4RX9A

Syk catalytic domain complexed with a potent pyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
277
structure length
268
Chain Sequence
VYLDRKLLTLEDKELGFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery and profiling of a selective and efficacious syk inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rx9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rx9A01
4GYGA 4ZOGA 3UZPA 3H3CA 3MPTA 4UALA 3ZZEA 3R8MA 2CGXA 2IPXA 2A19B 4QQJA 1LPUA 4FSMA 4HNFA 4TNDA 1ZYJA 1NW1A 4O7SA 1U54A 2GNGA 2VX0A 3R01A 3BGZA 4KUJA 3G2FA 4PL5A 4C2VA 4FV6A 3GNIB 3PVWA 3F7WA 5F95A 3RZBA 3HAVA 2B7AA 3A7HA 4NUSA 5DEYA 4BYJA 3ATSA 1ND4A 4L7FA 2R9SA 4I23A 3BKBA 2WELA 3NX8A 4XS2A 4AQCA 4HGEA 4XV9A 4Z55A 5M55A 5TKDA 3QHRA 4N6YA 4QMSA 4EK8A 4K9YA 5T68A 3ZS5A 3WI6A 4EUUA 2YCRA 4OTFA 2BTRA 4MWIA 4BY9E 2RFNA 2RG6A 3SD0A 3CGFA 3MFTA 2VNYA 3QX4A 3ZLYA 1W82A 2QKWB 1LP4A 2QONA 3KK9A 3QQHA 2XCHA 2QQ7A 4DH5A 2VX1A 4BCOA 1YXXA 2W9ZB 3VO3A 2UZOA 3O96A 3PPJA 4EORA 3L1SA 4J98A 5F20A 3RK7A 3LFAA 4B0GA 5I3RA 2QU6A 4RSSA 4MX9A 3I6UA 2P2IA 4XLVA 1YHSA 4NW6A 5AR7A 4LOOA 5GJFA 4N0SA 4ASEA 4UMQA 4ENXA 3OTVA 4ZJVA 3EMGA 4FNZA 3BQRA 5CSXA 3IW8A 3BHHA 4GG7A 4HPTE 4IQ6A 3A8WA 1KE7A 1K9AA 1SVGA 5DE2A 5EHLA 3CGOA 5AP5A 3TI1A 3N4VA 3THBA 3KQ7A 4ITHA 3C4XA 4QTCA 4C61A 5A46A 4PDOA 3QU0A 1XWSA 4YBKA 2XKCA 3OEZA 4Q2AA 3RCJA 4CXAA 4FTMA 2DWBA 4I20A 4FEQA 3BWJA 4E4XA 4IADA 5I9UA 3NUYA 4FE2A 3G0EA 4JI9A 4QPMA 1UWHA 2WMWA 2W4KA 2YDIA 2O63A 4EZ7A 5IQAA 1GIIA 1GAGA 4NM7A 5FEDA 2YZLA 3C0HA 4KD1A 4UX9A 2WAJA 3VRZA 3WF9A 3OBGA 3DKFA 3I0QA 2YABA 3D2KA 1Z9XA 2BIYA 2GPHA 3A7JA 4JBPA 5IEXA 1PXLA 4YNEA 5FBOA 5JZNA 4M14A 1WCCA 3HRBA 4FVPA 5IUHA 3HUBA 4LL5A 3QGWA 4R3RA 3ELJA 4R7BA 5IQHA 5IA1A 3NVMB 1OKZA 5J1VA 3V51A 2OZOA 2UUEA 2YACA 3T8OA 4EH4A 4BCGA 2R3HA 3MJ2A 5CU6A 4F0IA 4XUFA 1OI9A 3UTOA 4A9TA 3QCSA 4AN3A 5HCZA 2R3QA 3OD6X 5HD7A 1IA8A 4RQKA 5CAQA 4HGTA 4D1XA 5EDRA 1BLXA 3JS2A 3BHTA 3ZH8A 3EN4A 2R5TA 4EQMA 2UZDA 2G15A 1CMKE 2CJMA 5KKRB 2XBAA 2PHKA 5LVNA 3QBNA 3OBJA 3F2RA 4F6WA 2XNNA 5M56A 4I6BA 3UGCA 3E8CA 5L8JA 3EB0A 3Q4ZA 4PRJA 4ANQA 5LQFA 3AD6A 3OWJA 4J7BA 2ITYA 3H0ZA 4O83A 1SZMA 3EFWA 3GQLA 4G2FA 3KRXA 2OI4X 4HYSA 3ZM4A 3U6IA 4XBRA 2BAQA 3W2OA 3FAAA 4AT5A 2WQBA 3TXOA 1NVSA 2BFXA 4E4NA 1XH7A 3ORNA 3TZ8A 3GU6A 2YN8A 4ZZOA 2J0LA 4PP7A 5L4QA 3UZRA 3VBXA 2BZHB 4JX3A 5ACBC 3ZDIA 3GI3A 5LVMA 5IEYA 4KS8A 5E4HA 3FY2A 3POZA 1MRVA 4Y83A 4UZDA 1KE8A 4LG4A 4CRSA 4AS0A 4C33A 5KMLA 4HPUE 1JVPP 3Q9YA 4QMMA 2YFXA 4UWYA 3RPVA 3HMNA 4J8MA 4YP8A 4V05A 1Y91A 4JDIA 4DH8A 4WUNA 3WYYA 4BCQA 4AW1A 5IDNA 2JKMA 2WTCA 3IOPA 4UV0A 5IQDA 1KE5A 3A2CA 5KNJA 3QWJA 4MXCA 4O0VA 2FH9A 4C34A 4PTCA 3VQUA 2GNLA 4RGJA 2PVFA 2QODA 3VC4A 4BF2A 4D2TA 4XLIA 5E8SA 3E3PA 5L6WL 3IW4A 5IA2A 4NYEA 1Q24A 2J9MA 2PY3A 2VZ6A 4EHZA 5CU4A 2RKUA 4PY1A 2HIWA 4K33A 4DTBA 3H0YA 4AACA 5AR2A 2IZUA 5FUTA 3KXZA 4RLLA 4AZEA 5K5XA 2ITWA 2VN9A 3F5PA 4DBNA 2PZRA 4MD7E 2XJ0A 4FTJA 5HX8A 3DJ6A 5E8YA 5EYCA 5KZIA 1YKRA 3DS6A 2HCKA 2ZJWA 4DEBA 4R77A 3FWQA 4FEVA 4IJ9A 4C2WA 4BDEA 5I3OA 3LLAA 1MP8A 2C5OA 4YHTA 5FM2A 3ZMMA 4ZY4A 5BYZA 4TRLA 5BVFA 5L8KA 3FHRA 1ZOGA 4KIOA 5C4KA 5CWZA 2YM4A 3B8QA 4IVDA 2JGZA 3IDBA 4JDKA 3RAIA 4F9CA 4KSPA 4PL3A 5KUPA 3HAMA 2ETKA 3QTIA 4RZVA 5FEQA 2WQOA 4CFUA 3P0MA 3OOGA 3DFAA 5J1WA 3UNKA 3M2WA 5JFWA 4CMOA 3W8QA 2G01A 3ZXZA 4Q5EA 1W8CA 5I9WA 3LCDA 4ANMA 5AP7A 3GBZA 3VS4A 3V6SA 3UBDA 5M51A 1YRPA 2G2HA 4F7NA 3OP5A 3OMVA 3FLWA 5AEPA 3AMBA 4P5QA 3OWKA 1IR3A 4FOCA 4LGHA 3QD4A 2WU6A 3ANQA 3PXFA 4CLIA 4PNIA 5FRIA 5K9IA 2YM8A 4DITA 2BALA 1YOMA 3A4OX 3E87A 4MNFA 4HVDA 3UNJA 2IVVA 4ZSLA 5HNIX 2CGWA 2QLUA 4CFVA 3GUBA 3PWDA 3I7BA 4JXFA 3T9TA 5JFXA 4KKHA 5IISA 5AUXA 1HCLA 5HE2A 3WZKA 1BKXA 1H08A 4DH3A 1G8SA 2IVSA 4CYJA 4CEGA 3D7ZA 1MUOA 4FTCA 4ERWA 4P90A 5HCYA 4QQCA 4JT3A 4DG2E 3LPBA 4BIBA 3C5IA 4L52A 4U3ZA 2W5AA 3GEQA 2E2BA 5DR6A 3E88A 2C6TA 5ANEA 2VWBA 2EXCX 3MN3A 2R7BA 3AT2A 5K0XA 1ZOHA 3P9JA 1H1PA 2WGJA 4R1YA 3R1SA 2F7EE 1UU3A 3G0FA 1G5SA 4RIWA 5DR9A 4RIYB 2WKMA 5CVFA 3C4FA 4EZ3A 4BGHA 3LCSA 4EZ5A 2H9VA 2ZMCA 5B2KA 4OAUC 4O22A 3EFKA 2EVAA 3T9IA 4QYHA 