4ANBA

Crystal structures of human mek1 with carboxamide-based allosteric inhibitor xl518 (gdc-0973), or related analogs.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
282
structure length
282
Chain Sequence
MALGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDEMANEFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title Novel Carboxamide-Based Allosteric Mek Inhibitors: Discovery and Optimization Efforts Toward Xl518 (Gdc-0973)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 282
sequence length 282
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4anbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4anbA01
4JJRA 4JAJA 4O6EA 4UZHA 4IAIA 5IUIA 4MHAA 3SHEA 4J96A 2I0VA 4KWPA 4EH5A 4CKIA 5A4QA 5KE0A 1H25A 4MNFA 2FSMX 3HMPA 4EYMA 3RK7A 4H05A 3BHTA 2W9FB 4O27B 3F5XA 2GDOA 4EKLA 1J7IA 4DTBA 3AC2A 2YN8A 2WB8A 3OWKA 1WBPA 3NYXA 5DEWA 1KE8A 2ETRA 4QQTA 5DE2A 3CKWA 5DNRA 2F57A 3DAJA 2VTQA 2UW7A 3DXPA 4O7NA 4IWPA 1YXSA 4C57A 5HESA 3FC1X 2HCKA 4I5MA 5CT7A 2ITNA 3TACA 5G6VA 3Q4CA 4CFNA 3PJCA 5C4KA 4UXQA 3QC9A 4PQNA 1Q8ZA 2P3GX 4YNOA 2JFLA 4DE4A 2PE1A 4O7SA 4BDDA 5FEEA 3DDQA 5BVOA 5E8VA 4D58A 3V5WA 3UNZA 3OEZA 5I9XA 4LL5A 5EOBA 3MPTA 5AV2A 5LVNA 3U8WA 2EB3A 3LJ0A 3OHTA 4OTHA 5CVGA 3LM0A 4C36A 3V5QA 4CKJA 2UW4A 1CM8A 4ITIA 5D1JA 4DEIA 3D9VA 4Y5HA 1ZARA 3W2OA 5IA1A 3TUDA 4YO4A 4XG6A 4UX9A 4FKWA 4YZDA 5HLWA 3NR9A 4G1WA 2ETKA 3O7LB 4YURA 4N0SA 3DK6A 3DB8A 4QP8A 4U3YA 3OOGA 3EZVA 5F94A 4H1JA 5M08A 3FZTA 2AC3A 2OJIA 4O0XA 4IIRA 4CG9A 3HDNA 3V01A 4CTBA 4GKHA 2E9OA 1TQIA 2ERZE 4EQMA 4JLCA 3PY3A 5A4TA 4ZXTA 5EI8A 5KMNA 3AOXA 2C0OA 4JG7A 1P2AA 2R3KA 2JC6A 5FBNC 3T3UA 3NNUA 2C1BA 2WIHA 3VS6A 2H34A 4G34A 1BYGA 3HAMA 2X4ZA 3AMAA 3D5WA 3WI6A 3QD0A 2GTNA 2OGVA 4ORKA 1XH8A 3AXWA 4LV8A 4AZTA 3EKNA 4FV8A 1XH7A 3TDWA 1XWSA 3R1YA 5CU0A 3OOMA 5FQDC 1H08A 3VUDA 2X2MA 4APCA 4W4YA 3EN7A 4DGLC 2YABA 3ORIA 4NCTA 4QMOA 5AUZA 2YM7A 3RK9A 2P33A 1ZYLA 2LGCA 4AXAA 1PXMA 5M4CA 3BEAA 2JDRA 3QALE 4MKCA 3SGCA 3E8DA 3LJ2A 2QVSE 4X2NA 5GZ9A 2OBJA 1IA9A 2OG8A 4D0XA 3BBWA 1ZYDA 4Y46A 3VNTA 4O86A 5CXZA 3WF5A 5E8YA 3V5PA 5HLPA 3RK5A 3NUPA 3NCZA 1SVGA 4HGLA 3ZC5A 2I7QA 2QD9A 3QHWA 5EW8A 5FP5A 1PJKA 2JIIA 4E3CA 5E92A 5KMIA 4AW5A 3KXMA 4WNMA 3IKAA 4KUJA 4QMQA 3ZO3A 4OT6A 2BRNA 3LCOA 5AX3A 1KOBA 3UQFA 4JL9A 3LQ8A 3DKCA 3GU7A 3KMMA 3MH0A 2Z7SA 3QQGA 5I4NA 3PFQA 4HZRA 4ZJIA 3KRXA 3EFKA 4GVJA 4MCVA 3IDCA 1CKPA 2O8YA 3OC1A 2Q0BA 3ODZX 1WBWA 4FT0A 1B38A 2B4SB 4F09A 4FC0A 5HU9A 2WTCA 4M66A 5ETAA 3OF0A 3P1AA 4MH7A 3T9TA 3GCQA 4GT4A 2YHVA 5F1ZA 3Q6UA 5FTOA 1IEPA 2VZ6A 3LFQA 3LOKA 5AP4A 3BE2A 3CTQA 3SOAA 4DH1A 3JY9A 5C03A 3HMIA 4UWYA 5FXSA 5LQFA 5HE3A 2IVTA 4DGGA 4EUTA 4IDTA 5KMMA 4FEVA 4AZFA 4CXAA 2BRBA 4BCPA 4AW1A 3TN8A 4BDEA 4LOPA 4E5AX 4EH6A 1HOWA 3PRFA 3A4PA 3EQHA 2F7ZE 3DQWA 1BI8A 4MX9A 1JKKA 3I1AA 4UWCA 2W1ZA 3UPXA 3NX8A 3QF9A 4LGHA 2E9VA 3RHKA 4C4IA 4GL9A 2QO2A 1P4FA 4FNWA 4PPAA 5H8BA 1H1RA 3GC0A 5KMOA 4NTSA 4N6ZA 2ONLA 4QMWA 5EW3A 3Q3BA 4UMTA 3R1QA 3WE4A 1MUOA 5JFVA 4MXCA 5IMEA 4TKSA 2GNFA 4DH3A 4B8LA 1Q8YA 3HA6A 5E7RA 2BZJA 4NZWB 4N6YA 5KZIA 4ALUA 2VTHA 4RZVA 4YBKA 3DKOA 2J50A 4F0FA 4XP2A 3OUKA 3KC3A 3TI1A 2QR7A 1IR3A 2WTIA 4FOCA 5LARA 2VWXA 3R9HA 4XHKB 5IA0A 2C68A 3EQFA 4ZSLA 3C5IA 2BMCA 4QP1A 3EIDA 4FZ7A 3DLZA 3FXWA 4QP6A 2GNLA 3U9NA 2JKOA 2XS0A 3UDBA 3JXWA 3VWAA 5L8KA 4BCNA 2RSVA 2ZMDA 3LFFA 3QX4A 2XNBA 2YM6A 3VUIA 1I44A 3R1NA 2RG5A 4AACA 3RJCA 4OTPA 2DQ7X 1Z57A 3D15A 4PL4A 5E4HA 4QNAA 1IRKA 4RT7A 4M14A 4EK4A 1WZYA 3FHRA 4FSUA 1FPUA 5CLPA 4GRBA 3UGCA 1J1CA 4QMVA 4ZOGA 4TNBA 4IHPA 4YZ9A 3PPJA 3RCDA 4XX9A 1YI3A 3W10A 4EORA 4EOJA 4U3ZA 5LVMA 4EQCA 2XJ2A 1F3MC 3OCSA 4FUYA 3KULB 3LFNA 5EM8A 4A7CA 4AG8A 5FXQA 4DN5A 4LUDA 4S33A 5KMJA 3FY2A 4BL1A 3F5GA 5EYDA 3W2QA 4BDKA 5HTIA 3KULA 1Q61A 4GS6A 2JAMA 2R3IA 3OW4A 3DBFA 4U40A 4F9AA 1UWJA 5AX9A 3P78A 5LVPA 4RC3A 4JX3A 4XH6A 3D5UA 2X2LA 5DEYA 3RPOA 2HK5A 3ACJA 4C2VA 4DG0E 3PLAE 5FBOA 2PU8A 2HZ0A 4FT7A 3VRYA 3P79A 4O0TA 4FODA 5AP1A 3WE8A 4F1OA 3S00A 5GINE 4YZBA 3CGOA 5CAUA 2XRWA 5D7AA 2RG6A 5HCYA 3UE4A 3S2PA 5IISA 3P0MA 2CDZA 3I6UA 2CNUA 2EUFB 2FH9A 3I79A 3BE9A 2ITWA 3WZJA 2EVAA 5HX8A 2FB8A 3RVGA 3UYSA 1YI6A 3N9XA 4BIBA 1PHKA 3PIXA 2XK8A 4GIHA 4JI9A 4ANNA 3OUNB 3BU6A 4YJUA 3UOHA 3QTWA 3FZPA 4NFNA 3ORLA 5AR7A 5FXRA 4EOLA 2IZSA 2P0CA 4O96A 2XK3A 4J71A 4OTFA 3CY2A 4R3PA 3PG3A 3WF7A 3GQLA 3FYJX 3QQHA 4I6FA 4EWQA 3PG1A 2BDFA 2CSNA 4MQ2A 3FLYA 4S30A 4ONAA 1Q97A 1UU7A 2C5OA 2V55A 3QWJA 4JBVA 4D5HA 3CPCA 3QA8A 4KBCA 3JUHA 3E7VA 3W8QA 3U6IA 2FGIA 1NXKA 3A7HA 2R2PA 4ZY6A 2GPHA 4MF0A 1FVRA 3POZA 4EH9A 4FA2A 2YLFA 4QP2A 1GJOA 4I41A 4RFMA 2XIRA 3FI4A 3OXIA 4YGAA 3ID6C 4RX9A 4ZLYA 3TG1A 3BCEA 3TUCA 3I0QA 3P7CA 2HXLA 4B6LA 3QZGA 3MH2A 3OFMA 3GOPA 5HIDA 2X4FA 4TYHB 3OTVA 4BWKA 5JK3A 2B0QA 2QU6A 2XP2A 4AT4A 2PMNX 4RIOA 4BDIA 3QQJA 2H6DA 2X1NA 4ENYA 1WMKA 3R8VA 3VC4A 4LV5A 2C6DA 4TYHA 2YM4A 4GW8A 2BZKB 2QOKA 2CGUA 1ZY4A 3O96A 4C62A 5TE0A 3UZPA 2BROA 4QD6A 4XV1A 3WZUA 1O6KA 4AZVA 4F99A 3FMHA 3LLTA 3PDTA 2Z02A 4A06A 4XBRA 4G5PA 4IZAA 1H07A 2V0DA 