3S4QA

P38 alpha kinase complexed with a pyrazolo-triazine based inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
349
structure length
326
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of pyrrolo[2,1-f][1,2,4]triazine C6-ketones as potent, orally active p38α MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 326
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3s4qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3s4qA01
4BWXA 2RGPA 4M67A 2RIOA 4BDEA 5H2UA 4PQNA 1V0PA 3EL8A 3N4UA 3RMFA 4QYFA 4BZDA 4EZ5A 4YJOA 2PTKA 2WB8A 2XKDA 5DR9A 3V5JA 2C69A 4ZZOA 3E8EA 3DBEA 5AMNA 3D7ZA 1YXTA 2PZ5A 3WF6A 1O6YA 1UNGA 4O0VA 4YPSA 3H9FA 4C4IA 2FSMX 1MQ4A 4JG6A 3OMVA 2PSQA 4C33A 3VS1A 1NW1A 3UVPA 4A06A 2YWPA 4KRDA 4EK4A 5M08A 5D1JA 2UW8A 2YIRA 4CYJA 4NCTA 3MVMA 4E8AA 4LOPA 2CNVA 4M15A 4EK5A 4NM5A 4QMXA 5LMAA 2CN5A 4I0SA 4WUNA 3LCOA 1ZMWA 3SW4A 2ZDTA 3ZSHA 2BZHB 5ETAA 5JFXA 1KE5A 3COIA 3KRLA 1IASA 3NVMB 3TV6A 2UW4A 4YZNA 2BRGA 3VS4A 5AUUA 3LXPA 2OK1A 4LFIA 2JDRA 1DAWA 3QUEA 3D5WA 3IW6A 3F3TA 3NPCA 2OW3A 4JX3A 3SV0A 4OT5A 3VC4A 2G2IA 2I1MA 3Q4ZA 4ITHA 4R78A 3DY7A 4OTDA 5EKOA 3G9LX 4FKLA 4U3YA 2BIKB 3FQHA 3UOKA 1ZYJA 2GFSA 2VRXA 3B8RA 4MD7E 5CTPA 4ID7A 4LL5A 4Q2AA 3LVPA 5HIDA 4CNHA 5HORA 5I5ZA 1YXXA 2RFEA 3KXZA 5A4QA 2BFYA 4D4VA 4D0WA 3LAUA 4NU1A 3PRIA 4BCGA 4DGMA 3QALE 2R5TA 5JH6A 4L46A 1P4FA 3W2PA 1XH4A 4AA0A 4AZWA 2R3FA 2J0KA 2XJ1A 3QFVA 2VTQA 2RL5A 4X2FA 5HE2A 5LCKA 2EU9A 4RVKA 3RK9A 4AACA 5AR4A 1ZYSA 4C8BA 3TZ9A 2PVNA 3UC3A 2W5HA 2ITVA 2I0VA 3FQEA 4EWHA 4XHKB 2OWBA 3CY2A 2YIXA 5HNBA 4B8LA 5AR2A 2ONLA 4KBCA 2C6KA 3R8ZA 3KN5A 3R9RA 2BROA 4K77A 4YC6A 5JGAA 5IPJA 3V5TA 2BHEA 2GTMA 1OMWA 4QP4A 4W4WA 4IZYA 4G3GA 2G2HA 1BL6A 1K9AA 3LFSA 1JKTA 3MFUA 4MXXA 1J1CA 2YIQA 1XKKA 5CI6A 2OJ9A 1TQPA 1V0BA 4PPBA 5I9VA 3O51A 4D2WA 4BI1A 4M69B 4I5MA 4J8MA 3TCPA 3D94A 1FOTA 4DCAA 5BUIA 3OTUA 4ZEGA 3P4KA 2Z7LA 4FV7A 3OCTA 4C34A 5BYZA 3LXLA 4AU8A 4NFNA 1KSWA 4IFGA 4FTNA 2PPQA 3DQWA 3P1AA 2Z60A 3KCKA 4D2RA 4I5CA 4AQCA 4JDKA 3ANQA 4GYIA 4YC3A 3ZFXA 4I6FA 5L2SA 3QQHA 3VS6A 2VD5A 2WTKB 4EOIA 4CKRA 2FGIA 3DDPA 2WQMA 1SVEA 4B0GA 4UY9A 4IB5A 3NIEA 2EXEA 3GUBA 3WZJA 4N4SA 4U9AA 2XEYA 5J95A 2UZOA 3GU5A 1R78A 1CTPE 3CXWA 1B39A 5A4EA 3MPTA 3C4XA 4R7HA 4ENXA 5BMSA 4UXQA 3DFAA 3CCNA 3W1FA 1WCCA 4AAAA 4X2KA 4L01A 3FLQA 3D5XA 3OBJA 4FV2A 3DOGA 2C0IA 1QCFA 3DLSA 3TNQB 2HY81 2W5BA 3UVQA 5DGZA 5IZFA 3FUPA 1PYXA 5JMSA 2J2IB 2VTNA 5K4IA 5FBNC 1GZNA 2W4JA 4FV4A 3LLAA 1UU7A 2BAKA 4FKUA 5AV0A 4YJRA 5C26A 2W9FB 3SVVA 3FKNA 4O81A 5EM8A 3DFCB 5CEMA 3UPXA 4TYGA 5J5TA 3I4BA 1J1BA 2J9MA 1OL2A 2PMLX 2XH5A 5DHJA 2IPXA 2JKOA 3TNWA 3FHIA 5HG8A 3OY1A 4NTTA 4GK3A 2YZAA 3OEFX 4FYOA 3OHTA 2QG5A 3OP5A 4EH7A 4BCFA 4ANBA 3LIJA 4LRKA 4G3EA 3LFNA 3PLAE 5GZ8A 2WOTA 4UYNA 2G01A 3IW5A 4IAAA 4QP2A 5B2KA 4C62A 1Q5KA 4BYJA 4EORA 4DFBA 3O7LD 5JZJA 3O8PA 4FNZA 3F3ZA 3MIYA 5DEWA 1ZYDA 4QP7A 1UWJA 2FB8A 3G0EA 1UKHA 3E3PA 3MVJA 4HZSA 5EW3A 3BWFA 3E93A 5HU3A 3R83A 2X4ZA 4O6LA 4W4VA 2OZAA 5K0KA 2PE0A 2IN6A 3EWHA 2C0OA 3ZDIA 2W1CA 4F0IA 2GDOA 4R5YA 2ESMA 2XIKA 1U5QA 3EN7A 2QLUA 4V05A 3BLQA 2IW9A 4UWCA 3HAMA 3LXKA 2XNMA 3NIZA 4F63A 2WEIA 1M17A 2UZTA 4QQJA 4V0GA 4BBEA 3RPRA 3FQSA 3L8XA 4DEIA 4JL9A 3ORZA 3GOKA 4GT3A 4USFA 2CKOA 2PE2A 4AE6A 4RX5A 3FMLA 2UZNA 2P33A 3W2SA 4FNYA 4DGNA 5IQBA 2OZOA 1Y91A 4QTAA 2JIIA 3FMHA 1M7QA 4YTFA 1XWSA 4ANOA 3PWYA 4PNKA 1BL7A 5I3RA 5L2TA 1BI8A 2PHKA 3NNXA 5KZ0A 2PL0A 5TE0A 4YJSA 4ZS4A 4NM0A 1XH6A 3GGFA 4B7TA 3V6RA 3FSKA 1KV1A 3BWJA 1XH7A 3AT4A 3JS2A 3PXKA 4FKTA 5HE3A 2E9NA 4NIFB 4F9CA 1WZYA 4RWIA 4D1XA 3KF4A 5HD4A 2B53A 4IVBA 2I0YA 2J90A 5GZAA 4ZSEA 4F9BA 5FTOA 3VVHA 2FO0A 2XYUA 2BZJA 4FIEA 4MWHA 3NW7A 5KMOA 5IQCA 2ZV8A 4IC7A 1H25A 4TWOA 4ZJJA 1TQIA 3A2CA 5EQYA 4EYJA 3KU2A 4YUQA 5GNKA 5M06A 1R3CA 4DLIA 3ZLYA 4HCTA 2VTJA 4PPCA 4F1OA 2VZ6A 3O23A 3TJDA 2JDVA 5CEOA 2W1GA 1J7UA 3MB7A 3CS9A 1SMHA 4QMNA 3U6JA 1R0EA 4UWYA 4DEHA 3PUPA 2XNOA 3ZUVA 1OBGA 3FSFA 4K9YA 4PNIA 5HTBA 4YNEA 3LCKA 3NLBA 5KMIA 4AZEA 3Q5IA 4DC2A 2C0TA 3NUSA 3CGFA 3RZBA 4ANNA 4DTBA 1PXMA 2VV9A 2GS7A 3POZA 3TUCA 4Q5EA 5TKDA 3W55A 2ZB1A 2IW8A 2IVSA 1FVVA 5GINE 3OVVA 3U9NA 3LFAA 2QODA 2C5YA 3M1SA 3PXZA 4ANQA 1KOAA 1G5SA 3DZQA 4IANA 2DWBA 4I4FA 5ANKA 1CKIA 1IAHA 3AG9A 5A4CA 4O6EA 3IO7A 3UE4A 5IEVA 2J5FA 4FX3A 5J9YA 4MD9E 2F2UA 1E1XA 3L9NA 4C0TA 2V0DA 5IDPA 3GBZA 3EQIA 4UMRA 2Z7SA 3A62A 2ITPA 3LLTA 3I81A 2GQRA 3VS5A 2HK5A 2WNTA 5JGBA 3ODYX 5EM7A 2GHGA 1JKSA 4LMNA 4ZLZA 3FMMA 3NNWA 5C01A 4DCEA 2BRNA 3SG9A 3DBQA 5LQFA 2QONA 2XNGA 3QZGA 3EKKA 2XRWA 3U4WA 3FMJA 3FWQA 5HLWA 4C4FA 2ZV2A 1DI9A 4EH5A 1Q97A 4O7WA 3SXSA 5BUJA 4ZJIA 3L1SA 3VNTA 4YO6A 3HA8A 3S1HA 4EH9A 5JKGA 3LQ8A 4J96A 4ZK5A 3LJ1A 4EK8A 5GJFA 1JPAA 4R7BA 4FGRA 3GC7A 3FI4A 3ELJA 4R1VA 3KMWA 4BZOA 3PLSA 4EL9A 5IUHA 1LUFA 3LPBA 4FSZA 3O96A 5IQIA 1YDSE 5A4TA 3PPZA 5AUYA 3R0TA 2BRMA 4DA5A 5HHWA 2PZIA 3DZOA 4MWIA 3QX4A 4FIGA 4IAYA 3R1NA 5FM2A 2YM6A 4EH2A 3NCZA 4S33A 4K2RA 4XS2A 5IMEA 3EYGA 4XNEA 4BY9E 3C7QA 4P7EA 3VS0A 3HV3A 3JXWA 4M12A 4EK3A 1WBSA 