5TT7A 5KBRA 4O7VA 5IQBA 4RC2A 2CN5A 4FT3A 4PWNA 4GL9A 1QPJA 5LMKA 4YR8A 1JKKA 2ITZA 4FKRA 4PPAA 1KWPA 4Y85A 3QRJA 4CZUA 4C62A 5AP6A 5JRSA 2HWOA 2J6MA 4JBQA 5DLSA 3L9NA 3BYVA 4O0XA 3V5TA 2O8YA 5J5SA 5AUWA 4F4PA 2Z7QA 4U8ZA 5CAPA 2QI8A 2OU7A 3FMHA 3G33A 2BDWA 2BRNA 4PUZA 4EH6A 3RPYA 3COIA 2XYNA 3A61A 4I0TA 4QMOA 4G3GA 2IVUA 2OFVA 5AV3A 5FTQA 4A06A 2OXDA 4E1ZA 4EOMA 2OJIA 5L6PA 5LARA 1B6CB 4NK9A 3U55A 4GIIA 4HZSA 3F3UA 3B8RA 3Q32A 5DEWA 2JFLA 2PMIA 3COMA 4X3FB 3K54A 3TUDA 4DEEA 1OPLA 5D10A 2X4FA 1YXTA 5M09A 3F3WA 1VYZA 2ONLA 3CQUA 3MB7A 4FG8A 3CBLA 2JDSA 3FXXA 4GJ3A 3BZ3A 1U59A 5FDXA 4RRVA 5CEMA 3EQCA 1Y6BA 5EI6A 3KCKA 4E8AA 4YUQA 3OCGA 4IDTA 3ANRA 5D41A 4EOSA 3TNWA 2W1IA 5HVKA 2CDZA 3LCTA 2YIYA 2OWBA 4ZSJA 2JKOA 1XJDA 4JVGA 5CSVA 4FKVA 1OKYA 3A60A 3MS9A 5CU2A 5DIAA 3TTIA 4BKJA 3QZHA 5AIRA 5AR8A 2XNOA 1YI6A 2RFEA 3PSDA 3CD3A 3TZ7A 4Y95A 4PDSA 4XH6A 4YHFA 2CKPA 3H9FA 5E1SA 3H4JA 4K1BA 1OVEA 5DG5A 1OUYA 2YLFA 1G3NA 1JPAA 2R3KA 1WBVA 2X2MA 4IX4A 3N9XA 1PKDA 4QP7A 1YWRA 2BKZA 4LV5A 3DK3A 3WZDA 5IKWA 3TKIA 4MCVA 4M12A 4Q5HA 2J0JA 2BILB 5EM6A 2YCSA 2VGPA 1PXIA 1JKLA 4X21A 4YHJA 3VHEA 5LMKC 4O27B 2RFDA 4BCNA 2UZVA 4EJ7A 3DZQA 2WMVA 4IH8A 4Y5QA 3MFUA 4I6QA 5B0XA 1REJA 2FA2A 2V7OA 4HVHA 5AV4A 5F94A 1FMOE 2P0CA 1Q41A 3BBTB 4BIDA 4MXXA 1XQZA 3TIYA 2ZAZA 2W05A 1APME 1H01A 3IONA 3KFAA 1I44A 1XBAA 4GS6A 4IAAA 5HO6A 3RHXA 4BZOA 1V0BA 2X2KA 4I94A 4O0TA 4ZTSA 1Q8UA 3I6WA 4G6LA 3SV0A 3G90X 3TNQB 3EFLA 4QQ5A 5BX0A 3C0GA 2OIQA 2HELA 2WMBA 3FJQE 4BI2A 1NVQA 5D7AA 3R7YA 4NL0A 3T3UA 4K2RA 2B0QA 5CVHA 3UG2A 2ONLC 3QZIA 4CFXA 3TV7A 3UMWA 4EYMA 4EK4A 2NO3A 4UWBA 5M53A 3NDMA 3DXQA 3V5WA 3O51A 4YJSA 2GFCA 5DHJA 3C50A 4G3EA 2C5XA 4GEOA 4ZTLA 2EXEA 5CEPA 3G9LX 1Q62A 1K3AA 2JIIA 4FV2A 4FI1A 3NS9A 3FHIA 1U4DA 3RBWA 3R8VA 5LMBA 1BI8A 5DI1A 4C4IA 4MXAA 4O0YA 5ANIA 3ZFXA 3FI8A 2WO6A 3TM0A 4ENYA 1TQIA 5JFVA 2JDVA 3BI6A 4BDBA 2VD5A 3FZOA 3EWHA 4W4WA 2WTVA 4WNKA 5AR5A 1HCKA 3GCQA 2OO8X 5F4NA 4YLLA 3LOKA 5CSWA 2QU5A 5AAEA 4FIHA 3FC2A 4O86A 5KMNA 5A6NA 5E8ZA 2X9EA 4EC8A 1VZOA 4CVAA 4HZRA 3FSKA 1QPDA 3DBDA 5JMSA 3NYNA 4RJ6A 4C02A 1Q99A 1YOJA 1J91A 5CY3A 4EL9A 5HX6A 3SQQA 2I7QA 5J9LA 3D0EA 5J5TA 4D5HA 4XOYA 4L43A 4XX9A 5AX9A 4FKLA 4FTQA 4QOXA 1OL2A 2OJFE 3ET7A 4TY1A 3ALOA 4FTIA 4C4EA 4D58A 4CLJA 5JGBA 3TT0A 3GOKA 5HE1A 2PUIA 4LMNA 2E9VA 2UW0A 4E5BA 4G3FA 1KV1A 3PY1A 4IJPA 3F82A 5FDPA 4QTDA 3B2WA 3QQUA 3FI2A 3LXNA 4ID7A 3A4PA 4QT1A 5HQ0A 1WBSA 1JOWB 5GZ9A 5AUVA 2X81A 3BRBA 5ETIA 5JGAA 2PYWA 3HV5A 2JAVA 3OXTA 4U44A 3WILA 3WZJA 1KE6A 4NU1A 4RX9A 2RSVA 3FMJA 3PXYA 3DAJA 2EWAA 3TUBA 5J7BA 2PVLA 3O2MA 1ZZLA 2GMXA 3QLFA 1XH4A 1JLUE 3KC3A 3LFBA 1AQ1A 2XK4A 3MA3A 4FV3A 4I1ZA 4ACCA 4D2VA 3CTHA 4IB3A 4JAIA 3AD5A 2W96B 4A4XA 5D1JA 4EKLA 3SRVA 5BUEA 3UQCA 5C27A 1WBWA 4PL4A 2C5NA 4QMXA 3TV4A 3EL8A 4QNAA 3SW7A 3ACKA 5FXRA 1QCFA 2JDRA 4NWMA 4AOIA 4H05A 4UB7A 4XJ0A 5E8TA 4U43A 1DM2A 3ORIA 4IWQA 4YC3A 2IG7A 1G8AA 3SA0A 3QYWA 2P3GX 3CS9A 3ZSHA 4U80A 4YJNA 3UOKA 3NZ0A 3RJCA 3GCSA 5KMOA 1P4OA 2C6LA 3QUPA 4EKKA 4AOTA 4YJVA 1KSWA 1YI3A 3DDQA 5E7RA 3IDPA 4UMUA 2ETRA 2VTLA 1FINA 3UPZA 4FK3A 2P4IA 3OCTA 2FUMA 1CM8A 4Y46A 5HU9A 4FT9A 3C1XA 5DRDA 3PJ3A 2ERKA 2W5HA 4QD6A 5CXHA 3NUUA 4BDHA 3DAKA 3IW5A 5CVGA 3PIXA 3Q5IA 2XEZA 4UBAA 2CLXA 4FYNA 3QTWA 3L9MA 4AW5A 2PPQA 2VTPA 4F7JA 4RC4A 4FZFB 2IW9A 3ORZA 3HV4A 4ZAUA 4BTKA 5CXZA 1P4FA 4NJDA 3PYYA 4BICA 5IUGA 2FVDA 3UG1A 5FTGA 3MTLA 3PA3A 2YWVA 3GU8A 2C6IA 4GK4A 4M0ZA 4RA5A 4RFYA 4BTMA 4IAZA 4RZWA 4DEDA 5E92A 2XIXA 2GDOA 2VWVA 3FV8A 2XB7A 4X2FA 2QOBA 3TJDA 1Q61A 4IX6A 2YERA 3DPKA 3FLQA 5EHOA 2BTSA 4FZAB 4WUAA 1CTPE 2BFYA 4JG6A 3SVVA 4ZJJA 3FYKX 3GC7A 3NEWA 5EW3A 3UVPA 2OJ9A 3VBWA 3WIKA 2XNEA 4PPBA 5HG5A 4E3CA 3PY0A 4TWOA 3EJ1A 2C6OA 1ZMUA 2G1TA 1W84A 1K2PA 4MBLA 4MHAA 4YZMA 5EDQA 5FEEA 3QRUA 2OG8A 5L2TA 2R3LA 3FZPA 3KK8A 3PPZA 4AZFA 4KAOA 3GU7A 4O6EA 1Y8YA 2E9NA 2XK6A 5C4LA 2PMNX 3FDNA 3OROA 4OR5A 4ALWA 3MFRA 4IEBA 3MIYA 3ZUVA 4NKAA 3DNDA 5BYYA 4DG0E 4DHFA 3I5NA 2GU8A 4NT4A 2PE1A 5HVJA 3CY2A 3LZBA 4S30A 4UZHA 4YLJA 4JBVA 4YGAA 3K5VA 4DCEA 5L2WA 3OZ6A 3VW6A 2QR8A 4CTCA 4NM5A 1J7IA 