1GZ8A 3I0OA 5AADA 4WG4A 2PVMA 4Z3VA 5IEVA 1PXNA 5LXMA 5ANJA 4L8MA 4CKRA 1BL7A 3DV3A 2GS7A 3W33A 3ETAA 4U41A 2HZ4A 5HNGA 4CD0A 2ITQA 4HYIA 4KS8A 3KEXA 5CEMA 3ITZA 5FRIA 4H3QA 4E8AA 4C38A 3R83A 2UW3A 3LXNA 4EZ7A 5G1XA 5HG5A 5C8KA 2XNPA 3SVVA 4JXFA 4YC3A 3WZDA 4O7ZA 5IA2A 4H3BA 4L00A 4C8BA 3UIUA 3Q5ZA 4ITJA 4EEVA 2HW6A 3QTSA 4AGWA 3L9NA 3P86A 2ZM3A 3HLLA 4IX4A 1O6YA 5AM7A 3ZYAA 2RF9A 2ZV2A 1CDKA 3CY3A 2QOOA 2YIRA 4BYIA 3CBLA 2PY3A 5KBRA 4YJOA 4UZDA 2A1AB 5DOSA 2PVRA 3L8VA 3QL8A 5B2KA 3A8WA 2VV9A 3U9CA 1JSUA 3EQIA 4RC2A 5HNIX 5AMNA 3KRWA 5D7VA 1PRYA 5TKDA 5AP3A 3W1FA 1S9IA 4FTOA 5TO8A 4FKUA 3H0ZA 4LFIA 4HVDA 5K0XA 3Q4TA 2YCQA 1XO2B 1JVPP 3QBNA 5EDRA 4L01A 2XKEA 4FKVA 4FICA 5B0XA 2GMXA 2WU7A 3R8UA 3Q6WA 5DRBA 5IQCA 4FTAA 4HGSA 3QUDA 4L52A 4BBEA 1IG1A 2F7EE 4MBJA 3LW0A 3R00A 4C34A 5LVLA 5J7HA 5JH6A 5BQ0A 4QNYA 1GZKA 4FZ6A 5HE1A 4IB3A 4AW0A 3ZDIA 4CCUA 4GJ3A 3GFEA 2VO7A 3MH1A 3QTXA 3V04A 3VUTA 4A9TA 4L3PA 4U44A 4A4LA 2NPQA 3PY1A 4L42A 2F2CB 4MF1A 4YC8A 4BCMA 3NS9A 3BHHA 3IDBA 2EXEA 4G6LA 4IWOA 4J1RA 2YCFA 5LCJA 2EWAA 5CNNA 1L8TA 2I0EA 5FD2A 3UIXA 2IZUA 2OIQA 4HGTA 4X21A 3SXRA 1M2QA 2AYPA 4FV3A 1E1VA 2OJ9A 1JOWB 3BGZA 2XBAA 3F3ZA 3P5KA 3HV3A 4YJTA 5L8JA 5F4NA 4FSYA 4H58A 3ZUUA 4JQEA 3AT4A 3G2FA 2FVDA 2OIBA 2BR1A 4PTCA 4BDHA 5JGBA 4RG0A 4RWJA 4GJ2A 2QU5A 4RFZA 2WXVA 3VF9A 2WTJA 2PZYA 3ALOA 3VUKA 2F7XE 3A2CA 3AT3A 3OBGA 3COMA 1U5QA 3CJGA 4MNEB 1XJDA 4B4LA 3DNEA 4MVFA 4L44A 2H9VA 3QCXA 1YI4A 3PXKA 5HE2A 2G15A 3R2BA 2PZPA 4F1MA 3FZOA 4C7TA 4MD7E 2Q0NA 4I5PA 3MGYA 5J1WA 1YDRE 2PUNA 3KK8A 3PJ2A 2X81A 2BHHA 2IZTA 2VTMA 4DF3A 5JFSA 4DAWA 1AGWA 1H27A 3EN6A 4AA4A 4R7BA 5KKRC 2C1AA 3DS6A 4PP9A 4YP8A 4AZWA 4UV0A 2YDKA 5E8SA 2CKQA 2R7IA 3FQSA 4B9DA 3QXPA 4DLJA 4NL0A 2IW6A 1FINA 3R7IA 1YOMA 3GC9A 3BHYA 2PVKA 1OIYA 1JNKA 4FIFA 4X7QA 3NVKI 3QLGA 4BTKA 3EYGA 3VJOA 5JN2A 2RKUA 4YLLA 2QG7A 3RZFA 2WQOA 3D2IA 3Q2JA 1FVTA 1WBVA 3C5UA 4NJ3A 2WOUA 1OKVA 3WZKA 4TWCA 4Z9LA 3TUBA 3GCUA 4R3RA 5KKRB 5J5SA 5D9HA 1UNGA 5DT0A 3GI3A 5IUGA 3LQ5A 4WOVA 2PHKA 3NNVA 3A7JA 4W4VA 2Y0AA 3KRLA 4M3QA 2EXMA 4E6CA 3E93A 2QKWB 2PZIA 3GEQA 3C4XA 2IWIA 3MH3A 3ZO2A 4IZ7A 4ZY4A 4ZK5A 3VBVA 3OROA 3HV5A 4IJPA 4U0IA 5FTQA 3VO3A 5BVDA 5M51A 4BCGA 5HICA 2WQBA 3I81A 5L2WA 3UZRA 1U4DA 4FYNA 3VQUA 2CNQA 2VWIA 3EHAA 1XHAA 3NUXA 4TWPA 5HD7A 3SXSA 2C6IA 2W4OA 3Q32A 4C37A 3TNHA 4FUXA 4AF3A 3ZLWA 1X8BA 3KXGA 2W7XA 4FEQA 3ZLYA 3TWJA 3QYWA 2ZDTA 1XH9A 2O3PA 5I5ZA 5BYLA 3ZC6A 5DYJA 5IQGA 5E91A 4FE2A 3EN9A 3E3PA 4AP7A 4O84A 2A4LA 2PUIA 4ZTNA 2A0CX 5DRDA 4F63A 3LMIA 4IX6A 4WRGA 3F3WA 4AZEA 4RIYB 5L6PA 2GHMA 3E7OA 4EOIA 1MQ4A 4P4CA 5L2QA 1RQQA 4MXOA 4RC4A 2W1FA 3SOCA 1PYEA 2HENA 3BBTB 3OT8A 2ZJWA 2HZIA 4LI5A 5CZHA 4D5KA 3DZQA 3R71A 4TL0A 2XNNA 3BLQA 3QTRA 4M0ZA 2ITPA 2R3HA 1CMKE 3CKXA 3R28A 4M69B 2AUHA 3UNJA 4CTCA 5AUYA 3RNYA 2C3JA 4BCKA 2QI8A 5ETCA 2WMBA 3G51A 3AC3A 1IAHA 1VJYA 3C0GA 4GUBA 3IQ7A 2YZLA 4RLKA 1SVEA 1OITA 2OH4A 3WZEA 4BIEA 2XCHA 2W4JA 4J8MA 3G90X 4CT1A 2R5TA 5LOHA 1WBNA 2BUJA 1Q4LA 5CANA 4U42A 1UA2A 1R3CA 3SC1A 1S9JA 3G0FA 2W99B 3FLWA 5E1EA 3KGAA 4W4WA 1Z9XA 3ZO1A 4DH7A 4O1PA 5AEPA 5EKOA 5AV4A 1JWHA 1OUYA 4A9RA 3QTQA 5CSHA 1GOLA 2WOTA 2VGPA 2HY81 3U54A 1RW8A 5EK7A 1Y6BA 4ACMA 5A9UA 3VVHA 4NJDA 4R5SA 3PIYA 2HXQA 3QC4A 3MTFA 4JIKA 4D4SA 3OWPA 5EI2A 4O1OA 4XBUA 4BIDA 2X8DA 5AP6A 4C3FA 4G3FA 2QOHA 2JDSA 3TM0A 3H30A 1ERKA 5DWRA 4AW2A 3D83A 4L3LA 1B6CB 3ZO4A 2DWBA 5IDNA 3BKBA 1UV5A 5H3QA 2VNYA 4CFXA 4JDHA 4OBQA 5IEYA 1PXOA 5AR8A 3NUUA 3NIEA 3UZTA 1T46A 4E26A 2G01A 4AFEA 3R9OA 1U54B 3MYGA 4K0YA 1BL6A 4PDSA 5AUWA 5L3AA 3OCGA 1OBGA 3GVUA 5JFXA 2ESMA 4N4SA 2JKMA 3HA8A 4IBMA 2Z7LA 4CFWA 5GNKA 3DGKA 2YACA 1VEBA 1NT2A 2BDWA 3A61A 3FI3A 3FYKX 3F66A 3MVLA 4NKSA 3UOLA 4EONA 2VN9A 5I9WA 2BVAA 4X2KA 4EL9A 1WBTA 3MSSA 3SRVB 3ZSHA 3KCFA 4AE6A 4GSBA 4J52A 5E8TA 4BI0A 1UNLA 4MTAA 2R64A 4ZMEA 3TJCA 5GHVA 2OZOA 2HWPA 4O0RA 2JDTA 2Z60A 4GH2A 4KKHA 2R7BA 3RCJA 1DI9A 5HIBA 4DH5A 3SRVA 1LP4A 1J7LA 2BRGA 3NNWA 3SAYA 4QYGA 3ZRLA 5CQWA 3FE3A 4ASDA 4UMPA 5CEKA 5E9EA 1ATPE 4IADA 5FM2A 2HZNA 3IDPA 3Q9WA 4A07A 2UZDA 2EB2A 3FL5A 1APME 2JBOA 2R0UA 2C3KA 2FSTX 2R9SA 1PW2A 4IWQA 5HI2A 5HE0A 1KWPA 5HZNA 1PXKA 3HEGA 2C6KA 4R3CA 3GFWA 4ZP5A 3ZM4A 4F7SA 3VS2A 5LVOA 1SNXA 3KF7A 3QQFA 1CKIA 2VTTA 3CQUA 5J87A 4P2KA 3U87A 2VO0A 1KE7A 2AC5A 5ANKA 4NSTA 1H28A 2JKKA 3IK3A 1MRYA 3IG7A 3ZS5A 4AS0A 4DT9A 4NH1A 2R3JA 1GAGA 2V7OA 3VQHA 4YHJA 5CNOA 3C7QA 4LM5A 4FTLA 3TJDA 3TIYA 1OGUA 2X7OA 3MA3A 3CSVA 5A6OA 4DFNA 3R0TA 4R1VA 5CU4A 3NW6A 4E93A 3F6XA 4YTHA 2J0LA 2OXYA 4FNZA 2WNTA 1Q41A 2RIOA 3WF9A 2VX1A 2W17A 4OTDA 4G9RA 1JPAA 1V0PA 4FIGA 4FIHA 4AA5A 3ZMMA 4WNOA 3PY0A 4G17A 2XNGA 3MFUA 5AAFA 3HV6A 3G5DA 4GEOA 4PMTA 4QPSA 2BPMA 3VIDA 3VUMA 4GU9A 5K4IA 4FSRA 4BC6A 2WMQA 3DJ5A 2OW3A 1GIHA 3ACKA 3VHEA 3RM6A 3C0HA 2PE0A 5L2IA 4FNXA 5KBQA 2B9FA 5AIRA 2WMAA 4QTEA 5FM3A 3QHRA 3R04A 4FKSA 1YRPA 3WOWA 5CEOA 5HTBA 3ZFXA 3DZOA 4ITHA 3BI6A 2WEVA 1REKA 4IXPA 1QPEA 4ZSGA 3BLHA 4U79A 3G15A 2QO7A 3DXQA 3DAEA 2VTOA 4QP3A 5T6KA 1OL6A 4FT9A 3ZSIA 4BKZA 3C4CA 4I5HA 4ACGA 2IVSA 