4RX9A

Syk catalytic domain complexed with a potent pyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
277
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Discovery and profiling of a selective and efficacious syk inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rx9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rx9A01
2FH9A 3FKNA 2WMSA 3CIKA 4L46A 2I0HA 4MHAA 4EK5A 4R8QA 4DT9A 1WZYA 2BDJA 1SNUA 2PU8A 2CCHA 3QC4A 1OPJA 3HUBA 4E93A 4CYJA 3MA6A 1Z5MA 5HCYA 4F6UA 3R28A 5FQDC 3CQWA 3Q60A 1Z9XA 2XVDA 2XK9A 3NEWA 4I0TA 4ARKA 3FMKA 3I7CA 5DA3A 3NUAA 2CSNA 4FVQA 4WOVA 4ZTHA 2R7IA 3UNJA 1ZLTA 4J96A 2C6EA 3GU5A 4ERWA 3N9XA 2RFEA 4FMQA 1YI4A 5D9HA 2JKMA 4AFEA 4ZSAA 5EQYA 4A06A 2ITZA 4V0GA 5C1QB 1A06A 3CKXA 1VZOA 2ITYA 2R2PA 3AC3A 2QODA 3CD3A 3C9WA 1KOBA 3BPRA 4FGBA 3UDBA 4ANBA 5E1SA 4NFNA 5I4NA 3NUSA 4BGQA 3HMMA 1SYKA 3EYGA 5ETIA 2VWZA 3SOAA 3NYXA 3PJ1A 4I0SA 4B7TA 4O0SA 5HI2A 2QG7A 3KEXA 3BZ3A 5HQ0A 3GI3A 4F0FA 4WRSA 4BCFA 1YDSE 3MVMA 4IVDA 1ZOHA 3E64A 5AUXA 4DC2A 3BBWA 4EYJA 3BELA 3D83A 3QALE 4N6YA 4MD7E 2WQOA 4RVTA 3QHRA 2Y4IB 2J51A 2WTVA 1CTPE 3DBFA 4IZYA 5HE3A 3PIYA 4FX3A 4NKSA 2HXQA 4X0MA 5L2WA 2X4FA 4QPAA 3WYYA 3PE2A 4CT1A 1ZYSA 2BZHB 3AMAA 3OZ6A 4O91A 4C4FA 3IW5A 2WQMA 3BV3A 2IO6A 4GCJA 2YIXA 3PSCA 4D4YA 4USFA 1Y57A 3MIAA 1OECA 3Q5IA 4IVAA 3VNTA 4AZWA 3KXMA 3FI3A 1H1RA 3GCPA 4YZCA 3R8ZA 3TIZA 4RJ6A 5LQFA 4Y5HA 2OG8A 4O0TA 4RJ7A 4XRJA 5BVKA 4RA4A 4I22A 2PHKA 3DJ5A 4RVKA 1WBVA 4FSNA 4U3ZA 4ZZMA 3OOGA 4EOLA 4QYGA 3NUPA 4BCOA 4KKHA 5KO1A 1FGKA 4FV3A 4GYGA 3AT2A 2W1GA 4ZSGA 1L3RE 4GT3A 2GNLA 1KE6A 4O38A 4G17A 5DHJA 2FSTX 3F5GA 1HCKA 5IPJA 4RX5A 4A9RA 4FKSA 5EG3A 4YMJA 2WZJA 3R02A 1ZYLA 4UWCA 5KKRC 5KZIA 4ERKA 4PL4A 4IMYA 3OBGA 4CT2A 3O8UA 2RFDA 2PZ5A 2GTNA 2JFMA 4GMYA 5AP0A 3RK5A 3TI1A 2ERKA 2HW6A 2Y0AA 4LRKA 4UZHA 4YJNA 3SX9A 1G8SA 3AGLA 5ANIA 4M68A 4HGEA 1BKXA 2R3OA 4FTAA 5DN3A 3ELJA 3EQBA 4O2PA 4CZYB 4EJNA 4P5QA 2VTQA 1YWVA 4X7QA 2RFNA 1PKDA 3ENMA 4J8NA 3PJ3A 3GC8A 5GJFA 4RX9A 4NIFA 4WKQA 4U79A 3A62A 3QCYA 2IW8A 4D2WA 3FYKX 1FBNA 2OICA 1KE9A 3D14A 2P2HA 3FMEA 2A2AA 2FA2A 3LFSA 3R1SA 2YDKA 3OWLA 2H8HA 2XK7A 2ZV7A 3FSKA 3QWKA 4JT3A 3ZZEA 3UOJA 5K4IA 1SZMA 3CS9A 1ZAOA 2XNPA 1JBPE 3NCZA 4W8DA 2XF0A 4OBPA 4JG8A 4OTGA 5DPVA 3V51A 4C7TA 5FUTA 4QP8A 5JH6A 4N0SA 4DFZE 2YISA 4V0GB 4YSMA 5CU2A 4N57A 3FI4A 2ITUA 4LV5A 3QFVA 3IPHA 4H1JA 4ACMA 4C0TA 2JIIA 4O1OA 1V1KA 2I0YA 4TWOA 4FTQA 3O2MA 4B4LA 4BCQA 4L3LA 1LPUA 2YFXA 4FV1A 3VHKA 4QYEA 3OP5A 4EUUA 3L8VA 2XIYA 4EWQA 3E88A 4I6HA 2W1ZA 5DG5A 5C27A 2E9UA 3GOPA 3ZC5A 3LCSA 4M13A 3ZC6A 2WQNA 3EN5A 4IZAA 2ONLA 5E8TA 4RX8A 4J98A 3UPZA 3ZUUA 3PP0A 4BZOA 1Q41A 3IDCA 2XRUA 4FTRA 3Q6WA 3UBDA 3QRUA 3PXKA 4MNEA 5I9WA 4EK6A 3WZDA 3FC1X 3FQHA 1GZOA 2R3QA 1M7QA 4RGJA 4TTHB 5AV2A 4Z55A 5HG7A 3LCDA 4X21A 1OMWA 1UNLA 4XG6A 4AXAA 4FF8A 4EQUA 5CF8A 1ZZ2A 3QZIA 4DEGA 4M69A 3LW0A 3A7IA 3DXPA 1KE5A 1ZWSA 1M17A 4MCVA 4KABA 2E9PA 2WIPA 3FDNA 3QL8A 2GSFA 3NR9A 4IJPA 1Y6BA 3OTUA 3M2WA 4MKCA 3S3IA 1NY3A 4A07A 4EL9A 4FNWA 1H1SA 3TDWA 3PE1A 4YLLA 3BQRA 3ZXZA 4APPA 3OUKA 3ULZA 1OUKA 3PA3A 5BYZA 5HD4A 1YXUA 2YAKA 3D94A 3C5IA 3W55A 2REIA 3I79A 4LFIA 4FG8A 1RDQE 3AC1A 4G3FA 2HZIA 4G6LA 3NNXA 4QP9A 4ASXA 3U6HA 1A48A 2YM6A 2XP2A 4B8LA 4X2KA 2C6DA 3MFSA 2JDTA 5ANKA 4R7BA 1GZNA 3DAJA 3K2LA 3MPTA 4D0WA 3KULB 5CF5A 4QRCA 2UVZA 3DCVA 5AA9A 5J9ZA 3Q4TA 3MH3A 3TUDA 3VUMA 3AD5A 3OFMA 4RLKA 4AQCA 5GNKA 3AC8A 4NCTA 4RJ8A 4DITA 2GDOA 3BU3A 5JQ5A 4C61A 5IEVA 2PY3A 3AT4A 4MNFA 2UZOA 3I6WA 4BHNA 2B1PA 3HLLA 3KF7A 1FPUA 4LOOA 3VS0A 4X3FC 4DH5A 3QRTA 1OIRA 4CQEA 3U55A 5H3QA 2OFUA 5EM8A 4JVGA 4NIFB 3CPBA 3SC1A 2WAJA 3QTWA 4ACCA 4YO4A 2H9VA 3BE2A 3HNGA 4K11A 5LOHA 3P78A 4CFXA 3ZUTA 4W9XA 4NZWB 1A9UA 3IS5A 4AGCA 3VBYA 4IVCA 4FEWA 5HO6A 1WBTA 4RSSA 2Y6MA 5BMSA 3EFKA 4GT5A 2XIRA 4BTJA 4F6SA 3CTJA 2W17A 2EB3A 2QCSA 3HMNA 5EYMA 5BUIA 5CT0A 5EM5A 3GNIB 3BHUA 4O7TA 4RWLA 4ALUA 4YBJA 3LJ1A 2HZNA 3ZLSA 3ZLYA 4OTHA 2B9IA 2IN6A 5BVWA 4AWIA 2V55A 3PIXA 2WNTA 4IWQA 2WMQA 2HW7A 4KWPA 4F7SA 3SAYA 4AZTA 1HCLA 1WVYA 4P2KA 4J53A 2PUUA 3MDYA 3D15A 2HAKA 4G9CA 4LOQA 2CKPA 2W1FA 3HA8A 1DAYA 3IOPA 4KKEA 3KQ7A 3ZSHA 4FIFA 3R04A 3LJ2A 1SVHA 1K2PA 1ZXEA 3D5VA 4YHFA 2VTOA 3FZRA 4CEGA 1W84A 2O65A 4MNEB 4GUEA 4YJVA 4RZWA 2UZVA 4FIGA 3PSBA 1YKRA 4Z16A 4CLIA 4QQTA 1PMEA 1R78A 5B2MA 3DA6A 4CLJA 4IDVA 4AW0A 3UOLA 2WEIA 4D9UA 4ZK5A 4FKVA 4JBPA 5KCVA 3CY3A 3BLQA 4Y46A 3R73A 5HCXA 2GQSA 4CMOA 4QTEA 5EI8A 1PXMA 2XM8A 2BAKA 4IWPA 1TQPA 2JITA 3IKAA 4LRJA 1OKWA 1Y8GA 1QL6A 2C3LA 4U81A 4DEAA 4FEVA 3QUPA 5AP3A 4CVAA 1UWHA 4MQ1A 5T6KA 3R1NA 4LGHA 4HOKA 5AWMA 3ALOA 5HTBA 3RCDA 2EXCX 4AGWA 5GJDA 2YM4A 3MVHA 3GU6A 3PXYA 3QRIA 4M84A 2GHLA 3DS6A 1J91A 2YIWA 1PMUA 3TIYA 4ANLA 4BIDA 3QD2B 3GOKA 4I6QA 1JSTA 3EL8A 3SVVA 5J87A 2F9GA 5AMNA 3SG8A 2V22A 1Q8ZA 3AMYA 5EDRA 5C8MA 4CTBA 4IZ7A 4IM3A 2PK9A 5DEYA 3V5QA 2J9MA 4O21A 3EOCA 3KB7A 3PXZA 5IQHA 4I41A 4F99A 1GZ8A 2WTWA 2YWPA 3L9MA 5A6NA 3G0FA 5BVFA 3A7GA 4EI4A 5LJJA 1JKLA 2O3PA 4S33A 4W4YA 5LVLA 3R7UA 3V5LA 4Y95A 