3U87A 4GVAA 4YTCA 4NZWB 2WEIA 4MD8E 3SC1A 4D9TA 1PY5A 2BZJA 3DTCA 3DBQA 3CR0A 4M8TA 4P7EA 4ACDA 4M13A 3HGKA 4P2KA 4FTKA 2PVMA 1S9IA 2AUHA 4D28A 3U9CA 3EN7A 4OTWA 3VHKA 3JPVA 4C3RA 4CQGA 4PMPA 4IDVA 4GRBA 4F7LA 2OF4A 3HECA 2WMUA 3BEGA 4S33A 4AZVA 4KNBA 1OIRA 2GQRA 4QP9A 5E9EA 5IMXA 4YTHA 5EM8A 2FSLX 2IN6A 3MIAA 4OBPA 4PMTA 2C3IB 3R21A 3W8LA 4C58A 4EBVA 5IQFA 4QMUA 2XRWA 4IWPA 5C8MA 4EH8A 5GNKA 2WTDA 5IEVA 5C03A 4EK5A 2ZOQA 4KB8A 2W4OA 4O0SA 4OGRA 5A54A 3PXQA 4J53A 3KXGA 2G2IA 3S4QA 4YJUA 2C69A 3DKCA 2WIHA 4ERKA 4YO4A 3UO5A 2JBPA 4DH1A 5L2IA 3Q5ZA 4QP2A 1X8BA 4BDJA 5IU2A 3CP9A 1FGKA 1ZY5A 3VUMA 2YM7A 3PJCA 2B52A 2UW4A 2PVNA 4L7SA 4HVGA 4GT5A 3VS6A 3VUDA 3PSCA 5J9ZA 5K4IA 1WBOA 3R6XA 4KBAA 5D11A 2R3PA 4V0GA 2BRHA 4EOKA 3TL8A 4C35A 2EU9A 3BGPA 3MDYA 3NUAA 1Q8WA 2UVYA 4QP4A 3AT4A 1URWA 3ORPA 4U45A 5KX8A 3PLAE 1OKVA 1Y57A 3D9VA 5CZIA 3L8XA 1P14A 4AW2A 2YEXA 4FTAA 5ACKA 3G6GA 3NUPA 4BGQA 4R3CA 2UW9A 1VYWA 5AWMA 2R3JA 4CSVA 4YJPA 4KIKA 3FZTA 1Q8TA 2C1AA 1ZARA 4BWKA 1Z5MA 5M4FA 4AZWA 2YITA 3R28A 3SHEA 4XCUA 2OK1A 3H30A 4DAWA 4AFJA 4LL0A 4ZZNA 4WRGA 3F5XA 4GV1A 1J1BA 2B1PA 3QD0A 2C5VA 1NY3A 2XIKA 3EQPA 3ZONA 2V22A 3ZOSA 3UOJA 4HCVA 3TKHA 4DFYA 4USEA 5LCKA 3O23A 3KCFA 3BCEA 1FVVA 4NH1A 5EW8A 4JRNA 5BVEA 5G6VA 1S9JA 4WBOA 4C59A 4WRSA 4AP7A 3AC4A 3RAWA 3HKOA 2XKFA 2R3IA 3PZHA 3UIXA 4ANLA 3ORTA 5L2SA 2Y4IB 2XP2A 3PA4A 4RA4A 5T6KA 3G6HA 5J8IA 4RJ3A 2WXVA 2B9JA 2R3NA 4G5JA 5LXMA 4CT2A 4AUAA 2O2UA 4JG7A 2QCSA 3D5XA 3ZUTA 2BR1A 3OF0A 4H3BA 4ANBA 2PE2A 3F66A 4EOPA 5AV0A 3HEGA 5G1XA 4TYGA 4FX3A 5HLPA 2PSQA 4BIEA 4FKTA 3D2IA 4IFGA 5DRBA 4GUEA 2W1DA 3R9RA 3I1AA 5A4CA 1FQ1B 4I0RA 1CKIA 1QPCA 4XMOA 4H1MA 3RK5A 3WBLA 4JQEA 5ANKA 4BHNA 5HTBA 1OMWA 5ANGA 3CPBA 3FC1X 5EQPA 2C0IA 3WOWA 4KKEA 3RNYA 2WQNA 3E7OA 4S32A 5IMEA 1STCE 4NM0A 2W06A 3T3VA 2Y4PA 2ZV7A 4XG6A 4W4VA 1HOWA 2W7XA 4ZLOA 3P23A 4NW5A 3VJNA 4BYIA 4F6SA 5HCXA 4D4SA 3W55A 2YM3A 1ZMWA 5L6OA 1TKIA 2PZPA 1YDRE 3DTWA 1MQBA 3EIDA 4K0YA 3NSZA 3UOLA 3Q4CA 1DI8A 1UWJA 3LJ1A 3P4KA 5AADA 4EWQA 1KOBA 3SGCA 2X0GA 5HBJA 2XKDA 5I9VA 2ITNA 1M14A 2QVSE 4O82A 3ULIA 4LRMA 4IVCA 5DYJA 2QHMA 3FY0A 3O8PA 4QMLA 5CQUA 4EUTA 2XJ2A 3DK7A 4CRLA 5KMIA 3LFCA 2X8DA 4DFBA 1FPUA 4KIQA 2GNJA 3RVGA 1CSNA 3ZO1A 3GCVA 4O7ZA 2IZTA 4O84A 3UQFA 2WHBA 5EW9A 4D2PA 1WBNA 2PUPA 3RP9A 2XM9A 4AA0A 3PY3A 2XNMA 5JSMA 3ZO2A 3W2QA 5A6OA 2VO3A 1Q97A 3NYOA 3R0TA 4FKSA 3UNZA 4RIOA 1A48A 2WQMA 2BRGA 4J95A 3UQGA 4ITJA 5CNOA 5T3QA 5AX3A 3DK6A 1H1RA 2HXLA 4DFNA 4Y8DA 2WMSA 4IC8A 1AGWA 1PXMA 4NKSA 4NFNA 2VUWA 3W33A 1H25A 3FYJX 2C3LA 4JDJA 2W9FB 4F1MA 3Q6WA 1PMEA 4JJRA 4MVFA 3QCQA 1J3HA 2C3JA 3R22A 3KXMA 4KKGA 2C1BA 2GHLA 3LQ5A 4W4YA 3AC2A 3PRIA 5AV2A 2QOLA 4I4FA 3FLNC 1WVXA 2Z2WA 2JKQA 2YWPA 1U5RA 4XP2A 5BYLA 4L53A 2C0TA 4TWPA 4QP1A 3BLRA 4PDPA 1BYGA 4RMZA 3DJ5A 4FTTA 4Y5HA 3DKOA 2XNBA 3Q9WA 2XK3A 3UYTA 2A1AB 3KMMA 1FMKA 4DH7A 4ALVA 3ROCA 3TJCA 5F9EA 3JVSA 2UW3A 2R0IA 4WKQA 2EUFB 3FL5A 5DGZA 3SX9A 4F1TA 3PXZA 4IX5A 3ZC6A 4F6UA 2VNWA 4R7IA 2QG7A 1DS5A 1H1SA 4U9AA 4A4OA 2BUJA 4AFEA 3CKXA 1RDQE 4IZYA 1GY3A 5CYIA 4IZ5A 4DGMA 1RJBA 2GTMA 5M08A 4NJ3A 3ZEWA 3IQ7A 5HOAA 4F7SA 5IUIA 5CALA 3S3IA 4QMPA 3RPRA 3LFFA 5C01A 2VGOA 3QQGA 4Z16A 4RIXB 4NIFA 4M69A 4K6ZA 2BVAA 3BE9A 4BI0A 1BUHA 2Y8OA 3AGLA 3FLYA 4G9RA 2O65A 2OXXA 4G1WA 4XG4A 3EQBA 1XH9A 4FTLA 3OWPA 4O6LA 1YOLA 3VS2A 4E6QA 4O0WA 3U54A 4BZNA 4J99A 2RF9A 4H36A 3ZFYA 3NVKI 1Q3DA 2XK7A 2IW6A 3OT3A 1TVOA 4FUYA 3MPMA 4AAAA 3D7TB 1ZY4A 4KRCA 4V01A 3V8WA 4BBMA 3ZLWA 5FTOA 3R1YA 3F3VA 4O7RA 3FLSA 3UODA 1AD5A 5BVNA 2BIKB 2H8HA 4X3JA 5CAOA 4CKJA 3RWPA 3SG9A 2FSMX 3NAXA 4QTAA 4XHKB 5EOBA 3BHUA 4KS7A 4AA5A 4D5KA 3JY0A 1DAYA 1O6LA 2ZVAA 3MH3A 2DUVA 4EK3A 4X2KA 3QQFA 2PZ5A 3GCUA 5M07A 3FMDA 2UZEA 1J7UA 2OZAA 4IAIA 3GB2A 3VQHA 3SDJA 4TTHB 1ZYSA 4L3PA 3V04A 1H1QA 4IAYA 3TTJA 2GNIA 2PMLX 3AQVA 2YJRA 3GU4A 4B99A 3GC8A 3MVMA 3BHYA 5K5NA 4AT3A 3VS5A 4AZTA 1GNGA 1PXNA 1T45A 4EK6A 3EQFA 3H10A 3KL8A 1ERKA 3QFVA 3SXRA 1UKIA 5AJQA 4IW0A 5HBHA 3R8ZA 4CG8A 5A9UA 3BYUA 4FMQA 5EKNA 2WMXA 3FI4A 5ANJA 3CEKA 4BBEA 2XIZA 2C6MA 4FNXA 4XNEA 4E26A 2R0UA 3DBFA 3DXPA 