4FVPA 4PUZA 1W84A 3M42A 3Q4UA 4TYIA 4L67A 4QQTA 2X7OA 5J7BA 4PY1A 4FEWA 3HRBA 3ORKA 3PIZA 5GHVA 3VF9A 3TUBA 3OOMA 1AD5A 2WGJA 4FV5A 4FKSA 1IEPA 1KE8A 2HZNA 2BIYA 1YXUA 4IAKA 4TWNA 5AP5A 5L8JA 4DH1A 4YR8A 2JDTA 4D4YA 4FKIA 1CKPA 3DK7A 1G8SA 2Y0AA 3FMDA 4IWOA 4KS7A 2FSOX 4EJNA 3ZUUA 3VUKA 4OTRA 2W06A 3FKOA 5F20A 1XBAA 1Y57A 4OTFA 3MGYA 3PIXA 4PV0A 3GB2A 4GG7A 2C5XA 3LE6A 4JBQA 4JOAA 1WVYA 4JRNA 4WBBB 3DNDA 4CZYB 2E9UA 3FI8A 5ANDA 1OECA 2Z2WA 3TACA 4G6NA 5LMKC 3PA4A 3PVGA 4FTMA 5BVOA 4X3JA 2YAKA 3ERKA 4WNOA 4P5ZA 5M4IA 1OZ1A 2DUVA 2JAVA 3R1YA 5CXZA 5DVRA 3VUMA 4WO5A 1SM2A 2I0EA 3I5ZA 4FTIA 1OBDA 2VNWA 3Q2MA 3IQ7A 2YCFA 1PXOA 3E8DA 2I40A 3FZ1A 5I0BA 2HYYA 5G6VA 4A9SA 3DKOA 2YDJA 4OUCA 3CPCA 4F7SA 3P79A 4TT7A 2Q83A 1CKJA 3FV8A 5AR3A 3L8PA 4WG4A 3V3VA 4E6QA 3OD6X 3EN9A 1BX6A 3DDQA 1A9UA 2ITWA 5J87A 3QC4A 4FEVA 4J7BA 1G8AA 5HESA 2BZIB 5AM6A 4BCPA 4ZAUA 1GZ8A 4YSMA 3MJ2A 5BVEA 4QPSA 3F7WA 3F2RA 1UNHA 2WTKC 1RJBA 1STCE 1VJYA 4K0YA 1JSVA 1J3HA 3II5A 2WMAA 5CU6A 4YPDA 5KNJA 4E4NA 3BCEA 4FI1A 4FKJA 3TV7A 2REIA 4BWKA 2A4LA 2RFNA 4XV3A 1H28A 3FZRA 3QCSA 3QD2B 3UODA 3ZMMA 5HBJA 3A7GA 4I5PA 3LCSA 5FLFA 3S00A 1PY5A 1Q24A 2V55A 2Y7JA 3JR1A 2F7EE 5HLPA 4MX9A 1U54B 4QMWA 3R2BA 3OXIA 3CBLA 4PP9A 4U97A 1H4LA 3DGKA 3U8WA 3DCVA 3GEQA 4BCNA 4FSUA 2JIUA 2VO3A 2YM7A 2F7ZE 4RJ8A 3ZC6A 5IU2A 2YCRA 3WILA 3W16A 2OXDA 2F2CB 4NH1A 3UYTA 3UOHA 5A14A 4PMTA 4FK3A 4HOKA 2X2LA 3P7AA 4TW9A 3V5QA 3QCQA 4DBNA 4U45A 4O7LA 4IZ5A 1YW2A 4FTUA 5DH3A 5IEYA 5IA3A 4KUJA 2HW6A 1ZLTA 4KA3A 3FXWA 3DS6A 2VWBA 1PMEA 3TV4A 4D2VA 4BI0A 3HEGA 5C8NA 2QHMA 5EQPA 4B9DA 5F94A 4F99A 3MFTA 5IQEA 5A3XA 5LOHA 3BLHA 3EQHA 5GZ9A 1Z57A 2FUMA 3NW5A 4AT5A 2ITZA 1OITA 1YDTE 1YRPA 5EYDA 4HVSA 2G15A 3SX9A 2UW6A 4JLCA 4W8DA 2B9FA 1V0OA 1WBPA 3NYNA 2CGXA 2O65A 3FMEA 2VN9A 4RVLA 3EH9A 4B99A 2R3NA 4NT4A 5IH5A 3KULB 4EOQA 4USDA 5EK7A 4QNYA 4M66A 2CNQA 4G9RA 3WF8A 2YDKA 2PYWA 1GIHA 4RA4A 4M8TA 3MV5A 2P2HA 2QQ7A 4FVRA 3KB7A 3IDPA 4IX5A 4MQ2A 3Q9ZA 3TNPC 3OTVA 3QCXA 4BTJA 3E8CA 2X39A 4L52A 5DYJA 1GOLA 4A07A 3MW1A 1W98A 2ETKA 4C36A 5CVHA 3QTQA 4XMOA 3FC2A 3CY3A 5B2LA 4MHAA 4C7TA 4QMSA 5AP4A 4V04A 2UUEA 3NSZA 4FVQA 3IS5A 2BKZA 4YJQA 3BI6A 4BHNA 5K0XA 3GC0A 4G17A 4F64A 3SG8A 3CGOA 3V5WA 2WTCA 5FTQA 4BCQA 3ACKA 5HEZA 3QRKA 3UBDA 2B54A 4QTCA 5J79A 4AN2A 4FZDB 3UG2A 5BQ0A 3OXZA 5J1WA 4CFWA 3NEWA 3NW6A 1H08A 1J7IA 1U59A 2Y6MA 5DA3A 4BDJA 4BICA 2GHLA 3UOLA 4BGQA 4BDDA 3S2PA 3NR9A 5JRSA 3A99A 3BHTA 4OR5A 4OGRA 3U51A 3H9RA 2X4FA 4BBFA 3NUPA 4O27B 3PY3A 2W5AA 4LGGA 4MXZA 5F1ZA 3KFAA 4X6QC 3G5DA 4ZTRA 2X81A 4HNIA 4TWPA 1OL7A 3PDTA 3K3JA 3ZFYA 3F6XA 1CMKE 4PL5A 4X2JA 5AR8A 4ITJA 2QOLA 3VW8A 3FBVA 4ZP5A 4N6YA 4E7WA 4PDYA 3UJGA 1BUHA 3R04A 5GIPE 3A8XA 5M4CA 2I6LA 3KEXA 2IVUA 4IE9A 1GAGA 3K5UA 1Q99A 3EKNA 3Q3BA 4TY1A 2FSTX 4C4JA 3HDMA 3PVBA 4BCOA 4HW7A 4AZVA 1JSTA 1OL1A 3I0QA 1YWRA 2UZVA 2H34A 4CEGA 2R3JA 3EQBA 1XH5A 4J99A 3BHVA 4ZMFA 3HECA 5HBHA 3R8PA 3DXPA 3DQXA 4NWMA 3QWJA 4H3QA 4JBOA 4ZXTA 3RHKA 1DAYA 1SYKA 3LMGA 4JI9A 5M53A 3QUDA 5JZNA 2XM8A 4NK9A 4ZY6A 1IR3A 4IJ9A 4W9XA 3RKBA 3DXQA 4M14A 2J0IA 2W0JA 4D1ZA 2GHMA 3NDMA 4FKOA 4C02A 4FSYA 5IMXA 3VBVA 4ERKA 4IADA 2QO7A 5EW8A 3R7UA 2PZYA 3UC4A 1W0XC 2R3HA 4GRBA 2X1NA 5IUIA 4B6LA 1PXJA 2R7BA 1CDKA 1OKYA 4GCJA 3QKKA 3BZ3A 5HZNA 3G33A 2HENA 4X7QA 3NWWA 3AGMA 4F08A 4JR3A 4CFMA 3PE1A 2WIHA 2XIZA 3G2FA 5TT7A 3R7YA 4OT6A 5AJQA 5BVKA 3UZPA 4RC4A 3PJ3A 3RINA 4D2TA 3GU7A 4QMVA 3F2NA 3E92A 3TZ7A 4YNOA 5ACBC 3VS7A 4DH7A 3DB6A 3E62A 4AWIA 4YLKA 2B0QA 2GPHA 4ALWA 2W9ZB 2XNNA 1BKXA 3RTPA 3DT1A 4ASXA 3AC5A 4Y73A 4DINA 4JR7A 2LGCA 4QTDA 4YTHA 3TM0A 2PU8A 3HZTA 2XIRA 3FE3A 3G51A 4F0GA 2C47A 3G9NA 2VGOA 3RAWA 1UWHA 2R3QA 2X7FA 4ACCA 4RIWB 3C1XA 2ZM4A 4AZFA 2R7IA 3ZM4A 2IW6A 5CX9A 4RVMA 3S4QA 2WOUA 1OL6A 2DQ7X 4L6QA 3CQEA 2ERZE 2XA4A 1ZMVA 2HXQA 3FC1X 3FPMA 3BKBA 4XUFA 5LVNA 3MY0A 4A9RA 4EH8A 2QR7A 4QMUA 4RQVA 3ULIA 4BVUA 4G1WA 1ZXEA 3VW6A 4AZTA 4GMYA 5TO8A 4M84A 4BKYA 2YWVA 2GNHA 3O50A 3LFEA 4DITA 2QU5A 4BDKA 4H05A 1V1KA 2J6MA 3AMBA 2QOQA 3HV7A 4I94A 3RCDA 4CMTA 5JEBA 4WRSA 4NKAA 5AIKA 3QD0A 4L3PA 4HVHA 2A1AB 2JGZA 4BDIA 2UW5A 5BVFA 3C5UA 4HPUE 5H8BA 2XK6A 5KE0A 4XBRA 2CJMA 2XBJA 4FBXA 4DAWA 2UVYA 3PVWA 4HGTA 4GW8A 3AC4A 3D2IA 4II5A 2GSFA 4Y95A 5HG9A 5E91A 4EC8A 2IG7A 2F57A 3BEAA 3HMIA 4TTHB 3QHRA 4NM7A 2OIDA 4BN1A 3FPQA 4NZWB 4AOJA 3BHHA 3OUKA 4TKSA 2NO3A 4G6OA 2W4KA 4QMZA 5FP6A 4AW0A 5LMKA 3B2WA 5T3QA 3RK5A 3R2YA 2YEXA 4RVTA 3LMHA 3RM7A 3DKFA 4I24A 5DEYA 3MFRA 5BYLA 3RPVA 4GIIA 1M7NA 3P0MA 5J8IA 4QO9A 2A19B 3VQUA 2E2BA 4IQ6A 4M69A 1YXVA 3A7HA 1JWHA 2IZRA 3I6UA 4FEQA 4LI5A 2C6OA 5CNOA 5M55A 4QT1A 5E1SA 1KV2A 4OTHA 4L3JA 3WF5A 2IVVA 2YACA 3AC3A 4IIRA 5DBXA 4U3ZA 5LMBA 2C4GA 2PUNA 3BYMA 1FVRA 3OWPA 4CXAA 3HP2A 4X2GA 2X9FA 1REJA 2V62A 4Y8DA 5HD7A 4HVIA 4N0SA 4RT7A 4NW5A 4MF1A 4E6AA 2OO8X 3QBNA 3HDNA 2YCSA 2CGVA 4BBMA 5DWRA 4S32A 3U9CA 2NRYA 4C3PA 5HCZA 4G5JA 2EXCX 4GSBA 5ITAA 3QL8A 2J0MB 3REPA 3KK8A 3PXRA 3CD8A 3W2RA 4F6WA 4QP6A 3UZRA 4I6HA 3MBLA 2ZV7A 4E1ZA 4F7NA 4FIHA 5A46A 