3DKFA 4GUBA 3QX2A 2IPXA 5DGZA 4KB8A 2G2FA 4BWPA 3ITZA 3MVLA 4O0XA 3KK8A 5HD7A 5A9UA 4GFOA 1BMKA 3LCKA 4GS6A 3R7OA 4A9SA 2FYSA 4BGGA 1Q4LA 3OC1A 4K33A 3MY1A 5AEPA 3V5WA 5LMKA 3BLHA 2UW9A 3POOA 5DLSA 3W18A 2F2CB 5IDPA 2GNFA 4TL0A 4O81A 3R7EA 2BTSA 2BRGA 5FLFA 3U6IA 2PZIA 2XZSA 3DNDA 4L67A 1PRYA 4ANMA 2C1BA 2J0IA 2W1HA 3B8RA 3Q53A 4GK2A 2PVNA 2YERA 3KRRA 3PYYA 4QQCA 2X2LA 2PULA 3VUTA 4CKJA 2C47A 3Q5ZA 1URWA 2UZEA 3R2BA 2HXLA 3OTVA 4FV0A 4RFZA 2G9XA 4DH7A 2OJJA 4IXPA 2BTRA 2BCJA 4U6RA 3QYZA 1STCE 5CWZA 3VQHA 3P7CA 5IG1A 2IZUA 5CEKA 5L6PA 4Z7GA 4AN2A 3E8NA 4DLJA 1RW8A 4M66A 3U6JA 1W7HA 4FZ6A 4ZAUA 5LXMA 3L8XA 4EK3A 5LARA 5BUEA 2OZAB 3V5PA 3FY0A 4BDKA 5LWNA 2X6DA 1UKHA 4K6ZA 5AP1A 2ZMDA 5EM6A 4D1XA 4DINA 4FT5A 1J3HA 3OF0A 5IQFA 1FVRA 4LI5A 5HLPA 4GFMA 2R3NA 4IAYA 3AGMA 3H0YA 4E4MA 1LP4A 3E7OA 3QQUA 4EOQA 5FD2A 3QTIA 4LUEA 4X2JA 2YM7A 4O84A 1H07A 1LUFA 3PPJA 3MJ1A 2VTAA 4CCBA 2KTYA 4CMTA 1GZKA 3AD4A 2Z2WA 3ID6C 2PSQA 2X8IA 3HRFA 4FKTA 4ZOGA 5J9YA 2GPHA 3DY7A 5FXQA 1AQ1A 5CALA 4AGUA 5IA3A 2AUHA 3LFAA 3TUCA 4I94A 3OWJA 3R8PA 1GJOA 1CKIA 3VIDA 2VTHA 1IEPA 3CC6A 3QCQA 5ANOA 1WBOA 3RKBA 3U87A 3QQGA 3O51A 4ACGA 3FLWA 4JI9A 2EU9A 5EW3A 2XNNA 4TPTA 4CFNA 4MWIA 3QZFA 4LQMA 2FGIA 4YSJA 1YXXA 2UW5A 4J97A 1WBNA 2C68A 5AUVA 1HOWA 5I9YA 3LE6A 3SDJA 4E5WA 3QCSA 3RPSA 4MTAA 1PW2A 2PUIA 5CEQA 1U59A 3C7QA 4EKLA 4AP7A 5IH5A 1XH8A 4GIIA 3HMPA 5CVHA 4AN9A 4F64A 2DUVA 2YITA 1GOLA 5DRDA 2WTKB 4HYUA 3Q6UA 5BUJA 5CVFA 2VGOA 5CNNA 1YWNA 2A27A 4XP3A 3VRYA 4D58A 3WBLA 4KIKA 2XBJA 5FEQA 2R0UA 4FKQA 4WUAA 5D41A 3PDTA 4ZXTA 3EN6A 3UIUA 3MPMA 1U4DA 1V0OA 5M06A 5L6WL 4F0GA 4QMQA 4O0YA 3W32A 4D5KA 5CLPA 3FPQA 3R9HA 4J52A 3NVKI 4FTUA 4GG5A 4P90A 4IBMA 4JX7A 2LGCA 3DPKA 4WNMA 2DQ7X 3U8WA 3ZXTA 4QP1A 3OY3A 1FVTA 5HE0A 4BBEA 4YTCA 2HYYA 3EB0A 3FWQA 3BHVA 2P3GX 3NUNA 3R6XA 2C3KA 4EQCA 4Y8DA 3SRVB 1WBWA 5KMOA 5M51A 1CSNA 2C5VA 3RVGA 1OBGA 3FSFA 4BC6A 1R0PA 4R5YA 4JG6A 4UN0C 3QUEA 1OIQA 3QQHA 2A1AB 5HTIA 2VUWA 4C59A 3BHTA 2C5XA 5FTGA 2IW9A 5IA2A 4FT9A 3ZRLA 3IQ7A 1XH6A 2C3JA 1T46A 3FQEA 4PDPA 4ZS0A 2NRUA 1KE8A 5KMNA 5EDPA 3EFLA 4ITHA 4OTRA 3S0OA 3SG9A 5AP4A 3UG2A 4EWHA 5KBQA 2F2UA 4XNEA 2YM8A 3I4BA 4K9YA 5IMEA 1QPEA 5M53A 3V5TA 5FTQA 5HG9A 5IQAA 3ANQA 3W33A 2VO6A 5EI6A 2PMLX 4DGMA 3DK7A 2E9NA 4GU9A 4BWXA 2BFXA 4DCAA 3UZPA 3VBXA 3R21A 1OM1A 2JEDA 4D2SA 3NCGA 5BNJA 3BI6A 3KRWA 2O5KA 2W0JA 3PA5A 4Y5QA 2ZV8A 3UIBA 4E73A 5M4FA 3I5ZA 3ZUVA 4H1MA 4XLIA 4R3CA 3O8TA 5E8SA 3R9RA 4DE4A 5IQBA 1XKKA 2WB8A 3QTRA 4AZVA 4M8TA 3SOCA 2J0JA 2BAJA 3O23A 3DXNA 1JVPP 4BY9E 3NW7A 2VTPA 3NLBA 4JBOA 4I5MA 2QOOA 4BI0A 4JDHA 5IH6A 4XYFA 3Q32A 4CFUA 4OW8A 1YWRA 3QGWA 4GIHA 3ZSGA 5BX0A 5EQEA 3PG1A 1J7UA 4QO9A 2B9HA 4PTCA 3BV2A 3KN5A 1NVQA 4YZ9A 2VTNA 4EOMA 3OEZA 2QO7A 3NRMA 3UYSA 4U40A 1M14A 4J8MA 4GL9A 3TUBA 5CI7A 2QD9A 4K2RA 5HORA 3EIDA 3Q3BA 4B6LA 4R1YA 2X9FA 4BCJA 4DA5A 4XJ0A 5ANJA 5JEBA 2BAQA 3OWKA 4FTKA 1UU7A 3ORLA 3LMIA 1BLXA 2H34A 4F9BA 4D0XA 3ZRKA 4FSWA 3TCPA 4RJ5A 4KIKB 3COMA 3DKOA 5KKRB 3MFRA 4EOIA 2X8DA 5T3QA 2QG5A 3QX4A 4UYNA 3FMHA 5HKMA 4FG9A 5CT7A 3TKUA 2XNEA 5HG5A 4F0IA 4BTFA 1PJKA 5A46A 4ID7A 5KMIA 3CE3A 2CGXA 1VYWA 1REKA 3UNZA 4R78A 1DI9A 3H10A 2R64A 4G34A 1MRYA 4MBIA 3R8LA 3TL8A 5HNIX 3D0EA 2VTJA 2IVUA 3FZOA 5AR3A 4X2FA 5K4JA 3CP9A 3JXWA 4QMWA 4O82A 5E91A 4BKZA 3OMVA 3G51A 2YIYA 5EFQA 4KRCA 1W8CA 4FIIA 3S4QA 3QQKA 4H3BA 4IQ6A 2B0QA 3RZBA 2EXMA 1Q8UA 3FE3A 2EUFB 3HV7A 2PE0A 2QI8A 4BHZA 4E6QA 4LMUA 4E3CA 4ZLOA 2YCFA 5G6VA 3VBTA 4D1ZA 3UNKA 3WARA 3MY0A 3WOWA 3G15A 4EZ7A 4O7ZA 3DFCB 3EL7A 4TWPA 5C01A 4MD9E 4QMPA 3TNQB 4C4EA 1FMOE 3GCVA 5AIKA 4QNAA 4P4CA 3DAEA 3O96A 2UVYA 4QQJA 4U80A 5AP5A 4I21A 5K0KA 3W2SA 4EOJA 2GFCA 2W5HA 3LIJA 3ODYX 5LCKA 3Q9XA 5EI2A 5FDPA 4FKRA 5CAPA 3D9VA 2WO6A 2R3IA 1BUHA 2JGZA 4MH7A 2HOGA 4MXOA 3IONA 5IA1A 4ZEGA 1ZY5A 1IASA 4IB3A 3GB2A 3HV5A 3JS2A 3UO5A 5E8VA 2HIWA 2CDZA 4NSTA 3BE9A 3G33A 3E93A 2UZDA 4AW1A 3ANRA 3UC4A 4CZTA 4MF0A 3ATSA 3I6UA 2JFLA 3HV3A 5TO8A 5AR2A 2R3HA 2C69A 4KS8A 4A7CA 5HBJA 5IUHA 5LVNA 3G6GA 3KRLA 1MQBA 5EK7A 4EHZA 3KKVA 4EH7A 3VVHA 5AP7A 3ZO1A 3SHEA 1KV1A 2BHEA 2OIBA 2VWYA 2ESMA 1RE8A 3MVJA 4HJOA 2VZ6A 1OB3A 4WNKA 3DLSA 4C2VA 3UQGA 3F2RA 3F7WA 4G6OA 4ZTRA 5C8NA 2PE1A 2GHMA 4AOJA 1H1QA 2E9OA 1H4LA 4KSQA 2WIHA 3TV7A 1E9HA 1PXJA 5K9IA 3P23A 2XRWA 5A4LA 4JXFA 2CMWA 1U5RA 3H9OA 4HVHA 4O7NA 3FXXA 1WVWA 4TNDA 4WRGA 4DEIA 3NSZA 5HNGA 3C4WA 2I7QA 4BBMA 2WXVA 3EKKA 3LVPA 2VO0A 4KA3A 4C3RA 5JK3A 1I09A 2BILB 5L2IA 2QNJA 4LUDA 5CZHA 3NMUF 2X2KA 4QTCA 3VW8A 2JLDA 1OI9A 4FV5A 2FSMX 2BVAA 4EORA 4JDIA 5EYDA 3DFAA 4G1WA 3I1AA 3W10A 3PJ2A 3L9LA 3BYVA 3EKNA 4BIEA 4WNPA 4FTTA 2CHLA 5B0XA 4YJRA 4BTMA 3P86A 3K5VA 2W1EA 3Q4UA 4FKOA 4RRVA 5IA5A 4AZEA 2BKKA 4PF4A 1GIJA 5FGKA 3RWPA 2XB7A 3VBWA 4DEEA 4JQ8A 5AR7A 2XKCA 4QOXA 2OJ9A 5EHYA 5J5TA 1OVEA 2BZKB 4IAKA 3MH0A 2ZAZA 4X3FB 2BPMA 2BHHA 5ACKA 1YI6A 3E87A 4EOSA 3OVVA 4LGDA 5F20A 4ALVA 3FLQA 1H00A 4CG8A 4JDKA 4BGHA 2QOIA 3N4UA 3E5AA 3FPMA 3Q9YA 5IISA 3MBLA 1KV2A 3HYHA 3V6SA 5B2LA 3RINA 4FTJA 2UZNA 3V01A 