3LIJA 5AP5A 3UOKA 4F6WA 4EHGA 4WNKA 3N4VA 3A7IA 3KVWA 1NW1A 2FA2A 5KMLA 1OB3A 3VBQA 4NCTC 3II5A 4IAFA 4DFXE 4IM3A 1GIIA 1OL2A 2X2KA 5IA5A 4D1SA 2VX3A 4WKQA 4B7TA 3NIZA 3KXZA 5TF9A 5HGIA 5CXHA 5EYKA 5HO7A 4K11A 4X6QC 1G5SA 3TKHA 3IW8A 3IGGA 5DR6A 3TXOA 2QO9A 1BKXA 5J9YA 2CPKE 4H36A 4BFMA 3CE3A 4Q9SA 1NA7A 4ANMA 3LXLA 1P5EA 2Z7RA 3EQCA 3IS5A 5D12A 2LAVA 4C4FA 4TNDA 2J51A 5M4UA 1MP8A 3EMGA 4I6BA 4OTQA 3K3JA 3ZFYA 4MEDA 5M06A 3TEIA 2WMRA 3M42A 2PMOX 4UMQA 3SV0A 3QXOA 4DEHA 5IQFA 4C02A 3LCSA 1OVEA 2J2IB 2JD5A 4FV0A 3V3VA 1R39A 3EQRA 4FTJA 5K9IA 5JSMA 3E3BX 4E5BA 2BIYA 3O50A 4AGUA 2C6EA 2ITUA 1VYZA 2Z7QA 3MBLA 4D28A 2OJJA 2W05A 4F1TA 4GKIA 3A8XA 3IO7A 3LJ1A 5AAEA 4JG6A 5EDQA 3LVPA 2WMWA 4ERKA 4N57A 3DJ7A 4CFUA 5EOLA 3SW4A 2QONA 2C0TA 4IMYA 3CD3A 3TKIA 4EK6A 3R6XA 2VWYA 4TZRA 3E8CA 4QO9A 3U51A 5K5NA 4RQKA 4FL1A 4UALA 1PXPA 5AV1A 2PSQA 4KIKA 3IW4A 4OGRA 3JPVA 3R8LA 4FF8A 4WA9A 3UQCA 4TRLA 3THBA 3GC7A 1DM2A 1H1WA 1OL1A 2R3GA 3COKA 4PL3A 2JAVA 3LFSA 5BUEA 5EQYA 3LE6A 3QCQA 4FVRA 3S4QA 1BLXA 3DAKA 1PXJA 2GNGA 5I9UA 3TDVA 5FDXA 4FTKA 5HO6A 4USFA 1R0PA 2WPAA 2OF2A 2X7GA 3L8PA 4IFCA 5C26A 4BY9E 4I4EA 5GJFA 4LQMA 1H1SA 5DMZA 2ONLC 1J1BA 4IWDA 4YJSA 2VWVA 3V5TA 3HRCA 4CEGA 3I6WA 4FTNA 2BALA 4U81A 2H8HA 3Q9YA 2GHLA 1SVHA 3IW6A 3ORNA 4IANA 3R21A 4IVBA 3UQGA 2QR8A 3KVXA 3AMYA 5FTGA 2X8EA 3KN5A 3QYZA 1V1KA 3GC8A 4PMSA 4AT5A 4CRLA 3HMMA 2J90A 5AV3A 3H4JA 3BU3A 3QRIA 1T45A 4HJOA 3DJ6A 4UYNA 2WD1A 4JNWA 3R63A 4TY1A 4KBKA 2XM8A 4DG3E 2RFEA 5ICPA 2ZVAA 3WF6A 5D11A 3LFDA 4DFZE 4R78A 2X6DA 3A7FA 4K18A 3AQVA 4OTRA 4PV0A 2B9HA 3QTUA 3IOPA 3NEWA 4I94A 3UO6A 3ZXTA 4ANQA 4FV5A 4M12A 1M2RA 4K6ZA 3P4KA 3LQ3A 3NAYA 1PMUA 4DT8A 2UZBA 2YIXA 4HZSA 3NNXA 4PTEA 4BICA 2XH5A 4NM7A 4C4EA 2VTAA 5AUUA 4IZYA 1WVYA 3NYOA 4BF2A 4QOXA 1ZOEA 4XOZA 4JDKA 4NT4A 3MJ2A 3DTWA 4AFJA 2WMTA 4JAIA 5CENA 3UO4A 2EXCX 2UW8A 2O64A 2I1MA 2JEDA 4V04A 3ZONA 2R3MA 3BYUA 4LUEA 4L68A 5CT0A 5DH3A 2CKPA 4FTCA 5M55A 4KIOA 3FL4A 5AA8A 2CGWA 2GQRA 5CSXA 1JQHA 3GCVA 4G3EA 5CY3A 3IGOA 5B7VA 4FT5A 1VYWA 4YLKA 5C27A 4EH3A 2PPQA 2BZHB 2BAKA 4YNEA 4GUEA 4U97A 5H8GA 3K54A 4CMOA 4RA5A 4Z7HA 4DFUA 1GY3A 4QMUA 3WILA 4EHZA 3EYHA 2WTDA 3HX4A 4I6QA 4IDVA 3FKLA 5C8MA 5C8NA 2CHLA 2XIKA 3KFAA 1PKDA 4MXAA 1OPJA 2C69A 4W4XA 3O7LD 4MD8E 2Y6OA 1JKSA 2YWVA 4GFMA 2V5QA 5FG8A 4FV4A 3MFSA 3TV4A 3FZ1A 4DGNA 3GBZA 2WMVA 3DU8A 4KRCA 4PUZA 2XBJA 1LEZA 3HRBA 4ID7A 5IPJA 4U9AA 4MAOA 3AC5A 4FV7A 2BCJA 3LZBA 4I5CA 3NVMB 3ORMA 2YERA 3F5PA 3TZ8A 1ZZ2A 2QODA 4BHZA 4QQJA 3PA5A 4RMZA 5CTPA 1FVVA 5E8WA 3QRUA 3TCPA 4E20A 2IZRA 4O7TA 4RA4A 5ANEA 2ZM1A 3KKVA 4AT3A 2FO0A 3BWJA 5JQ8A 2R3RA 4R5YA 3ZH8A 3NW7A 4OLIA 3VS7A 4CCBA 4O0UA 2YCSA 3I4BA 5HVYA 2W1DA 3FXXA 4H1MA 5EKNA 4CT2A 1BMKA 3GP0A 3HP5A 3UBDA 2CCHA 3R7YA 1F5QA 4IC8A 3COHA 4RWKA 1G8AA 1YWRA 4YHTA 4U5JA 4CMTA 1QPCA 1SZMA 3QA0A 4NU1A 5BX0A 3BELA 2NP8A 3S0OA 4USEA 3BU5A 4ACHA 2BTSA 5CASA 3RP9A 5GIOE 4AX8A 3TTJA 4FGBA 1URCA 4I1ZA 3FMEA 5HBHA 5IA4A 3G9LX 4NFMA 3UIBA 2XIYA 5CI7A 1WBOA 4BWPA 3D5VA 4R1YA 1G3NA 1FMKA 2XIZA 4O82A 4ZZOA 4YZMA 2JDVA 3SLSA 4FKTA 3C51A 3DOGA 1TKIA 2YAKA 5CYIA 2W5BA 4FEXA 2GCDA 2P55A 2XMYA 5LJJA 4D2PA 5HQ0A 3BLRA 4G9CA 5DN3A 4IQ6A 1R0EA 2WIPA 2VU3A 3ORPA 4D4YA 2A19B 3I5NA 4EKKA 1O6LA 4CLJA 4U6RA 4BI2A 3EQDA 3PPZA 4J7BA 4ZLZA 3M1SA 4ZTSA 3BX5A 3P08A 3TZMA 3WIKA 4FTTA 1DAWA 4KKEA 3AGMA 1PXLA 3L9LA 1Z5MA 3FMDA 3I5ZA 4M15A 3SG8A 3QD3A 4I3ZA 5JRSA 3V5LA 1J91A 5BMSA 2XA4A 4A9UA 5HD4A 5J9ZA 3Q2MA 4D2TA 3ZRMA 3GENA 2F2UA 4YC6A 4EZ5A 3CC6A 3REPA 3ZRKA 1QMZA 4D9TA 4R77A 5L6OA 5CF8A 3E88A 3BV3A 4Q9ZA 2NRUA 5CAPA 3O8UA 5HBJA 3NSZA 5HORA 4XRJA 2VO6A 4OTIA 2X6EA 5M53A 5CSPA 4IE9A 3PJ3A 4RIXB 4NUSA 2VTJA 1F0QA 3KRJA 3W32A 4D2RA 4ZAUA 2YIWA 4EH8A 4NKAA 2YCRA 4QTBA 2F9GA 4PTGA 5K3YA 4AOTA 3QGWA 4RIXA 1STCE 3MY5A 3D7TA 3NPCA 4YLJA 5IKWA 4BB4A 4CV8A 3TV6A 1PYXA 4RJ7A 5BUJA 1YHVA 3F82A 3FHIA 4LYNA 5BMMA 1W82A 3VJNA 1ZMVA 1XQZA 4FOBA 4DTKA 4DFLA 4DCAA 3TIZA 3VW8A 1PXIA 5A6NA 4KABA 4D1ZA 4XS2A 4G16A 4MXXA 5LWNA 3H9RA 5EM7A 1J7UA 3HAVA 3H10A 3DFCB 3R2YA 4BCOA 4FSMA 5KX8A 1OI9A 3H3CA 4IFGA 4ERWA 5JEBA 2HYYA 1GNGA 4UXLA 3R8MA 5LMAA 4F0GA 2C4GA 4FL3A 5IQAA 2JKQA 3R7EA 2NRYA 2HIWA 1Q24A 3JS2A 3QTZA 4ANBA 2QOBA 4NM3A 2VTRA 4U45A 4II5A 1DS5A 3QQKA 3VS1A 4NK9A 5J7BA 1ZY5A 4RJ5A 3OWLA 2XKFA 4XP3A 3E87A 2VUWA 2YM8A 3IOKA 2YM5A 5JFWA 5M57A 2R4BA 5AR3A 4ARKA 4LOOA 2WZJA 2WQEA 4YR8A 2QOCA 3ERKA 2O0UA 4PL5A 1ZAOA 3UIMA 2XM9A 1MQBA 4CV9A 5E8UA 4EZ3A 2XYUA 5DR9A 3QX2A 4F0IA 3GXLA 4I6HA 3L1SA 3ORTA 2BKKA 3R30A 5EYCA 3CLYA 4EQUA 3ZM9A 2BRHA 4O2ZA 4QPAA 3EFLA 2XYNA 3QRTA 4JDIA 2HW7A 4HPUE 4ZZNA 4XG9A 5AP0A 4BCHA 3GCPA 5FEDA 2EU9A 1KE9A 2VGOA 4QMYA 4RJ3A 3ZZWA 2GNHA 3ALNA 3MS9A 3PWDA 4DYMA 2XUUA 2GS2A 2CLXA 1CTPE 3FMMA 2R3QA 1E9HA 4YJPA 1RDQE 4BRXA 1Y57A 4GFGA 3FPMA 5AM6A 4EH7A 5CWZA 4FSWA 1W84A 2UZNA 2PK9A 5D41A 4BHNA 4BZDA 3IECA 3KK9A 4CSVA 4EJNA 4HW7A 3JR1A 4D1XA 4TYJA 2J0MB 3RWPA 3CGFA 3C4FA 2A2AA 5I3OA 3KRRA 3OY3A 4E6QA 5GZAA 3VF8A 4BI1A 1OIUA 3PP1A 4FL2A 1H00A 3L8XA 4I22A 2B9JA 4G31A 4BGHA 2O63A 5HU3A 3E63A 