4GIHA 1E1VA 2WTVA 1ZARA 2JAMA 1NXKA 4FIFA 4XG6A 4M7IA 2QO2A 3VHEA 4DE4A 4FTCA 1PKDA 2JKQA 3F82A 3H10A 3RNYA 1YI3A 3OW3A 1H24A 1UA2A 3BU6A 4NJDA 3ZLSA 3CSVA 3U54A 4WNPA 3WE4A 4DLJA 1RDQE 3DXNA 5F4NA 4F0FA 3DBFA 4I3ZA 4E4MA 5CY3A 3Q6WA 4GFOA 1MRUA 2G9XA 3ZSGA 5FDPA 2PUIA 3N4TA 3EN5A 3ITZA 3R7EA 3EQDA 2WO6A 1EH4A 4GL9A 1L8TA 3I6WA 5DPVA 1WMKA 4RG0A 3BQCA 4N70A 1Q61A 4YC8A 2NP8A 4BCMA 4DG0E 4PTCA 2P0CA 1J7LA 4JDJA 4BR3A 3D5UA 1YI4A 1R39A 4OTQA 4BIDA 3C4EA 5KMMA 3IK3A 3TKHA 3TN8A 1XJDA 2X6DA 3PPKA 4AT4A 4QNAA 1NY3A 3CJGA 3LCDA 4ZY5A 3PYYA 5T68A 2AC3A 3N9XA 2C6MA 1OUKA 4BYIA 4YTIA 2W05A 4X3FB 5FXQA 2WQEA 4U7ZA 3THBA 3BV2A 2HIWA 4E73A 4O7RA 4CZUA 1Q8WA 4IW0A 5BUEA 4BC6A 1SZMA 5BVDA 2XK7A 3C5IA 4LM5A 4LG4A 2UZEA 3KXXA 4IFCA 2FYSA 3WZEA 5CU3A 4S34A 2VWWA 3UP7A 3E7VA 2R3OA 3TI1A 5HU9A 4AF3A 4WA9A 1F5QA 1ZZ2A 1ZYCA 3COHA 2J0LA 2YIWA 4BFMA 4FTKA 4ACGA 5AEPA 5AUTA 3EZVA 4ZTNA 3GT8A 4UZDA 4KKEA 3OCBA 4U43A 4PF4A 5KBQA 3SW7A 4MYGA 1RQQA 2XK8A 4IWQA 5AR7A 4JQ7A 5M4UA 4TL0A 4NFMA 1H1RA 3UO5A 3U6IA 2VTSA 2HXLA 3OF0A 4ZOGA 3KVXA 5AFVA 2ZVAA 3EQFA 4TWCA 2Z8CA 3RPYA 4MEDA 3W2QA 4EZ3A 3PY0A 4CRLA 1ERKA 4U80A 2WTIA 4NW6A 5TF9A 1FVTA 1Q3WA 3E5AA 3HP5A 3T3VA 5KCVA 4NKSA 3TXOA 5JGDA 3LQ5A 2HWPA 3DJ7A 4YO4A 2R64A 2V7OA 2YA9A 2SRCA 4NIFA 4QYEA 4UYAA 2X2MA 4R1YA 3WF9A 5DR6A 4ZSLA 3VQHA 1DI8A 4E5BA 3H4JA 3AOXA 4R6VA 5CYIA 4LV5A 4WD5A 3VBQA 1SVHA 4O7SA 4XBUA 2B4SB 4ZTHA 1YQJA 2XVDA 2OF4A 4UXLA 5E7RA 3KQ7A 2JBPA 2CMWA 2Z7RA 2QG7A 5FRIA 3Q60A 5LARA 3ZUTA 1XH8A 3KMMA 4J8NA 4L45A 2YZLA 1OIQA 4G3DA 4OBPA 5T6KA 2NPQA 5AA8A 2V22A 4MBLA 3D5VA 2OJGA 4XLIA 2AYPA 1OIRA 4BDAA 4FEUA 5CAQA 4Z9LA 3Q32A 4CTBA 4CKJA 3UZTA 4EOMA 3DBCA 4RC2A 2ITQA 2VTTA 4G16A 4YJVA 4F09A 1JLUE 4IM2A 4HPTE 4RA5A 4DFLA 3P7BA 4BIBA 3WYXA 2YERA 5IA0A 5M51A 4YZMA 1OUYA 2C3IB 4I6QA 4RSSA 4FEXA 5HO8A 1P5EA 4OW8A 4HYUA 4FOBA 4PMSA 4GFMA 3I7BA 3VHKA 2QOHA 4QQ5A 2CKEA 4BDBA 5CF6A 5E92A 3RNIA 5IQAA 3R00A 3MH3A 4NJ3A 1UKIA 2EXMA 4P4CA 5LJJA 4H1MA 2PVLA 3PG1A 1A06A 2BPMA 1URCA 3GQLA 4EZ7A 2WTWA 5KMNA 3UOJA 4KIQA 4RC3A 2CCHA 1M52A 2LAVA 3VAPA 4U40A 5CLPA 4TNBA 1IA8A 2XYNA 3NUNA 4KIKB 5EI6A 3BGQA 2WELA 4UEUA 3NMUF 4LQMA 5EW9A 1B38A 5CF5A 5KMLA 3VIDA 4DFUA 2C6DA 2XNPA 5IQHA 4FGBA 3PJ1A 4L44A 5M56A 3UIUA 4I6BA 5CQUA 2YHVA 3K3IA 5EG3A 3ROCA 3PXQA 2R3GA 3GOPA 5K4JA 4CT2A 5LWNA 1W8CA 4I0RA 4DT9A 4XOYA 4FSWA 4C38A 2IWIA 1U46A 5CEPA 4YJNA 2Z7QA 1LR4A 1YOJA 2RFSA 3SXRA 4GV1A 1TVOA 4P2KA 1H8FA 4DHFA 3F9NA 3NYOA 3HUBA 3NZ0A 5EM6A 4ERWA 2H8HA 4YSJA 2VNYA 3LM5A 3EB0A 3E8NA 4L68A 4RWJA 4I23A 1Y6BA 4DF3A 4K8AA 3FI3A 1OIYA 4BL1A 3ET7A 3FKLA 5EFQA 1XR1A 2Y8OA 4JQ8A 4UMUA 4F9YA 3NRMA 4O1PA 3IGOA 5B2MA 3LJ2A 3Q5ZA 2XCKA 3FXXA 3M2WA 3V8WA 3QLGA 3UG1A 3UO4A 4FV9A 4K11A 3MS9A 2H6DA 3ZC5A 3ACJA 3OEZA 1Q3DA 4JBVA 4GU9A 3F69A 4MQ1A 3RVGA 5C4KA 3KXMA 5CAOA 2P4IA 3QKLA 2C5OA 4GS6A 4MNFA 3GFEA 4DT8A 1IG1A 1TQMA 1VR2A 3H0YA 3FMNA 3Q96A 3KA0A 4FT5A 4QTBA 5EHLA 4AX8A 4U41A 4EONA 4AW1A 1UU9A 4AN3A 5HTIA 2JDSA 3SGCA 4LV8A 2YFXA 4TYJA 4WIHA 4AA5A 3SAYA 4YP8A 2GS2A 3S3IA 4CSVA 5GJGA 1H26A 5AAFA 4HCUA 5EM5A 2WQNA 5F9EA 3MB6A 5KMJA 1KUTA 5I4NA 1BYGA 3ZZEA 4FYNA 4FNXA 3BBWA 3O7LB 4CTCA 4MXCA 4Y46A 5D9HA 3CLYA 3MSSA 3KRWA 4JX7A 5CVFA 2UVZA 5AAEA 3UYSA 5IQFA 4GK2A 1QL6A 3UMWA 4YMJA 5IF1A 3GI3A 3EHAA 3R30A 4G34A 1OKWA 2JD5A 2VTLA 4IBMA 4QPMA 1GY3A 4M13A 5A54A 4D4SA 1PXPA 4L42A 3FJQE 3HV6A 4KBAA 4QD6A 4XRJA 4ANLA 4Z3VA 4EHGA 4L8MA 4E6CA 3IDBA 3ANRA 3PSBA 4GG5A 2WU7A 1KE9A 3R01A 5DRDA 4BCJA 5C8MA 3G90X 3FYJX 4ZTQA 3MDYA 4X21A 2C3KA 2FH9A 4X6RA 3WZUA 3NUYA 4S31A 4AE9A 4AGWA 3W8LA 3MH0A 4MNEB 2B7AA 5KMKA 3HMNA 4FZFB 2XKEA 1KWPA 2WTJA 3TIZA 3DTWA 3NGAA 5BMMA 3FZPA 3Q6UA 4IX3A 4C3FA 5KHXA 4U42A 4D2PA 3TL8A 4J53A 5C8KA 2GQGA 1PXIA 3KL8A 3KY2A 4O84A 4J97A 1UU3A 2QLQA 3EQPA 4FTRA 3LJ0A 4FKWA 4RBLA 3Q9YA 2WHBA 3QTXA 4FE2A 2C6IA 4BF2A 2OBJA 1Q8TA 4FTQA 4TNDA 2VWIA 4Y85A 5HICA 5HE1A 3TTIA 3L8SA 1R0PA 2YITA 1YHWA 1JAMA 3VBXA 3R63A 3R8MA 1U54A 2QOKA 2IZUA 4CMOA 4ZS0A 3K2LA 5HG5A 2YDIA 3N51A 3NNVA 3WZKA 2W4OA 3PJ2A 4ENYA 4FODA 4OTWA 3M11A 3ZBXA 4LL0A 3ZO3A 2HY0A 3NUAA 2ZMDA 3OBGA 4XEYA 4DYMA 1YXSA 2JDOA 2VWXA 3V04A 3W2OA 5L2IA 2JKKA 1Y8YA 3A7FA 3QD3A 3G0FA 4O0YA 5AX3A 5JFSA 2CHLA 4IB1A 4PL3A 3PIYA 3P86A 4KS8A 4IMYA 5E1EA 4WSYA 4IAZA 2WTDA 3HMMA 3CTHA 3RI1A 4ANMA 3QYWA 3EFLA 2JITA 3T9IA 1Q41A 4G2FA 3BQRA 4EUUA 2KTYA 4C3RA 4O0WA 3IW7A 3MI9A 4EOOA 3A8WA 2CNUA 4QPAA 1RW8A 4A4LA 4EOSA 3MESA 2QKWB 5E8ZA 3H9OA 4M0YA 4BCKA 4F6SA 3NX8A 3EN4A 3EQGA 4AW5A 2ETMA 4I22A 3KULA 3OUNB 5L6WL 5TR6A 3CQWA 3FZTA 5CU2A 3QZHA 4I21A 4YURA 3UDBA 3LXNA 4IB3A 3VJNA 3ZRLA 5I9WA 2WXVA 5KO1A 2JIVA 3CEKA 2NRUA 4WSQA 4FT3A 4CD0A 4DN5A 4FV0A 4X3FC 2W99B 3VULA 3R8LA 3TZ8A 3HA6A 4XG7A 1U4DA 4U44A 4O0UA 3ZFMA 5B7VA 3AXWA 3TUDA 3CR0A 1KE7A 4QMLA 4U79A 2OFVA 1Q8UA 3E63A 3ORPA 4ZSGA 4DTKA 4E93A 3F7ZA 1ZZLA 5AIRA 4CGAA 3E87A 3FDNA 2OLCA 2XNBA 3CTQA 3EFJA 2QOOA 4IHPA 2C3LA 4AOTA 5KKRB 5AV1A 3SRVA 4I93A 3ZRMA 4IDTA 4EH3A 5L3AA 1YHSA 3F88A 3AMYA 5C27A 1URWA 1PMNA 2GNLA 4KRCA 2PVJA 3BYUA 4K1BA 