2W05A 3V8TA 2W06A 2A19B 2G2HA 2RIOA 2XJ1A 2R3JA 3EN4A 4FSQA 3TNWA 3UODA 3FMNA 3CGOA 2BRBA 2GU8A 5ACBC 3WF8A 2ERZE 1PY5A 3WILA 2WMXA 4BCNA 4NL0A 1ZOEA 1OL2A 3GUBA 2CPKE 2HCKA 4AT5A 5CASA 4G9RA 5F4NA 2BDFA 4AX8A 4IDTA 3ULIA 1SMHA 3GC9A 4H39A 4TZRA 3TKIA 4F65A 4LYNA 1LEZA 1UNHA 4N4SA 4E6AA 4BDBA 2WQEA 5CI6A 5LWMA 1KUTA 3KULA 3EYHA 4BYIA 4OTPA 2GTMA 3PLSA 3B2WA 3ACKA 3TKHA 5A14A 3VRZA 3EN9A 2VTLA 2OIQA 5BVOA 1Y91A 2UW8A 4DF3A 3E8DA 4AG8A 3OHTA 3BHHA 2NP8A 2XKDA 3QF9A 2XKFA 3QTXA 2UVXA 3ZBXA 4IB0A 5HTCA 5CQWA 5LVPA 4XP2A 3R7IA 2X0GA 3WF6A 4WO5A 5E8XA 4I20A 2PVYA 5BVNA 5HEZA 4DGGA 1PXLA 4FVPA 5G1XA 3VS5A 4ASEA 3HGKA 3ORPA 4DTAA 3ENHA 2R4BA 3FLZA 5FG8A 1Q99A 4G5PA 4A9TA 3PXQA 1TQIA 3VBQA 4TWNA 3UP2A 1Q62A 4PX6A 4DBNA 3VUIA 3C4CA 3PP1A 4FC0A 3RAKA 4NH1A 3KFAA 3A8XA 3K5UA 4YZMA 1URCA 2CN8A 2VWWA 3RGFA 1JSUA 1OITA 4AE6A 5I5ZA 1JQHA 4RJ4A 3UO6A 5E4HA 4LRMA 2J0KA 4ASZA 2GQRA 3EQIA 4CFWA 5HVJA 5FTOA 4F9YA 2B9JA 4FTIA 2PUPA 3QTZA 3HVCA 4RMZA 3MS9A 2ZDUA 2XK6A 3VS4A 3FZSA 4FSYA 3TT0A 2OXXA 5DNRA 3R83A 4DTKA 1IRKA 1H1PA 1V0BA 4PTEA 3ZLWA 5DEWA 3OXIA 2B7AA 3E8CA 2YABA 2VV9A 3AC4A 2VGPA 3O0GA 4OT6A 4YJPA 5D11A 2FSLX 4YZNA 1OL7A 3SD0A 4DEBA 5BQ0A 3A4PA 3LFQA 1CKJA 3V8WA 1R0EA 1IA8A 4D9TA 2CNQA 4U0IA 2GQGA 2ZMCA 4JLCA 3KF4A 3PWYA 2BDWA 2XK8A 3NDMA 4XV2A 4YJUA 2UW0A 4DEDA 4EBWA 4XOYA 3UIXA 3S1HA 3D7TA 3D5WA 2WHBA 5CSHA 4NEUA 2X7FA 3EQHA 2V62A 3DDQA 4MVFA 3WIGA 3S2PA 4HPTE 2YHVA 2W99B 3BYOA 2Y8OA 4UZDA 1O6YA 1OIUA 2J90A 4C38A 3QRJA 2UW6A 3QXOA 2IVTA 2A0CX 1W82A 4G3EA 4EH3A 4QYHA 1QPDA 5GINE 4E6DA 2Z7QA 4FL2A 4RX7A 4UMUA 5A4TA 3T8OA 4DH8A 4F7NA 4O86A 3A61A 3OWPA 4E4NA 2Y6OA 2GNIA 3NX8A 2JDSA 3EZVA 2ITTA 4FL3A 2XS0A 3FLNC 5FEEA 2ZM1A 5CAOA 2BUJA 3LJ0A 5IF1A 2UZUE 3W16A 4I6FA 3ZRMA 4O0RA 2PVLA 2ZVAA 5CYIA 2ITPA 3Q4ZA 5HX6A 3CD8A 2ETMA 1CM8A 3LOKA 5H8GA 4O0UA 2B54A 2XK3A 3MIYA 5HLWA 4FTCA 3V5JA 3N51A 4ENYA 1YVJA 2BRMA 4LV8A 3SXSA 3UG1A 4OLIA 3UJGA 2VWIA 4NK9A 4GRBA 5D1JA 4FK6A 4HYIA 4X6RA 4WIHA 1F0QA 5HG8A 3ZONA 3HX4A 4UYAA 4XG2A 3LCOA 4IWOA 3FXWA 5F9EA 1H0VA 2IVSA 5E7RA 3VJNA 5T68A 2UW4A 2FO0A 2QURA 2VX1A 4L9IA 1UWJA 3QC9A 3UE4A 4YP8A 2WEVA 4Z7HA 2G1TA 3DBEA 3MYGA 5CSXA 4ZSLA 3R8VA 2PE2A 3MFUA 3TXOA 3ZO4A 2XJ0A 3DOGA 3RNIA 4DGNA 5HBEA 3UC3A 5A3XA 1M52A 2VWUA 3BYSA 3QHWA 3LCTA 4C4JA 2VNYA 4F1TA 5AUWA 3EH9A 3UGCA 4I93A 3AT3A 4L01A 2PVHA 3COIA 4UMPA 4FL1A 2C6IA 1H1WA 4EH6A 4E1ZA 4S30A 3A4OX 4JDJA 2C0OA 4PMTA 3VS7A 5H8EA 3S95A 3TTJA 4C34A 4ALWA 2PZYA 3NAYA 4TNBA 2IW6A 4FKGA 4OTFA 4V05A 3H3CA 3ZMMA 4HVIA 5M4CA 4CGAA 4U41A 5IDNA 2ITOA 3O71A 4FUXA 4E8AA 2C3IB 2YM5A 3G2FA 4XOZA 5KMMA 2OGVA 3RI1A 5KMJA 2JDVA 3CTQA 2V7AA 3F3WA 1TQMA 2WMWA 3PXRA 4MYGA 3FL4A 4ZIMA 4C62A 4F09A 5AUUA 3JR1A 1FQ1B 2QOCA 3ORNA 3R8MA 4Q5HA 3LFBA 2B52A 2OZAA 2EB2A 1MUOA 2WTCA 4EOPA 4QPSA 4J71A 2GNJA 4BYJA 1Q97A 2RG6A 5FXSA 5KBRA 2OXYA 3VULA 3KCFA 4HYSA 3WIKA 5IEXA 4H58A 4DT8A 4YJSA 4FNXA 4C3FA 2X7OA 3D7TB 5CX9A 3R63A 2OWBA 4KNBA 4QP2A 4H36A 4FTNA 4APCA 2Z60A 2XM9A 1XH5A 4FIEA 4ZP5A 5IQCA 3CQUA 4BDAA 2IG7A 5IEYA 4E20A 1DS5A 4EC9A 4RIWA 5HO7A 3KRJA 1UV5A 3U9NA 2JKQA 4KIQA 4GKIA 3WZEA 2H96A 5FBOA 4D4SA 3OT3A 4R1VA 3GFEA 3WF9A 4W4XA 3LAUA 1LEWA 3QXPA 3M11A 2O64A 1Q3WA 3U4WA 4QMLA 4EZ5A 3SA0A 3NIZA 5M07A 4QTDA 3LXPA 3ORZA 4GT4A 5CANA 4FICA 1W83A 4KBCA 3R1YA 4MEDA 4YC3A 2WMTA 3DT1A 4YZBA 5FM3A 2X1NA 3OCGA 4GVAA 5CENA 3FV8A 4M7IA 1JPAA 2PL0A 1BI7A 3LQ5A 5DYJA 4QMYA 5AM6A 3KMUA 5FM2A 4FV9A 2O0UA 5C03A 1UA2A 4M0YA 4FZAB 5J8IA 3LFEA 5HVYA 4UALA 3WYXA 5LVMA 2OKRA 5JZJA 3FMLA 5LMKC 3TDVA 5M4IA 2PMOX 1YDTE 4F08A 5HOAA 3OG7A 4YTHA 4I1ZA 4IX5A 1F3MC 4XS2A 1X8BA 2C5YA 1RQQA 5GIPE 1M2PA 4IB1A 3W2OA 1F5QA 4EOOA 4CV8A 2WMAA 3ZDIA 3BBTB 5ANDA 3E92A 3L8PA 5CXHA 5JRQA 5L6OA 1H08A 3A7FA 4TXCA 3UZTA 3RWQA 4UWYA 1P4OA 4KIOA 3CSVA 2KULA 2F49A 3OBJA 3NIEA 4BCIA 2QONA 3CCNA 3OW4A 3QD4A 3SRVA 4BDEA 4EH8A 3HAVA 2Z7LA 4EHVA 5L8KA 2P0CA 4F1MA 3B2TA 3QKMA 3AOXA 1W98A 3CXWA 4RC4A 4NWMA 1Q5KA 4AA5A 4E7WA 2ZM3A 1YDRE 3COHA 2VN9A 2CLQA 3A2CA 5L4QA 4ENXA 4UY9A 4WNOA 5J9LA 1XBAA 3P1AA 4F7JA 1OL6A 2R3FA 5JGBA 1YHSA 5CU3A 4FKIA 4ZLZA 3JY0A 4KD1A 3QRKA 2PWLA 4IM2A 2QR8A 5M56A 4YC6A 2F7ZE 3MFTA 4FYOA 4L68A 2ZV2A 3GFWA 5FBNC 4DFLA 4YO6A 2UW7A 4DGLC 4DTBA 5BYYA 3ZM9A 3DGKA 1OIYA 3MN3A 4OBQA 4XRLA 4EC8A 4NKAA 4USDA 4D55A 3E3BX 4BDFA 5C9CA 2OO8X 4L3PA 5EQPA 2VTTA 4IZ5A 4BCGA 4I5CA 4C8BA 2QU6A 2X7GA 4S31A 2IWIA 4L43A 4FR4A 4UB7A 2F7EE 3DKGA 3BX5A 4NYEA 1OPLA 4GW8A 3VW6A 2JIUA 3BHYA 4RIWB 3VAPA 4ZZOA 4UEUA 5BPYA 4FKWA 2AC5A 4FT3A 3W1FA 3HRCA 4MBLA 3I7BA 4R77A 2C6MA 5I9ZA 4TRLA 3FLYA 5HLNA 4PMMA 3THBA 3F3ZA 1H28A 3D2KA 3LM5A 4BIBA 1GY3A 2BMCA 2QU5A 3HEGA 4FIJA 4JRNA 4CRSA 5IA4A 5KMKA 3UO4A 3U54A 1P4FA 2X6EA 3DV3A 4TWCA 2C5NA 3MH1A 3QD0A 5FDXA 3QQFA 5EOBA 4BB4A 1OUYA 4ZJJA 1PXKA 3PSDA 4QP3A 2C0IA 4IC7A 4ZTSA 2JDRA 1VJYA 4YLJA 4O7LA 3IGGA 3UQFA 3PVUA 1PYXA 2JKOA 2RGPA 3CPCA 4EH5A 4AT3A 2GFSA 2NPQA 3GQLA 4U9AA 5IQIA 4RPVA 3G5DA 5AX3A 4YJTA 4AA4A 2QLQA 3ZSIA 2HK5A 4CRLA 4GJ3A 4GG7A 1G8AA 4AE9A 1H25A 4JAIA 4R5SA 4GU6A 4UV0A 