2UZLA 3KA0A 1I09A 1XH4A 4RLLA 3PP0A 4JT3A 4RFYA 4FKPA 4O0SA 4DTAA 3ZFMA 3IONA 3QAME 3GUBA 4FV1A 4L9IA 4PWNA 3Q4UA 5BYZA 2P4IA 2J0KA 4TYGA 3OCBA 4B0GA 4ALWA 3EL8A 3FZRA 4FTMA 3PXZA 4MWHA 1H4LA 3OXTA 5JQ5A 2GFCA 1DI8A 2G2IA 2UW9A 4UWBA 4XMOA 5E8ZA 2VWBA 5BVNA 5LWMA 2W4KA 4OTGA 4EJ7A 1J3HA 4Y5QA 5JMSA 2ITTA 3HUBA 3M2WA 2VAGA 4HCVA 3V51A 1PF8A 2ITVA 3DK3A 3MVHA 3BYOA 5JT2A 1YDTE 3RPSA 3AC1A 1UKIA 1OPKA 4IACA 4IVAA 3POOA 2PYWA 3G33A 4EK3A 2YZAA 3BQCA 5CU3A 2QNJA 5CQUA 3R7GA 4G3DA 3MIYA 1K2PA 4KIPA 2W1HA 4AN2A 4I20A 4M68A 3AMBA 4L6QA 4RBLA 4NM5A 3NUYA 4FG9A 4GIIA 5HG8A 3W18A 4Z7GA 4APPA 4FTIA 3TNPC 5IH6A 5FP6A 3UMXA 3ZBFA 2YJRA 3DDPA 2RGPA 5IEXA 1M7QA 2C6LA 5M07A 4FYOA 4S32A 5HG7A 3CS9A 5J95A 3E8EA 4CZYB 2GSFA 2C3LA 3PPKA 4V0GB 4WG5A 3HECA 3QZFA 2GHGA 1FMOE 3ET7A 2CNVA 4BDFA 4DBNA 4WUNA 2KULA 4NW6A 4V0GA 2UUEA 4YBJA 3QKKA 4F08A 4AUAA 3H9FA 4QP4A 3LKMA 5ANDA 2O65A 1ZYJA 4O83A 5KHXA 4NYEA 3LM5A 5BUIA 3DCVA 4BBFA 4FIEA 4C58A 4ZS0A 4O22A 5AIKA 3LHJA 1ZMUA 3UG1A 3AD5A 4EHVA 3HVCA 1Q3DA 2IO6A 5I0BA 2GQSA 4R6VA 5H8EA 4QPMA 4ZJVA 4JS8A 3GQIA 4KAOA 5JGAA 3NGAA 5KUPA 5FDPA 3ZU7A 2BIKB 3AC4A 5ETIA 5FGKA 4EH4A 5KNJA 2YA9A 3RPRA 3QQUA 4S31A 3I7BA 3QGYA 2E9NA 4PDPA 4AAAA 4XCUA 4YJVA 5A46A 3U6JA 1TQPA 3AD4A 3HYHA 4G3GA 5HCZA 4F7LA 1M17A 1OUKA 3SG9A 5CF4A 4KNBA 4BDAA 1OZ1A 1KSWA 4FZDB 3F69A 4IAKA 3O17A 4Y8DA 3C4EA 1JKTA 1E1XA 4G3CA 3VBWA 5DVRA 3ZZEA 3LFAA 4DHFA 4QMLA 4EC9A 5AWMA 4LRKA 2WELA 3CP9A 5DT4A 4ZJJA 5KCVA 3CR0A 2OZAA 3ZEPA 4ZMFA 2JIVA 2WU6A 2XJ1A 5ANGA 5KHWA 4NEUA 4FGRA 2X0GA 1P14A 3EWHA 4FV6A 4GCJA 5C9CA 2QG5A 1H24A 1XBAA 3BWFA 2ERKA 4WSQA 2R3LA 4QMTA 1XR1A 2ZB1A 4RVMA 3V8SA 3FEGA 1OIQA 3O8TA 1FGIA 1OM1A 4L7SA 4FKOA 4YPSA 3FLZA 3FPQA 1H26A 4B99A 4N70A 5AJQA 3F7WA 4WIHA 5HO8A 4H3PA 4C61A 3BZ3A 1UWHA 3VHKA 3R8ZA 3PYYA 3K5VA 1K9AA 4C4GA 3R8PA 5L2SA 4FG8A 4WHZA 4OTWA 2NNWB 2BAJA 3HDMA 4Y83A 3RAWA 2CKEA 3RI1A 4JRVA 2C5VA 3Q52A 2O5KA 1L3RE 3H0YA 3O71A 3W2CA 4EOPA 3U55A 5TOZA 2GNIA 2WGJA 2J0JA 3QWKA 5AR4A 4EI4A 1YVJA 1YWNA 3KCKA 3VUHA 5C4LA 3PA3A 2J5EA 5I3RA 4P5QA 3DK7A 1ZLTA 5D10A 1YW2A 2HWOA 2PVNA 4D2SA 1OL5A 3RAIA 1O9UA 4EK8A 3R7OA 3PE1A 1UU9A 4M8TA 3V5JA 5HTCA 4PDYA 5CU6A 3P9JA 5IQDA 3NLBA 4A4OA 4IAYA 4J99A 3OEFX 2CN8A 3HGKA 2Y9QA 3EFJA 3E8NA 3EQBA 2ZV8A 4I93A 5HCXA 2CJMA 4E7WA 3QU0A 4GV1A 2NO3A 3BYMA 4W8EA 3JVRA 5CEIA 1URWA 3PA4A 2XKDA 2C6OA 2UW0A 3ZBXA 2G2HA 4HVSA 3JVSA 4IW0A 4AGCA 2YISA 5AUVA 2REIA 2WEIA 1YXVA 3IPHA 3MV5A 4E6AA 5DT3A 1HCKA 2GTMA 5DIAA 1YHSA 3PJ1A 4ASXA 1TVOA 2ZOQA 5CF6A 4TT7A 1WBSA 2G2FA 2W9ZB 3FMNA 4UBAA 1YXTA 4Q2AA 2UZWE 2XJ0A 3MI9A 5AUXA 1GZNA 2R3NA 4FMQA 1OKYA 5IU2A 1IAJA 3KU2A 3OWJA 4I0SA 4LRMA 2OF4A 5M09A 4BDGA 3RM7A 3NWWA 4FSZA 4IEBA 5HHWA 3NMUF 3F2RA 3NYNA 3UODA 4EOSA 3UP7A 4YSMA 2C3IB 2VX0A 4AE9A 1PMEA 3CTJA 3EQPA 3FKNA 3ULIA 2RL5A 3VULA 2J9MA 5CVFA 5CAVA 2C0IA 4BCIA 5IH4A 2B7AA 3NDMA 5DG5A 4MXYA 4JBOA 2VNWA 1LUFA 5IZFA 5HNBA 3R7VA 5LMKC 3MVJA 4QTCA 3TNWA 4LOQA 2DYLA 2XRUA 3O8PA 5CI6A 3ZCLA 3D0EA 4IZ5A 2B54A 2XF0A 3TKUA 4ZTRA 5HEZA 3E64A 3MW1A 3RWQA 4AWIA 4PNIA 2OI4X 3RZBA 3O51A 3CCNA 5A54A 1U59A 4BCQA 2XNMA 2PVJA 3ORXA 4IVDA 3QUPA 3DBQA 3ORKA 1UU3A 3IW5A 5HBEA 3GU6A 4F4PA 2JBPA 4FEWA 4FSTA 3EB0A 1UU8A 4FKQA 4W9XA 3ROYA 4TXCA 5ANOA 1YDSE 3NAXA 3F61A 4CLIA 2Y4IC 4TYEA 2PUUA 4G6NA 4J53A 4ZSJA 3UMWA 3IW7A 4BDJA 4QQCA 5EHOA 2QOFA 3QKLA 2XK9A 4QYHA 5H2UA 1REJA 4ZIMA 3ROCA 4UB7A 4DEEA 2HAKA 3UOJA 3MN3A 2I40A 4CRSA 5LMKA 4GT5A 2OH0E 4JQ8A 4PF4A 1KV1A 4WO5A 2IW8A 2CLQA 5M4FA 1FBNA 2OLCA 4JG8A 2OWBA 4RWLA 5F9EA 1Y6AA 5I9ZA 3EH9A 3ELJA 4HPTE 1TQMA 4QYEA 2Z2WA 3WARA 2UZOA 2HELA 2JGZA 4AOIA 3VBYA 4BN1A 3ZHPC 3A60A 2E9PA 3NUSA 4WRSA 2JDOA 3RHXA 4Z55A 4I4FA 4KSQA 2XNEA 4PRJA 1Q8UA 2Y4IB 3DBDA 2IVUA 3WIGA 3CQEA 4E4NA 4I0RA 3BYVA 2RFDA 5AR2A 4FIJA 4AOJA 4WT6A 3PVGA 3MWUA 3LCDA 4CVAA 2I0HA 3ZSGA 5EQPA 4U80A 4YTCA 5IMXA 4WBBB 4RPVA 5HOAA 5KO1A 5JZNA 4FIIA 1Q8TA 5A4EA 2FYSA 4TWNA 3LMGA 3A4OX 2VTNA 2OFUA 5TT7A 3BV2A 2W1CA 3Q9ZA 3B8RA 4GT3A 4O2PA 5K5XA 1LEWA 3W2SA 2PVFA 4IX3A 2CCIA 4WNPA 2WMSA 4KIKB 2W96B 2OO8X 3HL7A 4BR3A 2R3PA 1FQ1B 3FLSA 3L9MA 3VBTA 4RVLA 4WUAA 3M11A 1A48A 3C50A 2CGXA 3KMWA 3ATTA 4JDJA 3R9RA 4WBOA 4PNKA 4GYIA 5ACBC 4ZS4A 4GK3A 1MRVA 1NY3A 2WTVA 4M13A 4Q5HA 4YHFA 3KN6A 3AGLA 4ZLOA 3F3VA 1WAKA 4KD1A 3ENHA 3PSDA 4IH8A 2WKMA 3H9OA 2G1TA 2YWPA 4KBAA 2WTKC 5FUTA 2QOLA 4OBPA 3C0IA 4JBQA 3B2WA 4I0TA 3OP5A 5DPVA 4EWHA 4O7RA 3N4TA 4BTFA 3K5UA 3QD4A 3FUPA 3G0EA 4XEYA 4AA0A 4G2FA 4IAAA 2OU7A 3O23A 4J98A 2X7FA 3MPMA 4OBOA 4M7IA 4XG8A 3RGFA 3FQEA 3PXQA 1OECA 2UZUE 3ZUVA 4R7HA 3HRFA 2YJSA 3U4WA 4LG4A 2OK1A 3EN5A 1H1QA 3SQQA 3WYYA 4CYJA 2FSLX 4M67A 3W16A 4YSJA 2ITXA 2WAJA 4BCFA 2WTKB 2PZ5A 4ZSAA 1RJBA 4HVIA 2XIXA 4I21A 3RPYA 3PTGA 4C2WA 3U6HA 5DBXA 3LXKA 1H8FA 5JRQA 3R02A 1R1WA 5E90A 1M2PA 2PZRA 4C0TA 4RX5A 3KB7A 3KQ7A 3ODYX 1Y8YA 4USDA 4EK5A 2C30A 5EI6A 4X6RA 4F64A 1A9UA 3ZTXA 3VS0A 2WQMA 4O7LA 3HUCA 3G9NA 3P7AA 4LMUA 4ACDA 1M52A 4E73A 3FY0A 5HG9A 4BWXA 4X2FA 2I0YA 5ACKA 4KSPA 3W2PA 2ACXA 2W5AA 4J8NA 3HV4A 4JR3A 3RPVA 4S34A 3Q4ZA 4BVUA 4X3FC 