3WIKA 4F65A 4KBKA 4RJ4A 3VRYA 4LGHA 5A9UA 4UWBA 2O64A 5J7HA 4MKCA 4UALA 2PMIA 1FQ1B 3MWUA 1REKA 3LFQA 4HYSA 4AN9A 4BTFA 2WAJA 5HNGA 4JS8A 1JKKA 3HYHA 2VTHA 4Y5HA 2V5QA 2HELA 3QQUA 1H07A 4AP7A 3QQKA 1FMKA 4GH2A 4RGJA 3RALA 3OWLA 4D9TA 4ZLOA 1YOMA 3QTZA 1L3RE 2VO6A 4JDIA 4L43A 4RWLA 3QUPA 3TIYA 3V51A 2EVAA 4FG8A 4IZAA 4YBJA 1PXKA 4AXAA 1I09A 2W1FA 2DS1A 2X6EA 3QWKA 4MD8E 4RLKA 4CLIA 4XV9A 4JIAA 3QGWA 5EI8A 2Q0NA 4AZSA 3OXTA 3D0EA 1LPUA 4MXAA 4IWPA 3O8UA 2GU8A 3QTWA 3EJ1A 3QTUA 2RFDA 4RIYA 3CD3A 4O2PA 4XH6A 2BKKA 3HNGA 5CAVA 3QKMA 4KWPA 4OBOA 4CKIA 4DG3E 4OAUC 4YJPA 2QR8A 4A4OA 3PE2A 3QZIA 2GS6A 2W1EA 5DN3A 2CDZA 2ZAZA 3TTJA 3PWDA 4XG3A 4EOKA 4EUTA 4GFGA 4TYHB 5AP2A 3MH1A 3MYGA 2QOIA 3GFWA 1J91A 3PP1A 4MVFA 5ANIA 4TYEA 3VBWA 1UNLA 4JXFA 2JEDA 2XJ2A 5C9CA 3LW0A 2ZMCA 3DJ5A 1WBNA 3QQGA 5M07A 3I60A 3MJ1A 4BDHA 4O0RA 4QMPA 2BHHA 2R3IA 3GCSA 4NM3A 3MPMA 3SRVB 3V6SA 4AOIA 3WF7A 1ZRZA 3NAYA 5FXSA 3CC6A 1JSUA 4JDHA 2QO9A 3H3CA 4XOZA 5HGIA 3G15A 4BCIA 5ETFA 4DEEA 3DU8A 3ATSA 5D12A 1PYEA 5J1VA 3KVWA 5JK3A 3DAKA 4ZY4A 5M44A 2IZTA 4FUYA 4RFYA 4FKGA 4YZ9A 1MRVA 2VO0A 5ANJA 4QOXA 4I0TA 4XP2A 4EKLA 3FMKA 1QPEA 3ZLWA 4MXOA 3ZO2A 3DAJA 2JFLA 3CQUA 2W1HA 4HCVA 1Y6AA 2BTRA 1TKIA 5E8UA 3PZEA 3D14A 4K33A 4EWQA 1AQ1A 3PG3A 4RIWA 4RX7A 1IAJA 3D7TB 4RIYB 4E20A 5I9ZA 3PA5A 1QPCA 4H3PA 2VUWA 2YM3A 3NNUA 1YKRA 4J52A 4BTMA 2ZOQA 5CALA 3JPVA 5KZIA 5KUPA 5EH0A 1Z5MA 3JY9A 4G6LA 4IVAA 1JQHA 3L9LA 2QOBA 5HVJA 1UU8A 5HX8A 1H1PA 4IM3A 2HOGA 4QYGA 3ATTA 4DFNA 3JYAA 2XIYA 4HVGA 2VWYA 5A4LA 5D10A 3GCQA 4TN6A 5HKMA 3BYOA 3MVLA 3IOPA 5DT4A 1F3MC 4PTGA 1Y8GA 1HCKA 3BU5A 5GIOE 4C37A 4CFNA 3ZCLA 4O38A 3UIXA 5FTGA 4G5PA 2UW9A 4WT6A 5LWMA 2ITOA 4UBAA 2IO6A 2OH4A 3F5GA 3UIMA 4AG8A 5EQEA 4HGSA 2PUUA 1WAKA 3I1AA 3R9OA 5AUXA 2OICA 4Y72A 5B0XA 2JLDA 5FDXA 3FLNC 4IAFA 4U6RA 5DIAA 2B9HA 4MAOA 2PZRA 2VX0A 4R77A 5HI2A 1FPUA 2XIXA 4GYGA 3W8QA 3ZO4A 3HX4A 2WMRA 5FP5A 3FLZA 1GZOA 4ZSAA 4EHEA 2VU3A 3H0ZA 2A27A 1FGKA 3ZO1A 3ZONA 4EOLA 1H00A 2PE1A 2ERKA 5AP1A 5E8XA 3OW4A 4FZ6A 3P08A 3FZOA 2ITTA 1T45A 3RAKA 1HOWA 5DLSA 4I4EA 5IISA 1VEBA 2OF2A 2YM8A 2QC6A 4FTAA 3P9JA 1E9HA 4BI2A 2VX1A 3R21A 4E4XA 4EOPA 4ITIA 4KB8A 4D5HA 4L7FA 5IA4A 3PA3A 1JBPE 2GFCA 2XK4A 1ND4A 4HZRA 4D28A 1PJKA 4ORKA 4FNWA 4XV2A 4QRCA 3T9TA 2I7QA 5AAGA 2YCQA 5DI1A 1G3NA 3EQRA 3R02A 4QMMA 2B9IA 3S95A 3VUTA 4CFFA 2PVFA 3BRBA 4YJUA 3ZH8A 3DK3A 3ZS5A 1CM8A 3BGZA 4FKPA 4GJ2A 4O83A 4DGOA 3D2KA 2OI4X 2WMTA 3MY1A 1NVRA 3LFBA 4FG7A 3W2CA 4TXCA 5L4QA 3PSDA 2KULA 3JUHA 3D15A 2WMVA 1LEZA 3Q9XA 4CQGA 3RJCA 2Y9QA 4MBJA 4ZMEA 1JVPP 2G1TA 2ZM3A 2XMYA 4F1TA 2YLEA 5AUZA 4FSNA 5AV4A 5D41A 4QMOA 3CKWA 2YABA 1ZMUA 4EOJA 3IG7A 2ITXA 3ZLXA 5C1QB 3TEIA 3VBYA 1OM1A 3AD5A 3R8UA 4GEOA 2WFYA 3TNIA 2PUPA 2HZ0A 4DFZE 5AX9A 4EQCA 3B2TA 5ANGA 2WU6A 5I9UA 4D9UA 2XKFA 2PMOX 3HMOA 2VTRA 3MN3A 4FTTA 3T8OA 2CLXA 3A61A 3R8VA 3A7IA 2PVKA 2C6LA 4FUXA 2C5NA 3SHEA 4IEBA 2Y4IC 3A4PA 1W82A 2E9VA 2WMUA 3LOKA 3MTLA 3SKCA 4APCA 2BILB 2BDFA 4EI4A 3R7IA 4O21A 1GIJA 1U5RA 2FA2A 4YHJA 1H1WA 3C13A 3UQFA 4XP3A 1H0WA 2UZWE 5CWZA 4ACDA 3FL5A 2OJFE 4ZZNA 2YJSA 3DNEA 4BZNA 3LQ3A 1FBNA 4LOOA 5CANA 2OIQA 4KABA 2OG8A 1PKGA 2XM9A 5AV3A 3W33A 3HRFA 1YVJA 3IW4A 5L8LA 4MTAA 4R8QA 3ZYAA 4BIEA 3UTOA 1RE8A 4PX6A 5HQ0A 4O0SA 1M2PA 2EB3A 2GMXA 2WQOA 2XZSA 5FWKK 3SD0A 5CNNA 3R9DA 3POOA 3QA0A 2YN8A 4C59A 3ORIA 3HLLA 4CT1A 2PMNX 4RRVA 5D7AA 4JIKA 4RIOA 2QVSE 3D9VA 3V5PA 5CSPA 1O6KA 5ETCA 3VBTA 1ZOHA 2JFMA 3EIDA 4V01A 4CFVA 4CFUA 4DGGA 5CU0A 4Z7HA 2R0UA 4X3FA 5EI2A 4WG3A 1FINA 4IDVA 2XB7A 2XS0A 4UMTA 3ZDUA 4AFJA 4G3CA 1A48A 5CAPA 2RKUA 4O1OA 3LFCA 3ZSIA 1WBOA 2BAJA 4PMMA 3TKUA 2BR1A 4D0XA 2W1IA 3G6GA 5A6NA 3FHRA 3ODZX 3R9HA 4ALUA 3R73A 4E26A 4BWPA 4YBKA 4EQMA 5C4LA 4Q9SA 2QKRA 4PDOA 5HCXA 5C03A 1JNKA 1PMVA 5J5SA 3IPHA 3LHJA 4JAJA 4JG7A 2B9JA 4PPAA 4PP7A 4L7SA 3ZZWA 3SC1A 2PZPA 3G6HA 3C50A 3MVHA 4RJ6A 3HKOA 4F4PA 3UNKA 2NNWB 2QNJA 3LFFA 5AUWA 5FQDC 5AADA 5IQDA 2BDWA 3GXLA 4FIJA 4HYIA 4PDSA 3UNZA 4W8EA 3DAEA 4C4HA 3Q52A 4CCBA 4Z7GA 3MY5A 5ACKA 2WKMA 4S2ZA 4WNKA 4DTAA 3BYVA 5CF4A 4UV0A 3SQQA 4QMYA 3QAME 4CG8A 4EJ7A 3C4ZA 2Y4PA 5H8EA 3L8VA 5KKRC 4H36A 3ENHA 4EHZA 3DLZA 4C61A 3RP9A 3IOKA 2WEVA 5IUGA 5CF8A 2XEZA 2WMBA 3PXYA 4BB4A 5IG1A 2PVMA 4FIIA 4FV3A 4IC8A 4O91A 3TDVA 2GTNA 3RWQA 4ZLYA 3C4CA 1IA9A 3QQLA 1XHAA 2OJIA 3A4OX 3UP2A 3CE3A 4BKZA 4M0ZA 3OCSA 4FKVA 4KSPA 4GKHA 3RPSA 4EKKA 4G3FA 3PFQA 2OSCA 3BHYA 5DFPA 3ORNA 4EH6A 3EQCA 4FOCA 3Q2JA 5L6PA 4MCVA 2GCDA 4FF8A 3GU6A 4RX9A 1OPKA 2RF9A 3ZU7A 5LVOA 2F9GA 4GVJA 3E64A 5FXRA 3R7OA 4E6DA 5I9XA 3Q4CA 2WPAA 3DKGA 4U8ZA 5HIEA 3PSCA 3TZMA 3IDCA 3AC8A 3ORMA 2C1AA 4L00A 3WE8A 1P4OA 4FV1A 2VO7A 3BE9A 4M97A 4DH8A 2ZDUA 3NYXA 2XRUA 3BYSA 4H58A 1OKVA 1GJOA 4NSTA 3ZXZA 4C35A 4FA2A 3SLSA 3QZFA 3PZHA 4UB7A 4LUDA 4MH7A 4AGDA 3KKVA 3R28A 2OIBA 4J98A 5M57A 3QTSA 2C68A 2VWZA 5IH6A 1QMZA 2UZBA 3RWPA 3Q4TA 4BHZA 3QQJA 2IVTA 4YZBA 4ZZMA 5IA1A 3AD4A 5IDNA 3VUDA 1YOLA 2ZYBA 4XG9A 2X9EA 1NA7A 2E9OA 3DV3A 3L9MA 5HVYA 3NS9A 5HX6A 3S0OA 3Q9WA 4RPVA 3LFDA 2WZJA 