3FY2A 4EOKA 3ZOSA 1OGUA 2GS6A 2J7TA 4C02A 2W7XA 4CZUA 3A60A 4DG2E 5I9VA 3R7YA 4J7BA 5CTPA 4CNHA 4BCHA 3LMHA 2C1AA 4M3QA 3DLZA 3FBVA 5LMBA 1NXKA 4NTSA 3MA3A 3TEIA 3ACJA 2YJRA 2WTDA 1JNKA 2QO9A 4J99A 4KKGA 4RFMA 3BU6A 5CEPA 3RHKA 3KU2A 3TTIA 4ZTLA 2YA9A 4GV1A 2G2IA 3FI2A 3O17A 3RPRA 5DFPA 1JWHA 3DNEA 2BRHA 1Z57A 2W9FB 2BIKB 3VWAA 1MP8A 2HENA 2Z8CA 3FHRA 1SVEA 2WMVA 3NNVA 4O1PA 4HYHA 2VAGA 4U8ZA 3LFCA 3COKA 5CXZA 2OI4X 2YLFA 3ERKA 1YXVA 2XBAA 2WU7A 3KCKA 4P5ZA 3KXHA 3ORMA 4II5A 3D7ZA 1ND4A 4JQ7A 4U97A 2PPQA 1VR2A 2OK1A 4YPDA 1KOAA 3MESA 3CJFA 4OR5A 2WPAA 4O7WA 3KVWA 3UVRA 2OXDA 2NO3A 3PIZA 5LMAA 2J50A 3FC2A 5IQDA 4DFNA 2O63A 4NM0A 1PMNA 1XBBA 3R00A 2O8YA 3VS6A 1RJBA 4NJDA 4QMMA 1YHVA 3OXTA 3LHJA 4XG4A 4IWDA 2W4KA 4IHPA 3GXLA 1WMKA 5AV1A 4PMSA 4FSUA 5DWRA 5A54A 5EYKA 3ZFMA 4EBVA 3I5NA 4I0RA 3C4XA 4YURA 4FG7A 3KXNA 3UVQA 1OZ1A 3LLTA 3BU5A 4RFYA 4AA0A 2IZRA 4HZSA 5C8KA 5FWKK 2C4GA 3PVWA 1YW2A 3VJOA 1BL7A 2UUEA 2XYNA 4GSBA 5JGDA 1H8FA 5GHVA 4FKPA 1BX6A 4TYHA 3C4EA 4W4VA 3BKBA 2OJGA 2PVMA 1PXIA 4LMNA 4U45A 3TNPC 3FKOA 5CAUA 5K0XA 2XUUA 2X8EA 4PNIA 1ATPE 2R7BA 5M55A 4ACDA 4B99A 4O7RA 5BYLA 3GCQA 3SV0A 3RTPA 4NT4A 4FUYA 2FB8A 2DYLA 2PTKA 4EH2A 5CEOA 3F2NA 3FMJA 4U5JA 1L8TA 4U43A 2VWBA 4FEXA 3QD3A 4F9AA 1DAWA 1CMKE 5AR4A 2FVDA 5AP6A 1ZYDA 4N70A 4RIOA 4HGSA 1ZARA 4NCTC 5CEIA 2PVKA 4S32A 5EDQA 2CKOA 4PWNA 3QKLA 3R8UA 4FTOA 3A99A 3TG1A 2Q83A 2I1MA 2XA4A 5CU0A 1J1BA 4CV9A 3C5UA 2CKEA 3EQFA 4L8MA 3T3VA 2RFSA 2VTIA 2UV2A 2XMYA 4FOCA 4XCUA 4HVGA 3TZ9A 4O7VA 1NVRA 5IKWA 4BICA 3QCXA 1B39A 4FVRA 2ACXA 2YEXA 4FKUA 3AMBA 4YGAA 2B53A 4GH2A 2W1DA 4JX3A 4F9CA 3A8WA 4PP7A 4PUZA 3HMIA 3PRIA 4HNFA 4WSYA 4AACA 2GS2A 1MQ4A 1H26A 3E63A 2Y4PA 5CS6A 2R3PA 4IAZA 4Q9ZA 1UU3A 5F94A 4LG4A 2ZB1A 3DK6A 3F7ZA 5CAVA 3SXRA 4X3FA 3POZA 3NZ0A 4BI2A 4E5BA 3ROYA 3EJ1A 4O0VA 3PWDA 4XLVA 4RWIA 3KXZA 4AF3A 4KBKA 3W2CA 4AT4A 3K3JA 2CNUA 5GIOE 5IUIA 5C4LA 1B6CB 1PF8A 4FI1A 4NW5A 1PKGA 2W96B 1S9JA 5JRSA 5IUGA 3PJCA 1WVXA 4YHJA 2VTRA 4O7SA 3RPOA 3LMGA 4DFXE 4J1RA 5CAQA 4MF1A 5DI1A 3V3VA 2FUMA 2X4ZA 4BRXA 3JUHA 4E5AX 2BRNA 1ZY4A 5BVDA 4L52A 1YOMA 4EHGA 4ZTMA 4CCUA 2JAVA 4WUNA 5DOSA 1ZMWA 1PXOA 4JIKA 4O6EA 1KWPA 2WGJA 3C1XA 4KINA 4UMQA 5M08A 5E8ZA 3M42A 4MD8E 5KNJA 4ANQA 2YN8A 3HKOA 3WF7A 5DT4A 2BROA 4RIXA 4XX9A 2QOHA 4FSRA 2Z02A 3DJ7A 4M0ZA 4A4XA 4K8AA 4RIYB 3HL7A 1XHAA 1H0WA 1ZOGA 3U51A 3QWJA 4AZSA 2VRXA 4Z3VA 3BEGA 5C26A 5JQ8A 3ZHPC 2HY81 4TYJA 1IAHA 1JLUE 2OJFE 2QQ7A 4R3PA 3NNWA 4F6WA 4OGRA 1XH9A 1ZMVA 3PVGA 4MK0A 5ETAA 1M7NA 2C6OA 3LLAA 4R7IA 3EWHA 2J0MB 5D10A 1XH7A 3C0GA 3P08A 4TYHB 3WZUA 2IZTA 4OAVB 5K3YA 2OSCA 3AC5A 4LL5A 5D7VA 5EOLA 5HIBA 3VC4A 3BGZA 4K18A 5DMZA 3OEFX 2UZBA 4MAOA 3R01A 3SQQA 2V0DA 4ACHA 4EK4A 4RG0A 5I3OA 3T3UA 5J79A 3G9NA 5EW8A 4U44A 3JVSA 3DU8A 3HUCA 4TKSA 4F4PA 2CKQA 3PLAE 4CFVA 4JR3A 4XP0A 3PG3A 3OS3A 4B8MA 5D7AA 3DXQA 2J0LA 3IW7A 5CVGA 5AX9A 3ROCA 4EONA 3E8EA 2ZM4A 2C5OA 2HZ4A 5A4QA 5JFWA 1JKKA 4IADA 4IVBA 3ZCLA 3FEGA 4CMUA 4O83A 4JR7A 1Q24A 4FV6A 4O27B 4CFFA 1M2QA 3ZU7A 2GNHA 3K3IA 4XUFA 1YOLA 2R3KA 5FRIA 1CDKA 3O7LB 4HNIA 4O22A 3GVUA 2FSOX 2PZRA 3FKLA 5AP2A 3SGCA 2WELA 2F7XE 3ET7A 4PY1A 5E8YA 4ZY6A 4D4RA 1VEBA 2QOFA 4GK4A 4D4VA 3IOKA 2GCDA 4TT7A 4GKHA 2ZOQA 3TZMA 4EYMA 2R3RA 4FNYA 1FINA 3G0EA 3MWUA 4FV7A 3DBDA 4LM5A 3ZTXA 4ANNA 3Q52A 3UP7A 3KN6A 3E3PA 5L8LA 4QMOA 1BL6A 4F70A 5E9EA 5E90A 5FXRA 4FZ7A 3FHIA 3H0ZA 4H3QA 4BDJA 3DTWA 1JKTA 3O8PA 1OKVA 2XCKA 1G3NA 5A4CA 1Q8WA 3Q04A 2PMNX 4KUJA 3GCSA 2CNVA 1KSWA 2R3MA 3P9JA 3F3UA 2R3GA 4G16A 3FZPA 5HZNA 5IMXA 5CSPA 4A9UA 2YM3A 3KA0A 4ITJA 3VUGA 2C6KA 2RL5A 5AUTA 4JBVA 4BBFA 5CNOA 4AS0A 2QKWB 1REJA 2PYWA 4UMTA 2HWPA 2WKMA 3FXZA 1P14A 4GFGA 4TYIA 3HP2A 2YWVA 2O2UA 2WQBA 3RK9A 3WZKA 4RA5A 4X2NA 4DHFA 4AFJA 4AAAA 2YCQA 3HDNA 2HWOA 2W4JA 3BYMA 3F9NA 4I5HA 2XH5A 2WMBA 3TJDA 3KMMA 3ZLXA 5AFVA 4IAIA 5GZ9A 2I40A 2LAVA 4RIXB 3Q2JA 4AGDA 4C4HA 2B4SB 3R9OA 3VUKA 4DBXA 4Y83A 3I60A 5JFXA 4XG8A 4JS8A 4L00A 3HV6A 5H2UA 4KS7A 4UX9A 4HCTA 1NW1A 3AD6A 3QQJA 4JNWA 3BGQA 4PQNA 5AUZA 4AOIA 4C33A 4AN3A 5AV3A 3F69A 4R7HA 4UMRA 4FGRA 4FTLA 2ZYBA 3MI9A 4E4XA 4BCMA 4YNEA 4QMNA 2C30A 4BR3A 1WAKA 3F5XA 4CFMA 2F4JA 2P55A 3FMDA 3R7VA 3HRBA 1ERKA 2C0TA 3NWWA 4ZSEA 4Q5EA 2XYUA 3BCEA 3UYTA 2ZDTA 2ETRA 3L9PA 2W1IA 1QCFA 2XIXA 4TW9A 3OCTA 2ZB0A 3OT8A 4PDYA 3P5KA 5DR9A 5M44A 3GC7A 4DG0E 2W5AA 5HIEA 3FI8A 2ITWA 3NW6A 5HO8A 4DLIA 3MB6A 1XO2B 4CQGA 4D2RA 4YHTA 4BL1A 2XIZA 4C2WA 3F61A 4O2ZA 3TM0A 4ASDA 3H9RA 4FNZA 3DKCA 4IFCA 3BQCA 2YACA 4LL0A 3N4TA 4QT1A 4MQ2A 3FMMA 5ANEA 4IJ9A 5TE0A 3BLRA 5HIDA 4QP4A 4OAUC 5AV0A 1OL5A 3ZS5A 3P7AA 4L7SA 4MXXA 4AZFA 1WBPA 3OXZA 3MW1A 3W2PA 2IZSA 2G01A 3F5PA 5IU2A 3R22A 5JGAA 3DQWA 3TNIA 5LVOA 5TT7A 4IB5A 4NFMA 5CQUA 2RG5A 3L8SA 4PTGA 2OFVA 3ZDUA 3N4VA 3C0HA 5E8UA 4EJ7A 1MRVA 1YHWA 1XR1A 3DQXA 2NNWB 3Q9WA 3ORKA 2VWXA 2J4ZA 3CQEA 4PL3A 2PVFA 4WHZA 2OW3A 4QYFA 4IM0A 4D5HA 1WFCA 2WTJA 4NU1A 4F9WA 4ZTQA 2QOLA 4XV1A 3B8QA 2XNMA 4IX3A 4RVMA 3UMWA 4PP9A 5A4EA 3JYAA 3NW5A 4QMTA 5L3AA 1IA9A 1R1WA 3NGAA 2IJMA 