5DA3A 3P7BA 5EH0A 5FGKA 4MNEB 3MBLA 1ZZ2A 3DFCB 4JLCA 1A06A 2BAKA 2FGIA 2PUUA 5EK7A 2BCJA 4OTDA 5HG8A 4DA5A 3P1AA 1WZYA 2WQEA 4I93A 4U3YA 2X6EA 4DGNA 5DN3A 2VTHA 3EN6A 3W16A 2Y6OA 1FVTA 4PTEA 2FSTX 1OBGA 2QO9A 5DBXA 1U54B 3E64A 3OG7A 1OL5A 4GT3A 4XEYA 5K3YA 4BKZA 1GZ8A 3BLQA 1ZRZA 3AD4A 3CQWA 4WO5A 4EH9A 1H0WA 1ZWSA 3D4QA 3KREA 4MQ1A 1L8TA 4JR3A 4FTRA 4ZSAA 5D12A 4IWOA 1CDKA 3VF8A 2W1CA 2XF0A 1OPKA 4MXZA 2EB2A 5IA4A 3K3IA 2FO0A 3PA5A 4U81A 4D0XA 2XK9A 4I6FA 4LFIA 5CT7A 4EH5A 1PHKA 5KHXA 4DT9A 4X6RA 1OL7A 2OW3A 3OOMA 4R7HA 2G9XA 1RQQA 2XUUA 3EH9A 3ZC5A 3HMOA 3D5UA 4H39A 2VO0A 3R71A 4OW8A 2HW6A 5EDPA 2ZDUA 4RWIA 4CTBA 4DBXA 3TIZA 5H9BA 4N57A 4RX8A 4ZLZA 3OCSA 4FGBA 5CEIA 1F0QA 2AYPA 4FIJA 4FKQA 2BRBA 2HXQA 3A99A 3NYVA 3FKNA 3OUKA 3TEIA 3IPHA 1M2RA 1IAHA 3A7GA 4FNWA 3P7AA 4IAFA 4BWPA 1OUKA 4EBWA 3R9HA 4ZTMA 4XRJA 1H0VA 1YXSA 1IG1A 3FQHA 4F09A 4C36A 4FC0A 4DLIA 2XNPA 4G3DA 4CKIA 2YZAA 3KKVA 4F9WA 3IOKA 2CSNA 4EYJA 3WF5A 3OXIA 1H24A 4JDHA 3R9NA 4AN9A 4ANNA 4AW0A 5M44A 2HZ0A 4UYAA 3MSSA 4E20A 3RINA 4N6ZA 3IGOA 4EONA 4I24A 4C4JA 3VS7A 2W99B 2QHNA 5CAVA 2IO6A 5GZ8A 3R9DA 2JITA 5EOLA 4CQEA 3R1QA 4C8BA 2G2FA 3KU2A 2R3FA 5CU3A 3PP1A 3VVHA 2UZBA 3MPAA 3NPCA 1JBPE 2WTKC 4GG5A 3OY1A 4QTEA 2Q0BA 4HW7A 1KUTA 1LUFA 3O7LD 5KCVA 3BYSA 4YTFA 3VUIA 5FP6A 4FSNA 5IH4A 2QOKA 2JEDA 5I9YA 5H3QA 4I21A 4WT6A 4EOJA 3U6JA 5BNJA 1Q4LA 2W1HA 4YZDA 5CI6A 2GS7A 5HORA 4WNPA 4A9RA 4E6DA 1FOTA 4BI1A 3A7IA 4AGCA 5C8KA 5HI2A 2XJ1A 5EKOA 5FLFA 3DBCA 2O5KA 4HYUA 4XBUA 5TF9A 2IWIA 3MWUA 3R30A 5HLNA 3F2AA 4I5MA 5BMSA 3S95A 5LVLA 3UZTA 4FOBA 1P2AA 3QKKA 4RWLA 3R7EA 3QWKA 5CENA 3HDNA 4O81A 5IQIA 3QZFA 1Q3WA 1B38A 2R3RA 5KO1A 2X7GA 3PE2A 1PYXA 4CG9A 3DB8A 4TXCA 4O96A 4JIKA 4RG0A 5A3XA 3WE8A 3S1HA 5GINE 3CJGA 5K0KA 2CKEA 3KXXA 4D0WA 4GT4A 1YWVA 1M7NA 2UW8A 2HZ4A 4BDAA 5FM3A 3M1SA 4DLJA 2XIYA 3O7LB 3FUPA 5EM7A 2C0OA 4FSZA 4R6VA 4BDKA 3E8NA 2HK5A 4G31A 5BMMA 5L3AA 3E92A 1IASA 1MRYA 4R78A 4LI5A 3GC9A 5KMMA 4KINA 3SW4A 3EQDA 4TYHA 5TOZA 2WTWA 3VNTA 5A14A 2ITVA 2CLQA 1O9UA 5HTIA 2J2IB 3OEFX 4H1JA 3BV2A 1JSTA 5ETCA 3HZTA 4X2NA 4RJ5A 3S00A 3RWQA 4AWIA 1VJYA 3E3BX 3E8DA 2W1GA 4DCAA 4FSRA 3KRLA 3LXLA 3PP0A 2YCFA 3JVRA 3R7IA 3BU5A 2ERZE 3FSFA 3FE3A 3HRCA 3RZFA 2B55A 4IVBA 4BDFA 2VTIA 4BBFA 5JK3A 4LM5A 2XNGA 4RWJA 5HG9A 2R4BA 2C5YA 3QRKA 3U6HA 3BE2A 3HLLA 4ASXA 4OBOA 5B2MA 4AE6A 2QR7A 1OKWA 3AC5A 2YIWA 3GFWA 4E7WA 4DINA 5AAGA 4FKUA 4J8NA 4BDGA 3FQEA 3PVUA 3QD2B 4IB1A 5IPJA 2ITTA 2PULA 3WE4A 4U40A 3QL8A 1H26A 1I09A 4F65A 1U5QA 4XG2A 1H28A 2VTAA 5AIKA 5GJDA 3OT8A 1UA2A 3KXNA 3V6RA 3V01A 5HICA 4YJQA 4UMPA 5FG8A 4FIGA 1FGIA 5HE3A 5LVOA 4X6QC 3Q3BA 4BR3A 1GZOA 3I7CA 2ITPA 4R5YA 3IKAA 3POOA 1SMHA 2J4ZA 2W1ZA 3NW5A 2LAVA 2VTNA 3GC0A 1JWHA 3RCDA 5L2QA 5BQ0A 3HUCA 3I81A 4BTJA 3WIGA 3DV3A 5AAFA 4I41A 3QHWA 2UW7A 2V62A 1GJOA 2GHMA 2YAKA 3DLZA 3OHTA 2WIPA 3L8PA 1NVRA 3MI9A 4TW9A 4DTKA 1MQ4A 3MH0A 3NNXA 5JFSA 1SVHA 2PMOX 4RT7A 2YIRA 4ZXTA 3W32A 4AGWA 4DT8A 3WZEA 4AGUA 1JNKA 3C4ZA 2OSCA 2RL5A 1H00A 3TV6A 4AXAA 3QCXA 2XS0A 2CPKE 3RK9A 3MY1A 4ONAA 4EQCA 4F9YA 4RX5A 3F2NA 3UDBA 2R3OA 5HVYA 2ZB1A 4RFZA 3Q4UA 4CCBA 5HBEA 4CV9A 4I0SA 4C0TA 4WA9A 2P2HA 5ITAA 3P08A 2VO7A 3F5UA 3PIZA 3HMMA 4MTAA 4F08A 3ZU7A 4EC9A 2C3KA 3UC3A 3VS1A 3SG8A 2GFSA 5HTCA 4QMZA 1E1XA 2ZM4A 3RM7A 4FV1A 3QRTA 2DQ7X 3NNUA 4FICA 3HV6A 3WARA 3BU6A 4BDCA 5IH6A 5CQWA 3H9OA 4W8EA 3UPXA 1UNGA 3DBEA 5HU3A 2X39A 1XHAA 4EOIA 3CSVA 1H07A 4R8QA 4QMVA 4FIFA 3LVPA 4WG4A 4UXLA 4ZSGA 2DS1A 1PRYA 3G15A 4FT0A 4MH7A 5HLWA 3FXWA 4I3ZA 3EYGA 4QP3A 1CKPA 2H6DA 3GENA 4H3PA 3QTRA 3OVVA 4TNBA 4FEUA 3IDCA 4D1ZA 1JAMA 5E90A 3LFSA 2UZNA 2ZV2A 4YPSA 2QKRA 1YHWA 2CCIA 2ITOA 3GGFA 4FTUA 4JAJA 3BV3A 3RHKA 1W7HA 4AT4A 5H8EA 4PNKA 3ORXA 4MYGA 1B39A 3FLZA 3ZLXA 4M97A 4X2GA 5EHYA 3UIUA 4RIWB 2B9FA 3U8WA 4BDDA 1OECA 4L46A 5CT0A 3C51A 3CIKA 3P5KA 5CNNA 4FZ6A 2VTTA 2E9UA 2UVZA 3FKLA 3OC1A 4LGGA 3F6XA 4M0YA 2ZMDA 1A9UA 5HO7A 5AFVA 4NFMA 2V7AA 1XBBA 2X7FA 4FK6A 4UN0C 4MD9E 3FBVA 1WBPA 4IE9A 5H8GA 2YLEA 2OJJA 2QOFA 3GOPA 5JGDA 3DB6A 2PE0A 3NW7A 4CT1A 3AMAA 4RQVA 2PZIA 3V3VA 4QMTA 1JSVA 5AA9A 3DDPA 