4U79A 5HD4A 3W2RA 4E7WA 4L8MA 4ZTQA 4R77A 2P2IA 4YJPA 3UZTA 3MFRA 4M0YA 2EXMA 4X2GA 2IN6A 2OJFE 3LCTA 5AR2A 3QRUA 4JIKA 3LMIA 2CLQA 5FEEA 2XM9A 3I5ZA 4H3BA 3PIXA 4Z3VA 4BGGA 4WD5A 5LVMA 3FJQE 3FZOA 3HMMA 4Z16A 3ZLYA 2PZYA 4YLKA 4BDFA 1H27A 2WQMA 3RAHA 4C4FA 3QU0A 1ZY4A 2Y7JA 3PPZA 4XP0A 3H4JA 4FI1A 2YEXA 4JLCA 2QR7A 4X21A 4O96A 3E8EA 2UUEA 3A60A 4N6YA 1Q41A 1WBNA 4EOMA 2B9IA 3PG1A 4M97A 3S1HA 3FLYA 4O2PA 5EM5A 5K3YA 3QF9A 3P7AA 3VWAA 1XQZA 3BYVA 3ORLA 5M53A 1KE9A 4XG6A 4FK6A 4RWIA 4U44A 3ZU7A 4QMNA 2GNJA 2QO2A 3VJNA 3EFJA 4YZDA 4X3JA 3ZUTA 4O81A 1WBTA 4N4SA 3BQRA 5JQ5A 1JKKA 2P55A 4DTAA 4EH9A 4H1MA 5KMLA 3UNZA 5BVEA 5CZHA 5LWMA 3ZC6A 3H3CA 5HCXA 4RFMA 5GNKA 4GU6A 2BRBA 4AFJA 3CLYA 3GU7A 4AE9A 2XK6A 2XK7A 5CXHA 5LVOA 3MA6A 4BIEA 4NCTC 4R1YA 3SXRA 5HNBA 4OBQA 4ZS4A 3NAYA 1FMOE 1ZZLA 4YPSA 4FNYA 2B9HA 3QCXA 3C4EA 3OG7A 5FP6A 4TYGA 4E6QA 2XB7A 3MH0A 5CWZA 2GPHA 3HEGA 4C33A 4FSUA 4JBQA 4BWPA 2B0QA 5HZNA 1YXUA 4O7ZA 4JG6A 3F69A 4BC6A 2YN8A 3DAEA 3PA5A 4J1RA 4HVHA 3ORTA 2V0DA 1OPKA 4F63A 4FR4A 3R2BA 4H05A 4CFNA 3DA6A 4U97A 3G15A 3ENHA 2PVNA 1B39A 4NK9A 3ORKA 4G6LA 3C5UA 2PVLA 4J95A 1LEWA 4MBLA 3HV4A 3QQJA 4BDAA 1HCLA 4O1OA 5BYYA 4KKGA 4DH7A 2CNQA 3ZXZA 4FTOA 4DEDA 2GU8A 1E1VA 2QOLA 2R3PA 4RJ8A 4C2VA 1PMNA 5CSVA 5A14A 4KUJA 2JDSA 2A0CX 4NU1A 4AW5A 3DBEA 3TNWA 2Y8OA 3UMXA 4BTFA 4KBKA 3VS2A 3COKA 3K3IA 4HZSA 4YJUA 5CAOA 3CJFA 1P4OA 1SZMA 2WIPA 2XBJA 4I23A 5E90A 4A9SA 3D5WA 4L3LA 4WT6A 2OJJA 4BYIA 5CF8A 5AIKA 5EW8A 2Y6OA 3CCNA 1ZYSA 2O63A 3ANRA 2C47A 3LZBA 4UMPA 5F94A 2X6DA 5CF4A 1OM1A 3BU3A 3O71A 2EU9A 1P5EA 3OS3A 5HG9A 2EWAA 2WTCA 1W7HA 2DQ7X 1FGKA 5AR5A 1FVTA 4D4YA 4EKKA 2W1HA 4IJ9A 3WE4A 3I4BA 4DEBA 3MJ1A 2DYLA 4CMTA 3UNKA 4C7TA 2X2KA 2YM4A 1PMUA 2ESMA 2A19B 1OIUA 3D5XA 2UW0A 5AX9A 3S95A 1XHAA 3FZPA 3IW5A 4A7CA 4DGNA 1YI3A 3PA4A 5EM7A 5J8IA 3FL5A 2R3JA 1H01A 2C1BA 4XG8A 2VWYA 5BVNA 2HYYA 4KIKA 3ORXA 4FKIA 2OG8A 2ZV2A 3IQ7A 2BCJA 3DJ7A 2P33A 3VS4A 4H39A 2R5TA 3MA3A 4AN9A 1GIIA 3JS2A 3Q4CA 4HCVA 5C8KA 2HXLA 5AX3A 4M14A 4GMYA 5EHYA 4AQCA 4NTTA 3TNPC 5BUIA 5M4IA 3NNUA 3PY0A 1IAJA 2BRHA 2QVSE 3HUBA 4USEA 3QQGA 4FSMA 3W55A 1J1BA 2XKCA 4QP8A 4YHTA 5DT4A 3OCBA 4KBCA 3AT2A 3MFTA 5DLSA 3DBQA 3QGYA 1WVWA 4M68A 4DEGA 5BVDA 3DNDA 5JFSA 1CKPA 3P9JA 4O21A 2GHGA 4D9UA 3FZTA 1YXXA 2QO9A 3WF7A 4FV1A 2JKQA 4ZAUA 4QRCA 5M09A 4I93A 1Q8UA 2QHNA 5DI1A 3FPQA 2ZVAA 3TNIA 4C34A 2HIWA 5HG8A 1CDKA 3V5QA 3V6RA 5HX6A 1V0OA 4IX6A 2BAJA 1OIYA 4AZVA 4YZNA 3CGOA 2UZWE 1CM8A 2VWZA 2NPQA 4LL5A 3ZH8A 4Y46A 5IQEA 3O96A 5M56A 4CVAA 4TWOA 3UZPA 2VTPA 3C0HA 2W5AA 5DFPA 2OO8X 4RT7A 3EQBA 2NRYA 3PP1A 3EOCA 4I5PA 5A46A 3HV5A 4AU8A 3HV6A 2GS2A 4O7TA 2WAJA 4IH8A 4EYJA 3NUSA 4KBAA 5IQDA 1ZXEA 3FZ1A 1NA7A 2OGVA 3VBYA 3RKBA 5BYLA 1UNHA 5CNNA 3WF8A 4D28A 1JSUA 1STCE 3C7QA 3RNIA 3IW6A 2YZLA 5AV2A 2IZRA 2YDKA 4Z7GA 5GJGA 3DB6A 4AN3A 3F9NA 3CR0A 2I1MA 4J98A 3ZYAA 1U4DA 2GTMA 3CY3A 4QNYA 4S32A 3M11A 4XYFA 3ID6C 4YJOA 3E63A 3QTQA 3QALE 5HCZA 3T3UA 4RJ6A 4PP9A 4RX7A 4MH7A 3OY1A 3R9DA 5CF6A 5IH5A 4CNHA 4OT5A 4MCVA 4CYIA 2UW8A 3EN4A 1OB3A 4GK3A 5E8UA 2PK9A 4AW2A 1XH7A 3OTUA 4FKJA 4E1ZA 5AR4A 5CSXA 4FTAA 3ALOA 4ZSGA 1QMZA 2H96A 1JAMA 2AC3A 3QRTA 4PNIA 4O22A 