3OUNB 4FV4A 5KHWA 4C3PA 1BI8A 4OTIA 5BVEA 3JPVA 3RPVA 4O6LA 4X6QC 4NM5A 5HBHA 4BTKA 3JVRA 3QKKA 3QAME 2VX3A 3AXWA 3KRXA 2WFYA 3LXNA 4MBJA 2CGUA 4Y73A 4YU2A 1ZYCA 3ZYAA 3C50A 5DT3A 4AUAA 4S2ZA 4IX6A 5IQEA 4QP6A 4R3RA 5E92A 2DS1A 3W2RA 4BZNA 3LKMA 2XK4A 4HPUE 3G6HA 1AGWA 1IG1A 1P2AA 2H6DA 3O50A 1P5EA 4DFUA 2BZIB 3KXXA 3QGYA 3TN8A 3PA4A 5CZIA 4ANSA 2J2IB 4U42A 5D12A 4EEVA 4YC8A 5CEMA 2R9SA 3R30A 4PMPA 2JD5A 1UU8A 3FJQE 4A9YA 3UMXA 1CKPA 1XH4A 3R1QA 3QTUA 3LFDA 2VO7A 3L1SA 4NUSA 3ODZX 5AJQA 5HESA 2GMXA 4DYMA 2PVRA 4YTFA 5CU6A 4WBBB 3TV6A 1JKSA 3OCSA 4KRDA 3TACA 3GCUA 1YXSA 5DR2A 3HECA 3REPA 4DCEA 4CXAA 4EUTA 1PHKA 4QMSA 4G6NA 3F3TA 4MXAA 5DR6A 4FZFB 5C4KA 1H01A 5A6OA 4BVUA 5AAGA 2E9VA 5HU9A 5JFSA 2Z7SA 5JMSA 4YUQA 3DB6A 4DFYA 2QOQA 3KY2A 4G2FA 2OH4A 3F88A 4BDHA 3HMOA 3Q4CA 4QMVA 2Y4IC 4JG7A 3PY1A 3WF5A 4L6QA 4ZTNA 3IW8A 5IZFA 3QUDA 3A7HA 4RVLA 3RMFA 1O9UA 2VTSA 4BDGA 2RF9A 4GVJA 4QNYA 4YZDA 4W8EA 4LOPA 5AM7A 4AOTA 4EH4A 1R39A 1B38A 4G5JA 2VU3A 3NPCA 3VS2A 1JSVA 3P7BA 4FEUA 2OJIA 3ZH8A 1QMZA 5CSVA 3BYUA 1BYGA 3FUPA 4EHEA 1J1CA 2UW3A 1DM2A 2Q0NA 4KSPA 4G3DA 4MX9A 3RCJA 4FV2A 2VD5A 2QLUA 4L53A 5IQGA 3CGFA 3D5XA 1EH4A 1ZMUA 2JAMA 3IECA 4RBLA 5DIAA 4CYIA 2ZV9A 2YZLA 3ZBFA 3DAKA 3EFJA 1O6KA 3NYOA 2WMUA 4DG3E 2W4OA 2V7OA 3ATTA 4J95A 3MV5A 4ITIA 2AYPA 2HY0A 4L44A 4W4WA 5EYCA 5K5XA 2YIRA 3CY2A 3CTHA 5HNBA 5EHLA 3LZBA 5J7BA 3KC3A 3VS1A 4Q9SA 5CF4A 4G3CA 3KGAA 4PRJA 3S00A 2CN5A 3EZRA 3HP5A 4I6BA 2OH0E 4I92A 4BDIA 2J5FA 4QD6A 3PJ8A 2B9FA 1GIIA 2X2MA 4LGGA 4E4LA 4A4LA 3LXKA 3T9IA 3VQUA 3FLSA 3EQPA 3IG7A 5ITAA 2UZTA 2IVVA 4UXLA 2XEZA 2X39A 2RSVA 4M69B 5E8WA 3T9TA 4C37A 2Y9QA 3ZFXA 4ZMFA 3QTSA 5J7HA 3RNYA 4MWHA 1H27A 4RQKA 5DBXA 4PDSA 3ZFYA 2YLEA 3PUPA 4FOBA 3R0TA 4EH9A 2JKKA 2ZJWA 1Y6AA 2J6MA 4ORKA 1JAMA 3P0MA 3HA6A 1Q3DA 1UKIA 4FSTA 4HCUA 2R3LA 3IGOA 4OUCA 5DT0A 5TR6A 4F7LA 3OROA 4G31A 3F2AA 4BZDA 1TKIA 1OKZA 1U5QA 4WG5A 4BKJA 1UVRA 2YZAA 4U3YA 3BWFA 3VF8A 5JSMA 3TZ7A 3MSSA 4Y72A 4ZJVA 4BDCA 4DAWA 1IR3A 4ZJIA 4QMZA 4I24A 2AC3A 5IH4A 5JT2A 3LQ3A 3IDPA 4FYNA 4MXYA 3DB8A 3CLYA 3EMGA 1PMVA 1SM2A 5DVRA 5KZ0A 4QTAA 3HAMA 4IACA 3QZGA 4M67A 2EWAA 4RZVA 3DBCA 3F6XA 4D2VA 2HELA 3HDMA 4PPCA 2WOUA 2R5TA 4EZ3A 2XNGA 3IW6A 5FEDA 3TV4A 3ZEWA 2OF2A 2W1CA 4IX4A 3NUUA 1AD5A 4ZMEA 4DN5A 1PYEA 3EFWA 5IA0A 3AQVA 2X9EA 4USEA 1NVSA 2OLCA 1G5SA 3A7JA 3OW3A 2GS7A 5AUYA 2ITQA 3BGPA 4KAOA 3RAIA 3QA8A 2P2IA 2RKUA 3ZEPA 3PTGA 3MJ2A 3PZEA 3EN7A 4CG9A 4IFGA 3LPBA 4QMXA 4C58A 3M1SA 3V6RA 3LXLA 2QKRA 1LR4A 4WD5A 3MGYA 4FV8A 4FTMA 1K9AA 4K1BA 2W5BA 3MY5A 4OTQA 4E6CA 5DE2A 3GU7A 3MTFA 3QZHA 5HICA 3QLFA 3RALA 3C4ZA 3NVMB 3FL5A 5L2TA 1OPKA 1YQJA 3D2IA 3I0OA 2JC6A 4V04A 4BKYA 2GHGA 1YRPA 3F5UA 3CJGA 3MPAA 4RLLA 1SVGA 5JZNA 5TF9A 4MXCA 4O0WA 4RC2A 1YI3A 3ZO2A 2Z7RA 3EQCA 1FOTA 1U54A 4ZLYA 3NS9A 5KE0A 4D2PA 4XEYA 2OZOA 5F95A 5KHXA 4XV3A 4PDOA 4M15A 4IAFA 4ZS4A 4RC3A 3PFQA 3JY9A 5I3RA 4HGTA 1XQZA 4S34A 4H3PA 5J95A 4OTWA 3RPYA 4DGOA 3EQDA 4L7FA 3PY3A 3C13A 3GU4A 2ITXA 5EW9A 3QBNA 4F1OA 5AA8A 4GEOA 4U7ZA 3WE8A 5AR8A 3KMWA 2XKEA 4FA2A 2V5QA 3GENA 4O96A 2XNOA 2E2BA 5E1EA 2QO2A 4WBOA 4GJ2A 3EHAA 3ORTA 4AW5A 4NJ3A 5ANGA 4PPBA 3CBLA 2A4LA 3VHEA 5M4UA 4O7YA 3ORXA 4D28A 2BIYA 4RJ3A 4IC8A 3GGFA 1PXNA 4C4GA 3GT8A 1ZRZA 3FZTA 4M14A 4X2GA 4C4IA 2C6LA 4XBUA 4F63A 3OOMA 2WD1A 4I23A 2X81A 3AC2A 3TNHA 2WTIA 3MB7A 1Y8YA 1K3AA 2CJMA 4D1SA 4QTBA 1Q61A 2P4IA 4JQEA 5AIRA 1VYZA 3GP0A 4IE9A 3UOKA 5GZAA 3ETAA 4WA9A 1WCCA 2VO3A 4UWBA 1SNXA 4PL5A 4XV9A 1Q8YA 5BMMA 5AAFA 4OT5A 5HE1A 2NRYA 2CCIA 1ZZLA 4FZDB 3GU8A 3SW4A 3VO3A 4JIAA 4FKLA 4CD0A 4NW6A 4I4FA 2YJSA 2Q0BA 2UZWE 5L2QA 2CLXA 3H4JA 3RJCA 3UZRA 3K54A 3UVPA 1IAJA 3PY0A 1KE7A 4TN6A 2VX0A 5B7VA 1XBCA 1S9IA 4AW2A 5FP6A 4E26A 5H8BA 2JBPA 2ONLC 3DTCA 3SKCA 4JRVA 4KBAA 1V0PA 5JFVA 4YJQA 3OD6X 4UBAA 3RHXA 4WSQA 1FMKA 1YOJA 2YAAA 3O7LD 4WT6A 4GYIA 1QPCA 3PRFA 4BWKA 4NTTA 4CTCA 3NYNA 5EM7A 3Q96A 5J1WA 4RT7A 2QHMA 1UNGA 3DZOA 2XCHA 4UXQA 5EKOA 3QU0A 2QHNA 4ANOA 3D5UA 4IH8A 4W9WA 4FSZA 3TZ8A 3W2QA 4R6VA 4HGLA 3RBWA 3UTOA 4V01A 4GK3A 4C57A 2OU7A 3OCBA 2EXEA 4BDDA 4G3GA 3NAXA 4TYEA 4YLKA 5CY3A 2BZJA 2VTMA 3C0IA 4WG4A 2BFYA 2BR1A 4BI1A 1TVOA 4RIYA 3LM0A 2QR7A 3EQGA 4JJRA 4OTDA 3Q2MA 2VWVA 3R71A 4YJOA 1E1VA 1OKYA 2YCSA 5FP5A 3ZO3A 3DK3A 4CSVA 4I3ZA 3IO7A 1Q8TA 2DWBA 1APME 2QOBA 1U54B 2G15A 3F66A 1M2RA 3QTQA 4Q2AA 3VBVA 5TOZA 3V04A 4K77A 4TYGA 4XHKB 2QC6A 4BN1A 3PVBA 4ZZNA 1W0XC 2XIKA 4FK3A 1YXTA 4B0GA 5ICPA 3MH2A 5F1ZA 3PZHA 3ZM4A 2OIDA 3GQIA 5DRBA 4BFMA 4N6ZA 5HX8A 3F3VA 3IK3A 1MRUA 1J7LA 5HU3A 3U9CA 4DEHA 2PVJA 4L45A 2GNGA 1DI8A 2ETKA 3R2YA 3KL8A 4FEQA 2JIVA 3R7GA 4IW0A 4XG7A 5EHOA 3HZTA 5JKGA 5AADA 3PPKA 1GNGA 4DFBA 1WBSA 4JBQA 4M12A 2C6TA 3UIMA 4I4EA 3LFNA 3NNUA 3GC0A 4PV0A 3RAWA 3FYJX 5HVKA 5TKDA 4XMOA 3CEKA 2I0VA 4BCPA 3V8SA 3DBQA 3LFFA 1U46A 2Y7JA 4FSMA 3UPXA 2EVAA 5J5SA 3FAAA 2YCRA 3SLSA 3I81A 3P4KA 1OBDA 5M57A 3C51A 3DDPA 1R3CA 4FE2A 1E1XA 2PUNA 4C35A 2R0IA 3VS3A 4EKKA 3RZFA 4D2TA 5I0BA 2JBOA 3MTLA 4BF2A 5EKNA 4CKRA 4YTIA 2I6LA 5I9UA 4ONAA 1UU9A 