5CXHA 2J5EA 2OGVA 3PJ8A 4ASEA 4JNWA 4PL4A 3R9NA 3R71A 5CT7A 3RM6A 5DMZA 3FAAA 2VWVA 4KIKA 3E7OA 3W18A 1GNGA 2X8IA 5I3OA 2OXYA 3QRJA 2PULA 2BZKB 3C9WA 4K18A 3BGPA 4ZTLA 3JVRA 4N6ZA 4DEGA 4PMPA 4AUAA 3TKIA 4UZHA 3UQCA 3OWJA 2RG6A 5BVWA 2ITYA 2ZJWA 4MBIA 4EHVA 1OI9A 2RG5A 3TT0A 3VWAA 5GJDA 4FV6A 2ZV9A 3PXFA 4DEBA 4R5SA 4BCHA 3HRCA 4PDPA 3QU0A 5D7VA 4APPA 3DB8A 3A7JA 4CQEA 5JN2A 2BAQA 4B4LA 3VO3A 3ETAA 3F3WA 1MP8A 3GCPA 5CSHA 1WVWA 1FMOE 2ZB0A 5L2QA 3BHUA 2BRBA 3LCTA 4O96A 3T3UA 4EYMA 2B1PA 5EOLA 3KC3A 3UNJA 1ZYLA 3F3VA 5E8WA 2WIPA 3AT2A 5CEIA 1Q8ZA 2H9VA 4XG8A 3QYZA 4OAVB 3VF8A 4ACHA 3EZRA 3O0GA 3TNHA 4OTIA 3VN9A 3NAXA 2O3PA 1OL5A 4A4XA 5AWMA 2ACXA 2XNEA 5HO6A 4CV8A 2R3MA 1WBVA 5DNRA 4IAIA 3BE2A 5D11A 4A9YA 4CRSA 2UV2A 4KNBA 4BDGA 2BDJA 4G31A 3E3BX 3UPZA 2I0HA 4YTCA 3F5PA 5L2WA 4IH8A 3IECA 3ENMA 4C58A 4GJ3A 3OOGA 3GC8A 4DEAA 2RSVA 4C4GA 3OZ6A 4JRVA 3B8QA 3VUGA 2PVRA 2VWUA 5CU4A 1KE6A 2O8YA 3H30A 4XLVA 4A7CA 4KSQA 1YWNA 2OJJA 4FL2A 5FD2A 3ORTA 4D58A 2H96A 4B8MA 1S9JA 3CKXA 2J4ZA 4CYIA 2WMWA 4F7JA 1H1SA 3LZBA 3P5KA 4TRLA 3N4VA 1VYZA 3KXGA 1LEWA 4PTEA 2E9PA 5TOZA 3KXHA 3FI2A 4RJ7A 4GU6A 1KOBA 4EH4A 4O7NA 5HBEA 3O71A 1OGUA 2VX3A 5JQ5A 4RZWA 1H01A 3SXFA 3C0GA 4O0XA 4FC0A 4RLLA 2OXXA 3QTIA 3BV3A 4IJPA 1OVEA 3FL4A 4YHFA 3BX5A 1JOWB 3GCVA 4TZRA 2OH0E 5JQ8A 1UVRA 2A2AA 2CN8A 1PRYA 1ZOEA 2FSLX 1JKLA 3A60A 2X8EA 4FMQA 2BRHA 4NEUA 2BUJA 2VTAA 3KCFA 4XX9A 2VAGA 4JBPA 4C2VA 4E4LA 4DBXA 2OZAB 3R6XA 4JT3A 4ONAA 3EFWA 4BTKA 4MNEA 3R1SA 3RK7A 3WYYA 2BTSA 3D83A 3CPBA 4MF0A 2VGPA 4OLIA 5EYKA 3OY3A 5BVNA 3ZEWA 3FLYA 3RBWA 2J50A 4X0MA 4QMQA 4ARKA 4V0GB 2HW7A 3U55A 4GK4A 4FZ7A 2GNGA 4CV9A 5DOSA 1HCLA 1PW2A 2X8DA 3Q53A 5J9LA 4EK6A 4Z55A 1T46A 3I5NA 4FICA 3OWKA 1ZY4A 3R1QA 4CVAA 3I79A 4R3PA 4XJ0A 2CPKE 3VS3A 4BDCA 1Q62A 4O0TA 1WBTA 2UZUE 5HLNA 2PVHA 3UMXA 4X2NA 2GQSA 4ZTMA 3MH2A 1M2RA 2X0GA 3AD6A 1X8BA 4H39A 3QHWA 3PTGA 4JQEA 3BIZA 3OS3A 2AUHA 3F3UA 3NCGA 4JG8A 4RWKA 3IONA 2CKPA 4ANSA 5KHWA 3CTJA 5H8GA 2OU7A 4FKQA 5HVKA 4O7ZA 2WMXA 2QOFA 3DJ6A 1M2QA 2HZ4A 4ASDA 3GQIA 3IGGA 5FG8A 3SOAA 4L53A 1CSNA 4F9WA 4F9AA 3NVKI 4J71A 2F4JA 3RGFA 3UIBA 5LVPA 3K54A 3HV5A 5EYCA 4DFXE 5CVGA 3EN6A 3ORLA 1P14A 5L8KA 3ZXTA 5J9ZA 4O7VA 4QYYA 3LKMA 1Q8YA 3UQGA 1SNXA 4WKQA 4F1MA 4EBWA 3F61A 5I9YA 3VUHA 4E3CA 2W1DA 3MPAA 1XO2B 4R3CA 1LP4A 5HG7A 2CLQA 1NVSA 2CCIA 4D5KA 1PF8A 4ZJVA 5G1XA 2QCSA 4FV8A 3F66A 4CMUA 4FTJA 5DE2A 2YJRA 3RZFA 1OB3A 2VTOA 3E88A 2P3GX 2X2KA 1XQZA 3KXNA 2YM5A 4LUEA 4WG5A 5FM3A 4O82A 3DBDA 5DT3A 5K5NA 1MRYA 3HGKA 3L9PA 3AQVA 3GC9A 2QI8A 4CLJA 5E9EA 2Y4IB 3RPOA 5M09A 2A0CX 3BELA 5E8YA 3WOWA 2C30A 4C57A 2IJMA 3TG1A 2UW7A 4U81A 1PXNA 4IZ7A 1K3AA 2OFUA 5CS6A 3IW8A 3KN6A 2J7TA 2DYLA 2O0UA 1IRKA 3HMPA 3KK9A 2YAAA 3QX2A 4Y83A 4HVDA 4W4XA 5AR5A 5KBRA 1YWVA 3OROA 2R3LA 4KKHA 3C4WA 5CASA 3ZHPC 3OFMA 2UW3A 5KX8A 1FGIA 3QQFA 4P5QA 5AA9A 4FK6A 3AGLA 3OCGA 3U4UA 4J95A 4U5JA 4ACMA 5A6OA 5JSMA 2ITUA 3QGYA 4FSMA 4Q9ZA 3C51A 4R3RA 2VTMA 3P78A 5HOAA 5FEEA 3IKAA 1PHKA 5IQGA 1OKZA 4ZSJA 4KKGA 4EQUA 2CGWA 3K5VA 5IKWA 3BPRA 3O17A 4QYHA 4BKJA 5JFVA 2CKQA 4D1SA 4IACA 3KMUA 4OTGA 3COKA 4HNFA 4NYEA 4AFEA 5LCJA 4FT9A 3BLRA 4NCTC 4QP8A 4ZIMA 3OC1A 2YIYA 2W1ZA 4F6UA 3ULZA 4R7IA 1ZY5A 5ANOA 3VUIA 4UMPA 5K5XA 3DKCA 4I92A 3V5LA 2BMCA 5FUTA 1BLXA 4HGEA 4RFZA 3D4QA 3VS2A 1Z9XA 5AP7A 2XCHA 5CEQA 4O86A 1UV5A 4Q5HA 2QURA 2GNIA 5DG5A 3HV4A 4AA4A 5AP3A 3LM0A 4RIXA 2YLFA 2F7XE 2XUUA 3EYHA 4XYFA 3RCJA 4BRXA 4IB0A 4TYHA 5ANEA 3RHXA 3TJCA 3KRRA 2C5VA 3V01A 1GIIA 4RFMA 2Y6OA 2R4BA 4GVAA 4FKRA 4DH3A 4FSTA 4FSQA 2WD1A 1R1WA 5E4HA 4FSRA 5FGKA 4BGGA 4CZTA 3CP9A 3F5XA 5CSVA 4NL0A 4FZAB 3UGCA 2R3PA 3U87A 4UN0C 1APME 4WNMA 3SA0A 1GZKA 2XP2A 2W17A 5JRQA 1WFCA 4LRJA 3QXPA 3ZEPA 3R7VA 1XBCA 4S30A 4IVDA 3V8TA 4EC9A 4FL3A 2VTIA 1SVGA 2P2IA 3GU8A 3I7CA 1O6LA 2XK9A 3ORXA 5HNIX 3WZDA 3PRFA 2FVDA 5LVLA 2PVYA 4FTLA 3SOCA 2OKRA 5E8TA 2YM4A 4FL1A 4FT7A 1VZOA 2ONLC 3CIKA 4G9CA 4PWNA 4KIPA 2QHNA 4YGAA 4XG2A 4KAOA 4QMTA 3ID6C 3WARA 1W83A 3TWJA 4GT5A 3C0IA 3KRJA 3P23A 3ZTXA 2QU6A 3V8SA 5H3QA 3EL7A 4YLJA 1PMUA 4M68A 4CCUA 1SNUA 2PK9A 5M4FA 4KD1A 1M14A 4XG4A 4EBVA 4PRJA 4AGUA 5DRBA 2R3RA 1DS5A 4GUBA 4LYNA 3D7TA 3FYKX 4AT3A 2F49A 3COMA 3NUUA 5EDPA 5FEQA 4J1RA 5EHOA 5CEKA 2UZDA 3AC1A 5IA2A 4FG9A 2R0IA 4WRGA 5EYMA 2QOCA 1YHVA 1NVQA 4RIXB 5LXMA 4XV1A 3WBLA 4WHZA 5BPYA 1AGWA 1ATPE 2BFXA 2IZSA 3BU3A 4P90A 3BBTB 4I41A 3QRTA 3ROYA 4MK0A 3ZM9A 2J51A 3WI6A 4DEDA 3C0HA 4LMUA 4WOVA 5CSXA 2XKCA 3PP0A 5AP0A 4XCUA 4FT0A 3FY2A 5AUVA 4FTOA 2WMQA 3QA8A 1MQBA 3DPKA 4NTSA 3GP0A 3JY0A 5E8SA 4KINA 5EOBA 2X7GA 3QTRA 3KRXA 4RJ5A 4LOQA 5F95A 5FBOA 3MA3A 4F70A 2BALA 3PPJA 4ALVA 4YLLA 5EHYA 5AM7A 5JT2A 1QPDA 4CG9A 4WBOA 2C6EA 3QD4A 2G2FA 3ZBFA 3FLSA 3FZSA 3VJOA 1MUOA 5CSWA 4HGLA 4ASZA 2JBOA 1NT2A 3QCYA 2O2UA 5LVMA 3PJCA 4OBQA 2HWOA 4M3QA 2EB2A 3DK6A 4I5HA 4C4EA 3LMIA 3UO6A 4N57A 2ITNA 2QD9A 4I20A 3JVSA 1OPLA 3FY0A 4IX6A 5CENA 2HCKA 5E8VA 4MXYA 4IX4A 1YDRE 4W9WA 1BMKA 4EEVA 3WIGA 3F5UA 5CQWA 2C3JA 2O63A 4RZVA 3I0OA 3ZRKA 4DGLC 5BX0A 1WBWA 2WQBA 