4E5AX 4LV8A 4E93A 3O8TA 4CFNA 2Y6MA 4DC2A 2A4LA 4LGDA 1GIHA 3R1NA 4TPTA 1PMVA 4XG7A 1UV5A 4F1OA 3QALE 4CNHA 5IG1A 1SNUA 2J0KA 2R3GA 3LXKA 3NGAA 4I92A 4II5A 4WHZA 4KBCA 5CSPA 4MKCA 4FBXA 4O21A 3DT1A 4DEGA 2YIXA 3JXWA 4QNYA 4ZEGA 2J0MB 5AR4A 3ZRLA 3NUNA 2RG5A 4WG5A 4K11A 3ZRKA 2HW7A 3KRWA 3Q04A 4AE9A 4FA2A 3ZLSA 3BEAA 4AA4A 3F5GA 3M11A 2NNWB 4OBQA 4APPA 3UYSA 3LW0A 5LWNA 2V5QA 3VUGA 2QO7A 2UZWE 2GQGA 3TUCA 5DWRA 3DLSA 3O71A 2C30A 3DZOA 5AUUA 4UY9A 3HA6A 3C13A 4KABA 1TQPA 4Z7GA 4Q9ZA 3EQRA 4D2RA 4QMWA 4XRLA 1JKSA 4PMSA 4C3PA 5M06A 1OM1A 3HP2A 3V5JA 1YDTE 1PKGA 3PIYA 5JN2A 4PTGA 1W0XC 4OTRA 3MY0A 3UVRA 1JKTA 3Q4TA 4OTHA 4FEXA 3B2TA 4HVSA 2WEVA 3II5A 2QO2A 5C9CA 2Z60A 4I6HA 4YZCA 2WMTA 2I0VA 4IMYA 3CTQA 3KVXA 1QMZA 3C4WA 3SOCA 4FYOA 3ZO3A 4PP9A 2QLQA 2HOGA 4RBLA 4E73A 4GKHA 4IXPA 2GQSA 1W98A 3I4BA 1YXVA 3HMPA 4TYJA 3KEXA 4QPSA 4ARKA 4ZMEA 3VUTA 3OW3A 2QOHA 3PTGA 4RWKA 3JYAA 4X7QA 2YM6A 3QX2A 4G34A 4CZTA 5D9HA 3KN6A 4APCA 2XBJA 3K5UA 3O8UA 4MXYA 2W1EA 3KULB 3OXZA 4OLIA 1T46A 3QUDA 2XMYA 4NSTA 5AP4A 5KKRC 2ZDTA 3VN9A 4TYIA 2OF2A 1GZKA 4C7TA 3V5LA 2JD5A 4N4SA 2Z7SA 4FL1A 4P5ZA 1U46A 2VU3A 3ERKA 4B4LA 3IG7A 4H58A 2REIA 1PXOA 1OIUA 1Y8GA 2WZJA 2Q0NA 3OY3A 4ZY6A 5I4NA 1FBNA 1F5QA 2NP8A 3Q96A 2RGPA 2WOUA 4GMYA 1OGUA 4ZLYA 3LFQA 2B4SB 3CXWA 3QLGA 2QOIA 2WB8A 4FZDB 3RMFA 4ASZA 5JQ8A 2B9IA 2YA9A 1UU7A 3RNIA 2OFUA 3ZUUA 2C6KA 5HESA 2WMRA 1Q5KA 2BZKB 2QNJA 2XZSA 4JQ7A 2F7XE 4EEVA 3A8XA 3IS5A 3QXOA 3EN9A 4ANOA 1R0EA 3AC3A 4OTPA 2UV2A 4YLKA 4USDA 3ENHA 3ZBXA 4DE4A 4O1PA 4YC6A 2VTQA 3LCKA 1YDSE 3D15A 3VUHA 2DYLA 2XYUA 4QTBA 5J9YA 2OBJA 4Y73A 5FBNC 4FNYA 3V5PA 2IJMA 2XK8A 3C7QA 5ANDA 2QOQA 2CHLA 2AC5A 4PV0A 4QYFA 1ZYCA 3C9WA 1O6KA 4C3FA 1RW8A 3D14A 4M3QA 2VRXA 2XCKA 3RI1A 1J7LA 2F4JA 1Q8YA 2Y0AA 3DU8A 4JS8A 3W2SA 4M7IA 4ANSA 2ZYBA 3VBQA 3CJFA 1XH6A 4HYHA 5HNGA 5CEQA 4DGLC 4R1VA 4QYEA 3IW7A 3CCNA 3FZRA 3DNEA 2YDJA 3COHA 4YJTA 1GOLA 2WTJA 3VRYA 4YNOA 4Z7HA 3IECA 4CV8A 4FUXA 4GCJA 1H27A 4AGDA 4FEWA 3QTXA 5DT3A 3LJ2A 3IO7A 1VR2A 4UEUA 4WOVA 5D7VA 3UP7A 4GK2A 4PF4A 2R7IA 4ALUA 4DF3A 4B8LA 2AC3A 3N4UA 3QQKA 3DXNA 2OXYA 1WBTA 5HNBA 5AA8A 3LXPA 2VO6A 3TZ9A 3Q52A 3U9NA 2CNQA 1VEBA 3PVGA 3IGGA 4FT7A 3LCOA 1R1WA 4IM2A 4RIYA 4FSYA 1Y6AA 2B9HA 3SRVB 4G16A 1IRKA 3QZGA 3ORKA 3PE1A 4OTQA 3VWAA 4FV9A 3QQJA 3JR1A 3MYGA 1GIJA 3NCZA 3QAME 5TR6A 4B6LA 3W2RA 4LRKA 4IB5A 4TKSA 3VIDA 3I0OA 3U51A 5CS6A 4AU8A 4DFUA 3E8EA 3LE6A 3M42A 3ZSGA 5IF1A 4CMTA 2X1NA 3I5ZA 4L6QA 1FVRA 1UVRA 3PSBA 4FTOA 5LMAA 5TO8A 3UE4A 3LFEA 3N51A 3D5VA 4G17A 3VBTA 4ZS4A 4IB0A 4GH2A 5H2UA 3TG1A 3S0OA 1L3RE 5CANA 4X3FA 3LKMA 2GCDA 4IM3A 3R04A 1M2PA 5DPVA 1IEPA 4BFMA 3KVWA 5F1ZA 3CKWA 4M68A 2X4ZA 4DTAA 4K77A 4L67A 1M17A 3KN5A 4PPCA 4RVMA 4CCUA 4EI4A 1OBDA 4XP3A 5JEBA 4GFMA 4HCUA 4A4LA 3ZM9A 1KOAA 4MBIA 3QA0A 3FXZA 2UZLA 4QYYA 3PXKA 4D4RA 1NA7A 3AMYA 4K18A 1E1VA 4YTIA 4X0MA 1R3CA 4EHVA 3H9RA 5BVKA 3UC4A 2XIRA 4HJOA 5EG3A 4JX7A 4U7ZA 4MK0A 4BCJA 2BDFA 3ZXTA 4D2WA 3IK3A 4JNWA 3PZEA 3BBWA 4OTGA 4F70A 3LM0A 4FODA 3W10A 5GZAA 5GHVA 5CF4A 3Q2MA 4GSBA 3UMXA 3TNHA 3DOGA 3AG9A 2ITQA 2HWPA 4PX6A 1WFCA 3RTPA 2UW5A 1V0PA 3AXWA 2ITUA 4NTTA 5EYKA 3Q9ZA 2GHGA 4RVTA 5I9ZA 4L3LA 1W83A 4V04A 3QA8A 3E7VA 2PWLA 3NAYA 3P78A 4Z9LA 2R2PA 3DAEA 4O7NA 2JC6A 2OIBA 4BCHA 4QPAA 5DR2A 3NNWA 4C37A 3NCGA 4U97A 3ALNA 3BYMA 2ITXA 4A7CA 3PXRA 3U4UA 3WF7A 4GYIA 2NRYA 3QTZA 3HA8A 3TKUA 4FSUA 4KWPA 2PVKA 3R00A 4CFFA 4DEHA 1XBCA 4L44A 4GVJA 4L01A 4LQMA 4MBJA 4GUBA 4OUCA 3BIZA 3HYHA 4X3FC 5B7VA 5B2LA 5CEOA 3R8PA 3R83A 3UVQA 2I6LA 4FG7A 4RVKA 5AMNA 4BKYA 5A4TA 1NXKA 4HNIA 4ZIMA 3LQ3A 3E93A 2ETMA 3QKLA 5KMJA 1QPEA 2FSOX 3LFNA 4BGGA 5BVOA 1YVJA 3NWWA 4P4CA 5IA0A 4O7WA 1YI4A 4F63A 4FV0A 4QYGA 2PVRA 2UW6A 2ZB0A 5AP2A 3KF7A 1DAWA 3OUNB 2Q83A 3NIEA 3BLHA 4FGRA 4YJOA 4B8MA 5DVRA 4XV3A 4BCMA 3ID6C 5E8VA 1ZMVA 3ORMA 3TWJA 1ZYLA 3BQCA 3GQIA 4XG9A 4E4LA 3Q60A 3GFEA 3Q9XA 4TWNA 3NR9A 5I5ZA 3PJ8A 3C4EA 4I4EA 2VWWA 5FD2A 3AC1A 4J52A 4LOPA 5GJGA 3QCYA 1OIYA 4V0GB 4OAVB 4L8MA 5HEZA 4GFOA 4BTFA 3R7OA 3ZRMA 4UWCA 2WNTA 3ZTXA 3HMIA 3ZHPC 4HOKA 3AOXA 5HE0A 5CX9A 3R02A 3ATTA 4Z3VA 4YZBA 