2W9ZB 4QMUA 4ZY5A 3FZ1A 5B2KA 4YR8A 3HV4A 2J5EA 3P79A 4FIHA 4HZRA 2OF4A 1ZYJA 1J7IA 3EQRA 5AV4A 3F82A 1GAGA 2WU6A 4K0YA 3IW4A 4RQVA 3E62A 5EH0A 2ITNA 4M97A 3U4UA 3GBZA 2JDOA 1FGIA 3IDBA 4Y85A 5HCZA 3RP9A 4A4OA 4HVDA 4DH1A 2ITVA 1OL1A 4TY1A 4ZSJA 2F57A 3I0QA 3W8LA 5L2SA 4YNOA 3II5A 4EK8A 2B55A 2I0EA 3DJ6A 4XG9A 4IAAA 4YPSA 4JL9A 2BKZA 4PNKA 3NUXA 4FT0A 5KMLA 5CSWA 5CF6A 2YIQA 3KXGA 4ZY4A 4HCVA 2CGWA 5HE2A 3VUHA 4JAJA 3CKWA 3NUYA 3PXFA 2HZ0A 2WOTA 5H9BA 4HW7A 3E7VA 3KREA 2P33A 3SXFA 4L42A 4MXZA 4QP7A 4DH3A 3ZZWA 2OBJA 4IANA 4FODA 4Z9LA 3W8QA 3QYWA 5L8JA 4P7EA 4QYYA 2XNBA 5AR5A 3OY1A 5K5NA 3CR0A 2PMIA 3QLGA 5ETFA 4CKIA 1O6LA 4QQ5A 2SRCA 3H9FA 4NM3A 2YDJA 3QA0A 3UOHA 4H05A 1JOWB 3L9NA 4RWJA 4IEBA 1XWSA 3Q9ZA 2XJ2A 3RAHA 4JOAA 3VUDA 2QVSE 1QPJA 3RM6A 3BWJA 5LCJA 4B9DA 1H24A 2YDIA 3BIZA 1FVVA 3AG9A 4AU8A 1XJDA 2UZLA 3WE4A 2WMRA 4HVSA 4X3JA 4XBRA 3DZQA 5HHWA 3FQSA 3SW7A 5GJGA 3GEQA 5J1VA 3PPZA 4XG3A 4PPAA 1GIHA 4NM7A 4BCKA 5M09A 3LQ8A 2PZPA 3ALNA 3H30A 4IIRA 2QOKA 3KVXA 2WTKC 3BRBA 3C4FA 4QPMA 3ORIA 3VF9A 5GZ8A 3KK9A 4EQMA 1I44A 4OBOA 4C36A 1T45A 2VNWA 2XEYA 4KIPA 5KX8A 5JN2A 3QQLA 3R9DA 3WZJA 2BALA 3WI6A 5AAEA 1NA7A 3G90X 4RWKA 3RM7A 4XH6A 4I5PA 3RK7A 4YBKA 5I9XA 3UQCA 4L3JA 3TJCA 3TWJA 4FKJA 3D4QA 5DH3A 5ETCA 5KUPA 1NT2A 3G9LX 3NYVA 4FT7A 5HGIA 3VN9A 1PXPA 5CU4A 3BEAA 4WG3A 3R9NA 2CGVA 4FBXA
chains in the Genus database with same CATH superfamily
2FH9A 3FKNA 2WMSA 3CIKA 4L46A 2I0HA 4MHAA 4EK5A 4R8QA 4DT9A 1WZYA 2BDJA 1SNUA 2PU8A 2CCHA 3QC4A 1OPJA 3HUBA 4E93A 4CYJA 3MA6A 1Z5MA 5HCYA 4F6UA 3R28A 5FQDC 3CQWA 3Q60A 1Z9XA 2XVDA 2XK9A 3NEWA 4I0TA 4ARKA 3FMKA 3I7CA 5DA3A 3NUAA 2CSNA 4FVQA 3W0RA 4WOVA 4ZTHA 2R7IA 3UNJA 1ZLTA 4J96A 2C6EA 3GU5A 4ERWA 3N9XA 2RFEA 4FMQA 1YI4A 5D9HA 2JKMA 4AFEA 4ZSAA 5EQYA 4A06A 2ITZA 4V0GA 5C1QB 1A06A 3CKXA 1VZOA 2ITYA 2R2PA 3AC3A 2QODA 3CD3A 3C9WA 1KOBA 3BPRA 4FGBA 3UDBA 4ANBA 5E1SA 4NFNA 5I4NA 3NUSA 4BGQA 3HMMA 1SYKA 3EYGA 5ETIA 2VWZA 3SOAA 3NYXA 3PJ1A 4I0SA 4B7TA 4O0SA 5HI2A 2QG7A 3KEXA 3BZ3A 5HQ0A 3GI3A 4F0FA 4WRSA 4BCFA 1YDSE 3MVMA 4IVDA 1ZOHA 3E64A 5AUXA 4DC2A 3BBWA 4EYJA 3BELA 3D83A 3QALE 4N6YA 4MD7E 2WQOA 4RVTA 3QHRA 2Y4IB 2J51A 2WTVA 1CTPE 3DBFA 4IZYA 5HE3A 3PIYA 4FX3A 3TYKA 4NKSA 2HXQA 4X0MA 5L2WA 2X4FA 4QPAA 3WYYA 3PE2A 4CT1A 1ZYSA 2BZHB 3AMAA 3OZ6A 4O91A 4O4FA 4C4FA 3IW5A 2WQMA 3BV3A 2IO6A 4GCJA 2YIXA 3PSCA 4D4YA 4USFA 1Y57A 3MIAA 1OECA 3Q5IA 4IVAA 3VNTA 4AZWA 3KXMA 3FI3A 1H1RA 3GCPA 4YZCA 3R8ZA 3TIZA 4RJ6A 5LQFA 4Y5HA 2OG8A 4O0TA 4RJ7A 4XRJA 5BVKA 4RA4A 4I22A 2PHKA 3DJ5A 4RVKA 1WBVA 4FSNA 4U3ZA 4ZZMA 3OOGA 4EOLA 4QYGA 3NUPA 4BCOA 4KKHA 5KO1A 1FGKA 4FV3A 4GYGA 3AT2A 2W1GA 4ZSGA 1L3RE 4GT3A 2GNLA 1KE6A 4O38A 4G17A 5DHJA 2FSTX 3F5GA 1HCKA 5IPJA 4RX5A 4A9RA 4FKSA 5EG3A 4YMJA 2WZJA 3R02A 1ZYLA 4UWCA 5KKRC 5KZIA 4ERKA 4PL4A 4IMYA 4DDIA 3OBGA 4CT2A 3O8UA 2RFDA 2PZ5A 2GTNA 2JFMA 4GMYA 5AP0A 3RK5A 3TI1A 2ERKA 2HW6A 2Y0AA 4LRKA 4UZHA 4YJNA 3SX9A 1G8SA 3AGLA 5ANIA 4M68A 4HGEA 1BKXA 2R3OA 3W0OA 4FTAA 5DN3A 3ELJA 3EQBA 4O2PA 2XALA 4CZYB 4EJNA 4P5QA 2VTQA 1YWVA 4X7QA 2RFNA 1PKDA 3ENMA 4J8NA 3PJ3A 3GC8A 5GJFA 4RX9A 4NIFA 4WKQA 4U79A 3A62A 3QCYA 2IW8A 4D2WA 3FYKX 1FBNA 2OICA 1KE9A 3D14A 2P2HA 3FMEA 2A2AA 2FA2A 3LFSA 3R1SA 2YDKA 3OWLA 2H8HA 2XK7A 2ZV7A 3FSKA 3QWKA 4JT3A 3ZZEA 3UOJA 5K4IA 1SZMA 3CS9A 1ZAOA 2XNPA 1JBPE 3NCZA 4W8DA 2XF0A 4OBPA 4JG8A 4OTGA 5DPVA 3V51A 4C7TA 5FUTA 4QP8A 5JH6A 4N0SA 4DFZE 2YISA 4V0GB 4YSMA 5CU2A 4N57A 3FI4A 2ITUA 4LV5A 3QFVA 3IPHA 4H1JA 4ACMA 4C0TA 2JIIA 4O1OA 1V1KA 2I0YA 4TWOA 4FTQA 3O2MA 4B4LA 4BCQA 4L3LA 1LPUA 2YFXA 4FV1A 3VHKA 4QYEA 3OP5A 4EUUA 3L8VA 2XIYA 4EWQA 3E88A 4I6HA 2W1ZA 5DG5A 5C27A 2E9UA 3GOPA 3ZC5A 3LCSA 1W2DA 4M13A 3ZC6A 2WQNA 3EN5A 4IZAA 2ONLA 5E8TA 4RX8A 4J98A 3UPZA 3ZUUA 3PP0A 4BZOA 3W0MA 1Q41A 3IDCA 2XRUA 4FTRA 3Q6WA 3UBDA 3QRUA 3PXKA 4MNEA 5I9WA 4EK6A 3WZDA 3FC1X 3FQHA 1GZOA 2R3QA 1M7QA 4RGJA 4TTHB 5AV2A 4Z55A 5HG7A 3LCDA 4X21A 1OMWA 1UNLA 4XG6A 4AXAA 4FF8A 4EQUA 4FRFA 5CF8A 1ZZ2A 3QZIA 4DEGA 4M69A 3LW0A 3A7IA 3DXPA 1KE5A 1ZWSA 1M17A 4MCVA 4KABA 2E9PA 2WIPA 3FDNA 3QL8A 2GSFA 3NR9A 4IJPA 1Y6BA 3OTUA 3M2WA 4MKCA 3S3IA 1NY3A 4A07A 4EL9A 4FNWA 1H1SA 3TDWA 3PE1A 4YLLA 3BQRA 2X0OA 3ZXZA 4APPA 3OUKA 3ULZA 1OUKA 3PA3A 5BYZA 5HD4A 1YXUA 2YAKA 3D94A 3C5IA 3W55A 2REIA 3I79A 4LFIA 4FG8A 1RDQE 3AC1A 4G3FA 2HZIA 4G6LA 3NNXA 4QP9A 4ASXA 3U6HA 1A48A 2YM6A 2XP2A 4B8LA 4X2KA 2C6DA 3MFSA 2JDTA 5ANKA 4R7BA 1GZNA 3DAJA 3K2LA 3MPTA 4D0WA 3KULB 5CF5A 4QRCA 2UVZA 3DCVA 5AA9A 5J9ZA 3Q4TA 3MH3A 3TUDA 3VUMA 3AD5A 3OFMA 4RLKA 4AQCA 5GNKA 3AC8A 4NCTA 4RJ8A 4DITA 2GDOA 3BU3A 5JQ5A 4C61A 5IEVA 2PY3A 3AT4A 4MNFA 2UZOA 3I6WA 4BHNA 2B1PA 3HLLA 3KF7A 1FPUA 4LOOA 3VS0A 4X3FC 4DH5A 3QRTA 1OIRA 3BL7A 4CQEA 3U55A 5H3QA 2OFUA 5EM8A 4JVGA 4NIFB 3CPBA 3SC1A 2WAJA 3QTWA 4ACCA 4YO4A 2H9VA 3BE2A 3HNGA 4K11A 5LOHA 3P78A 4CFXA 3ZUTA 4W9XA 4O4CA 4NZWB 1A9UA 3IS5A 4AGCA 3VBYA 4IVCA 4FEWA 5HO6A 1WBTA 4RSSA 2Y6MA 5BMSA 3EFKA 4GT5A 2XIRA 4BTJA 4F6SA 3CTJA 2W17A 2EB3A 2QCSA 3HMNA 5EYMA 5BUIA 5CT0A 5EM5A 