3OT3A 3QRUA 2PY3A 2C6TA 3HUCA 3AT3A 3O2MA 4O2ZA 4YZDA 1OPJA 2XJ0A 3P7CA 4JAIA 4E5AX 5L6OA 4RQKA 3MTFA 5DR2A 5E90A 5CT0A 1WVXA 4IVCA 4QTEA 4XRLA 5H9BA 2JKMA 3EMGA 2B55A 4D4RA 4CFXA 1H1QA 4YJTA 3AC2A 2ZM1A 4IWDA 4U0IA 2GNFA 5ICPA 3AMAA 3MIAA 4RX8A 2R3KA 2Q0BA 5EKNA 1S9IA 1VYWA 5CI7A 2WMSA 3GNIB 1K2PA 2W96B 4IXPA 1I44A 1W7HA 1OIUA 2ETRA 2UVXA 3GU4A 2GNJA 5IA5A 3HAVA 3F2AA 4GUEA 4C2WA 4QQCA 1H0VA 1ZAOA 4QP1A 3VRZA 2PWLA 5CZHA 4AGCA 4F7LA 3DA6A 3OG7A 3RAIA 4DG2E 2AC5A 2BVAA 3EFKA 3QRIA 2BCJA 3DTCA 3QLFA 3ALOA 5EDQA 2XK3A 5FEDA 4QP9A 4UMQA 4LGDA 5BYYA 2JC6A 5AP6A 4USEA 2R2PA 2W7XA 5K9IA 1XBBA 4A9TA 4A9UA 4YHTA 1QPJA 4RJ3A 2HAKA 3QXOA 3EOCA 4JVGA 3UVRA 2Z02A 4D55A 4H1JA 2EWAA 2HZIA 3FLWA 3W10A 4BDFA 2VTPA 3R22A 5HE0A 3RAHA 3MFSA 2P55A 4GT4A 1Q4LA 3QF9A 5AV2A 3GENA 4ZTSA 3PVUA 4KIOA 5CAUA 5IH4A 3W32A 3PY1A 4AW2A 1ZWSA 1O9UA 4H3BA 3OT8A 2EUFB 4O22A 5HO7A 5ETIA 3R7GA 4L9IA 4AS0A 3KF7A 1ZOGA 4YZCA 4IM0A 5K3YA 2C1BA 4O7YA 4O7TA 3NUXA 4HYHA 3HVCA 3FEGA 3ZOSA 2XBAA 2J0JA 1DM2A 3GVUA 1H27A 4FR4A 4RMZA 5HCYA 3KREA 3TDWA 4JJRA 3O8TA 4Z16A 4D2SA 2YISA 3ALNA 4XP0A 4I1ZA 4L3LA 5DT0A 4HJOA 4E5WA 2O5KA 1P2AA 1YI6A 2UW0A 3MA6A 4LRMA 3KGAA 3HL7A 5HIBA 3C4FA 1F0QA 1B6CB 3QC9A 4GKIA 5EDRA 5IEXA 4DFYA 5HTCA 2B52A 4OTPA 4TPTA 3FXZA 4Y5QA 3Q04A 4UX9A 4K6ZA 3CJFA 3NYVA 3BEGA 2CSNA 4NUSA 1BI7A 1PXLA 4YU2A 5JFWA 2R9SA 3SDJA 1XH9A 4BGHA 2V7AA 5CZIA 3U6HA 2XF0A 5BNJA 3GCUA 4WUAA 4QP3A 4W4YA 2UZLA 2CGUA 4DH5A
chains in the Genus database with same CATH superfamily
4BWXA 2RGPA 4M67A 2RIOA 4BDEA 5H2UA 4PQNA 1V0PA 3EL8A 3N4UA 3RMFA 4QYFA 4BZDA 4AXEA 4EZ5A 4YJOA 2PTKA 2WB8A 2XKDA 5DR9A 3V5JA 2C69A 4ZZOA 3E8EA 3DBEA 5AMNA 3D7ZA 1YXTA 2PZ5A 3WF6A 1O6YA 1UNGA 4O0VA 4YPSA 3H9FA 4C4IA 2FSMX 1MQ4A 4JG6A 3OMVA 2PSQA 4C33A 3VS1A 1NW1A 3UVPA 4A06A 2YWPA 4KRDA 4EK4A 5M08A 5D1JA 2UW8A 2YIRA 4CYJA 4NCTA 3MVMA 4E8AA 4LOPA 2CNVA 4M15A 1G8JA 4EK5A 4NM5A 4QMXA 5LMAA 2CN5A 4I0SA 4WUNA 3LCOA 1ZMWA 3SW4A 2ZDTA 3ZSHA 2BZHB 5ETAA 5JFXA 4AXCA 1KE5A 3COIA 3KRLA 1IASA 3NVMB 3TV6A 2UW4A 4YZNA 2BRGA 2X0PA 3VS4A 3LXPA 2OK1A 4LFIA 5AUUA 2JDRA 1DAWA 3QUEA 3D5WA 3IW6A 3F3TA 3NPCA 2OW3A 4JX3A 3SV0A 4OT5A 3VC4A 2G2IA 2I1MA 3Q4ZA 4ITHA 4R78A 3DY7A 4OTDA 5EKOA 3G9LX 4FKLA 4U3YA 2BIKB 3FQHA 3UOKA 1ZYJA 2GFSA 2VRXA 3B8RA 4MD7E 5CTPA 4ID7A 4LL5A 4Q2AA 3LVPA 5HIDA 4CNHA 5HORA 5I5ZA 1YXXA 2RFEA 3KXZA 5A4QA 2BFYA 4D4VA 4D0WA 3LAUA 4NU1A 3PRIA 4BCGA 4DGMA 3QALE 2R5TA 5JH6A 4L46A 1P4FA 3W2PA 1XH4A 4AA0A 4AZWA 2R3FA 2J0KA 2XJ1A 3QFVA 2VTQA 2RL5A 4X2FA 5HE2A 5LCKA 2EU9A 4RVKA 3RK9A 4AACA 5AR4A 1ZYSA 4C8BA 3TZ9A 2PVNA 3UC3A 2W5HA 2ITVA 2I0VA 3FQEA 4EWHA 4XHKB 2OWBA 3CY2A 2YIXA 5HNBA 4B8LA 5AR2A 2ONLA 4KBCA 2C6KA 3R8ZA 3KN5A 3R9RA 2BROA 4K77A 4YC6A 5JGAA 5IPJA 3V5TA 2BHEA 2GTMA 1OMWA 4QP4A 4W4WA 4IZYA 4G3GA 2G2HA 1BL6A 1K9AA 3LFSA 1JKTA 4O4EA 3MFUA 4MXXA 1J1CA 2YIQA 1XKKA 5CI6A 3W0OA 2OJ9A 1TQPA 1V0BA 4PPBA 5I9VA 3O51A 4D2WA 4BI1A 4QDVA 4M69B 4I5MA 4J8MA 3TCPA 3D94A 1FOTA 4DCAA 5BUIA 3OTUA 4ZEGA 3P4KA 2Z7LA 4FV7A 3OCTA 4C34A 5BYZA 3LXLA 4AU8A 4NFNA 1KSWA 4IFGA 4FTNA 2PPQA 3DQWA 3P1AA 2Z60A 3KCKA 4D2RA 4I5CA 4AQCA 4JDKA 3ANQA 4GYIA 4YC3A 3ZFXA 4I6FA 5L2SA 3QQHA 3VS6A 4O4DA 2VD5A 2WTKB 4EOIA 4CKRA 2FGIA 3DDPA 2WQMA 1SVEA 4B0GA 4UY9A 4IB5A 4MUQA 3NIEA 2EXEA 3GUBA 3WZJA 4N4SA 4U9AA 2XEYA 5J95A 2UZOA 3GU5A 1R78A 1CTPE 3CXWA 1B39A 3UDSA 5A4EA 3MPTA 3C4XA 4R7HA 4ENXA 5BMSA 4UXQA 3DFAA 3CCNA 3W1FA 1WCCA 4AAAA 4X2KA 4L01A 3FLQA 3D5XA 3OBJA 4FV2A 3DOGA 2C0IA 1QCFA 3DLSA 3TNQB 2HY81 2W5BA 3UVQA 5DGZA 5IZFA 3FUPA 1PYXA 5JMSA 2J2IB 2VTNA 5K4IA 5FBNC 1GZNA 2W4JA 4FV4A 3LLAA 1UU7A 2BAKA 4FKUA 5AV0A 4YJRA 5C26A 2W9FB 3SVVA 3FKNA 4O81A 5EM8A 3DFCB 5CEMA 3UPXA 4TYGA 5J5TA 3I4BA 1J1BA 2J9MA 1OL2A 2PMLX 2XH5A 5DHJA 2IPXA 2JKOA 3TNWA 3FHIA 5HG8A 3OY1A 4NTTA 4GK3A 2YZAA 3OEFX 4FYOA 3OHTA 2QG5A 3OP5A 4EH7A 4BCFA 4ANBA 3LIJA 4LRKA 4G3EA 3LFNA 3PLAE 5GZ8A 2WOTA 4UYNA 2G01A 3IW5A 4IAAA 4QP2A 5B2KA 4C62A 1Q5KA 4BYJA 4EORA 4DFBA 2XARA 3O7LD 5JZJA 3O8PA 4FNZA 3F3ZA 3MIYA 5DEWA 1ZYDA 4QP7A 1UWJA 2FB8A 3G0EA 1UKHA 3E3PA 3MVJA 4HZSA 5EW3A 3BWFA 3E93A 5HU3A 3R83A 2X4ZA 4O6LA 4W4VA 2OZAA 5K0KA 2PE0A 2IN6A 3EWHA 2C0OA 3ZDIA 2W1CA 4F0IA 2GDOA 4R5YA 2ESMA 2XIKA 1U5QA 3EN7A 2QLUA 4V05A 3BLQA 2IW9A 4UWCA 3HAMA 3LXKA 2XNMA 3NIZA 4F63A 2WEIA 1M17A 2UZTA 4QQJA 4V0GA 4BBEA 3RPRA 3FQSA 3L8XA 4DEIA 4JL9A 4BJJA 3ORZA 3GOKA 4GT3A 4USFA 2CKOA 2PE2A 4AE6A 4RX5A 3FMLA 2UZNA 2P33A 3W2SA 4FNYA 4DGNA 5IQBA 2OZOA 1Y91A 4QTAA 2JIIA 3FMHA 1M7QA 4YTFA 1XWSA 4ANOA 3PWYA 4PNKA 1BL7A 5I3RA 5L2TA 1BI8A 2PHKA 3NNXA 5KZ0A 2PL0A 2XALA 5TE0A 4YJSA 4ZS4A 4NM0A 1XH6A 3GGFA 4B7TA 3V6RA 3FSKA 1KV1A 3BWJA 1XH7A 3AT4A 3JS2A 3PXKA 4FKTA 5HE3A 2E9NA 4NIFB 4F9CA 1WZYA 4RWIA 4D1XA 3KF4A 5HD4A 2B53A 4IVBA 2I0YA 2J90A 5GZAA 4ZSEA 4F9BA 5FTOA 3VVHA 2FO0A 2XYUA 2BZJA 4FIEA 4FRFA 4MWHA 3NW7A 5KMOA 5IQCA 2ZV8A 4IC7A 1H25A 4TWOA 4ZJJA 1TQIA 3A2CA 5EQYA 4EYJA 4AXDA 3KU2A 4YUQA 5GNKA 5M06A 1R3CA 4DLIA 3ZLYA 4HCTA 2VTJA 4PPCA 4F1OA 2VZ6A 3O23A 3TJDA 2JDVA 5CEOA 2W1GA 1J7UA 3MB7A 