3WZDA 2F57A 4TYJA 2G2HA 4RC3A 4U5JA 5DEYA 5IUHA 2OIBA 1L8TA 4KB8A 4TPTA 4TTHB 5EYKA 1QPCA 4XJ0A 1B38A 4X3FB 4GG5A 5HO8A 4CSVA 5JZJA 4BR3A 4NEUA 2OXDA 3OC1A 3UO5A 3ORNA 3ACJA 3ATSA 2X9FA 2WEIA 2R3OA 2J0JA 3TJCA 5IQGA 5ETAA 4D2SA 4WG3A 4EZ7A 4IZAA 2E2BA 3ZZEA 5HG5A 4BCFA 4CT1A 3LCOA 3CKWA 3I60A 3FMHA 5FM3A 4C62A 4C8BA 4F9CA 4DT8A 2FSMX 3BEGA 4IBMA 5DN3A 1JBPE 3BU5A 5JFWA 5HORA 3B2TA 5AP1A 3NX8A 3KGAA 3DK6A 4RPVA 4FTTA 4OTGA 1W0XC 4W4XA 4RX9A 3W8LA 4L6QA 4G9CA 3U4WA 4DTKA 3MVLA 3ZSIA 3SG8A 3TUCA 5IG1A 1G3NA 4RA4A 3WF6A 4C4IA 4EWHA 4O0WA 2ETMA 3GU5A 4IVDA 4X2KA 3Q04A 4GYGA 4YC8A 4OTPA 2XNMA 4AA5A 5BPYA 1JKLA 4V04A 2E9UA 3PJ1A 1ZRZA 2E9NA 3MH2A 3UIBA 4PMPA 4NKSA 3F2NA 3AGLA 2P2HA 4KA3A 1IEPA 3D9VA 2JITA 3LFSA 1DI9A 2J6MA 4B99A 1RW8A 2BUJA 1BYGA 3WOWA 1V1KA 1Q8WA 2QLQA 2QD9A 1YXVA 4MXCA 5DPVA 2DUVA 2IZSA 1Q62A 2ITPA 2CHLA 3IKAA 4GUEA 1AD5A 2BZKB 4ONAA 3W10A 4O86A 4I0RA 2BZIB 2HZ4A 2CKPA 1UU3A 3HNGA 4D1XA 1T45A 4YP8A 3UNJA 5EI2A 1KV1A 1WBPA 3FAAA 2VTSA 1F3MC 3DFCB 3QLGA 1YQJA 3CIKA 4MXXA 2GTNA 2OJIA 4QPMA 2VO6A 2VTMA 4UB7A 5FP5A 1J3HA 4B9DA 4UMTA 3VRZA 1XJDA 3ATTA 3BWJA 3BYMA 4WNKA 4LMNA 2H8HA 2J7TA 4D55A 3OXIA 5JFXA 5J1VA 4GT3A 3OBGA 3MY1A 4YBJA 2RL5A 2R7IA 2BRGA 4FT5A 5KHXA 1YXTA 2C5VA 5HE0A 4F0GA 3KK9A 3WI6A 3D7TB 2BTRA 5HIDA 3VUDA 5LOHA 2XS0A 5HGIA 3SD0A 2C6LA 4BBFA 4I24A 4BN1A 3BKBA 2X8DA 3R01A 4HGSA 3TUDA 3OOMA 1SYKA 4RLLA 5K0KA 2JBOA 4W9WA 3MVJA 5EDPA 1OI9A 5DE2A 4EH4A 4GH2A 3RPVA 4HVSA 3TZ7A 2YM3A 4U7ZA 4YJTA 3TNHA 3H9FA 2VGPA 3N51A 3E3BX 4QP7A 4O2ZA 4D5KA 4DCEA 2OH4A 1SM2A 5LQFA 4MNFA 4O1PA 3UOHA 4FEXA 4O7NA 2XJ1A 3CD8A 4L44A 4EOOA 4M15A 5AP5A 3QWKA 3GP0A 3AT3A 4I0TA 5EFQA 4FGRA 5KZ0A 4UXQA 5TT7A 5J1WA 4PMSA 4EJNA 4UWCA 5CI7A 5C03A 3TZ9A 5FEQA 4KWPA 5EQPA 4DA5A 3W2SA 1U5QA 4UYNA 2HY0A 2WHBA 4FTLA 4DYMA 3P08A 4ZLOA 2XIYA 5BMSA 1FBNA 4LL0A 2C5XA 3AMAA 2PVJA 3NRMA 3PG3A 3EB0A 5HE2A 4IIRA 3V5JA 2ZV9A 3GCSA 5M08A 3TI1A 5BVKA 4FZ6A 4BCIA 3ZO4A 5JH6A 2BIKB 3OP5A 1FPUA 3QZIA 2R2PA 4UEUA 3ZLWA 1VR2A 4CYJA 3E88A 1PMEA 4A9RA 3BBWA 3KKVA 4JBOA 4EH8A 2WELA 3C4XA 3BHHA 4FVPA 4NCTA 4FG9A 3LFQA 3HLLA 3PYYA 3QC9A 4JR7A 2ZDTA 5FUTA 4YHFA 4RJ5A 2BFYA 3M42A 4LM5A 4NL0A 4LG4A 3CTHA 2JGZA 3R8ZA 4EK5A 4BYJA 2UVZA 4L67A 4D4VA 3MB6A 5K5XA 3FI2A 3IONA 3UTOA 4F70A 5IH6A 1Y6AA 3OCSA 2SRCA 2XEZA 5HI2A 4OAVB 1UNGA 3KMMA 4AGDA 2PZRA 2XIRA 2VAGA 3GOPA 2O64A 3FBVA 4X2NA 2EXCX 2YCFA 3S3IA 3H0YA 3PFQA 4LI5A 3FY0A 3AG9A 3CEKA 2BKZA 2OZAA 2WMUA 3KRLA 4FTUA 4IC8A 2HWPA 4LOQA 4BBEA 3EFKA 2JEDA 3KXHA 4YR8A 4IMYA 5AUUA 3NYOA 4EOJA 2VTHA 2DWBA 1M7NA 3VUGA 4KS7A 4MK0A 4F0FA 5I9ZA 3MW1A 1GIHA 2QC6A 3NUPA 4BCGA 4O0VA 5AR3A 5B2MA 3NUYA 3QD2B 3LW0A 4LRMA 3KRRA 2ITQA 4IZYA 4S30A 4AGCA 3Q9ZA 4HYHA 4QMLA 2GFSA 2BDJA 2HAKA 3MI9A 4PF4A 2QONA 4TY1A 1WBVA 3TT0A 4CXAA 3Q9WA 1DAWA 3D5VA 4V0GA 2H6DA 3JR1A 5K0XA 4GRBA 3ERKA 3HA6A 2BILB 4H36A 2PMNX 2ITOA 3RP9A 3NPCA 1QPJA 3D4QA 2W1ZA 4F99A 4I4FA 4FV4A 5DG5A 5TF9A 5CANA 2UW5A 4C4JA 4GV1A 5D7AA 1CKIA 2Z7QA 2CDZA 1Y6BA 4IXPA 4RC2A 4Q2AA 2JDVA 2I40A 3BHUA 3KY2A 3LFEA 3VRYA 2PE2A 5FXSA 3SXSA 3V5PA 1J7UA 4L46A 2XMYA 4ITIA 2OF2A 5LVLA 5KMNA 5IQBA 4CMUA 4F9WA 2CPKE 2FGIA 3LMHA 1ZARA 2QI8A 2R3MA 3PPKA 3VC4A 