3GNIB 3BHUA 4O7TA 4RWLA 4ALUA 4YBJA 3LJ1A 2HZNA 3ZLSA 3ZLYA 4OTHA 3TMOA 2B9IA 2IN6A 5BVWA 4AWIA 2V55A 3PIXA 2WNTA 4IWQA 2WMQA 2HW7A 4KWPA 4F7SA 3SAYA 4AZTA 1HCLA 1WVYA 4P2KA 4J53A 2PUUA 3MDYA 3D15A 2HAKA 4G9CA 4LOQA 2CKPA 2W1FA 3HA8A 1DAYA 3IOPA 4KKEA 3KQ7A 3ZSHA 4FIFA 3R04A 3P5JC 3LJ2A 1SVHA 1K2PA 1ZXEA 3D5VA 4YHFA 3KIOC 2VTOA 3FZRA 4CEGA 1W84A 2O65A 4MNEB 4GUEA 4YJVA 4RZWA 2UZVA 4FIGA 3PSBA 1YKRA 4Z16A 4CLIA 4QQTA 1PMEA 1R78A 5B2MA 3DA6A 4CLJA 4IDVA 3PUFC 4AW0A 3UOLA 2WEIA 4D9UA 4ZK5A 4FKVA 4JBPA 5KCVA 3CY3A 3BLQA 4Y46A 3R73A 5HCXA 2GQSA 4CMOA 4QTEA 5EI8A 1PXMA 2XM8A 2BAKA 4IWPA 1TQPA 2JITA 3IKAA 4LRJA 1OKWA 1Y8GA 1QL6A 2C3LA 4U81A 4DEAA 4FEVA 3QUPA 5AP3A 4CVAA 1UWHA 4MQ1A 5T6KA 3R1NA 4LGHA 4HOKA 5AWMA 3ALOA 5HTBA 3RCDA 2EXCX 4AGWA 5GJDA 2YM4A 3MVHA 3GU6A 3PXYA 3QRIA 4M84A 2GHLA 3DS6A 1J91A 2YIWA 1PMUA 3TIYA 4ANLA 4BIDA 3QD2B 3GOKA 4I6QA 1JSTA 3EL8A 3SVVA 5J87A 2F9GA 5AMNA 3SG8A 2V22A 1Q8ZA 3AMYA 5EDRA 5C8MA 4CTBA 4IZ7A 4IM3A 2PK9A 5DEYA 3V5QA 2J9MA 4O21A 3EOCA 3KB7A 3PXZA 5IQHA 4I41A 4F99A 1GZ8A 2WTWA 2YWPA 3L9MA 5A6NA 3G0FA 5BVFA 3A7GA 4EI4A 5LJJA 1JKLA 2O3PA 4S33A 4W4YA 5LVLA 3R7UA 3V5LA 4Y95A 3DKFA 4GUBA 3QX2A 2IPXA 5DGZA 4KB8A 2G2FA 4BWPA 3ITZA 3MVLA 4O0XA 3KK8A 5HD7A 5A9UA 4GFOA 1BMKA 3LCKA 4GS6A 3R7OA 4A9SA 2FYSA 4BGGA 1Q4LA 3OC1A 4K33A 3MY1A 5AEPA 3V5WA 5LMKA 3BLHA 2UW9A 3POOA 5DLSA 3W18A 2F2CB 5IDPA 2GNFA 4TL0A 4O81A 3R7EA 2BTSA 2BRGA 5FLFA 3U6IA 2PZIA 4AXEA 2XZSA 3DNDA 4L67A 1PRYA 4ANMA 2C1BA 2J0IA 2W1HA 3B8RA 3Q53A 4GK2A 2PVNA 2YERA 3KRRA 3PYYA 4QQCA 2X2LA 2PULA 3VUTA 4CKJA 2C47A 3Q5ZA 1URWA 2UZEA 3R2BA 2HXLA 3OTVA 4FV0A 4RFZA 2G9XA 4DH7A 2OJJA 4IXPA 2BTRA 2BCJA 4U6RA 3QYZA 1STCE 5CWZA 3VQHA 3PFYA 4AXCA 3P7CA 5IG1A 2IZUA 5CEKA 5L6PA 4Z7GA 4AN2A 3E8NA 4DLJA 1RW8A 4M66A 3U6JA 1W7HA 4FZ6A 4ZAUA 5LXMA 3L8XA 4EK3A 5LARA 5BUEA 2OZAB 3V5PA 3FY0A 4BDKA 5LWNA 2X6DA 1UKHA 4K6ZA 5AP1A 2ZMDA 5EM6A 4D1XA 4DINA 4FT5A 1J3HA 3OF0A 5IQFA 1FVRA 4LI5A 5HLPA 4GFMA 2R3NA 4IAYA 3AGMA 3H0YA 4E4MA 1LP4A 3E7OA 3QQUA 4EOQA 5FD2A 3QTIA 4LUEA 4X2JA 2YM7A 4O84A 1H07A 1LUFA 3PPJA 3MJ1A 2VTAA 4CCBA 2KTYA 4CMTA 1GZKA 3AD4A 2Z2WA 3ID6C 2PSQA 2X8IA 3HRFA 4FKTA 4ZOGA 5J9YA 4QDVA 2GPHA 3DY7A 5FXQA 1AQ1A 5CALA 4AGUA 5IA3A 2AUHA 3LFAA 4DHJA 3TUCA 4I94A 3OWJA 3R8PA 1GJOA 1CKIA 3VIDA 2VTHA 1IEPA 3CC6A 3QCQA 5ANOA 1WBOA 3RKBA 3U87A 3QQGA 3O51A 4ACGA 3FLWA 4JI9A 2EU9A 5EW3A 2XNNA 4TPTA 4CFNA 4MWIA 3QZFA 4LQMA 2FGIA 4YSJA 1YXXA 2UW5A 4J97A 1WBNA 2C68A 5AUVA 1HOWA 5I9YA 3LE6A 3SDJA 4E5WA 3QCSA 3RPSA 4MTAA 1PW2A 2PUIA 5CEQA 1U59A 3C7QA 4EKLA 4AP7A 5IH5A 1XH8A 4GIIA 3HMPA 5CVHA 4AN9A 4F64A 2DUVA 2YITA 1GOLA 5DRDA 2WTKB 4HYUA 3Q6UA 5BUJA 5CVFA 2VGOA 5CNNA 1YWNA 2A27A 4XP3A 3VRYA 4D58A 3WBLA 4KIKA 2XBJA 5FEQA 2R0UA 4FKQA 4WUAA 5D41A 3PDTA 4ZXTA 3EN6A 3UIUA 3MPMA 1U4DA 1V0OA 5M06A 5L6WL 4F0GA 4QMQA 4O0YA 3W32A 4D5KA 5CLPA 3FPQA 3R9HA 4MUQA 4J52A 2X0PA 3NVKI 4FTUA 4GG5A 4O4EA 4P90A 4IBMA 4JX7A 2LGCA 3DPKA 4WNMA 2DQ7X 3U8WA 3ZXTA 4QP1A 3OY3A 1FVTA 5HE0A 4BBEA 4YTCA 2HYYA 3EB0A 3FWQA 3BHVA 2P3GX 3NUNA 3R6XA 2C3KA 4EQCA 4Y8DA 3SRVB 1WBWA 5KMOA 5M51A 1CSNA 2C5VA 3RVGA 1OBGA 3FSFA 4BC6A 1R0PA 4R5YA 4JG6A 4UN0C 3QUEA 1OIQA 3QQHA 2A1AB 5HTIA 2VUWA 4C59A 3BHTA 2C5XA 5FTGA 2IW9A 5IA2A 4FT9A 3ZRLA 3IQ7A 1XH6A 2C3JA 1T46A 3FQEA 4PDPA 4ZS0A 2NRUA 1KE8A 5KMNA 5EDPA 3EFLA 4ITHA 4OTRA 3S0OA 3SG9A 5AP4A 3UG2A 4EWHA 5KBQA 2F2UA 4XNEA 2YM8A 3I4BA 4K9YA 5IMEA 1QPEA 5M53A 3V5TA 5FTQA 5HG9A 5IQAA 3ANQA 3W33A 2VO6A 5EI6A 2PMLX 4DGMA 3DK7A 2E9NA 4GU9A 4BWXA 2BFXA 4DCAA 3UZPA 3VBXA 3R21A 1OM1A 2JEDA 4D2SA 3NCGA 5BNJA 3BI6A 3KRWA 2O5KA 2W0JA 3PA5A 4Y5QA 2ZV8A 3UIBA 4E73A 5M4FA 3I5ZA 3ZUVA 4H1MA 4XLIA 4R3CA 3O5AA 3O8TA 5E8SA 3R9RA 4DE4A 5IQBA 1XKKA 2WB8A 3QTRA 4AZVA 1XMLA 4M8TA 3SOCA 2J0JA 2BAJA 3O23A 3DXNA 1JVPP 4BY9E 3NW7A 2VTPA 3NLBA 4JBOA 4I5MA 2QOOA 4BI0A 4JDHA 5IH6A 4XYFA 3Q32A 4CFUA 4OW8A 1YWRA 3QGWA 4GIHA 3ZSGA 5BX0A 5EQEA 3PG1A 1J7UA 4QO9A 2B9HA 4PTCA 3BV2A 3KN5A 1NVQA 4YZ9A 2VTNA 4EOMA 3OEZA 2QO7A 3NRMA 3UYSA 4U40A 1M14A 4J8MA 4GL9A 3TUBA 5CI7A 2QD9A 4K2RA 5HORA 3EIDA 3Q3BA 4B6LA 4R1YA 2X9FA 4BCJA 4DA5A 4XJ0A 5ANJA 5JEBA 2BAQA 3OWKA 4FTKA 1UU7A 3ORLA 3LMIA 1BLXA 4QEBA 2H34A 4F9BA 4D0XA 3ZRKA 4FSWA 3TCPA 4RJ5A 4KIKB 3COMA 3DKOA 5KKRB 3MFRA 4EOIA 2X8DA 5T3QA 2QG5A 3QX4A 4UYNA 3FMHA 5HKMA 4FG9A 5CT7A 3TKUA 2XNEA 5HG5A 4F0IA 4BTFA 1PJKA 5A46A 4ID7A 5KMIA 3CE3A 2CGXA 1VYWA 1REKA 3UNZA 4R78A 1DI9A 3H10A 2R64A 4G34A 1MRYA 4MBIA 3R8LA 3TL8A 5HNIX 3D0EA 2VTJA 2IVUA 3FZOA 5AR3A 4X2FA 5K4JA 3W0SA 3CP9A 3JXWA 4QMWA 4O82A 5E91A 4BKZA 3OMVA 3G51A 2YIYA 5EFQA 4KRCA 1W8CA 4FIIA 3S4QA 3QQKA 4H3BA 4IQ6A 2B0QA 3RZBA 2EXMA 1Q8UA 3FE3A 2EUFB 3HV7A 2PE0A 2QI8A 4BHZA 4E6QA 4LMUA 4E3CA 4ZLOA 2YCFA 5G6VA 3VBTA 4D1ZA 3UNKA 3WARA 3MY0A 3WOWA 3G15A 4EZ7A 4O7ZA 3DFCB 3EL7A 4TWPA 5C01A 2X0QA 4MD9E 4QMPA 3TNQB 4C4EA 1FMOE 3GCVA 5AIKA 4QNAA 4P4CA 3DAEA 3O96A 2UVYA 4QQJA 4U80A 5AP5A 4I21A 5K0KA 3W2SA 4EOJA 2GFCA 2W5HA 3LIJA 3ODYX 5LCKA 3Q9XA 5EI2A 5FDPA 4FKRA 5CAPA 3D9VA 2WO6A 2R3IA 1BUHA 2JGZA 