3TNIA 4BCFA 3EL7A 3QD3A 4ZY5A 4O91A 3UIMA 3BYOA 5L8LA 2F9GA 2VWXA 4I22A 2ZV9A 5GIOE 4C4GA 1V1KA 3BHVA 3GXLA 2CGVA 5DOSA 2WTIA 4KIKB 4CZYB 3DY7A 3HV3A 4J1RA 4QMYA 5EYMA 3R7VA 5E8WA 4LMUA 1H8FA 3QTSA 5E1EA 4TYEA 3JUHA 2JLDA 3KMUA 5M4UA 4OT5A 3ACJA 2YJSA 1BMKA 3ZYAA 1YQJA 2PVJA 3DCVA 4RFMA 4DYMA 5IDPA 1MRUA 1E9HA 1PYEA 3P79A 2JIVA 3UP2A 3WF6A 5CF6A 5DT4A 2HYYA 3S2PA 4R5SA 3FPMA 4YURA 4YJRA 2X9FA 4WNMA 2H96A 3VF9A 3LJ0A 3LQ8A 3RM6A 2PVYA 4UXQA 4ZS0A 4DGGA 4MF0A 4FV5A 5BUIA 2O64A 3VJOA 4B7TA 2Z8CA 3LMHA 2XVDA 3HV7A 3WYXA 1YXUA 4GKIA 4YSMA 3F3TA 5AP0A 1ZAOA 3KY2A 4IHPA 2P33A 3OWLA 5DH3A 4BC6A 4BDIA 4RJ8A 3LFDA 2X6DA 4DFXE 3MH2A 5K4JA 2R3MA 3LLTA 3U4WA 5M57A 3P86A 2WOTA 3F3ZA 4EH3A 4KRDA 4BCPA 4DFLA 1UNLA 4F0GA 2Z7LA 5AUZA 5BVWA 3ZCLA 2YHVA 2VWUA 1R0PA 4QP6A 4D4VA 4F0FA 5KMKA 1NT2A 2RFSA 2PVHA 1OL6A 4EQUA 3FKOA 5LOHA 3KGAA 2JDTA 4U41A 3R73A 4M15A 3ZZWA 3FI3A 2I0HA 1SNXA 3VS3A 5FXQA 4ACMA 1PW2A 4HGSA 4CMUA 1SVEA 1R78A 4S2ZA 3ULZA 5J87A 3CQEA 2HY81 4EWHA 5HZNA 3BU3A 2PZYA 5H8BA 4QMNA 3ZSIA 2JFMA 4U79A 5LCJA 1Z57A 4EHGA 5IQCA 2CGUA 5AP3A 3SKCA 4RVLA 3VBVA 2A0CX 3EKKA 4XV1A 5J95A 1IA9A 4TZRA 2QOCA 4O7YA 3W2PA 4O38A 4CFMA 2GS6A 4GU6A 4U0IA 3N4TA 1OL1A 3HRFA 1PXJA 4DG3E 3Q2JA 1M2QA 4ZSEA 4IWDA 4MAOA 3RALA 1V0OA 4FT5A 3L9PA 3QTQA 2VV9A 3ZBFA 4TWCA 4F9AA 2W17A 4MEDA 5EFQA 2GS2A 3CLYA 3I60A 5CF8A 1WVYA 3NIZA 2CNVA 1OZ1A 2A27A 5HO8A 4HVIA 2VTRA 4EOQA 3ZEPA 3PVBA 4AZSA 1M52A 1QL6A 3A7FA 4ZTHA 3O0GA 3ORLA 4W9XA 2R64A 3FMNA 4J96A 3G5DA 3RPOA 3AT3A 5EYDA 3TACA 2JBOA 2QD9A 3MH1A 4M84A 4QMQA 4JR7A 4WSQA 5JT2A 2I1MA 4FF8A 5KZ0A 5BUJA 4M66A 4HCTA 4RX7A 1UNHA 3BWFA 4G6NA 1BI7A 4LUEA 3HDMA 4F64A 2X2LA 4JRVA 5BPYA 5IQEA 3WF8A 3OS3A 4TT7A 1JSUA 2ZM3A 4ZMFA 1OB3A 1YHVA 2HENA 2IZRA 4FV4A 4GW8A 2H34A 3R7UA 4FL2A 4XYFA 3FZ1A 4FKPA 1R39A 1CKJA 2BAJA 2P55A 5DMZA 3MA6A 2I0EA 2ACXA 2ZM1A 3OTUA 4S31A 4A9UA 2I0YA 3EQHA 3ZDUA 3RGFA 2LGCA 4LRJA 5AM7A 2ESMA 4E5WA 2XA4A 3PFQA 4CFWA 4ZTQA 4BL1A 2PUNA 3CY3A 4EHEA 4O0UA 4L45A 3ODZX 3TZMA 4QQTA 5M4IA 3JY9A 4I5CA 4L42A 2OICA 4L3JA 3R8LA 3NW6A 3MFSA 3W1FA 5IQGA 3HL7A 4KA3A 3O50A 4JIAA 4HYIA 5LWMA 4IAKA 4J97A 4IC7A 3NMUF 1ZXEA 4N70A 4ACHA 4PQNA 3RAKA 4ORKA 1XO2B 2IVTA 3KXHA 4NTSA 3KF4A 5TE0A 3DKGA 2O0UA 2J51A 3QTUA 4EH2A 4EJNA 1SYKA 2WMAA 3V5QA 4XG8A 2RIOA 4C57A 4FL3A 3OCBA 4I5HA 3SXFA 3ITZA 5CAUA 2YIQA 5GIPE 2KULA 2W1FA 3EKNA 2F49A 4NIFB 2UZTA 1XR1A 3DJ7A 4M69B 3TNPC 3QGYA 3W18A 3IW6A 2XEYA 4C38A 1XH5A 1PMNA 3KULA 3FMLA 1F3MC 2OH0E 2BZIB 3NLBA 5ETAA 2W0JA 4R3PA 3R7GA 3RAHA 3EOCA 4FV8A 4RPVA 4F99A 5IZFA 2QOOA 5LJJA 4EOLA 3FMEA 3F69A 4OT6A 2C6EA 3MGYA 4FIIA 1PXKA 4W9WA 1J1CA 4GJ2A 4YZNA 2QURA 4TN6A 4DEIA 5CSHA 5CU0A 3KRJA 3QXPA 3FPQA 3V8SA 4JOAA 2F57A 4MF1A 4Q9SA 4BCIA 2JAMA 1EH4A 2BKKA 4GK3A 3KA0A 3EQGA 3GU5A 3R63A 5AUYA 5HIDA 5HKMA 4JBOA 3AGMA 2E9OA 5IA3A 4D2SA 3QQLA 2J50A 4FSTA 2OZAB 3QKMA 1LR4A 3BX5A 3PUPA 2VAGA 4LUDA 3Q6UA 4CD0A 4WIHA 5EQYA 3L9LA 3C4CA 4FSQA 4JQ8A 4F9BA 1ZOEA 3PJ1A 4CYIA 2EXMA 5CZHA 2JKKA 4GU9A 2C68A 4JL9A 4BRXA 4A9SA 3TDWA 2OKRA 2HY0A 3ODYX 4Y72A 2YCQA 4QRCA 5KBQA 2KTYA 2PTKA 1BL7A 4YO6A 3SLSA 1OITA 5E91A 5A4EA 4AF3A 4KIPA 4YMJA 2GNFA 2PL0A 4FKOA 4HGLA 4BHZA 1OPJA 1JQHA 1P5EA 3QF9A 5JQ5A 2O3PA 4W8DA 3QC4A 3R8UA 4WSYA 5IA5A 5FP5A 3UO4A 2B54A 4A9YA 4C4FA 3MB6A 2VWYA 2GSFA 3CPCA 3FL4A 3P7CA 3EQIA 4O7LA 3C0IA 3MV5A 1PJKA 2X7OA 4AG8A 4TL0A 4WBBB 2BDJA 3HNGA 3TN8A 3ENMA 2PK9A 4UMTA 4RC3A 1YW2A 2PU8A 4L00A 5ANOA 3VS0A 4IVAA 5BVDA 2HZNA 5I9XA 3EHAA 3HP5A 2WTKB 1REKA 2BPMA 2FYSA 1UU9A 3REPA 1WAKA 2W4JA 5A4LA 4YPDA 4XP0A 4D1SA 4NM3A 2VX3A 2V55A 3QRIA 3MVHA 1BX6A 3NYXA 4FG9A 5HG7A 3PDTA 3CC6A 3R2BA 1PF8A 5KHWA 4FVRA 3CTJA 4BB4A 4FTNA 2FB8A 3NUSA 2WFYA 3E62A 2SRCA 4XG3A 3MY5A 3V8TA 3BGQA 5CTPA 3EZVA 2HAKA 1TQMA 3F9NA 4FIEA 4O2PA 4U6RA 4W4XA 3PPKA 3ROYA 2CCHA 3L8SA 4JG8A 3QC9A 5HGIA 4ASDA 5AUTA 4CKRA 5ETFA 4C4HA 5A4QA 4K8AA 3O17A 4G6OA 5JKGA 3PRFA 3UO6A 3EYHA 3MTFA 4X2JA 4IBMA 4BVUA 2Z02A 2OH4A 2WMQA 4MWHA 3DA6A 1KV2A 2VTSA 2ZV8A 4QO9A 5DNRA 3W2CA 4BCKA 4ZTRA 4RLKA 3I79A 5ICPA 4WNOA 4G3CA 3TDVA 2NPQA 4AN2A 4DFZE 3FMKA 2HZIA 2Y4IC 3GP0A 3OFMA 