5AFVA 5H2UA 3LFBA 3QZGA 3Q52A 4G2FA 3IS5A 4U42A 4DN5A 4MWHA 2C3KA 2HOGA 1YHSA 2CCHA 4HGLA 2HENA 2YCQA 2C5OA 2ITXA 3LKMA 2B55A 2BRNA 2YIXA 3K2LA 4IFGA 4QPSA 3TZMA 3VBVA 4FMQA 4JAJA 4XH6A 4D4SA 1O9UA 4I41A 3A62A 4C35A 4O6EA 4GK4A 3U55A 1XR1A 3A7JA 4BVUA 1MRUA 3PXRA 3R83A 3ZEPA 4ACHA 4F7LA 5B2LA 3GOKA 4QMZA 4OTIA 2CGXA 2VO7A 3LCDA 2P4IA 3IPHA 4IAZA 1NT2A 4FV5A 2CKQA 4HYIA 5TO8A 2LAVA 4KAOA 3ULIA 2OBJA 5EI8A 3R8VA 2JAMA 3QTIA 5AJQA 3D2KA 2C0OA 3EQFA 2BMCA 4LMUA 3UE4A 5D41A 4A4XA 4N57A 3MWUA 5L2QA 4F08A 3JY0A 2UZNA 4KIQA 5H9BA 4PX6A 1UKHA 4AUAA 4JQEA 1KE7A 3BHYA 3EN9A 2W1DA 3BRBA 4IADA 2YFXA 1GZKA 3HRFA 4OTRA 5IPJA 5CX9A 3U6HA 5J5TA 1OPJA 4GS6A 2Z7LA 3P5KA 2RF9A 5ETFA 3BYUA 1YHWA 3Q6UA 4XG7A 3HV7A 4ANOA 5L8LA 2UZDA 4IX4A 4ACCA 1GOLA 5CAQA 2GNHA 3C1XA 1PY5A 2IZTA 3FHRA 5I9UA 1DS5A 3UC4A 3ZM9A 4U81A 1IA8A 3AOXA 2WQBA 1SVHA 4XLVA 4FTMA 3ZMMA 4AZEA 2XCHA 3MIAA 3LJ2A 4KRCA 2PSQA 2R0UA 2V7AA 3HGKA 3F5PA 3Q60A 4NW6A 3A8XA 3ZM4A 5T68A 4B8MA 3F3VA 3G9LX 1OUKA 1U5RA 3FHIA 4P7EA 4WNOA 5AP0A 2WIHA 3K54A 4QP2A 4RVMA 3VUMA 4MVFA 2Y4PA 3C0IA 5A4EA 3QCQA 3GFEA 4XG2A 3DJ6A 4UN0C 3LFAA 3MTFA 2OFUA 4DLIA 3EQRA 4NW5A 1OUYA 5LJJA 4PQNA 4XX9A 4A9TA 4ZTHA 4FNXA 3EMGA 3QA0A 4NKAA 3TCPA 3TXOA 3ZHPC 4F6UA 5CSPA 5IA4A 3L8XA 4BWKA 4BCKA 1SVEA 1PXMA 4MWIA 5BVOA 2QO7A 3F7ZA 4D2PA 4KRDA 5LMAA 2NNWB 4B7TA 3NIZA 1A06A 1OMWA 4O0SA 4V05A 1FVVA 5LARA 2R3GA 4U80A 4EOPA 4X2JA 1GAGA 3EFWA 3C0GA 3F3UA 3RCDA 5JN2A 5EOLA 3A61A 3F61A 3FLZA 3S00A 4CQEA 3VS7A 1QPEA 4JQ7A 4I1ZA 5HHWA 4DBNA 2W1GA 2J51A 2Z8CA 5C8MA 4DAWA 4HJOA 1QL6A 4YTCA 1M14A 2OXXA 4EKLA 3WYXA 2UZBA 1PRYA 4WRSA 5E8YA 3ROYA 3MVHA 4AF3A 3D2IA 3U54A 3NR9A 4RVLA 3R7IA 5HU9A 4PL3A 3MFSA 4YSMA 3KULB 4EHGA 5I9WA 4LRJA 4FT9A 4PRJA 4GK2A 1H4LA 5A3XA 4D2VA 4GEOA 4Z7HA 3F2AA 3NDMA 5JZNA 3IDBA 5GIOE 4E5BA 4OLIA 1R1WA 3LAUA 3OOGA 3UYSA 1ZMVA 1OGUA 1Q4LA 4V01A 4OBOA 3Q9YA 5FRIA 3U87A 5J95A 2R0IA 1R0PA 3F88A 2JDRA 1I44A 4P5QA 4PDPA 2VO0A 4DITA 3FXZA 4QP3A 3FXWA 3SRVB 4Q9ZA 5LCKA 1PXLA 3ODYX 2WMBA 2CGVA 4OBPA 5FGKA 3RMFA 4BKJA 3E62A 4O0YA 3TV7A 4I5CA 4AA4A 3R71A 4JNWA 3I79A 3CP9A 4RIXB 4BWXA 3R7VA 2KTYA 2PVHA 3QAME 3ZRLA 4AN2A 5KMOA 3D5UA 4FV3A 3R8MA 5ACBC 3V8WA 3OT8A 3G5DA 3MTLA 2IG7A 3JUHA 3UGCA 3BU6A 4KIPA 1WMKA 4BKZA 5CU0A 1OKZA 5FM2A 2CNVA 1YI6A 3L9NA 4FODA 5DBXA 5L8KA 4ZZOA 2W7XA 5HNGA 4GFMA 2A2AA 3F6XA 2O8YA 4BTMA 4EK4A 2B1PA 1P14A 5AUZA 4C59A 5KHWA 3F66A 4HOKA 4Y72A 4U45A 2WB8A 3PZHA 4PPCA 3FY2A 1XO2B 5AM6A 3EL7A 3D14A 3LFNA 3C13A 1Y8YA 2QOIA 4IWOA 4BZDA 4C3FA 4EHVA 2C69A 2R7BA 5G1XA 4OW8A 4C2WA 1M7QA 4M7IA 3CKXA 3UPXA 4BGQA 5IQIA 2QLUA 4NJDA 5AM7A 2W1IA 2YIWA 4L7SA 3P79A 4IAAA 4BCQA 4EOKA 2NO3A 3VUTA 2PUPA 3GCPA 5ETIA 3CC6A 4IAYA 3NWWA 2QOKA 2WMWA 3DKGA 2ITNA 4BHNA 4ACMA 2X6EA 5L6WL 3A99A 5ACKA 3W33A 4E93A 4QMVA 5KZIA 5T3QA 3QTXA 2XJ0A 4BIBA 5CAVA 5M51A 1CSNA 3RWPA 4F0IA 2FUMA 3CY2A 2I0EA 4ID7A 5BVWA 3TDVA 3UZRA 1ZOEA 5IZFA 2CMWA 3BLHA 2YJSA 4QD6A 4J52A 4D9TA 3CBLA 2BROA 4BCPA 3MSSA 2QOBA 2CCIA 3GFWA 3HKOA 1XKKA 1BUHA 3ROCA 4E6DA 1OECA 5EG3A 3GCUA 2ITVA 2YWPA 3OWPA 5IUIA 1BMKA 5LXMA 2PVRA 4M8TA 2QNJA 5AEPA 2FYSA 3ORPA 1JLUE 3VW6A 5IH4A 2WTKB 3MDYA 4IACA 2QR8A 4IM3A 2GDOA 4M69B 4BI2A 