3CS9A 1SMHA 4QMNA 3U6JA 1R0EA 4UWYA 4DEHA 3VONA 3PUPA 4FJVA 2XNOA 3ZUVA 1OBGA 3FSFA 4K9YA 4PNIA 5HTBA 4YNEA 3LCKA 3NLBA 5KMIA 4AZEA 3Q5IA 4DC2A 2C0TA 3NUSA 3CGFA 3RZBA 4ANNA 4DTBA 1PXMA 2VV9A 2GS7A 3POZA 3TUCA 4Q5EA 5TKDA 3W55A 2ZB1A 2IW8A 2IVSA 1FVVA 5GINE 3OVVA 3U9NA 3LFAA 2QODA 2C5YA 3M1SA 3PXZA 4ANQA 1KOAA 1G5SA 3DZQA 4IANA 2DWBA 4I4FA 5ANKA 1CKIA 1IAHA 3AG9A 5A4CA 4O6EA 3IO7A 3UE4A 5IEVA 2J5FA 4FX3A 5J9YA 4MD9E 2F2UA 1E1XA 3L9NA 4C0TA 2V0DA 5IDPA 3GBZA 3EQIA 4UMRA 2Z7SA 3A62A 2ITPA 3LLTA 3I81A 2GQRA 3VS5A 2HK5A 2WNTA 5JGBA 3ODYX 5EM7A 2GHGA 1JKSA 4LMNA 4ZLZA 3ML1A 3FMMA 3NNWA 5C01A 4DCEA 2BRNA 3SG9A 3DBQA 5LQFA 2QONA 2XNGA 3QZGA 3EKKA 2XRWA 3U4WA 3FMJA 3FWQA 5HLWA 4C4FA 2ZV2A 1DI9A 4EH5A 1Q97A 4O7WA 3SXSA 5BUJA 4ZJIA 3L1SA 3VNTA 4YO6A 3HA8A 3S1HA 4EH9A 5JKGA 3LQ8A 4J96A 4ZK5A 3LJ1A 4EK8A 5GJFA 1JPAA 4R7BA 4FGRA 3GC7A 3FI4A 3ELJA 4R1VA 3KMWA 4BZOA 3PLSA 4EL9A 5IUHA 1LUFA 3LPBA 4FSZA 3O96A 5IQIA 1YDSE 5A4TA 3PPZA 5AUYA 3R0TA 2BRMA 4DA5A 5HHWA 2PZIA 3DZOA 4MWIA 3QX4A 4FIGA 4IAYA 3R1NA 5FM2A 2YM6A 4EH2A 3NCZA 4S33A 4K2RA 4XS2A 5IMEA 3EYGA 4XNEA 4BY9E 3C7QA 4P7EA 3VS0A 3HV3A 3JXWA 4M12A 4EK3A 1WBSA 4FVPA 4PUZA 1W84A 3M42A 3Q4UA 4TYIA 4L67A 4QQTA 2X7OA 5J7BA 4PY1A 4FEWA 3HRBA 3ORKA 3PFYA 3PIZA 5GHVA 3VF9A 3TUBA 3OOMA 1AD5A 2WGJA 4FV5A 4FKSA 1IEPA 1KE8A 2HZNA 2BIYA 1YXUA 4IAKA 4TWNA 5AP5A 5L8JA 4DH1A 4YR8A 2JDTA 4D4YA 4FKIA 1CKPA 3DK7A 1G8SA 2Y0AA 3FMDA 4IWOA 4KS7A 2FSOX 4EJNA 3ZUUA 3VUKA 4OTRA 2W06A 3FKOA 5F20A 1XBAA 1Y57A 4OTFA 3MGYA 3PIXA 4PV0A 3GB2A 4GG7A 2C5XA 3LE6A 4JBQA 4JOAA 1WVYA 4JRNA 4WBBB 3DNDA 4CZYB 2E9UA 3FI8A 5ANDA 1OECA 2Z2WA 3TACA 4G6NA 5LMKC 3PA4A 3PVGA 4FTMA 5BVOA 4X3JA 2YAKA 3ERKA 4WNOA 4P5ZA 5M4IA 1OZ1A 2DUVA 2JAVA 3R1YA 5CXZA 5DVRA 3VUMA 4WO5A 1SM2A 2I0EA 3I5ZA 4FTIA 1OBDA 2VNWA 3Q2MA 1W2CA 3IQ7A 2YCFA 1PXOA 3E8DA 2I40A 3FZ1A 5I0BA 2HYYA 5G6VA 4A9SA 3DKOA 2YDJA 4OUCA 3CPCA 4F7SA 3P79A 4TT7A 2Q83A 1CKJA 3FV8A 5AR3A 3L8PA 4WG4A 3V3VA 4E6QA 3OD6X 3EN9A 1BX6A 3DDQA 1A9UA 2ITWA 5J87A 3QC4A 4FEVA 4J7BA 1G8AA 5HESA 2BZIB 5AM6A 4BCPA 4ZAUA 1GZ8A 4YSMA 3MJ2A 5BVEA 4QPSA 3F7WA 3F2RA 1UNHA 2WTKC 1RJBA 1STCE 1VJYA 4K0YA 1JSVA 1J3HA 3II5A 2WMAA 5CU6A 4YPDA 5KNJA 4E4NA 3BCEA 4FI1A 4FKJA 3TV7A 2REIA 4BWKA 2A4LA 2RFNA 4XV3A 1H28A 3FZRA 3QCSA 3QD2B 3UODA 3ZMMA 5HBJA 3A7GA 4I5PA 3LCSA 5FLFA 3S00A 1PY5A 1Q24A 2V55A 2Y7JA 3JR1A 2F7EE 5HLPA 4MX9A 1U54B 4QMWA 3R2BA 3OXIA 3CBLA 4PP9A 4U97A 1H4LA 3DGKA 3U8WA 3DCVA 3GEQA 4BCNA 4FSUA 2JIUA 2VO3A 2YM7A 2F7ZE 4RJ8A 3ZC6A 5IU2A 2YCRA 3WILA 3W16A 2OXDA 2F2CB 4NH1A 3UYTA 3UOHA 5A14A 4PMTA 4FK3A 4HOKA 2X2LA 3P7AA 4TW9A 3V5QA 3QCQA 4DBNA 4U45A 4O7LA 4IZ5A 1YW2A 4FTUA 5DH3A 5IEYA 5IA3A 4KUJA 2HW6A 1ZLTA 4KA3A 3FXWA 3DS6A 2VWBA 1PMEA 3TV4A 4D2VA 4BI0A 3HEGA 5C8NA 2QHMA 5EQPA 4B9DA 5F94A 4F99A 3MFTA 5IQEA 5A3XA 5LOHA 3BLHA 3EQHA 5GZ9A 1Z57A 2FUMA 3NW5A 4AT5A 2ITZA 1OITA 1YDTE 1YRPA 5EYDA 4HVSA 2G15A 3SX9A 2UW6A 4JLCA 4W8DA 5BV3A 2B9FA 1V0OA 1WBPA 3NYNA 2CGXA 2O65A 3FMEA 2VN9A 4RVLA 2IF8A 3EH9A 4B99A 2R3NA 4NT4A 5IH5A 3KULB 4EOQA 4USDA 5EK7A 4QNYA 4M66A 2CNQA 4G9RA 3WF8A 2YDKA 2PYWA 1GIHA 4RA4A 4M8TA 3MV5A 2P2HA 2QQ7A 4FVRA 3KB7A 3IDPA 4IX5A 4MQ2A 3Q9ZA 3TNPC 3OTVA 3QCXA 4BTJA 3E8CA 2X39A 4L52A 5DYJA 1GOLA 4A07A 3MW1A 1W98A 2ETKA 4C36A 5CVHA 3QTQA 4XMOA 3FC2A 3CY3A 2XANA 5B2LA 4MHAA 4C7TA 4QMSA 5AP4A 3PUFC 4V04A 2UUEA 3NSZA 4FVQA 3IS5A 2BKZA 4YJQA 3BI6A 4BHNA 5K0XA 3GC0A 4G17A 4F64A 3SG8A 3CGOA 3V5WA 2WTCA 5FTQA 4BCQA 3ACKA 5HEZA 3QRKA 3UBDA 2B54A 4QTCA 5J79A 4AN2A 4FZDB 3UG2A 5BQ0A 3OXZA 5J1WA 4CFWA 3NEWA 3NW6A 1H08A 1J7IA 1U59A 2Y6MA 5DA3A 4BDJA 4BICA 2GHLA 3UOLA 4BGQA 4BDDA 3S2PA 3NR9A 5JRSA 3A99A 3BHTA 4OR5A 4OGRA 3U51A 3H9RA 2X4FA 4BBFA 3NUPA 4O27B 3PY3A 2W5AA 4LGGA 4MXZA 5F1ZA 3KFAA 4X6QC 3G5DA 4ZTRA 2X81A 4HNIA 4TWPA 1OL7A 3PDTA 3K3JA 3ZFYA 3F6XA 1CMKE 4PL5A 4X2JA 5AR8A 4ITJA 2QOLA 3VW8A 3FBVA 4ZP5A 4N6YA 4E7WA 4PDYA 3UJGA 1BUHA 3R04A 5GIPE 3A8XA 5M4CA 2I6LA 3KEXA 2IVUA 4IE9A 1GAGA 3K5UA 1Q99A 3EKNA 3Q3BA 4TY1A 2FSTX 4C4JA 3HDMA 3PVBA 4BCOA 4HW7A 4AZVA 1JSTA 1OL1A 3I0QA 1YWRA 2UZVA 2H34A 4CEGA 3W0PA 2R3JA 3EQBA 1XH5A 2A98A 4J99A 3BHVA 4ZMFA 3HECA 5HBHA 3R8PA 3DXPA 3DQXA 4NWMA 3QWJA 4H3QA 4JBOA 4ZXTA 3RHKA 1DAYA 1SYKA 3LMGA 4JI9A 5M53A 3QUDA 5JZNA 2XM8A 4NK9A 4ZY6A 1IR3A 4IJ9A 4W9XA 3RKBA 3DXQA 4M14A 2J0IA 2W0JA 4D1ZA 2GHMA 3NDMA 4FKOA 4C02A 4FSYA 5IMXA 3VBVA 4ERKA 4IADA 2QO7A 5EW8A 3R7UA 2PZYA 3UC4A 1W0XC 2R3HA 4GRBA 2X1NA 5IUIA 4B6LA 1PXJA 2R7BA 1CDKA 1OKYA 4GCJA 3QKKA 3BZ3A 5HZNA 3G33A 2HENA 4X7QA 3NWWA 3AGMA 4F08A 3KIOC 4JR3A 4CFMA 3PE1A 2WIHA 2XIZA 3G2FA 5TT7A 3R7YA 4OT6A 5AJQA 5BVKA 3UZPA 4RC4A 3PJ3A 3RINA 4D2TA 3GU7A 4QMVA 4DDIA 3F2NA 3E92A 3TZ7A 4YNOA 5ACBC 3VS7A 4DH7A 3DB6A 3E62A 4AWIA 4YLKA 2B0QA 2GPHA 4ALWA 2W9ZB 2XNNA 1BKXA 3RTPA 3DT1A 4ASXA 3AC5A 4Y73A 4DINA 4JR7A 2LGCA 4QTDA 4YTHA 3TM0A 2PU8A 3HZTA 2XIRA 3FE3A 3G51A 4F0GA 2C47A 3G9NA 2VGOA 3RAWA 1UWHA 2R3QA 2X7FA 4ACCA 4RIWB 3C1XA 2ZM4A 4AZFA 2R7IA 3ZM4A 2IW6A 5CX9A 4RVMA 3S4QA 2WOUA 1OL6A 2DQ7X 4L6QA 3CQEA 