4QP8A 1RE8A 4G5PA 3LMIA 2GNHA 2YDKA 3VW8A 4USFA 4YU2A 3GCPA 3PWYA 2Y7JA 2YM5A 2WD1A 4M67A 4DN5A 4LYNA 3LHJA 3FQSA 3COKA 5I0BA 5M4CA 5FXSA 3VAPA 4O7TA 5EI2A 4XV2A 2WU7A 1SM2A 2Y9QA 3F7ZA 4O1OA 3NRMA 2BHEA 4IIRA 5JRQA 2XRUA 4A07A 4O0RA 5EI8A 2OJGA 4FVQA 2CKOA 5CEKA 4NCTA 2JDOA 4EH7A 2BRMA 3SAYA 1GZNA 3MESA 4YZ9A 4FKIA 4IZAA 4U5JA 2J7TA 3ETAA 4IFCA 2VTOA 3EZRA 3ZFMA 2J5EA 2J5FA 4D4YA 3EFJA 4G9CA 4NEUA 2VTJA 4IX3A 2EB3A 3L8VA 5CI7A 1O6YA 2C4GA 3PJ2A 5KE0A 1BL6A 2OGVA 4B9DA 4U42A 4FKGA 2OLCA 2B53A 2XM8A 4O2ZA 3SXSA 3KB7A 3G9NA 5AP1A 2IZSA 3BELA 4UYNA 3RKBA 2WPAA 3E5AA 3K3JA 5FQDC 3TCPA 3PG1A 4FR4A 4WG3A 2BROA 5CLPA 3C5UA 4FZ7A 3KMWA 2GTNA 4ZK5A 2BMCA 5DT0A 2CMWA 2XKEA 4I5PA 3LAUA 3D83A 3MVJA 3PLSA 3QUEA 3LIJA 4FKJA 4ZP5A 4FV7A 3OW4A 4IM0A 3NUXA 3VULA 4IZ7A 2VTMA 2CNUA 2VWZA 3GT8A 4L9IA 2A2AA 2C6DA 4RIXA 3VUKA 1PMUA 2I40A 3ZO4A 3LMGA 4ACGA 1WVWA 1LEWA 2YISA 3FMMA 3Q53A 5AM6A 2J90A 2X8EA 3LM5A 5CF5A 4MXOA 3HX4A 3SOAA 4J71A 4LOQA 2JIUA 2VWIA 4MQ2A 3UJGA 5J79A 4ZJIA 3K2LA 2YAAA 1LEZA 4BN1A 1ZYDA 2X8IA 3D94A 2BHHA 1IAJA 4DEAA 3HVCA 3GVUA 3F88A 4OTIA 5AR3A 1H1WA 5JZJA 2CKQA 1H4LA 5AV1A 3D7TA 2UVXA 4FKWA 3VBYA 4GIHA 4TYHB 4UMRA 5JH6A 4YSJA 3EN5A 3A62A 3QYZA 4RJ4A 4ZTNA 3AC8A 5C1QB 3BPRA 3RPSA 1XH8A 3PG3A 5EQEA 4EOOA 1M7QA 1URCA 3CD8A 3DQXA 1OIQA 4KSQA 4GFGA 4H3QA 4NCTC 3KRRA 4L68A 4YBJA 3DQWA 2J0IA 3MW1A 5CASA 3MVLA 4D55A 2C47A 2F7ZE 5HIBA 2XH5A 4E6CA 3F61A 4YC8A 3E63A 4IANA 3NNVA 5HHWA 1WMKA 1PXPA 4S34A 5J7HA 2Z7RA 3R9OA 1DI9A 4E6AA 5HD4A 1YWNA 3CE3A 4RJ7A 4AOJA 4ZZMA 1UKHA 3DGKA 3UIBA 1ATPE 2IW8A 4PDYA 4BWXA 5IH5A 4WD5A 1Q8ZA 1ZLTA 5C8NA 2W5BA 3MJ1A 5LVPA 5EM5A 4BZDA 4DGOA 2QG5A 5C26A 4CGAA 2UZUE 3FZSA 3FEGA 2V0DA 3WZUA 5E8XA 4E4MA 4FSWA 4PMMA 2CN8A 4XOZA 1KE9A 3R2YA 4MNEA 4D9UA 3UOHA 2NRUA 2OIDA 4AX8A 3G51A 2F2UA 4ITIA 4IACA 1XKKA 3D5WA 4KBKA 5DFPA 5FWKK 5HIEA 5E8UA 2F2CB 2QC6A 1UU8A 2E9PA
chains in the Genus database with same CATH superfamily
4GYGA 4ZOGA 3UZPA 3H3CA 3MPTA 4UALA 3ZZEA 3R8MA 2CGXA 2IPXA 2A19B 4QQJA 1LPUA 4FSMA 4HNFA 4TNDA 1ZYJA 1NW1A 4O7SA 1U54A 2GNGA 2VX0A 3R01A 3BGZA 4KUJA 3G2FA 4PL5A 4C2VA 4FV6A 3GNIB 3PVWA 3F7WA 5F95A 3RZBA 3HAVA 2B7AA 3A7HA 4NUSA 5DEYA 4BYJA 3ATSA 1ND4A 4L7FA 2R9SA 4I23A 3BKBA 2WELA 3NX8A 4XS2A 4AQCA 4HGEA 4XV9A 4Z55A 5M55A 5TKDA 3QHRA 4N6YA 4QMSA 4EK8A 4K9YA 5T68A 3ZS5A 3WI6A 4EUUA 2YCRA 4OTFA 2BTRA 4MWIA 4BY9E 2RFNA 2RG6A 3SD0A 3CGFA 3MFTA 2VNYA 3QX4A 3ZLYA 1W82A 2QKWB 1LP4A 2QONA 3KK9A 3QQHA 2XCHA 2QQ7A 4DH5A 2VX1A 4BCOA 1YXXA 2W9ZB 3VO3A 2UZOA 3O96A 3PPJA 4EORA 3L1SA 4J98A 5F20A 3RK7A 3LFAA 4B0GA 5I3RA 2QU6A 4RSSA 4MX9A 3I6UA 2P2IA 4XLVA 1YHSA 4NW6A 5AR7A 4LOOA 5GJFA 4N0SA 4ASEA 4UMQA 4ENXA 3OTVA 4ZJVA 3EMGA 4FNZA 3BQRA 5CSXA 2NYAA 3IW8A 3BHHA 4GG7A 4HPTE 4IQ6A 3A8WA 1KE7A 1K9AA 1SVGA 5DE2A 5EHLA 3CGOA 5AP5A 3TI1A 3N4VA 3THBA 3KQ7A 4ITHA 3C4XA 4QTCA 4C61A 5A46A 4BJJB 4PDOA 3QU0A 1XWSA 4YBKA 2XKCA 3OEZA 4Q2AA 3RCJA 4CXAA 4FTMA 2DWBA 4I20A 4FEQA 3BWJA 4E4XA 4IADA 5I9UA 3NUYA 4FE2A 3G0EA 4JI9A 4QPMA 1UWHA 2WMWA 2W4KA 2YDIA 2O63A 4EZ7A 5IQAA 1GIIA 1GAGA 4NM7A 5FEDA 2YZLA 3C0HA 4KD1A 4UX9A 2WAJA 3VRZA 3WF9A 3OBGA 3DKFA 2XARA 3I0QA 2YABA 3D2KA 1Z9XA 2BIYA 2GPHA 3A7JA 4JBPA 5IEXA 1PXLA 4YNEA 5FBOA 5JZNA 4M14A 1WCCA 3HRBA 4FVPA 5IUHA 3HUBA 4LL5A 3QGWA 4R3RA 3ELJA 4R7BA 5IQHA 5IA1A 3NVMB 1OKZA 5J1VA 3V51A 2OZOA 2UUEA 2YACA 3T8OA 4EH4A 4BCGA 2R3HA 3MJ2A 5CU6A 4F0IA 4XUFA 1OI9A 3UTOA 4A9TA 3QCSA 4AN3A 5HCZA 2R3QA 3OD6X 5HD7A 1IA8A 4RQKA 5CAQA 4HGTA 4D1XA 5EDRA 1BLXA 3JS2A 3BHTA 3ZH8A 3PFYA 3EN4A 2R5TA 4EQMA 2UZDA 2G15A 1CMKE 2CJMA 5KKRB 2XBAA 2PHKA 5LVNA 3QBNA 3OBJA 3F2RA 4F6WA 2XNNA 5M56A 4I6BA 3UGCA 3E8CA 5L8JA 3EB0A 3Q4ZA 4PRJA 4ANQA 5LQFA 3AD6A 3OWJA 4J7BA 2ITYA 3H0ZA 4O83A 1SZMA 3EFWA 3GQLA 4G2FA 3KRXA 2OI4X 4HYSA 3ZM4A 3U6IA 4XBRA 2BAQA 3W2OA 3FAAA 4AT5A 2WQBA 3TXOA 1NVSA 2BFXA 4E4NA 1XH7A 3ORNA 3TZ8A 3GU6A 2YN8A 4ZZOA 2J0LA 4PP7A 5L4QA 3UZRA 3VBXA 2BZHB 4JX3A 5ACBC 3ZDIA 3GI3A 5LVMA 5IEYA 4KS8A 5E4HA 3FY2A 3POZA 1MRVA 4O4DA 4Y83A 4UZDA 1KE8A 4LG4A 4CRSA 4AS0A 4C33A 5KMLA 4HPUE 1JVPP 3Q9YA 4QMMA 2YFXA 4UWYA 3RPVA 3HMNA 4J8MA 