4F9BA 4ANQA 4CZUA 4G1WA 2GSFA 5CENA 3PXZA 3ZRMA 4O82A 4CKJA 2YABA 5EDRA 5EYCA 5CAUA 3W1FA 1ZAOA 1R39A 4FNWA 4IM0A 5FG8A 3ZLXA 4WIHA 2F4JA 4XMOA 4AA0A 3D7ZA 2IWIA 4RVTA 4CV8A 4EH6A 5CS6A 1NY3A 4EBVA 5AA8A 4HGEA 5DIAA 2WMSA 3HUCA 5HOAA 3EWHA 3NYNA 4FT3A 4XNEA 3SDJA 4PWNA 4JRVA 3UC3A 5IEVA 4M67A 4FE2A 2X4FA 4CRSA 4IWDA 2LGCA 2ITUA 3PSDA 2P0CA 5FBOA 2OIDA 3TACA 4R7IA 2C1AA 4YUQA 2YM8A 2Q83A 2OSCA 5AV1A 2C30A 2RIOA 4IVBA 4MNEA 4PDYA 4O83A 4NM7A 1PKDA 2ZMDA 5CAPA 1BI8A 2C3JA 4I6FA 3MV5A 4HZRA 3ORMA 2B7AA 4L3JA 2X4ZA 3R9NA 4YJRA 5IISA 3DTCA 1XH5A 3RAIA 2ZV8A 3ZUVA 4BDKA 2YAAA 2F7EE 3R7UA 5HVYA 4Z9LA 4DEHA 2OFVA 5ITAA 3LQ3A 3OUKA 3OZ6A 4FV2A 4F9AA 3PVGA 4YNOA 3M2WA 4IANA 3NW5A 3AT4A 4BI1A 3UP2A 4F9YA 4DFBA 3HAVA 4NM3A 5DGZA 4G9RA 3KK8A 4O91A 4RIYB 3GENA 1WBWA 5TKDA 2OLCA 5CNOA 4RC4A 4AGWA 4M12A 1YRPA 4PTCA 4TYHA 4E8AA 1U46A 2PMIA 2XNGA 5E8SA 5C27A 3COHA 4YSJA 3KC3A 1WFCA 1ZOHA 4C58A 4CTCA 2G9XA 2C6IA 3PZEA 1UU9A 5LCJA 5CEPA 4LOPA 2R4BA 2CN8A 3FE3A 3KXNA 3PVUA 3RINA 4U6RA 2JFLA 4O7VA 3PJ2A 1MRYA 3TV6A 3UVQA 4R7BA 3B2WA 2RFEA 1PJKA 1JSTA 3FMJA 4IC7A 4CMOA 3MY5A 3ULZA 2EUFB 5CU2A 5IF1A 4MF0A 3UQGA 2PE0A 2QODA 4OR5A 4ARKA 3EHAA 4D1SA 4AXAA 5AWMA 4GFOA 4E4MA 4RWLA 3FXXA 4O38A 1W83A 2V22A 4HVDA 1SMHA 3OEZA 4QQJA 4A07A 4RA5A 3ZTXA 3HVCA 4WKQA 3QQLA 1H1WA 1OL1A 4DG0E 1PF8A 2WD1A 4PDSA 4YU2A 5JEBA 2G15A 4AZTA 1MQBA 3PLSA 4FEWA 3FUPA 4Y5QA 5IDPA 1PW2A 3DU8A 3FZSA 3QTRA 1FQ1B 1KOBA 4MBJA 1W82A 5AA9A 5E8VA 5D9HA 2HW7A 2GHLA 5HVJA 3WE8A 4RJ4A 4BGHA 4I4EA 3VS0A 1S9IA 2RFNA 1Q8YA 3AQVA 4UZDA 4XG9A 4FA2A 5CALA 1XWSA 3PE2A 3KMUA 5C9CA 5M4FA 5KKRC 3FMDA 5DEWA 3NW6A 4X2FA 3OY3A 4NUSA 5FXRA 2BZHB 5AR7A 1O6YA 3EQDA 4I20A 5FBNC 3UO6A 2QU6A 4ZY6A 3EH9A 3KRWA 2PWLA 2FVDA 5HLNA 4BDBA 4WUAA 4I21A 3KXZA 2CKOA 2YERA 4G3GA 3KN6A 1IAHA 3BQCA 4I22A 1SNUA 4APCA 1REKA 5EH0A 5CEQA 1ZYLA 4EL9A 5L6OA 4C36A 5DNRA 4W8DA 1UWJA 3QHRA 3H9OA 4GYIA 3U4UA 4A9YA 4DH5A 2R3FA 2BHEA 3R8PA 4ZMEA 3NVKI 4JJRA 5M4UA 1CKJA 1M2RA 2UZTA 4L9IA 4XLIA 3Q96A 1Y91A 3LOKA 5FXQA 3R8UA 4NJ3A 3VHEA 4WBOA 2XNNA 3U6IA 3QZFA 4LV8A 5CSWA 1U54A 3O2MA 4JBPA 3HDNA 5IU2A 2WQEA 2XNOA 2ITZA 4FT0A 3CJGA 2YA9A 5CZIA 5FTQA 2R3IA 3W32A 4ZSAA 5JQ8A 4ANMA 4BHZA 3PDTA 4ZTMA 3FC2A 3NCZA 1OBDA 1K2PA 2PTKA 2WQNA 5HBHA 2IW8A 2IPXA 5DR2A 1ND4A 1UVRA 3VBQA 5E7RA 3VAPA 3KF4A 4B4LA 3KMWA 4TZRA
chains in the Genus database with same CATH superfamily
3R1NA 4K8AA 5K4JA 5BYZA 1OIQA 4BL1A 4F1OA 5H8EA 2Y0AA 2C68A 3AD6A 3D83A 4O7LA 3DKCA 3KCKA 2IO6A 4UX9A 3UDZA 2OW3A 2OU7A 2W9ZB 2WMQA 3Q32A 3G6GA 3FI3A 4DGMA 4EC9A 5AAGA 4F1MA 2UZEA 2GQRA 3SHEA 4RWJA 5ANEA 4C38A 3LXNA 3CQUA 4USDA 2OWBA 5IQFA 3R04A 5CQWA 3C9WA 2C6EA 3Q4TA 4LFIA 4S31A 5AAEA 2ACXA 3I81A 3PUPA 4IB0A 4WOVA 4ZTLA 4IVAA 4HVGA 4CFFA 4DEIA 4W4WA 4AP7A 3LCSA 2F2CB 3RVGA 3KA0A 3EQIA 4GSBA 4YMJA 2VTNA 5J7HA 2J0KA 3EN7A 4D4RA 4DC2A 4EZ3A 1GY3A 1VZOA 2WOTA 5FTOA 3E5AA 3ENMA 3V8SA 5L4QA 3MPTA 4XBRA 2WPAA 3SV0A 5E92A 2YIRA 4FSWA 3FLNC 3KL8A 1FMKA 4Y95A 5HCYA 1J1CA 2W4KA 2B52A 4J7BA 5GJFA 3VUHA 3DXPA 4IDVA 4NIFA 4WNMA 2BAQA 4QOXA 3PXYA 4GIIA 3HX4A 3GT8A 3I5NA 3EIDA 4KNBA 4PL4A 3R9RA 1Q8TA 4RIWA 5IUGA 4DGGA 2FSOX 5E8WA 4BF2A 5KMIA 1GZOA 4L00A 5KX8A 