4DFYA 4HOKA 3QKMA 3I60A 3PVUA 1W0XC 3ANRA 4E4LA 3BHUA 4RVTA 2QLQA 4C59A 2BHEA 2QOIA 4YJNA 1QPDA 3E62A 3NYVA 3R73A 4QP7A 5CVHA 4ZTMA 4FEUA 4TPTA 4NTTA 5B2LA 5EM5A 4GMYA 4KKGA 4MYGA 4Z16A 3Q5IA 5HIEA 4IC7A 2VTPA 2J6MA 3VRZA 4W8DA 4DEBA 5EM6A 2PL0A 2JLDA 2QLUA 1W8CA 4YU2A 4X3FB 5J79A 3GGFA 3HP2A 2BFXA 2FSOX 2G9XA 1NVRA 3O2MA 4FTQA 3D2KA 3HNGA 4P5ZA 4M84A 3C13A 3KY2A 3T8OA 4FSQA 3DTCA 1ZXEA 5BYYA 4X3FA 4PMPA 5C1QB 5L4QA 4K9YA 2OXXA 4Q5EA 4YZCA 1Q99A 3FKOA 2OSCA 4F70A 3EJ1A 4WSYA 5IDPA 1Y8GA 2E2BA 1OBDA 2VD5A 3LXPA 5M44A 3E92A 2BAQA 3RAKA 4WG3A 1U46A 4AU8A 3PZEA 4DEGA 4O6LA 2X9FA 4YJRA 4ZTHA 2HY0A 2YAAA 4FKIA 4GYGA 3ANQA 1SM2A 3FLNC 4FTRA 4K1BA 3D14A 4QMSA 4JVGA 2VWZA 4RRVA 3RINA 3ENMA 4E1ZA 3NUNA 3GT8A 4IAZA 1W98A 4GK4A 2B1PA 3LAUA 4KB8A 4CGAA 3Q04A 3VS3A 3FI8A 4FNYA 4ZSEA 1Q62A 4DINA 4F9CA 3B2TA 4DITA 4CG8A 4RQVA 4QMMA 5AP7A 5JGDA 3PVBA 3LMHA 2QQ7A 2B55A 4ANLA 4BDCA 5CAOA 3UO5A 4O81A 4L3JA 4QYFA 4X0MA 4J95A 3KXNA 4RJ6A 3TT0A 1UNHA 3HMOA 4TTHB 5DI1A 1XBCA 5IQBA 2Y8OA 4TW9A 5IA3A 3V6RA 3OT3A 4EBVA 4FTUA 4ENXA 2YM3A 2BTRA 4LMNA 1V0OA 4CZUA 2V62A 4HYSA 1ZZLA 2ETMA 1JAMA 2VWWA 3UNKA 4FSNA 4O0VA 5FEQA 1YQJA 4U8ZA 1JBPE 1KV2A 3KMUA 2QC6A 4Y73A 2OKRA 4ZTLA 2C5XA 3BPRA 1PMNA 4C35A 1BUHA 1Q8WA 3UTOA 3BEGA 4KIQA 1G8SA 3GU8A 2GU8A 5EDPA 1QCFA 4GG5A 3OD6X 3V6SA 4OAVB 2UZTA 4QMPA 4FBXA 4P90A 2GQGA 1XBBA 2A27A 3OG7A 5IQEA 4D4VA 3DY7A 2CGVA 2QURA 3C4ZA 2PMLX 3ZUTA 4R7IA 5FLFA 4FKJA 3SDJA 1RE8A 1XH5A 4HCTA 4V05A 4YUQA 4KINA 4MQ1A 3TNQB 4DGOA 5JKGA 1ZYSA 1A06A 2FUMA 3KXHA 4AN9A 4XV2A 4C4JA 3QRJA 3RTPA 3QQLA 4E5WA 2PUPA 3UVRA 5GJGA 3FXZA 5AA9A 3OY1A 5KZ0A 4BCJA 1JSVA 4XP0A 3MTLA 4BYJA 4FKGA 3DKFA 3T9IA 4D0WA 3TZ7A 4GFOA 4FVPA 3K3IA 2J0IA 2XCKA 4MXZA 5TR6A 5AP2A 2OIDA 2J4ZA 1YWVA 2XK7A 4EYJA 4FKRA 3GNIB 4FR4A 3R9NA 4PY1A 3W8LA 1SYKA 2XNOA 2YIYA 2VTLA 3QLFA 2R3FA 1UVRA 3FQHA 4ASEA 5IF1A 3QZHA 5CF5A 2Y7JA 3EN4A 4RZWA 3A62A 4ZEGA 2VTSA 3QTIA 3DBEA 4X2GA 4DEDA 1OIRA 4O0WA 4XV3A 4L45A 3VW6A 2IG7A 2JIUA 4U43A 3EL7A 1LR4A 1Y91A 3C4WA 3MFRA 4FK3A 4JRNA 4CNHA 4UMUA 4GU6A 2XK6A 1EH4A 4O38A 3F3TA 3L9PA 4AN3A 4BTJA 5ITAA 3S1HA 3MESA 4A9SA 3D7TB 3SD0A 3W55A 1YHWA 3FSFA 1QPJA 4BDBA 4D9UA 2VWUA 4MWIA 5CU2A 2X8IA 3MY0A 1WVXA 5CSWA 4XG4A 5AFVA 3NRMA 4FI1A 4D4RA 4EUUA 1KOAA 3OZ6A 3ZEWA 4M97A 1W7HA 3ZOSA 3R7UA 4JBPA 3NCGA 4AQCA 4PP7A 3EQGA 2C5NA 2VO3A 3CEKA 4W9WA 4O21A 1PY5A 5LCKA 4DBXA 3BGPA 5EYMA 3HKOA 2PVLA 4HNFA 5M56A 2W1IA 1YOLA 2UZVA 3C1XA 3CXWA 4E4MA 2DUVA 2BZIB 4EOOA 1OPLA 4DC2A 2QKRA 5HX6A 4G6OA 2BILB 3HV7A 4Y85A 4S2ZA 4QMZA 5J9LA 3R1SA 2C6TA 1VR2A 2QHNA 3Q60A 1B39A 1ZOHA 2BRMA 4TYIA 5GJDA 2UV2A 4LGDA 3EKKA 3F2AA 5CSVA 5CEQA 2ITZA 5M4IA 4L53A 1MRUA 3LCTA 4ACCA 4RX7A 3ZDUA 3ZXZA 2QCSA 5IQHA 2J5FA 3MDYA 4M0YA 2C6MA 3MFTA 5I9VA 1ZWSA 3RBWA 2UVXA 4EHEA 2PE2A 4GK2A 4O91A 4XNEA 3TL8A 2ZDUA 5GZ8A 4BZOA 3V8TA 2C47A 3AT2A 3F3UA 4O0YA 3SW7A 3MB6A 4X2JA 4F9WA 1XH6A 4I92A 5JZJA 2W0JA 3QZIA 4LL0A 4F6SA 4B8MA 4OAUC 1NVQA 3D5XA 2IPXA 3BYSA 5AUTA 4J97A 2ZB0A 4G5JA 1VZOA 2QHMA 3WYXA 3PJ8A 3E5AA 4ZY5A 3DFAA 1H0WA 3F9NA 2IJMA 4XUFA 2V22A 3N4UA 5CZIA 3D7ZA 2I6LA 5BVFA 3WBLA 4FZAB 5FWKK 4X3JA 1DAYA 3KXXA 5EFQA 2B9IA 5IH5A 2OJFE 3QCSA 5L8LA 3KF4A 3D4QA 5A14A 3RALA 2BDJA 5DGZA 2B53A 3V8WA 3F2NA 2BFYA 4NW5A 4QMXA 1XKKA 5BNJA 3U4UA 4OT5A 4FG7A 4FT3A 4HCUA 4L43A 3UJGA 2BKZA 4F6UA 3PSCA 1Q3WA 2IVVA 4C3RA 4RJ8A 2ZAZA 3TZ9A 2CMWA 5KMKA 5BVWA 3A7GA 3CPBA 5L2TA 3S95A 3COIA 5I9YA 3DKGA 4RSSA 5J5TA 2DS1A 3SA0A 2F49A 1H01A 1YXUA 3Q53A 4CFFA 3ATSA 4NIFB 2WMXA 5EG3A 4KA3A 4IB0A 3UP2A 4XLIA 1WVWA 3FJQE 4NIFA 4XLVA 3OVVA 4FV9A 3TNIA 5ETFA 1GIJA 4HVHA 4TN6A 1KE6A 5GIPE 3VS4A 1JSTA 3B8QA 4L46A 2IW9A 4MBIA 2ZM4A 4YPDA 3DNDA 3L8SA 4MNEA 5CAQA 2ITOA 1ND4A 5CX9A 5DA3A 4EBWA 3VAPA 4XOYA 2F4JA 3DT1A 4OW8A 3UVQA 1ZMWA 1OMWA 4JQ7A 4KS7A 4BTMA 3FAAA 1SMHA 1ZYCA 4XG2A 3BQRA 4F7NA 5BVEA 3R22A 2GNJA 4JIAA 4QYYA 4QRCA 3RNIA 2KTYA 4ZTQA 3HZTA 5A4CA 2E9UA 3BGQA 3W2RA 3FMKA 3KREA 2RFSA 4FK6A 3SKCA 5IUHA 2C5YA 3BRBA 2WHBA 4A9YA 2V7AA 1GZOA 4IM0A 4JOAA 4QTDA 1WCCA 1YKRA 5HVJA 3UVPA 1V0BA 3QCYA 3F5UA 5T3QA 3QUEA 4R8QA 2XZSA 4Y72A 1IASA 4IX5A 4L67A 3AD6A 3LLAA 3FLQA 5CALA 3DXNA 2CKOA 3N51A 2R0IA 4EC8A 3DA6A 5A3XA 4FKLA 4RGJA 4HYHA 4PDOA 3UC4A 3FI2A 4RVKA 4K77A 4MD9E 2YDJA 5IQIA 3LFCA 3HMNA 4PX6A 5AV0A 4RWIA 4A4XA 4ALVA 4YTFA 4HVGA 4NM0A 4XJ0A 4MBLA 2YITA 3BIZA 2Y4PA 2YFXA 4K8AA 3FMJA 1P4OA 2YEXA 4O7VA 1HCLA 3QFVA 4GVAA 4UMRA 3RAHA 3LCKA 4XG7A 3T3VA 2X39A 1ZRZA 2PVYA 5L6WL 2ZV7A 4I24A 5J8IA 2OJGA 5BVKA 1OKZA 3OS3A 4CFVA 3KL8A 3CJFA 5A4LA 1OL7A 2XVDA 4QP9A 3EZRA 3R01A 3O0GA 4ANOA 4BGQA 1FOTA 1W83A 5EQEA 2SRCA 1U5RA 4QTAA 3MVMA 3SXFA 3NZ0A 4EOMA 3WF8A 4DFBA 3JY0A 3PSBA 4DCEA 4FX3A 3OMVA 3RMFA 3ULZA 4K33A 2Q83A 3DLSA 3FDNA 2Y6MA 2XB7A 5IG1A 4ZZMA 2PMIA 3PZHA 2P2IA 4FVQA 3FC2A 4FZFB 4RIYA 4O7YA 3QRKA 1BX6A 2WTWA 3FZSA 4V01A 1IA8A 1CKJA 4YMJA 3ZLSA 2YIQA 3GCSA 3GU5A 2WFYA 1YOJA 1KE5A 2O2UA 3F7ZA 3FSKA 3LPBA 2JFMA 2YLEA 2WO6A 4P7EA 4UEUA 4ANSA 4BKYA 2P2HA 3OW3A 3UYTA 5EH0A 1H0VA 3P23A 5HKMA 5CEPA 1KUTA 4XYFA 1JLUE 2OFVA 4CQGA 4AGDA 5AR5A 