2ERZE 2XA4A 1ZMVA 2HXQA 3FC1X 3FPMA 3BKBA 4XUFA 5LVNA 3MY0A 4A9RA 4EH8A 2QR7A 4QMUA 4RQVA 3ULIA 4BVUA 4G1WA 1ZXEA 3VW6A 4AZTA 4GMYA 5TO8A 4M84A 4BKYA 2YWVA 2GNHA 3O50A 3LFEA 4DITA 2QU5A 4BDKA 4H05A 1V1KA 2J6MA 3AMBA 2QOQA 3HV7A 4I94A 3RCDA 4CMTA 5JEBA 4WRSA 4NKAA 5AIKA 3QD0A 4L3PA 4HVHA 2A1AB 1ST4A 2JGZA 4BDIA 2UW5A 5BVFA 3C5UA 4HPUE 5H8BA 2XK6A 5KE0A 4XBRA 2CJMA 2XBJA 4FBXA 4DAWA 2UVYA 3PVWA 4HGTA 4GW8A 3AC4A 3D2IA 4II5A 2GSFA 4Y95A 5HG9A 5E91A 4EC8A 2IG7A 2F57A 3BEAA 3HMIA 4TTHB 3QHRA 4NM7A 2OIDA 4BN1A 3FPQA 4NZWB 4AOJA 3BHHA 3OUKA 4TKSA 2NO3A 4G6OA 2W4KA 4QMZA 5FP6A 4AW0A 5LMKA 3B2WA 5T3QA 3RK5A 3R2YA 2YEXA 4RVTA 3LMHA 3RM7A 3DKFA 4I24A 5DEYA 3MFRA 5BYLA 3RPVA 4GIIA 1M7NA 3P0MA 5J8IA 4QO9A 2A19B 3VQUA 2E2BA 4IQ6A 4M69A 1YXVA 3A7HA 1JWHA 2IZRA 3I6UA 4FEQA 4LI5A 2C6OA 5CNOA 5M55A 4QT1A 5E1SA 1KV2A 4OTHA 4L3JA 3WF5A 2IVVA 2YACA 3AC3A 4IIRA 5DBXA 4U3ZA 5LMBA 2C4GA 2PUNA 3BYMA 1FVRA 3OWPA 4CXAA 3HP2A 4X2GA 2X9FA 1REJA 2V62A 4Y8DA 5HD7A 4HVIA 4N0SA 4RT7A 4NW5A 4MF1A 4E6AA 2OO8X 3QBNA 3HDNA 2YCSA 2CGVA 4BBMA 5DWRA 4S32A 3U9CA 2NRYA 2AQXA 4C3PA 5HCZA 4JMQA 4G5JA 2EXCX 4GSBA 5ITAA 3QL8A 2J0MB 3REPA 3KK8A 3PXRA 3CD8A 3W2RA 4F6WA 4QP6A 3UZRA 4I6HA 3MBLA 2ZV7A 4E1ZA 4F7NA 4FIHA 5A46A 4GIHA 1E1VA 2WTVA 1ZARA 2JAMA 1NXKA 4FIFA 4XG6A 4M7IA 2QO2A 3VHEA 4DE4A 4FTCA 1PKDA 2JKQA 3F82A 3H10A 3RNYA 1YI3A 3OW3A 1H24A 1UA2A 3BU6A 4NJDA 3ZLSA 3CSVA 3U54A 4WNPA 3WE4A 4DLJA 1RDQE 3DXNA 5F4NA 4F0FA 3DBFA 4I3ZA 4E4MA 5CY3A 3Q6WA 4GFOA 1MRUA 2G9XA 3ZSGA 5FDPA 2PUIA 3N4TA 3EN5A 3ITZA 3R7EA 3EQDA 2WO6A 1EH4A 4GL9A 1L8TA 3I6WA 5DPVA 1WMKA 4RG0A 3BQCA 4N70A 1Q61A 4YC8A 2NP8A 4BCMA 4DG0E 4PTCA 2P0CA 1J7LA 4JDJA 4BR3A 3D5UA 1YI4A 1R39A 4OTQA 4BIDA 3C4EA 5KMMA 3IK3A 3TKHA 3TN8A 1XJDA 2X6DA 3PPKA 4AT4A 4QNAA 1NY3A 3CJGA 3LCDA 4ZY5A 3PYYA 5T68A 2AC3A 3N9XA 2C6MA 3W0QA 1OUKA 4BYIA 4YTIA 2W05A 4X3FB 5FXQA 2WQEA 4U7ZA 3THBA 1VLRA 3BV2A 2HIWA 4E73A 4O7RA 4CZUA 1Q8WA 4IW0A 5BUEA 4BC6A 1SZMA 5BVDA 2XK7A 3C5IA 4LM5A 4LG4A 2UZEA 3KXXA 1TFFA 4IFCA 2FYSA 3WZEA 5CU3A 4S34A 2VWWA 3UP7A 3E7VA 2R3OA 3TI1A 5HU9A 4AF3A 4WA9A 1F5QA 1ZZ2A 1ZYCA 3COHA 2J0LA 2YIWA 4BFMA 4FTKA 4ACGA 5AEPA 5AUTA 3EZVA 4ZTNA 3GT8A 4UZDA 4KKEA 3OCBA 4U43A 4PF4A 5KBQA 3SW7A 4MYGA 1RQQA 2XK8A 4IWQA 5AR7A 4JQ7A 5M4UA 4TL0A 4NFMA 1H1RA 3UO5A 3U6IA 2VTSA 2HXLA 3OF0A 4ZOGA 3KVXA 5AFVA 2ZVAA 3EQFA 4TWCA 2Z8CA 3RPYA 4MEDA 3W2QA 4EZ3A 3PY0A 4CRLA 1ERKA 4U80A 2WTIA 4NW6A 5TF9A 1FVTA 1Q3WA 3E5AA 3HP5A 3T3VA 5KCVA 4NKSA 3TXOA 5JGDA 3LQ5A 2HWPA 3DJ7A 4YO4A 2R64A 2V7OA 2YA9A 2SRCA 4NIFA 4QYEA 4UYAA 2X2MA 4R1YA 3WF9A 5DR6A 4ZSLA 3VQHA 1DI8A 4E5BA 3H4JA 3AOXA 3TMOA 4R6VA 5CYIA 4LV5A 4WD5A 3VBQA 1SVHA 4O7SA 4XBUA 2B4SB 4ZTHA 1YQJA 2XVDA 2OF4A 4UXLA 5E7RA 3KQ7A 3UDZA 2JBPA 2CMWA 2Z7RA 2QG7A 5FRIA 3Q60A 5LARA 3ZUTA 1XH8A 3KMMA 4J8NA 4L45A 2YZLA 1OIQA 4G3DA 4OBPA 5T6KA 2NPQA 5AA8A 2V22A 4MBLA 3D5VA 2OJGA 4XLIA 2AYPA 1OIRA 4BDAA 4FEUA 5CAQA 4Z9LA 3Q32A 4CTBA 4CKJA 3UZTA 4EOMA 3DBCA 4RC2A 2ITQA 2VTTA 4G16A 4YJVA 4F09A 1JLUE 4IM2A 4HPTE 4RA5A 4DFLA 3P7BA 4BIBA 3WYXA 2YERA 5IA0A 5M51A 4YZMA 1OUYA 2C3IB 4I6QA 4RSSA 4FEXA 5HO8A 1P5EA 4OW8A 4HYUA 4FOBA 4PMSA 4GFMA 3I7BA 3VHKA 2QOHA 4QQ5A 2CKEA 4BDBA 5CF6A 5E92A 3RNIA 5IQAA 3R00A 3O5AA 3MH3A 4NJ3A 1UKIA 2EXMA 4P4CA 5LJJA 4H1MA 2PVLA 3PG1A 1A06A 2BPMA 1URCA 3GQLA 4EZ7A 2WTWA 5KMNA 3UOJA 4KIQA 4RC3A 2CCHA 1M52A 2LAVA 2X0QA 3VAPA 4U40A 5CLPA 4TNBA 1IA8A 2XYNA 3NUNA 4KIKB 5EI6A 3BGQA 2WELA 4UEUA 3NMUF 4LQMA 5EW9A 1B38A 5CF5A 5KMLA 3VIDA 4DFUA 2C6DA 2XNPA 5IQHA 4FGBA 3PJ1A 4L44A 3NFGB 5M56A 3UIUA 4I6BA 5CQUA 2YHVA 3K3IA 5EG3A 3ROCA 3PXQA 2R3GA 3GOPA 5K4JA 4CT2A 5LWNA 1W8CA 4I0RA 4DT9A 4XOYA 4FSWA 4C38A 2IWIA 1U46A 5CEPA 4YJNA 2Z7QA 1LR4A 1YOJA 2RFSA 3SXRA 4GV1A 1TVOA 4P2KA 1H8FA 4DHFA 3F9NA 3NYOA 3HUBA 3NZ0A 5EM6A 4ERWA 2H8HA 4YSJA 2VNYA 3LM5A 3EB0A 3E8NA 4L68A 4RWJA 4I23A 1Y6BA 4DF3A 4K8AA 3FI3A 1OIYA 4BL1A 3ET7A 3FKLA 5EFQA 1XR1A 2Y8OA 4JQ8A 4UMUA 4F9YA 3NRMA 4O1PA 3IGOA 5B2MA 3LJ2A 3Q5ZA 2XCKA 3FXXA 3M2WA 3V8WA 3QLGA 3UG1A 3UO4A 4FV9A 4K11A 3MS9A 2H6DA 3ZC5A 3ACJA 4LV7A 3OEZA 4QEBA 1Q3DA 4JBVA 4GU9A 3F69A 4MQ1A 3RVGA 5C4KA 3KXMA 5CAOA 2P4IA 3QKLA 2C5OA 4GS6A 4MNFA 3GFEA 4DT8A 1IG1A 1TQMA 1VR2A 3H0YA 3FMNA 3Q96A 3KA0A 4FT5A 4QTBA 5EHLA 4AX8A 4U41A 4EONA 4AW1A 1UU9A 4AN3A 5HTIA 2JDSA 3SGCA 4LV8A 2YFXA 4TYJA 4WIHA 4AA5A 3SAYA 4YP8A 2GS2A 3S3IA 4CSVA 5GJGA 1H26A 5AAFA 4HCUA 5EM5A 2WQNA 5F9EA 3MB6A 5KMJA 1KUTA 5I4NA 1BYGA 3ZZEA 4FYNA 4FNXA 3BBWA 3O7LB 4CTCA 4MXCA 4Y46A 5D9HA 3CLYA 3MSSA 3KRWA 4JX7A 5CVFA 2UVZA 5AAEA 3UYSA 5IQFA 4GK2A 1QL6A 3UMWA 4YMJA 5IF1A 3GI3A 3EHAA 3R30A 4G34A 1OKWA 2JD5A 2VTLA 4IBMA 4QPMA 1GY3A 4M13A 5A54A 4D4SA 1PXPA 4L42A 3FJQE 3HV6A 4KBAA 4QD6A 4XRJA 4ANLA 4Z3VA 4AXFA 4EHGA 4L8MA 4E6CA 3IDBA 3ANRA 3PSBA 4GG5A 2WU7A 1KE9A 3R01A 5DRDA 4BCJA 5C8MA 3G90X 3FYJX 4ZTQA 3MDYA 4X21A 2C3KA 2FH9A 4X6RA 3WZUA 3NUYA 4S31A 4AE9A 4AGWA 3W8LA 3MH0A 4MNEB 2B7AA 5KMKA 3HMNA 4FZFB 2XKEA 1KWPA 2WTJA 3TIZA 3DTWA 3NGAA 5BMMA 3FZPA 3Q6UA 4IX3A 4C3FA 5KHXA 4U42A 4D2PA 3TL8A