4MH7A 2HOGA 4MXOA 3IONA 5IA1A 4ZEGA 1ZY5A 1IASA 4IB3A 3GB2A 3HV5A 3JS2A 3UO5A 5E8VA 2HIWA 2CDZA 4NSTA 3BE9A 3G33A 3E93A 2UZDA 4AW1A 3ANRA 3UC4A 4CZTA 4MF0A 3ATSA 3I6UA 2JFLA 3HV3A 5TO8A 5AR2A 1XMMA 2R3HA 2C69A 4KS8A 4A7CA 5HBJA 5IUHA 5LVNA 3G6GA 3KRLA 1MQBA 5EK7A 4EHZA 3KKVA 4EH7A 3VVHA 5AP7A 3ZO1A 3SHEA 1KV1A 2BHEA 2OIBA 2VWYA 2ESMA 1RE8A 3MVJA 4HJOA 2VZ6A 1OB3A 4WNKA 3DLSA 4C2VA 3UQGA 3F2RA 3F7WA 4G6OA 4ZTRA 5C8NA 2PE1A 2GHMA 4AOJA 1H1QA 2E9OA 1H4LA 4KSQA 2WIHA 3TV7A 1E9HA 1PXJA 5K9IA 3P23A 2XRWA 5A4LA 4JXFA 2CMWA 1U5RA 3H9OA 4HVHA 4O7NA 3FXXA 1WVWA 4TNDA 4WRGA 4DEIA 3NSZA 5HNGA 3C4WA 2I7QA 4BBMA 2WXVA 3EKKA 3LVPA 2VO0A 4KA3A 4C3RA 5JK3A 1I09A 2BILB 5L2IA 2QNJA 4LUDA 5CZHA 3NMUF 2X2KA 4QTCA 3VW8A 2JLDA 1OI9A 4FV5A 2FSMX 2BVAA 4EORA 4JDIA 5EYDA 3DFAA 4G1WA 3I1AA 3W10A 3PJ2A 3L9LA 3BYVA 3EKNA 4BIEA 4WNPA 4FTTA 2CHLA 5B0XA 4YJRA 4BTMA 3P86A 3K5VA 2W1EA 3Q4UA 4FKOA 4RRVA 5IA5A 4AZEA 2BKKA 4PF4A 1GIJA 5FGKA 3RWPA 2XB7A 3VBWA 4DEEA 4JQ8A 5AR7A 2XKCA 4QOXA 2OJ9A 5EHYA 5J5TA 1OVEA 2BZKB 4IAKA 3MH0A 2XAMA 2ZAZA 4X3FB 2BPMA 2BHHA 5ACKA 1YI6A 3E87A 4EOSA 3OVVA 4LGDA 5F20A 4ALVA 3FLQA 1H00A 4CG8A 4JDKA 4BGHA 2QOIA 3N4UA 3E5AA 3FPMA 3Q9YA 5IISA 3MBLA 1KV2A 3HYHA 3V6SA 5B2LA 3RINA 4FTJA 2UZNA 3V01A 2W05A 3V8TA 2W06A 2A19B 2G2HA 2RIOA 2XJ1A 2R3JA 3EN4A 4FSQA 3TNWA 3UODA 3FMNA 3CGOA 2BRBA 2GU8A 5ACBC 3WF8A 2ERZE 1PY5A 3WILA 2WMXA 4BCNA 4NL0A 1ZOEA 1OL2A 3GUBA 2CPKE 2HCKA 4AT5A 5CASA 4G9RA 5F4NA 2BDFA 4AX8A 4IDTA 3ULIA 1SMHA 3GC9A 4H39A 4TZRA 3TKIA 4F65A 4LYNA 1LEZA 1UNHA 4N4SA 4E6AA 4BDBA 2WQEA 5CI6A 5LWMA 1KUTA 3KULA 3EYHA 4BYIA 4OTPA 2GTMA 3PLSA 3B2WA 3ACKA 3TKHA 5A14A 3VRZA 3EN9A 2VTLA 2OIQA 5BVOA 1Y91A 2UW8A 4DF3A 3E8DA 4AG8A 3OHTA 3BHHA 2NP8A 2XKDA 3QF9A 2XKFA 3QTXA 2UVXA 3ZBXA 4IB0A 5HTCA 5CQWA 5LVPA 4XP2A 3R7IA 2X0GA 3WF6A 4WO5A 5E8XA 4I20A 2PVYA 5BVNA 5HEZA 4DGGA 1PXLA 4FVPA 5G1XA 3VS5A 4ASEA 3HGKA 3ORPA 4DTAA 3ENHA 2R4BA 3FLZA 5FG8A 1Q99A 4G5PA 4A9TA 3PXQA 1TQIA 3VBQA 4TWNA 3UP2A 1Q62A 4PX6A 4DBNA 3VUIA 3C4CA 3PP1A 4FC0A 3RAKA 4NH1A 3KFAA 3A8XA 3K5UA 4YZMA 1URCA 2CN8A 2VWWA 3RGFA 1JSUA 1OITA 4AE6A 5I5ZA 1JQHA 4RJ4A 3UO6A 5E4HA 4LRMA 2J0KA 4ASZA 2GQRA 3EQIA 4CFWA 5HVJA 5FTOA 4F9YA 3AKLA 2B9JA 4FTIA 2PUPA 3QTZA 3HVCA 4RMZA 3MS9A 2ZDUA 2XK6A 3VS4A 3FZSA 2XAOA 4FSYA 3TT0A 2OXXA 5DNRA 3R83A 4DTKA 1IRKA 1H1PA 1V0BA 4PTEA 3ZLWA 5DEWA 3OXIA 2B7AA 3E8CA 2YABA 2VV9A 3AC4A 2VGPA 3O0GA 4OT6A 4YJPA 5D11A 2FSLX 4YZNA 1OL7A 3SD0A 4DEBA 5BQ0A 3A4PA 3LFQA 1CKJA 3V8WA 1R0EA 1IA8A 4D9TA 2CNQA 4U0IA 2GQGA 2ZMCA 4JLCA 3KF4A 3PWYA 2BDWA 2XK8A 3NDMA 4XV2A 4YJUA 2UW0A 4DEDA 4EBWA 4XOYA 3UIXA 3S1HA 3D7TA 3D5WA 2WHBA 5CSHA 4NEUA 2X7FA 3EQHA 2V62A 3DDQA 4MVFA 3WIGA 3S2PA 4HPTE 2YHVA 2W99B 3BYOA 2Y8OA 4UZDA 1O6YA 1OIUA 2J90A 4C38A 3QRJA 2UW6A 3QXOA 2IVTA 2A0CX 1W82A 4G3EA 4EH3A 4QYHA 1QPDA 5GINE 4E6DA 2Z7QA 4FL2A 4RX7A 4UMUA 5A4TA 3T8OA 4DH8A 4F7NA 4O86A 3A61A 3OWPA 4E4NA 2Y6OA 2GNIA 3NX8A 2JDSA 3EZVA 2ITTA 4FL3A 2XS0A 3FLNC 5FEEA 2ZM1A 5CAOA 2BUJA 3LJ0A 5IF1A 2UZUE 3W16A 4I6FA 3ZRMA 4O0RA 2PVLA 2ZVAA 5CYIA 2ITPA 3Q4ZA 5HX6A 3CD8A 2ETMA 1CM8A 3LOKA 5H8GA 4O0UA 2B54A 2XK3A 3MIYA 5HLWA 4FTCA 3V5JA 3N51A 4ENYA 1YVJA 2BRMA 4LV8A 3SXSA 3UG1A 4OLIA 3UJGA 2VWIA 4NK9A 4GRBA 5D1JA 4FK6A 4HYIA 4X6RA 4WIHA 1F0QA 5HG8A 3ZONA 3HX4A 4UYAA 4XG2A 3LCOA 4IWOA 3FXWA 5F9EA 1H0VA 2IVSA 5E7RA 3VJNA 5T68A 2UW4A 2FO0A 2QURA 2VX1A 4L9IA 1UWJA 3QC9A 3UE4A 4YP8A 2WEVA 3BL9A 4Z7HA 2G1TA 3DBEA 3MYGA 5CSXA 4ZSLA 3R8VA 2PE2A 1W2CA 3MFUA 3TXOA 3ZO4A 2XJ0A 3DOGA 3RNIA 4DGNA 5HBEA 3UC3A 5A3XA 1M52A 2VWUA 3BYSA 3QHWA 3LCTA 4C4JA 2VNYA 4F1TA 5AUWA 3EH9A 3UGCA 4I93A 3AT3A 4L01A 2PVHA 3COIA 4UMPA 4FL1A 2C6IA 1H1WA 4EH6A 4E1ZA 4S30A 3A4OX 4JDJA 2C0OA 4PMTA 3VS7A 5H8EA 3S95A 3TTJA 4C34A 4ALWA 2PZYA 3NAYA 4TNBA 2IW6A 4FKGA 4OTFA 4V05A 3H3CA 3ZMMA 4HVIA 5M4CA 4CGAA 4LV7A 4U41A 5IDNA 2ITOA 3O71A 4FUXA 4E8AA 2C3IB 2YM5A 3G2FA 2NYAA 4XOZA 5KMMA 2OGVA 3RI1A 5KMJA 2JDVA 3CTQA 2V7AA 3F3WA 1TQMA 2WMWA 3PXRA 4MYGA 3FL4A 4ZIMA 4C62A 4F09A 5AUUA 3JR1A 1FQ1B 2QOCA 3ORNA 3R8MA 4Q5HA 3LFBA 2B52A 2OZAA 2EB2A 1MUOA 2WTCA 4EOPA 4QPSA 4J71A 2GNJA 4BYJA 1Q97A 2RG6A 5FXSA 5KBRA 2OXYA 3VULA 3KCFA 4HYSA 3WIKA 5IEXA 4H58A 4DT8A 4YJSA 4FNXA 4C3FA 2X7OA 3D7TB 5CX9A 3R63A 2OWBA 4KNBA 4QP2A 4H36A 4FTNA 4APCA 2Z60A 2XM9A 1XH5A 4FIEA 4ZP5A 5IQCA 3CQUA 4BDAA 2IG7A 5IEYA 4E20A 1DS5A 4EC9A 4RIWA 5HO7A 3KRJA 1UV5A 3U9NA 2JKQA 4KIQA 4GKIA 3WZEA 2H96A 5FBOA 4D4SA 3OT3A 4R1VA 3GFEA 3WF9A 4W4XA 3LAUA 1LEWA 3QXPA 3M11A 2O64A 1Q3WA 3U4WA 4O4BB 4QMLA 4EZ5A 3SA0A 3NIZA 4LDTA 5M07A 4QTDA 3LXPA 3ORZA 4GT4A 5CANA 4FICA 1W83A 4KBCA 3R1YA 4MEDA 4YC3A 2WMTA 3DT1A 4YZBA 5FM3A 2X1NA 1ST0A 3OCGA 4GVAA 5CENA 3FV8A 4M7IA 3NFGB 3UDSA 1JPAA 2PL0A 1BI7A 3LQ5A 5DYJA 4QMYA 3VONA 5AM6A 3KMUA 5FM2A 4FV9A 2O0UA 5C03A 1UA2A 4M0YA 4FZAB 5J8IA 3LFEA 5HVYA 4UALA 3WYXA 5LVMA 2OKRA 5JZJA 3FMLA 5LMKC 2AQXA 3TDVA 5M4IA 2PMOX 1YDTE 4F08A 5HOAA 3OG7A 4YTHA 4I1ZA 4IX5A 1F3MC 4XS2A 1X8BA 2C5YA 1RQQA 5GIPE 1M2PA 3BLAA 4IB1A 3W2OA 1F5QA 4EOOA 4CV8A 2WMAA