1UV5A 2QCSA 3E7OA 3GU4A 4G31A 3L8SA 4WA9A 4IM2A 4JI9A 2XKDA 3F7WA 3POOA 3RWQA 4BTJA 5L2WA 3P7BA 2VX1A 1H24A 2YITA 2WKMA 4DINA 4UMUA 3DCVA 1ZMUA 3DAJA 5AUXA 5I3RA 5KCVA 5HNIX 2A27A 5DT0A 3VS1A 2Y4IC 4J99A 4YJQA 4FKVA 2PMOX 3QC4A 4A9UA 4RWKA 3HA8A 4CFMA 3AD5A 4GL9A 4EORA 1H07A 5LWNA 4LUEA 2UV2A 3P4KA 2PZIA 3FMLA 5AP3A 5HX8A 3SW7A 3QRKA 3B8QA 4ITHA 3GBZA 4KIOA 2C3IB 2JFMA 3THBA 4NH1A 5F20A 1EH4A 4BRXA 3LQ5A 2C6KA 3QCSA 4F6WA 3GGFA 4WG4A 4MXOA 3JYAA 4BCMA 4FV7A 3ZBXA 2CNUA 3DLSA 4MKCA 3BBTB 1DAYA 5E8ZA 1YDTE 3TWJA 4IX3A 4LGGA 3R22A 1UWHA 2J4ZA 3NAXA 4FKGA 4M84A 3ZBFA 2QU5A 1QCFA 3R00A 1F5QA 4C4EA 3Q5ZA 4F4PA 4A4OA 1BL7A 2VN9A 4J71A 3IECA 4DFXE 5T6KA 3R7YA 3E7VA 4H58A 5HEZA 3QQUA 4PPAA 3EQHA 3G6HA 3PUFC 4ACDA 4J53A 5EW3A 2FH9A 3ANQA 2CSNA 1K9AA 3PRIA 3QTSA 3PWDA 4R1VA 1PMVA 4S33A 5AUYA 4C37A 2QOCA 3BYSA 3C4ZA 4IHPA 4L45A 4L68A 3VHKA 4BB4A 5I4NA 2ETKA 4EQMA 4XHKB 4TKSA 3MBLA 1XH6A 2IW9A 1OBGA 4QYEA 4H3PA 3ZDUA 4ORKA 2PVFA 2QG7A 1UKIA 1APME 2VTIA 4AAAA 1ERKA 1Q97A 1YDRE 1YWNA 2XKEA 3COIA 5I9XA 2VWVA 3BCEA 4IVCA 3UMWA 4DGLC 4I94A 2QKRA 3BGPA 4GT5A 4JVGA 4TRLA 4E4LA 4PMTA 3ZFXA 4BDJA 3UVRA 4FX3A 2VWXA 5LMBA 1JOWB 2X2LA 4X3FA 3EN5A 3OVVA 4G17A 5CEKA 5GJDA 3FLWA 3G0EA 3KXGA 1J91A 1A48A 2W06A 4GIHA 4HNIA 3P78A 2Z7RA 3KRJA 4PDOA 3PVBA 4FKLA 2XEYA 3P7CA 5AR8A 5HBEA 4FL1A 1VYZA 4DCAA 1LPUA 3V6SA 2C6TA 4AS0A 4RFYA 2WZJA 3E8CA 3Q2JA 4CFUA 4TXCA 3LPBA 2QOOA 3VS3A 4EI4A 4QP9A 2WMTA 3MYGA 3UBDA 2F7XE 2X0PA 4JDJA 4EJ7A 2O5KA 2XBAA 1YHVA 3A4OX 4FIJA 3F82A 3C4WA 3R1QA 4YTHA 3SGCA 1TQMA 4F6SA 5FLFA 2WFYA 2PVMA 2PVKA 3FSFA 3GU8A 2H34A 4IB5A 2WMXA 4GKIA 2GMXA 3LM5A 3ZOSA 4TN6A 2REIA 3W2QA 2ZB1A 4OTDA 5KKRB 2RGPA 3B8RA 3ODZX 4NM5A 3PXKA 3BPRA 1W2DA 4RRVA 4BZNA 2YZAA 4BDIA 4PTEA 4XV1A 4ZLZA 2ZMCA 2W1CA 3ZSGA 2ZB0A 3TTJA 4RX5A 3G33A 3LHJA 5ETCA 4EQUA 3FC1X 2YWVA 3KXXA 4QDEA 3N4UA 2W5BA 3O50A 3HMPA 4CEGA 4D2RA 4QTCA 4CLJA 3EZRA 5AV3A 3RAKA 3O7LB 2EB3A 3UDSA 3QTUA 4EOLA 3BLRA 3E87A 4IWPA 2XF0A 5J9ZA 4QPAA 2IVUA 3ZSHA 2UVXA 3I6WA 1JKTA 4DHZA 3EKKA 3HV3A 2QKWB 5ICPA 3UOJA 2J2IB 3W2OA 1M2QA 2B9FA 4B6LA 3ACKA 1KE6A 5HTCA 3C4CA 4YZCA 4FV6A 2WXVA 4BZOA 3LQ8A 5DRDA 3GC9A 5CVFA 3VS5A 4MD9E 3RM7A 5HG7A 2CN5A 3POZA 4RSSA 3OCGA 3QTWA 4K9YA 1IA9A 3TN8A 5FWKK 4RVKA 2Q0NA 5HESA 4AG8A 4FOBA 2W4JA 4FYOA 4R5YA 4XG4A 2YDIA 2G2IA 3SLSA 3DXQA 4DFUA 3PSCA 5CI6A 1H0WA 2AUHA 2QOFA 2XIKA 3D7TA 3QUEA 4FSNA 4OTFA 4YNEA 1GZNA 5EW9A 3R0TA 4QMYA 2EVAA 3FI8A 3HDMA 3BL9A 3MJ2A 4FIHA 4H1JA 3RPSA 1S9JA 2UZVA 4OAUC 3BV2A 4LV5A 3MY0A 2GNGA 4WUNA 2BFXA 4FVQA 3IGGA 3QCYA 4NSTA 5ANDA 4IE9A 3GVUA 4FTJA 3IDPA 2I7QA 5IA1A 4CTBA 3NUNA 2BIYA 4O4DA 3L9LA 3LXPA 3VW8A 4TYEA 4IAIA 1LP4A 4PNKA 4ALVA 1PXKA 4O4BB 4LGHA 3UYTA 3ZCLA 4UMQA 4C3PA 5B0XA 5GIPE 5J79A 4FUYA 3BE9A 2PHKA 4QYGA 3G9NA 1NVSA 3FLQA 4XS2A 1XH9A 3R8LA 4FIFA 5DRBA 4DG2E 1IASA 3NZ0A 5CU4A 4IDTA 2BDWA 3LXKA 3D94A 4ASZA 2X39A 5KBQA 2W0JA 1YXSA 4DTBA 3PJ3A 5M4CA 2V55A 4K6ZA 3DQWA 5IA0A 3V5TA 5FTGA 3W8QA 3U8WA 1PHKA 4YGAA 1OL6A 2NP8A 3I0OA 2XUUA 3O51A 4YPDA 3H10A 3TKHA 4FC0A 4NTSA 3GEQA 5K9IA 2AEGA 3QQHA 4Z55A 3FWQA 4Y83A 4EBWA 2OH0E 2HCKA 4EK3A 1YOMA 4KINA 2PE1A 4ZIMA 2X8IA 1OVEA 4QYFA 3QKKA 4LRKA 1MUOA 2ERZE 