3VUGA 4DG2E 4M69A 4WD5A 5K0KA 2PULA 3TTIA 4ASZA 3NUAA 5F20A 2OZAB 2OICA 4EH2A 4XRLA 3EFWA 4HGEA 4XG3A 3GB2A 4IB1A 4C33A 4NWMA 3OCTA 2H96A 3MY1A 3D94A 3Q96A 1M7NA 2ZYBA 3DPKA 3UG2A 2VRXA 3ORZA 2UW5A 4PMMA 4IM2A 1YXXA 3VN9A 3MJ1A 4E6DA 4DA5A 1UKHA 3JYAA 4PPCA 4GG7A 5BPYA 4IVCA 3PE2A 4U7ZA 4CFMA 2JITA 3OXZA 2XEYA 4MK0A 5LMBA 3UPZA 3G6HA 2B52A 4O7WA 3LFEA 2W5HA 2UVZA 4RX8A 5EHYA 5ANIA 4CQEA 1PKGA 3C9WA 4CMUA 4OUCA 1CSNA 4EOKA 1R78A 3P7BA 3QD2B 1AQ1A 2IN6A 2PVHA 3FWQA 4LGGA 3S3IA 2RFNA 1OKWA 3DQXA 3PXYA 3SX9A 1Q5KA 3G6GA 4AZSA 5DHJA 3PXFA 1H1PA 3A99A 3TV7A 4QMNA 3CD8A 5AAGA 4D2VA 5J1VA 1ZOGA 4OR5A 3FBVA 1QL6A 3FMLA 1AD5A 2J7TA 4Y95A 4UN0C 3PUPA 5K4JA 3I7CA 3GU4A 3PXRA 4E4XA 1PMVA 3CTHA 3OTUA 2QOQA 5DLSA 5C01A 1U54A 2WMUA 3R9DA 2XKCA 3PLSA 4C3PA 3PRIA 2WQNA 3PWYA 3EOCA 2PWLA 2UZEA 2YDIA 3CIKA 4IJ9A 2OXDA 5CS6A 4D2WA 4F9YA 1WFCA 3VS5A 4TWOA 3MIAA 2W1EA 3MA6A 5HVKA 4D55A 3PIZA 5EHLA 4DGMA 4RIWB 4DEAA 2ITYA 4HNIA 3UC3A 4BBMA 2Z8CA 4F65A 5EW9A 3F88A 3AG9A 2W06A 1BI7A 4QT1A 3Q9XA 4RIWA 5F95A 3MPAA 3K2LA 3OBJA 4DLIA 5DR2A 3BHVA 3MB7A 2UW6A 4JR7A 4QQ5A 4BKJA 4LRJA 4CZTA 3VBXA 4JX7A 5DFPA 1JKLA 4I23A 4F9BA 3NW5A 3GOKA 1SNUA 2XK4A 2GS6A 4YZNA 4L7FA 2ZV9A 1K3AA 1LPUA 5E1SA 4BGGA 4HYUA 2GFSA 3LFBA 2XEZA 4RJ4A 4FV2A 3RKBA 4BZNA 1FGKA 4DH8A 4EOQA 2HOGA 4UYAA 2UVYA 4YJQA 5H9BA 3DB6A 4YO6A 2W1GA 1NVSA 4YTIA 3PVWA 4H39A 4F7JA 3ZLXA 4IB5A 5B2MA 3DBCA 4CYIA 2PTKA 2X9EA 4KRDA 2VTIA 4PPBA 4UY9A 2CN5A 4XV9A 5HLNA 2ZMCA 3CQWA 5E8XA 5T68A 3AC8A 1M14A 4K2RA 4C4HA 3FV8A 2R3OA
chains in the Genus database with same CATH superfamily
4JJRA 4JAJA 4O6EA 4UZHA 4IAIA 5IUIA 4MHAA 3SHEA 4J96A 2I0VA 4KWPA 4EH5A 4CKIA 5A4QA 5KE0A 1H25A 4MNFA 2FSMX 3HMPA 4EYMA 3RK7A 4H05A 3BHTA 2W9FB 4O27B 3F5XA 2GDOA 4EKLA 1J7IA 4DTBA 3AC2A 2YN8A 2WB8A 3OWKA 1WBPA 3NYXA 5DEWA 1KE8A 2ETRA 4QQTA 5DE2A 3CKWA 5DNRA 2F57A 3DAJA 2VTQA 2UW7A 3DXPA 4O7NA 4IWPA 1YXSA 4C57A 5HESA 3FC1X 2HCKA 4I5MA 5CT7A 2ITNA 3TACA 5G6VA 3Q4CA 4CFNA 3PJCA 5C4KA 4UXQA 3QC9A 4PQNA 1Q8ZA 2P3GX 4YNOA 2JFLA 4DE4A 2PE1A 4O7SA 4BDDA 5FEEA 3DDQA 5BVOA 5E8VA 4D58A 3V5WA 3UNZA 3OEZA 5I9XA 4LL5A 5EOBA 3MPTA 5AV2A 5LVNA 3U8WA 2X0QA 2EB3A 3LJ0A 3OHTA 4OTHA 5CVGA 3LM0A 4C36A 3V5QA 4CKJA 2UW4A 1CM8A 4ITIA 5D1JA 4DEIA 3D9VA 4Y5HA 1ZARA 3W2OA 5IA1A 3TUDA 4YO4A 4XG6A 4UX9A 4FKWA 4YZDA 5HLWA 3NR9A 4G1WA 2ETKA 3O7LB 4YURA 4N0SA 4DHJA 3DK6A 3DB8A 4QP8A 4U3YA 3OOGA 3EZVA 5F94A 4H1JA 5M08A 3FZTA 2AC3A 2OJIA 4O0XA 4IIRA 4CG9A 3HDNA 3V01A 4CTBA 4GKHA 4DDIA 2E9OA 1TQIA 2ERZE 4EQMA 4JLCA 3PY3A 3W0RA 5A4TA 4ZXTA 5EI8A 5KMNA 3AOXA 2C0OA 4JG7A 1P2AA 2R3KA 2JC6A 5FBNC 3T3UA 3NNUA 2C1BA 2WIHA 3VS6A 2H34A 4G34A 1BYGA 3HAMA 2X4ZA 3AMAA 3D5WA 3WI6A 3QD0A 2GTNA 2OGVA 4ORKA 1XH8A 3AXWA 4LV8A 4AZTA 3EKNA 4FV8A 1XH7A 3TDWA 1XWSA 3R1YA 5CU0A 3OOMA 5FQDC 1H08A 3VUDA 2X2MA 4APCA 4W4YA 3EN7A 4DGLC 2YABA 3ORIA 4NCTA 4QMOA 5AUZA 2YM7A 3RK9A 2P33A 1ZYLA 2LGCA 4AXAA 1PXMA 5M4CA 3BEAA 2JDRA 3QALE 4MKCA 3SGCA 3E8DA 3LJ2A 2QVSE 4X2NA 5GZ9A 2OBJA 1IA9A 2OG8A 4D0XA 3BBWA 1ZYDA 4Y46A 3VNTA 4O86A 5CXZA 3WF5A 5E8YA 3V5PA 5HLPA 3RK5A 3NUPA 3NCZA 1SVGA 4HGLA 3ZC5A 2I7QA 2QD9A 3QHWA 5EW8A 5FP5A 1W2DA 1PJKA 2JIIA 4E3CA 5E92A 5KMIA 4AW5A 3KXMA 4WNMA 3IKAA 4KUJA 4QMQA 3ZO3A 4OT6A 2BRNA 3LCOA 5AX3A 1KOBA 3UQFA 4JL9A 3LQ8A 3DKCA 3GU7A 3KMMA 3MH0A 2Z7SA 3QQGA 5I4NA 3PFQA 4HZRA 4ZJIA 3KRXA 3EFKA 4GVJA 4MCVA 3IDCA 1CKPA 4O4CA 2O8YA 3OC1A 2Q0BA 3ODZX 1WBWA 4FT0A 1B38A 2B4SB 4F09A 4FC0A 5HU9A 2WTCA 4M66A 5ETAA 3OF0A 3P1AA 4MH7A 3T9TA 3GCQA 4GT4A 2YHVA 5F1ZA 3Q6UA 5FTOA 1IEPA 2VZ6A 3LFQA 3LOKA 5AP4A 3BE2A 3CTQA 3SOAA 4DH1A 3JY9A 5C03A 3HMIA 4UWYA 5FXSA 5LQFA 5HE3A 2IVTA 4DGGA 4EUTA 4IDTA 5KMMA 4FEVA 4AZFA 4CXAA 2BRBA 4BCPA 4AW1A 3TN8A 4BDEA 4LOPA 4E5AX 4EH6A 1HOWA 3PRFA 3A4PA 3EQHA 2F7ZE 3DQWA 1BI8A 4MX9A 1JKKA 3I1AA 4UWCA 2W1ZA 3UPXA 3NX8A 3QF9A 4LGHA 2E9VA 3RHKA 4C4IA 4GL9A 2QO2A 1P4FA 4FNWA 4PPAA 5H8BA 1H1RA 3GC0A 5KMOA 4NTSA 4N6ZA 2ONLA 4QMWA 5EW3A 3Q3BA 4UMTA 3R1QA 3WE4A 1MUOA 5JFVA 4MXCA 5IMEA 4TKSA 2GNFA 4DH3A 4B8LA 1Q8YA 3HA6A 5E7RA 2BZJA 4NZWB 4N6YA 5KZIA 4ALUA 2VTHA 4RZVA 4YBKA 3DKOA 2J50A 4F0FA 4XP2A 3OUKA 3KC3A 3TI1A 2QR7A 1IR3A 2WTIA 4FOCA 5LARA 2VWXA 3R9HA 4XHKB 5IA0A 2C68A 3EQFA 4ZSLA 3C5IA 2BMCA 4QP1A 3EIDA 4FZ7A 3DLZA 3FXWA 4QP6A 2GNLA 3U9NA 2JKOA 2XS0A 3UDBA 3JXWA 3VWAA 5L8KA 4BCNA 2RSVA 2ZMDA 3LFFA 3QX4A 2XNBA 2YM6A 3VUIA 1I44A 3R1NA 2RG5A 4AACA 3RJCA 4OTPA 2DQ7X 1Z57A 3D15A 4PL4A 5E4HA 4QNAA 1IRKA 4RT7A 4M14A 4EK4A 1WZYA 3FHRA 4FSUA 1FPUA 5CLPA 4GRBA 3UGCA 1J1CA 4QMVA 4ZOGA 4TNBA 4IHPA 4YZ9A 3PPJA 3RCDA 4XX9A 1YI3A 3W10A 4EORA 4EOJA 4U3ZA 5LVMA 4EQCA 2XJ2A 1F3MC 3OCSA 3W0SA 4FUYA 3KULB 3LFNA 5EM8A 4A7CA 4AG8A 5FXQA 4DN5A 4LUDA 4S33A 5KMJA 3FY2A 4BL1A 3F5GA 5EYDA 3W2QA 4BDKA 5HTIA 3KULA 1Q61A 4GS6A 2JAMA 2R3IA 3OW4A 3DBFA 4U40A 4F9AA 1UWJA 5AX9A 3P78A 5LVPA 4RC3A 4JX3A 4XH6A 3D5UA 2X2LA 5DEYA 3RPOA 2HK5A 3ACJA 4C2VA 4DG0E 3PLAE 5FBOA 2PU8A 2HZ0A 1W2FA 4FT7A 3VRYA 3P79A 4O0TA 4FODA 5AP1A 3WE8A 4F1OA 3S00A 5GINE 4YZBA 3CGOA 5CAUA 2XRWA 5D7AA 2RG6A 5HCYA 3UE4A 3S2PA 5IISA 3P0MA 2CDZA 3I6UA 2CNUA 2EUFB 2FH9A 3I79A 3BE9A 2ITWA 3WZJA 2EVAA 5HX8A 2FB8A 3RVGA 3UYSA 1YI6A 3N9XA 4BIBA 1PHKA 3PIXA 2XK8A 4GIHA 4JI9A 4ANNA 1VLRA 3OUNB 3BU6A 4YJUA 3UOHA 3QTWA 3FZPA 4NFNA 3ORLA 5AR7A 5FXRA 4EOLA 3VONA 2IZSA 2P0CA 4O96A 2XK3A 4J71A 4OTFA 3CY2A 4R3PA 3PG3A 3WF7A 3GQLA 3FYJX 3QQHA 4I6FA 4EWQA 3PG1A 2BDFA 2CSNA 4MQ2A 3FLYA 4S30A 4ONAA 1Q97A 1UU7A 2C5OA 2V55A 3QWJA 4JBVA 4D5HA 3CPCA 3QA8A 4KBCA 3JUHA 3E7VA 3W8QA 3U6IA 2FGIA 1NXKA 3A7HA 2R2PA 4ZY6A 2GPHA 4MF0A 1FVRA 3POZA 4EH9A 4FA2A 2YLFA 4QP2A 1GJOA 4I41A 4RFMA 2XIRA 3FI4A 3OXIA 4YGAA 3ID6C 4RX9A 4ZLYA 3TG1A 3BCEA 3TUCA 3I0QA 3P7CA 2HXLA 4B6LA 3QZGA 3MH2A 3OFMA 3GOPA 5HIDA 2X4FA 4TYHB 3OTVA 4BWKA 5JK3A 2B0QA 2QU6A 2XP2A 4AT4A 2PMNX 4RIOA 4BDIA 3QQJA 2H6DA 2X1NA 4ENYA 1WMKA 3R8VA 3VC4A 4LV5A 2C6DA 4TYHA 2YM4A 4GW8A 2BZKB 2QOKA 2CGUA 1ZY4A 3O96A 4C62A 5TE0A 3UZPA 2BROA 4QD6A 4XV1A 3WZUA 1O6KA 4AZVA 4F99A 3FMHA 3LLTA 3PDTA 2NYAA 2Z02A 4A06A 4XBRA 4G5PA 4IZAA 1H07A 2V0DA 1GZ8A 3I0OA 5AADA 4WG4A 2PVMA 4Z3VA 5IEVA 1PXNA 5LXMA 5ANJA 4L8MA 4CKRA 1BL7A 3DV3A 2GS7A 3W33A 3ETAA 4U41A 2HZ4A 5HNGA 4CD0A 2ITQA 4HYIA 4KS8A 3KEXA 5CEMA 3ITZA 5FRIA 4H3QA 4E8AA 4C38A 3R83A 2UW3A 3LXNA 4EZ7A 5G1XA 5HG5A 5C8KA 2XNPA 3SVVA 4JXFA 4YC3A 3WZDA 4O7ZA 5IA2A 4H3BA 4L00A 4C8BA 4DHZA 3UIUA 3Q5ZA 4ITJA 4EEVA 2HW6A 3QTSA 4AGWA 3L9NA 3P86A 2ZM3A 3HLLA 4IX4A 1O6YA 5AM7A 3ZYAA 2RF9A 2ZV2A 1CDKA 3CY3A 2QOOA 2YIRA 4BYIA 3CBLA 2PY3A 5KBRA 4YJOA 4UZDA 2A1AB 5DOSA 2PVRA 3L8VA 3QL8A 5B2KA 3A8WA 2VV9A 3U9CA 1JSUA 3EQIA 4RC2A 5HNIX 5AMNA 3KRWA 5D7VA 1PRYA 5TKDA 5AP3A 3W1FA 1S9IA 4FTOA 5TO8A 4FKUA 3H0ZA 4LFIA 4HVDA 5K0XA 3Q4TA 2YCQA 1XO2B 1JVPP 3QBNA 5EDRA 4L01A 2XKEA 4FKVA 4FICA 5B0XA 2GMXA 2WU7A 3R8UA 3Q6WA 5DRBA 5IQCA 4FTAA 4HGSA 3QUDA 4L52A 4BBEA 1IG1A 2F7EE 4MBJA 3LW0A 3R00A 4C34A 5LVLA 5J7HA 5JH6A 5BQ0A 4QNYA 1GZKA 4FZ6A 5HE1A 4IB3A 4AW0A 3ZDIA 4CCUA 4GJ3A 3GFEA 2VO7A 3MH1A 3QTXA 3V04A 3VUTA 4A9TA 4L3PA 4U44A 4A4LA 2NPQA 2XALA 3PY1A 4L42A 2F2CB 4MF1A 4YC8A 4BCMA 3NS9A 3BHHA 3IDBA 3BL9A 2EXEA 4G6LA 4IWOA 4J1RA 4AXEA 2YCFA 5LCJA 2EWAA 5CNNA 1L8TA 2I0EA 5FD2A 3UIXA 2IZUA 2OIQA 4HGTA 4X21A 3SXRA 1M2QA 2AYPA 4FV3A 1E1VA 2OJ9A 1JOWB 3BGZA 2XBAA 3F3ZA 3P5KA 3HV3A 4YJTA 5L8JA 5F4NA 4FSYA 4H58A 3ZUUA 4JQEA 3AT4A 3G2FA 2FVDA 2OIBA 2BR1A 4PTCA 4BDHA 5JGBA 4RG0A 4RWJA 4GJ2A 2QU5A 4RFZA 2WXVA 3VF9A 2WTJA 2PZYA 3ALOA 3VUKA 2F7XE 3A2CA 3AT3A 3OBGA 3COMA 1U5QA 3CJGA 4MNEB 1XJDA 4B4LA 3DNEA 4MVFA 4L44A 2H9VA 3QCXA 1YI4A 3PXKA 5HE2A 2G15A 3R2BA 2PZPA 4F1MA 3FZOA 4C7TA 4MD7E 2Q0NA 4I5PA 3MGYA 5J1WA 1YDRE 2PUNA 3KK8A 3PJ2A 2X81A 2BHHA 2IZTA 2VTMA 4DF3A 5JFSA 4DAWA 1AGWA 1H27A 3EN6A 4AA4A 4R7BA 5KKRC 2C1AA 3DS6A 4PP9A 4YP8A 4AZWA 4UV0A 2YDKA 5E8SA 2CKQA 4O4EA 2R7IA 3FQSA 4B9DA 3QXPA 4DLJA 4NL0A 2IW6A 1FINA 3R7IA 1YOMA 3GC9A 3BHYA 2PVKA 1OIYA 1JNKA 4FIFA 4X7QA 3NVKI 3QLGA 4BTKA 3EYGA 3VJOA 5JN2A 2RKUA 4YLLA 2QG7A 3RZFA 2WQOA 3D2IA 3Q2JA 1FVTA 1WBVA 3C5UA 4NJ3A 2WOUA 1OKVA 3WZKA 4TWCA 4Z9LA 3TUBA 3GCUA 4R3RA 5KKRB 5J5SA 5D9HA 1UNGA 5DT0A 3GI3A 5IUGA 3LQ5A 4WOVA 2PHKA 3NNVA 3A7JA 4W4VA 2Y0AA 3KRLA 4M3QA 2EXMA 4E6CA 3E93A 2QKWB 2PZIA 3GEQA 3C4XA 2IWIA 3MH3A 3ZO2A 4IZ7A 4ZY4A 4ZK5A 3VBVA 3OROA 3HV5A 4IJPA 4U0IA 5FTQA 3VO3A 5BVDA 5M51A 4BCGA 5HICA 2WQBA 3I81A 5L2WA 3UZRA 1U4DA 4FYNA 3VQUA 2CNQA 2VWIA 3EHAA 1XHAA 3NUXA 4TWPA 5HD7A 3SXSA 2C6IA 2W4OA 3Q32A 2XANA 4C37A 3TNHA 4FUXA 4AF3A 3ZLWA 1X8BA 3KXGA 2W7XA 4FEQA 3ZLYA 3TWJA 3QYWA 2ZDTA 1XH9A 2O3PA 3UDZA 5I5ZA 5BYLA 3ZC6A 5DYJA 5IQGA 5E91A 4FE2A 4F78A 3EN9A 3E3PA 4AP7A 4O84A 2A4LA 2PUIA 4ZTNA 2A0CX 5DRDA 4F63A 3LMIA 4IX6A 4WRGA 3F3WA 4AZEA 4RIYB 5L6PA 2GHMA 3E7OA 4EOIA 1MQ4A 4P4CA 5L2QA 1RQQA 4MXOA 4RC4A 2W1FA 3SOCA 1PYEA 2HENA 3BBTB 3OT8A 2ZJWA 2HZIA 4LI5A 5CZHA 4D5KA 3DZQA 3R71A 4TL0A 2XNNA 3BLQA 3QTRA 4M0ZA 2ITPA 2R3HA 1CMKE 3CKXA 3R28A 4M69B 2AUHA 3UNJA 4CTCA 5AUYA 3RNYA 2C3JA 4BCKA 2QI8A 5ETCA 2WMBA 3G51A 3AC3A 1IAHA 1VJYA 3C0GA 4GUBA 3IQ7A 2YZLA 4RLKA 1SVEA 1OITA 2OH4A 3WZEA 4BIEA 2XCHA 2W4JA 4J8MA 3G90X 4CT1A 2R5TA 5LOHA 1WBNA 2BUJA 1Q4LA 5CANA 4U42A 1UA2A 1R3CA 3SC1A 1S9JA 3G0FA 2W99B 3FLWA 5E1EA 3KGAA 4W4WA 1Z9XA 3ZO1A 4DH7A 4O1PA 5AEPA 5EKOA 5AV4A 1JWHA 1OUYA 4A9RA 3QTQA 5CSHA 1GOLA 2WOTA 2VGPA 2HY81 3U54A 1RW8A 5EK7A 1Y6BA 4ACMA 5A9UA 3VVHA 4NJDA 4R5SA 3PIYA 2HXQA 3KIOC 3QC4A 3MTFA 4JIKA 4D4SA 3OWPA 5EI2A 4O1OA 4XBUA 4BIDA 2X8DA 5AP6A 4C3FA 4G3FA 2QOHA 2JDSA 3TM0A 3H30A 1ERKA 5DWRA 4AW2A 3D83A 4L3LA 1B6CB 1W2CA 3ZO4A 2DWBA 5IDNA 3BKBA 1UV5A 5H3QA 2VNYA 4CFXA 4JDHA 4OBQA 5IEYA 1PXOA 5AR8A 3NUUA 3NIEA 3UZTA 1T46A 4E26A 2G01A 4AFEA 3R9OA 1U54B 3MYGA 4K0YA 1BL6A 4PDSA 5AUWA 5L3AA 3OCGA 1OBGA 3GVUA 5JFXA 2ESMA 4N4SA 2JKMA 3HA8A 4IBMA 2Z7LA 4CFWA 5GNKA 3DGKA 2YACA 1VEBA 1NT2A 2BDWA 3A61A 3FI3A 3FYKX 3F66A 3MVLA 4NKSA 3UOLA 4EONA 2VN9A 5I9WA 2BVAA 4X2KA 4EL9A 1WBTA 3MSSA 3PUFC 3SRVB 3ZSHA 3KCFA 4AE6A 4GSBA 4J52A 5E8TA 4BI0A 1UNLA 4MTAA 2R64A 4ZMEA 3TJCA 5GHVA 2OZOA 2HWPA 4O0RA 2JDTA 2Z60A 4GH2A 4KKHA 2R7BA 3RCJA 1DI9A 5HIBA 4DH5A 3SRVA 1LP4A 1J7LA 2BRGA 3NNWA 3SAYA 4QYGA 3ZRLA 