4E4XA 1Z5MA 5J5SA 4L52A 4FRFA 4L3PA 4CV9A 4F64A 4HNFA 2J50A 5A9UA 3V8TA 1QPDA 1VEBA 2R3QA 3GQIA 4FTKA 5IKWA 5JT2A 5LMKC 4UYAA 2VUWA 4AOIA 4FEVA 4JBVA 4CFXA 2X7GA 3U9NA 2FA2A 2VWBA 5C01A 3O8TA 5DR6A 1LUFA 3EQPA 2W9FB 3IG7A 3JY9A 3ZFYA 5GHVA 3FYJX 3QLFA 5M06A 1ZMWA 1RJBA 4FGBA 1KOAA 5CVHA 3ORZA 4FKPA 1YKRA 4HPTE 4IZ7A 4RQVA 1G8SA 5L6PA 3EKNA 3C50A 3W0RA 3BV3A 3ZFMA 4ANLA 3WYYA 3QGWA 3EFLA 3BGZA 2XKFA 3ML1A 5FQDC 2WTIA 2VNYA 4UV0A 2W4OA 2YIYA 3MH1A 4BICA 3CD3A 3DK7A 3NYXA 1W8CA 5I9YA 4ZXTA 4FSQA 4GKHA 3DTWA 3IW8A 4ZEGA 4QMQA 2ONLA 2PULA 4XBUA 2C0IA 3VUKA 1KSWA 3CXWA 3Q2MA 3QHWA 4QMXA 4X7QA 4EK6A 1KUTA 3UODA 3TL8A 3OF0A 1JVPP 1FOTA 3ZLSA 4BCHA 2UW3A 4JAIA 5AUVA 5L2IA 5EYDA 1I09A 3T9TA 2IVSA 2YM5A 3ZO1A 5IMEA 3QUPA 4FTQA 1PXOA 3O17A 4O6LA 4TNDA 4FUXA 3F3ZA 1WZYA 1GIJA 3WZUA 3TKIA 1GJOA 3R63A 3AMYA 2OICA 3MN3A 3DPKA 5CSHA 4R7HA 4F7SA 2PU8A 4ENYA 2A4LA 1YDSE 5IEXA 3NMUF 3FQHA 4MXYA 3GCQA 3UIMA 1F0QA 4DFYA 3ZONA 4LQMA 4XOYA 2VX3A 3ZEWA 5I0BA 3JPVA 3BZ3A 1X8BA 1Q99A 4PY1A 3HL7A 3BX5A 4L01A 2GNFA 4E6AA 5CEOA 3QXOA 4Q5HA 4H3QA 5D7VA 2A1AB 1URCA 4YO6A 4DH3A 3DXNA 1Q3WA 1JKSA 2RFSA 4XOZA 3BELA 3KEXA 4RJ3A 4EHEA 4FBXA 4ZSEA 3CSVA 4PPBA 1TKIA 4MNEB 2GHMA 3FKOA 3ZO2A 3OMVA 4ZSLA 4CKRA 4DDGA 3OXZA 4O7WA 3O0GA 3VF9A 4G5PA 2RFDA 3MH3A 3VUIA 3R28A 2X2MA 2XRUA 3DDQA 3AMBA 1V0PA 4D58A 3P23A 4U43A 3OEFX 3W16A 3P0MA 4S2ZA 3Q6WA 1OL2A 4QTBA 4ZJIA 3VBTA 4L42A 5C1QB 4TT7A 5HLWA 4FV0A 2BPMA 1FGIA 3F5GA 4I6BA 4JDHA 2R3NA 2J9MA 4G3FA 2CLXA 4IEBA 4AT3A 3JVSA 4CRLA 3RPRA 3TNQB 3BWFA 4D0WA 4KSPA 2WTDA 5HE3A 2HXQA 5AUTA 3FV8A 4WSQA 3A2CA 1URWA 3V04A 2XRWA 1ZY5A 3Q3BA 4OT6A 4FZ7A 3R9HA 2WEVA 4TYHB 4KIKB 3FKLA 2PYWA 3BL7A 2C5NA 3EJ1A 3FMKA 5IA5A 5AAFA 1TFFA 4G6NA 3ZS5A 4UXLA 5IEYA 3DV3A 3IW7A 3OTVA 3RPYA 1R78A 5JFVA 4RGJA 1CTPE 2JKMA 4AX8A 5IQCA 3GCVA 4WNPA 4ZMFA 2HWOA 4AW1A 4X3FC 4DG3E 4LV7A 3VIDA 3TG1A 4KS8A 4N6ZA 2YM6A 3DJ5A 2CJMA 2EB2A 2HZ0A 5FEDA 2PUIA 4NZWB 2BTSA 3WIKA 3HMNA 4U40A 2QQ7A 4FG7A 4JX3A 1TQPA 3I7BA 4I6HA 5H8GA 4I6QA 4D1ZA 2YCSA 2G2FA 2YLFA 3EYGA 2VV9A 2Y6MA 3G90X 2VNWA 3PJ8A 4ZS0A 3TDWA 1AQ1A 5J7BA 2JLDA 2OIQA 2QURA 3VS6A 1Q3DA 3HYHA 4DT9A 3OWKA 1MP8A 2R9SA 3R9OA 1XBBA 4BCJA 4QMSA 1KV2A 2WMVA 3HP2A 5B2KA 3TIZA 3V5WA 2IVTA 3CTQA 1BL6A 3LVPA 2XIXA 4BDGA 2ERKA 2VTJA 4FK3A 5FDPA 2XJ2A 4D0XA 2IZUA 4IB3A 4MBIA 5KUPA 3U9CA 2YAKA 5DT3A 3HECA 3F2RA 1JWHA 2XNBA 3JVRA 2VTOA 4G3CA 1G8KA 5JMSA 3COMA 2QHMA 4GCJA 1RQQA 1AGWA 4YLJA 4CKIA 2UZUE 2W99B 5CEMA 4LDTA 4M13A 3WZKA 4K1BA 1IRKA 3TZ8A 3L1SA 4FEQA 4FVRA 2O2UA 1ZYJA 3PTGA 2ZDUA 3GC7A 1M52A 2GQSA 4GJ3A 4ANSA 2XVDA 4EZ5A 4ALWA 5A54A 3OCTA 1DI8A 3DS6A 1YI4A 3AC2A 3QQKA 4ZY5A 1Y8GA 3KN5A 2AYPA 3N9XA 4A4LA 4CG8A 3NUUA 5AV4A 3NFFB 3K5UA 2XNPA 4ZTNA 3KULA 1Q24A 3LE6A 4DH1A 3PY3A 3EYHA 3K3JA 2XA4A 3P1AA 2ITYA 2J0IA 2FSTX 2X7OA 3DFAA 5AV0A 1W2FA 1U54B 2Y9QA 5EOBA 4QQTA 3TV4A 5M57A 2B9JA 5EYMA 4O4CA 5EKNA 3ZDIA 4IZ5A 5HE1A 3DBFA 4CCUA 2HELA 4YC3A 5E1EA 3BYOA 3KIOC 1R3CA 4EOQA 4BFMA 3T8OA 5KE0A 4BY9E 1Q61A 1PKGA 4NFMA 3SRVA 2JAVA 1H8FA 5CVGA 5JRSA 2ZM3A 3R1SA 4AT5A 4W9XA 5ANKA 3I0QA 1H1RA 1YOLA 1PYEA 4CQGA 3W0QA 4EOSA 4JIAA 3DGKA 4RIXA 4APPA 2JDTA 3QUDA 4TW9A 2HZIA 4FSTA 4ACGA 4ANNA 4RG0A 2B4SB 3DZQA 3ZUUA 3FZRA 2JKOA 3OXTA 3QZHA 3BLAA 4L43A 4I0SA 4AACA 4ZJVA 3KQ7A 3OD6X 5E4HA 1BX6A 1KE8A 2FO0A 2BHHA 3AC3A 3DKFA 4DF3A 5CLPA 3CTJA 3QX4A 3S0OA 4OTWA 5CTPA 4QP1A 2XIZA 4DDIA 3OWLA 1K3AA 4CT2A 5JSMA 4QMOA 4P2KA 3QXPA 4M3QA 5FD2A 1OGYA 3IOPA 4K77A 4BCOA 4O7RA 5EM8A 4II5A 4QTEA 2BRMA 4G3DA 3HRCA 1RE8A 3F3TA 4YZ9A 5I3OA 3CPCA 4E6CA 1M17A 2GNLA 4X6QC 4MXAA 5L3AA 3WZJA 4I92A 2E9PA 5A6NA 2VWUA 1Q5KA 3MPMA 4WO5A 2IF8A 4CD0A 3SXFA 3UO4A 2HZNA 3PSBA 5C8NA 4C57A 1YWRA 3FMNA 5G6VA 3MGYA 5ANOA 4EUTA 3LJ1A 4RBLA 4YURA 4U3YA 3CS9A 4NIFB 4L7FA 4RFZA 3OWJA 5L8JA 4AQKA 2I0VA 2J0MB 5ANJA 1OIRA 1WVYA 4BTKA 2UZLA 2XH5A 2O0UA 4RIWB 1YOJA 2VGOA 5LVPA 4FZDB 4FZAB 2PPQA 5F1ZA 4O84A 4UBAA 2XM8A 4HYSA 2PY3A 3FKNA 5CYIA 3FPMA 1H00A 2G01A 4F09A 3DZOA 3QL8A 4D2WA 1XBCA 4QMWA 5CT7A 2OXYA 3VNTA 4ANBA 2I0HA 3A7GA 4GFGA 4WSYA 4YHJA 2RSVA 4W8EA 3Q4UA 1TQIA 5H8BA 3QKLA 2J5EA 2R3KA 4D5HA 4XRJA 5DHJA 4AE6A 5D11A 3NUXA 4C3RA 4M69A 4PL5A 4EH3A 3PIZA 4O0XA 4S34A 2ZOQA 2IJMA 4AZWA 3FDNA 2BDFA 3QKMA 2F49A 5CU6A 3CQWA 3SW4A 2XAOA 2NRUA 4IW0A 1SVGA 3C4FA 1FVRA 4AT4A 4N0SA 4JG8A 4MYGA 2JKKA 4DBXA 3A7IA 2VD5A 2Z7SA 2OKRA 2YHVA 4QTAA 3RTPA 1MQ4A 3UG1A 3UPZA 3A4PA 1OZ1A 5EQYA 4BDDA 4XV3A 1OKVA 1XMMA 4UMRA 3P86A 5HTIA 4YBKA 2UW9A 4KKEA 4DGOA 5HLPA 4ZZMA 5LVNA 3R21A 4TNBA 4W4VA 2XK3A 4GG7A 4AXDA 4R3RA 3F5XA 4F1TA 5IA3A 1WAKA 1UU7A 2JBPA 5EK7A 4FT7A 4QT1A 2HW6A 1GNGA 2X7FA 4O0TA 3I6UA 4DFZE 1ZWSA 3EZVA 3R6XA 5GINE 3VQHA 2PZPA 4M0ZA 3IDCA 5EHOA 3CE3A 4TL0A 3CGFA 1CMKE 4DFNA 5HVKA 4FIGA 1WCCA 3W0OA 3UG2A 4B0GA 2WTWA 3NLBA 2BKKA 3WBLA 5LMKA 3OHTA 3PJCA 5M55A 5BUEA 3HRBA 1H0VA 3G51A 2ONLC 4JXFA 4XUFA 3R7EA 3FI4A 4KKHA 5HKMA 2PUNA 3LIJA 2YLEA 5AADA 4CGAA 4JS8A 3D15A 4JOAA 4FTIA 3T3VA 4ASEA 5C26A 2DS1A 3MESA 4FKUA 4QMPA 1GZ8A 2R64A 1H1PA 2JIVA 2UW4A 2UW6A 5F9EA 2YM7A 3KVWA 5M07A 4RIYA 3E64A 2J5FA 4N70A 3VBXA 3ELJA 4FV8A 2X9EA 3BHTA 2PL0A 4IJPA 3T9IA 3AC8A 4FL2A 3EQCA 4HYUA 2BZJA 2R3LA 4FSZA 2J0LA 4O0UA 4E26A 5KMJA 4LOOA 1VJYA 3RI1A 4KD1A 5AIRA 4CFWA 4RX8A 3RK7A 2ZAZA 3TIYA 4C0TA 4G6OA 4QQ5A 5D12A 4RZVA 3R7OA 5A4TA 5AP6A 3WF9A 2I6LA 4YTFA 3IO7A 3WILA 4ENXA 3C51A 4E3CA 5E8TA 2G1TA 2UZOA 4RJ7A 2VWIA 4NWMA 4OUCA 4MQ1A 2W05A 2E9OA 1BKXA 3WF5A 2F9GA 3DT1A 3NNXA 5TOZA 1WBOA 3QTZA 2YISA 3VN9A 2ZYBA 3SA0A 4NYEA 4E4NA 5H3QA 4IFCA 4XP2A 5BX0A 4AOJA 3LFDA 5E9EA 5DA3A 2Z60A 3FQSA 2VTTA 4FOCA 4EH5A 5IA2A 5JK3A 3NUAA 4FKOA 4U9AA 3ET7A 4UY9A 4DLJA 1NVRA 4LYNA 2WTJA 4YJSA 4NT4A 3V3VA 3E93A 4MHAA 5EDQA 4AZFA 3AC1A 4MD8E 3LJ0A 5C4KA 1JNKA 3SQQA 4C02A 2J90A 5B7VA 5K5NA 4XEYA 1H25A 3O7LD 3L8VA 4ZTSA 4FIEA 2OZAB 4JT3A 4BIDA 4DE4A 3QFVA 3I1AA 3BI6A 5HD7A 1LR4A 4Q5EA 5CU3A 5TE0A 3QRJA 3RGFA 3MFUA 2PZ5A 3E92A 2C6OA 4C4GA 4AW0A 3U51A 3SC1A 3O8UA 2WNTA 4FZFB 4X0MA 4DH8A 4EYMA 1SNXA 4RMZA 1O6KA 4Y5HA 3RHXA 2XYNA 5CQUA 4BKYA 3IW4A 4EK8A 4HVIA 4GUBA 4PP7A 2VRXA 4Y85A 1G5SA 4EQCA 5KBRA 1DM2A 3WZEA 3PY1A 2UW7A 2CGWA 3GB2A 3QWJA 3KB7A 4CLIA 4QDVA 3GUBA 2HY81 3SX9A 4ZY4A 3Q53A 2C3LA 4J8NA 1Q8ZA 4V0GB 2OF4A 4Y8DA 3UOLA 4YO4A 2XALA 3RAWA 4K18A 4QYHA 3H9RA 2I0YA 2W1EA 3UVPA 4R3PA 2OZOA 1ZLTA 4E73A 5HICA 3H0ZA 5CF5A 3PWYA 2RG6A 3AC4A 3IOKA 1E9HA 4AOTA 4BI0A 3PLAE 2PVYA 4RZWA 