5CQWA 3FE3A 4ASDA 4UMPA 5CEKA 5E9EA 1ATPE 4IADA 5FM2A 2HZNA 3IDPA 3Q9WA 4A07A 1TZDA 2UZDA 2EB2A 3FL5A 1APME 2JBOA 2R0UA 2C3KA 2FSTX 2R9SA 1PW2A 4IWQA 5HI2A 5HE0A 1KWPA 5HZNA 3O5AA 1PXKA 3HEGA 2C6KA 4R3CA 3GFWA 4ZP5A 3ZM4A 4F7SA 3VS2A 5LVOA 1SNXA 3KF7A 3QQFA 1CKIA 2VTTA 3CQUA 5J87A 4P2KA 3U87A 2VO0A 1KE7A 2AC5A 5ANKA 4NSTA 1H28A 2JKKA 3IK3A 1MRYA 3IG7A 3ZS5A 4AS0A 4DT9A 4NH1A 2R3JA 1GAGA 2V7OA 3VQHA 4YHJA 5CNOA 3C7QA 4LM5A 4FTLA 3TJDA 3TIYA 1OGUA 2X7OA 3MA3A 3CSVA 5A6OA 4DFNA 3R0TA 4R1VA 5CU4A 3NW6A 4E93A 3F6XA 4YTHA 2J0LA 2OXYA 4FNZA 2WNTA 1Q41A 3NFFB 2RIOA 3WF9A 2VX1A 2AEGA 2W17A 4OTDA 4G9RA 1JPAA 1V0PA 4FIGA 4FIHA 4AXCA 4AA5A 3ZMMA 4WNOA 3PY0A 4G17A 2XNGA 3MFUA 5AAFA 3HV6A 3G5DA 4GEOA 4PMTA 4QPSA 2BPMA 3VIDA 3VUMA 4GU9A 5K4IA 4FSRA 4BC6A 2WMQA 3DJ5A 2OW3A 1GIHA 3ACKA 3VHEA 3RM6A 3C0HA 2PE0A 5L2IA 4FNXA 5KBQA 2B9FA 5AIRA 2WMAA 4QTEA 5FM3A 3QHRA 3R04A 4FKSA 1YRPA 3WOWA 5CEOA 5HTBA 3ZFXA 3DZOA 4ITHA 3BI6A 2WEVA 1REKA 4IXPA 1QPEA 4ZSGA 3BLHA 4U79A 3G15A 2QO7A 3DXQA 3DAEA 2VTOA 4QP3A 5T6KA 1OL6A 4FT9A 3ZSIA 4BKZA 3AKLA 4QDVA 3C4CA 4I5HA 4ACGA 2IVSA 3LIJA 5AP5A 3UOKA 4F6WA 4EHGA 4WNKA 3N4VA 3A7IA 3KVWA 1NW1A 2FA2A 5KMLA 1OB3A 3VBQA 4NCTC 3II5A 4IAFA 4DFXE 4IM3A 1GIIA 1OL2A 2X2KA 5IA5A 4D1SA 2VX3A 4WKQA 4B7TA 3NIZA 3KXZA 5TF9A 5HGIA 5CXHA 5EYKA 5HO7A 4K11A 4X6QC 1G5SA 3TKHA 3IW8A 3IGGA 5DR6A 3TXOA 2QO9A 1BKXA 5J9YA 2CPKE 4H36A 4BFMA 3CE3A 4Q9SA 1NA7A 4ANMA 3LXLA 1P5EA 2Z7RA 3EQCA 3IS5A 5D12A 2LAVA 4C4FA 4TNDA 2J51A 5M4UA 1MP8A 3EMGA 4I6BA 4OTQA 3K3JA 3ZFYA 4MEDA 5M06A 3TEIA 2WMRA 3M42A 2PMOX 4UMQA 3SV0A 3QXOA 4DEHA 5IQFA 4C02A 3LCSA 1OVEA 2J2IB 2JD5A 4FV0A 3V3VA 1R39A 3EQRA 4FTJA 5K9IA 5JSMA 3E3BX 4E5BA 2BIYA 3O50A 4AGUA 2C6EA 2ITUA 1VYZA 2Z7QA 3MBLA 4D28A 2OJJA 2W05A 4F1TA 4GKIA 3BLAA 3A8XA 3IO7A 3LJ1A 5AAEA 4JG6A 5EDQA 3LVPA 2WMWA 4ERKA 4N57A 3DJ7A 4CFUA 5EOLA 3SW4A 2QONA 2C0TA 4IMYA 3CD3A 3TKIA 4EK6A 3R6XA 2VWYA 4TZRA 3E8CA 4QO9A 3U51A 5K5NA 4RQKA 4FL1A 4UALA 1PXPA 5AV1A 2PSQA 4KIKA 3IW4A 4OGRA 3JPVA 3R8LA 4FF8A 4WA9A 3UQCA 4TRLA 3THBA 3GC7A 1DM2A 1H1WA 1OL1A 2R3GA 3COKA 4PL3A 2JAVA 3LFSA 5BUEA 5EQYA 3LE6A 3QCQA 4FVRA 3S4QA 1BLXA 3DAKA 1PXJA 2GNGA 5I9UA 3TDVA 4BJJB 5FDXA 4FTKA 5HO6A 4USFA 1R0PA 2WPAA 2OF2A 2X7GA 3L8PA 4IFCA 5C26A 4BY9E 4I4EA 5GJFA 4LQMA 1H1SA 5DMZA 2ONLC 4BJJA 1J1BA 4IWDA 4YJSA 2VWVA 3V5TA 3HRCA 4CEGA 3I6WA 4FTNA 2BALA 4U81A 2H8HA 3Q9YA 2GHLA 1SVHA 3IW6A 3ORNA 4IANA 3R21A 4IVBA 3UQGA 4I6LA 2QR8A 3KVXA 3AMYA 5FTGA 2X8EA 3KN5A 3QYZA 4AXFA 1V1KA 3GC8A 4PMSA 4AT5A 4CRLA 3HMMA 2J90A 5AV3A 3H4JA 3BU3A 3QRIA 1T45A 4HJOA 3DJ6A 4UYNA 2WD1A 4JNWA 3R63A 4TY1A 4KBKA 2XM8A 4DG3E 2RFEA 5ICPA 2ZVAA 3WF6A 5D11A 3LFDA 4DFZE 4R78A 2X6DA 3A7FA 4K18A 3AQVA 4OTRA 4PV0A 2B9HA 3QTUA 3IOPA 3NEWA 4I94A 3UO6A 3ZXTA 4ANQA 4FV5A 4M12A 1M2RA 4K6ZA 3P4KA 3LQ3A 3NAYA 1PMUA 4DT8A 2UZBA 2YIXA 4HZSA 3NNXA 4PTEA 4BICA 2XH5A 4NM7A 4C4EA 2VTAA 5AUUA 4IZYA 1WVYA 3NYOA 4BF2A 4QOXA 1ZOEA 4XOZA 4JDKA 4NT4A 3MJ2A 3DTWA 4AFJA 2WMTA 4JAIA 5CENA 3UO4A 2EXCX 2UW8A 2O64A 2I1MA 2JEDA 4V04A 3ZONA 2R3MA 3BYUA 4LUEA 4L68A 5CT0A 5DH3A 2CKPA 4FTCA 5M55A 4KIOA 4JMQA 3FL4A 5AA8A 4QDEA 2CGWA 2GQRA 5CSXA 1JQHA 3GCVA 4G3EA 3NFGB 5CY3A 3IGOA 5B7VA 4FT5A 1VYWA 4YLKA 5C27A 4EH3A 1G8KA 1XMLA 2BZHB 2PPQA 2BAKA 4YNEA 4GUEA 4U97A 5H8GA 3K54A 4CMOA 4RA5A 4Z7HA 3P5JC 4DFUA 1GY3A 4QMUA 3WILA 4EHZA 3EYHA 2WTDA 3HX4A 4I6QA 4IDVA 3FKLA 5C8MA 5C8NA 2CHLA 2XIKA 3KFAA 1PKDA 4MXAA 1OPJA 2C69A 4W4XA 3O7LD 4MD8E 2Y6OA 1JKSA 2YWVA 4GFMA 2V5QA 5FG8A 4FV4A 3MFSA 3TV4A 3FZ1A 4DGNA 3GBZA 2WMVA 3DU8A 4KRCA 4PUZA 2XBJA 1LEZA 3HRBA 4ID7A 5IPJA 4U9AA 4MAOA 3AC5A 4FV7A 2BCJA 3LZBA 4I5CA 3NVMB 3ORMA 2YERA 3F5PA 3TZ8A 1ZZ2A 2QODA 4BHZA 4QQJA 3PA5A 4RMZA 5CTPA 1FVVA 5E8WA 3QRUA 3TCPA 4E20A 2IZRA 4O7TA 4RA4A 5ANEA 2ZM1A 3KKVA 4AT3A 2FO0A 3BWJA 5JQ8A 2R3RA 4R5YA 3ZH8A 3NW7A 4OLIA 3VS7A 4CCBA 4O0UA 2YCSA 3I4BA 5HVYA 2W1DA 3FXXA 4H1MA 5EKNA 4CT2A 1BMKA 3GP0A 3HP5A 3UBDA 2CCHA 3R7YA 1F5QA 1G8JA 4IC8A 3COHA 4RWKA 1G8AA 1YWRA 4YHTA 4U5JA 4CMTA 1QPCA 1SZMA 3QA0A 4NU1A 5BX0A 3BELA 2NP8A 3S0OA 4USEA 3BU5A 4ACHA 2BTSA 5CASA 3RP9A 5GIOE 4AX8A 3TTJA 4FGBA 1URCA 4I1ZA 3FMEA 5HBHA 5IA4A 3G9LX 4NFMA 3UIBA 2XIYA 5CI7A 1WBOA 4BWPA 3D5VA 4R1YA 1G3NA 1FMKA 2XIZA 4O82A 4ZZOA 4YZMA 2JDVA 3SLSA 4FKTA 3C51A 3DOGA 3BL7A 1TKIA 2YAKA 5CYIA 2W5BA 4FEXA 2GCDA 2P55A 2XMYA 5LJJA 4D2PA 5HQ0A 3BLRA 4G9CA 5DN3A 4IQ6A 1R0EA 2WIPA 2VU3A 3ORPA 4D4YA 2A19B 3I5NA 4EKKA 1O6LA 4CLJA 4U6RA 4BI2A 3EQDA 3PPZA 4J7BA 4ZLZA 3M1SA 4ZTSA 3BX5A 3P08A 3TZMA 3WIKA 4FTTA 1DAWA 4KKEA 3AGMA 1PXLA 3L9LA 1Z5MA 3FMDA 3I5ZA 4M15A 3SG8A 3QD3A 4I3ZA 5JRSA 3V5LA 1J91A 5BMSA 2XA4A 4A9UA 5HD4A 4LV7A 5J9ZA 3Q2MA 4D2TA 3ZRMA 3GENA 2F2UA 4YC6A 4EZ5A 3CC6A 3REPA 3ZRKA 1QMZA 3W0MA 4D9TA 4R77A 5L6OA 5CF8A 3E88A 3BV3A 4Q9ZA 2NRUA 5CAPA 3O8UA 5HBJA 3NSZA 5HORA 4XRJA 2VO6A 4OTIA 2X6EA 5M53A 5CSPA 4IE9A 3PJ3A 4RIXB 4NUSA 2VTJA 1F0QA 3KRJA 3W32A 4D2RA 4ZAUA 2YIWA 4EH8A 4NKAA 2YCRA 4QTBA 2F9GA 4PTGA 5K3YA 4AOTA 3QGWA 4RIXA 1STCE 3MY5A 3D7TA 3NPCA 4YLJA 5IKWA 4BB4A 4CV8A 3TV6A 1PYXA 4RJ7A