5HO6A 2WMAA 4YZBA 3IGOA 4MF1A 3DDPA 3SVVA 2W5HA 2ITTA 3MB7A 3LLTA 3O8PA 2CGUA 3ETAA 3PP0A 4UALA 4TYIA 5JKGA 4O27B 4ASDA 4HPUE 4YLLA 2C6DA 3RJCA 3KF7A 4K2RA 1NXKA 3CPBA 3FL4A 3NVMB 3OFMA 3F5UA 4EONA 5E1SA 2QOQA 5CT0A 4ZJJA 3BEAA 2C4GA 3L9MA 2WO6A 3FSKA 2Z2WA 3TUBA 4XV9A 3PVWA 5TR6A 5HBJA 4ZOGA 2C6MA 4UWYA 3RCJA 4BDCA 3W2PA 3M1SA 4R5SA 2WMRA 3RK5A 4NM0A 5ANIA 2OI4X 1OPLA 5JGBA 4ZTRA 4JMQA 4GW8A 2B54A 4J8MA 3OW4A 3RBWA 4EH2A 4R78A 4JDIA 3BHVA 2GS6A 4W4YA 4DEEA 1OKWA 3FLSA 5M44A 2HK5A 1ZYCA 3VULA 1NVQA 3G0FA 1H28A 5CXZA 1Z57A 4EC8A 1VLRA 3LMGA 5J9LA 4DHFA 2H9VA 5K4IA 4TWNA 5GZ8A 4O7SA 2F7ZE 4QMMA 2E9VA 2C5YA 5ANGA 5KMKA 3O23A 3N4TA 4ASXA 4I3ZA 5A4LA 4EUUA 5DR9A 3KFAA 4CFVA 2GFCA 5L2SA 4CZTA 1VYWA 2JD5A 5EHLA 3RM6A 3MVMA 2Z02A 3QYWA 1L3RE 1W98A 2ZM1A 5A4QA 3NS9A 3QYZA 4U41A 2EXEA 2YACA 3WIGA 3L8PA 3RHKA 3A7HA 4YJVA 1KWPA 4OTQA 4FKQA 4TWPA 3V01A 3DNEA 5KO1A 3F3WA 3GQLA 3AGMA 3AC5A 3NSZA 4IB1A 4EHZA 3PXFA 1BLXA 2XK9A 2IVVA 4KSQA 5DVRA 3W0SA 4FIIA 3LFCA 3S2PA 3K5VA 3IK3A 4E5AX 4FSRA 4ITJA 3PE1A 4G3EA 5C4LA 5I5ZA 4FTNA 5A4CA 4OGRA 2BALA 4D2TA 3UIXA 2F2UA 3RNYA 1PXJA 5BQ0A 3R73A 1PXIA 5DYJA 1UNLA 3R1YA 4R8QA 1YW2A 4YJNA 3UOKA 4TWCA 1P4FA 1B6CB 2KULA 3OUNB 4HCTA 2R3HA 5BUJA 2W96B 1IR3A 3CQEA 2VTRA 2W1FA 3QA8A 3ZO3A 1UA2A 4MEDA 4XRLA 3DOGA 3HZTA 3KRXA 4G16A 4L53A 3QX2A 5JRQA 3TM0A 3GI3A 3V5LA 2O65A 3II5A 3RZBA 3DKOA 2X8EA 2V7OA 4JG7A 2V62A 4HCUA 4U8ZA 3VQUA 2V5QA 2O3PA 4K0YA 4MXZA 1OL5A 2VTQA 2PMLX 4UWBA 4WG5A 2X0QA 3NNVA 4R3CA 4PMMA 3TEIA 2XARA 3Q5IA 5IDNA 1A9UA 3HMIA 3TTIA 4F7NA 2OJGA 4DFLA 4YC6A 3LXLA 4UZHA 1REJA 2GNIA 2GQGA 2UVYA 4BDEA 3DK3A 2X81A 4QNAA 5HIBA 5IQHA 4QYYA 1LEZA 3UP7A 4PV0A 3QD4A 4CZYB 1WBSA 4I5MA 3EQGA 3KVXA 5E91A 2XAMA 1MRVA 2WOUA 3OBJA 2YCRA 4FKWA 4JDKA 3N4VA 3FEGA 3NCGA 3SAYA 1J7LA 4E20A 4WBBB 4G5JA 2ZFYA 2WTKC 1V0BA 2WGJA 5CEIA 5HQ0A 2VTAA 2CKEA 1H26A 2PUUA 1Z9XA 2GS7A 5DOSA 3U6JA 3ORIA 1JQHA 2XK4A 4I5HA 4RIOA 2WQOA 3LFFA 4USFA 2WU6A 4G34A 2XZSA 4IX5A 4QTDA 3FYKX 3E8DA 4E5WA 4O0RA 4FTRA 4FKTA 4QO9A 3DB8A 1T46A 3BIZA 3GU6A 3Q4ZA 4U0IA 1PXNA 4KABA 1H1SA 3E3PA 3KCFA 5EI6A 3PXQA 5EM6A 2OJ9A 4J96A 1G8AA 2BAKA 1PYXA 4FYNA 3SOAA 1ZZ2A 1W84A 3D0EA 3L9PA 4GVJA 1FINA 2Y4IB 4FSYA 4QP6A 1H08A 4FKSA 3S4QA 2QG5A 5J9YA 2JIIA 3HAMA 1PXPA 1ZOGA 4F65A 3KU2A 4IAKA 4GJ2A 3KREA 1OITA 3PRFA 4QQCA 4R6VA 1M2PA 3DLZA 2JC6A 4MAOA 4DEAA 5D1JA 4QP4A 3FMMA 3W18A 3BGQA 4P90A 4X6RA 3JXWA 4XG3A 3DAKA 4ZP5A 4YTIA 4MD7E 4O7YA 4JR3A 4XV2A 5AP2A 1UU8A 5JGDA 3TYKA 3LM0A 3W2CA 1E1XA 2ETRA 3BE2A 3RALA 3ZZWA 2WTVA 3OROA 4JQ8A 4FTCA 1XBAA 3DQXA 3TJDA 3RK9A 4AFEA 3WARA 2Q0BA 2YJRA 4FNZA 3FMEA 3SOCA 1O6LA 3VO3A 5CASA 1NW1A 5BMMA 4GVAA 3A8WA 3VF8A 4ZLYA 4F7JA 5J87A 4LUDA 3SG9A 5HTBA 4RQKA 1HOWA 3Q9XA 3RZFA 2JDOA 1JPAA 3NNWA 4BCNA 1XH8A 5GZAA 3TKUA 2FB8A 2R3RA 5HO7A 4GT4A 3AKLA 4EOIA 3HP5A 4NFNA 1ZYDA 2QOHA 4A06A 5BVFA 2WU7A 4ALUA 4XCUA 5HIEA 4RLKA 5D10A 4Y73A 3ZC5A 2B53A 2ZV7A 5IMXA 3I7CA 1XH4A 3VVHA 4ZZNA 4GU9A 1OL7A 5IQAA 3OT3A 2XNEA 2GCDA 4JRNA 2VO3A 1U59A 3AD4A 4LGDA 4XP3A 3REPA 3UQCA 1RDQE 4Q9SA 3A7FA 2BVAA 5AP7A 5JGAA 5KNJA 2XK8A 3PPJA 3QRIA 4P4CA 5AP4A 2RKUA 3ITZA 5KMMA 3RPOA 1ST0A 5EQEA 1P2AA 3VBWA 2IW6A 3TMOA 2ITWA