4YP8A 4V05A 1Y91A 4JDIA 4DH8A 4WUNA 4MUQA 3WYYA 4BCQA 4AW1A 5IDNA 2JKMA 2WTCA 3IOPA 4UV0A 5IQDA 1KE5A 3A2CA 5KNJA 3QWJA 4MXCA 4O0VA 2FH9A 4C34A 4PTCA 3VQUA 2GNLA 4RGJA 2PVFA 2QODA 3VC4A 4BF2A 4D2TA 4XLIA 5E8SA 3E3PA 5L6WL 3IW4A 5IA2A 4NYEA 1Q24A 2J9MA 2PY3A 2VZ6A 4EHZA 5CU4A 2RKUA 4PY1A 2HIWA 4K33A 4DTBA 3H0YA 4AACA 5AR2A 4O4EA 2IZUA 5FUTA 3KXZA 4RLLA 4AZEA 4AXCA 5K5XA 2ITWA 2VN9A 3F5PA 4DBNA 2PZRA 4MD7E 2XJ0A 4FTJA 5HX8A 3DJ6A 5E8YA 5EYCA 5KZIA 1YKRA 3DS6A 2HCKA 2ZJWA 4DEBA 4R77A 3FWQA 4FEVA 4IJ9A 4C2WA 4BDEA 5I3OA 3LLAA 1MP8A 2C5OA 4YHTA 5FM2A 3ZMMA 4ZY4A 5BYZA 4TRLA 5BVFA 5L8KA 3FHRA 1ZOGA 4KIOA 5C4KA 5CWZA 2YM4A 3B8QA 4IVDA 2JGZA 3IDBA 4JDKA 3RAIA 4F9CA 4KSPA 4PL3A 5KUPA 3HAMA 2ETKA 3QTIA 4RZVA 5FEQA 2WQOA 4CFUA 3P0MA 3OOGA 3DFAA 5J1WA 3UNKA 3M2WA 5JFWA 4CMOA 3W8QA 2G01A 3ZXZA 4Q5EA 1W8CA 5I9WA 3LCDA 4ANMA 5AP7A 3GBZA 3VS4A 3V6SA 3UBDA 5M51A 1YRPA 2G2HA 4F7NA 3OP5A 3OMVA 3FLWA 4QEBA 5AEPA 3AMBA 4P5QA 3OWKA 3W0SA 1IR3A 4FOCA 4LGHA 3QD4A 2WU6A 3ANQA 3PXFA 4CLIA 4PNIA 5FRIA 5K9IA 2YM8A 4DITA 2BALA 1YOMA 3A4OX 3E87A 4MNFA 4HVDA 3UNJA 2IVVA 4ZSLA 5HNIX 2CGWA 2QLUA 4CFVA 3GUBA 3PWDA 3I7BA 4JXFA 3T9TA 5JFXA 4KKHA 5IISA 5AUXA 1HCLA 5HE2A 3WZKA 1BKXA 1H08A 4DH3A 1G8SA 2IVSA 4CYJA 4CEGA 3D7ZA 1MUOA 4FTCA 4ERWA 4P90A 5HCYA 4QQCA 4F78A 4JT3A 4DG2E 3LPBA 4BIBA 3C5IA 4L52A 4U3ZA 2W5AA 3GEQA 2E2BA 5DR6A 3E88A 2C6TA 5ANEA 2VWBA 2EXCX 3MN3A 2R7BA 3AT2A 5K0XA 1ZOHA 3P9JA 1H1PA 2WGJA 4R1YA 3R1SA 2F7EE 1UU3A 3G0FA 1G5SA 4RIWA 5DR9A 4RIYB 2WKMA 5CVFA 3C4FA 4EZ3A 4BGHA 3LCSA 4EZ5A 2H9VA 2ZMCA 5B2KA 4OAUC 4O22A 3EFKA 2EVAA 3T9IA 4QYHA 5TT7A 5KBRA 4O7VA 5IQBA 4RC2A 2CN5A 4FT3A 4PWNA 4GL9A 1QPJA 5LMKA 4YR8A 1JKKA 2ITZA 4FKRA 4PPAA 1KWPA 4Y85A 3QRJA 4CZUA 4C62A 5AP6A 5JRSA 2HWOA 2J6MA 4JBQA 5DLSA 3L9NA 3BYVA 4O0XA 3V5TA 2O8YA 5J5SA 5AUWA 4F4PA 2Z7QA 4U8ZA 5CAPA 2QI8A 2OU7A 3FMHA 3G33A 2BDWA 2BRNA 4PUZA 4EH6A 3RPYA 3COIA 2XYNA 3A61A 4I0TA 4QMOA 4G3GA 2IVUA 2OFVA 5AV3A 5FTQA 4A06A 2OXDA 4E1ZA 4EOMA 2OJIA 5L6PA 5LARA 1B6CB 4NK9A 3U55A 4GIIA 4HZSA 3F3UA 3B8RA 3Q32A 5DEWA 2JFLA 2PMIA 3COMA 4X3FB 3K54A 3TUDA 3KIOC 4DEEA 1OPLA 5D10A 2X4FA 1YXTA 5M09A 3F3WA 1VYZA 2ONLA 3CQUA 3MB7A 4FG8A 3CBLA 2JDSA 3FXXA 4GJ3A 3BZ3A 1U59A 5FDXA 4RRVA 5CEMA 3EQCA 1Y6BA 5EI6A 3KCKA 4E8AA 4YUQA 3OCGA 4IDTA 3ANRA 5D41A 4EOSA 3W0QA 3TNWA 2W1IA 5HVKA 2CDZA 3LCTA 2YIYA 2OWBA 4ZSJA 2JKOA 1XJDA 4JVGA 5CSVA 4FKVA 1OKYA 3A60A 3MS9A 5CU2A 5DIAA 3TTIA 4BKJA 3QZHA 5AIRA 5AR8A 2XNOA 1YI6A 2RFEA 3PSDA 3CD3A 3TZ7A 4Y95A 4PDSA 4XH6A 4YHFA 2CKPA 3H9FA 5E1SA 3H4JA 4K1BA 1OVEA 5DG5A 4DHZA 1OUYA 2YLFA 1G3NA 1JPAA 2R3KA 1WBVA 2X2MA 4IX4A 3N9XA 1PKDA 4QP7A 1YWRA 2BKZA 4LV5A 3DK3A 3WZDA 5IKWA 3TKIA 4MCVA 4M12A 4Q5HA 2J0JA 2BILB 5EM6A 2YCSA 2VGPA 1PXIA 1JKLA 4X21A 4YHJA 3VHEA 5LMKC 4O27B 2RFDA 4BCNA 2UZVA 4EJ7A 3DZQA 2WMVA 4IH8A 4Y5QA 3MFUA 4I6QA 5B0XA 1REJA 2FA2A 2V7OA 4HVHA 5AV4A 5F94A 1FMOE 2P0CA 1Q41A 3BBTB 4BIDA 4MXXA 1XQZA 3TIYA 2ZAZA 2W05A 1APME 1H01A 3IONA 3KFAA 1I44A 1XBAA 4GS6A 4IAAA 5HO6A 3RHXA 4BZOA 1V0BA 2X2KA 4I94A 4O0TA 4ZTSA 1Q8UA 3I6WA 4G6LA 3SV0A 3G90X 3TNQB 3EFLA 4QQ5A 5BX0A 3C0GA 2OIQA 2HELA 2WMBA 3FJQE 4BI2A 1NVQA 2A98A 5D7AA 3R7YA 4NL0A 3T3UA 4K2RA 2B0QA 5CVHA 3UG2A 2ONLC 3QZIA 4CFXA 3TV7A 3UMWA 4EYMA 4EK4A 2NO3A 4UWBA 5M53A 3NDMA 3DXQA 3V5WA 3O51A 4YJSA 2GFCA 5DHJA 3C50A 4G3EA 2C5XA 4GEOA 4ZTLA 2EXEA 5CEPA 3G9LX 1Q62A 1K3AA 2JIIA 4FV2A 4FI1A 3NS9A 3FHIA 1U4DA 3RBWA 3R8VA 5LMBA 1BI8A 5DI1A 4C4IA 4MXAA 4O0YA 5ANIA 3ZFXA 3FI8A 2WO6A 3TM0A 4ENYA 1TQIA 5JFVA 2JDVA 3BI6A 4BDBA 2VD5A 3FZOA 3EWHA 4W4WA 2WTVA 4WNKA 5AR5A 1HCKA 3GCQA 2OO8X 5F4NA 4YLLA 3LOKA 5CSWA 2QU5A 5AAEA 4FIHA 3FC2A 4O86A 5KMNA 5A6NA 5E8ZA 2X9EA 4EC8A 1VZOA 4CVAA 4HZRA 3FSKA 1QPDA 3DBDA 5JMSA 3NYNA 4RJ6A 4C02A 1Q99A 1YOJA 1J91A 5CY3A 4EL9A 5HX6A 3SQQA 2I7QA 5J9LA 3D0EA 5J5TA 4D5HA 4XOYA 4L43A 4XX9A 2AQXA 5AX9A 4FKLA 4FTQA 4QOXA 1OL2A 2OJFE 3ET7A 4TY1A 3ALOA 4FTIA 4C4EA 4D58A 4CLJA 5JGBA 3TT0A 3GOKA 5HE1A 2PUIA 4LMNA 2E9VA 2UW0A 4E5BA 4G3FA 1KV1A 3PY1A 4IJPA 3F82A 5FDPA 4QTDA 3B2WA 3QQUA 3FI2A 3LXNA 4ID7A 3A4PA 4QT1A 5HQ0A 1WBSA 1JOWB 5GZ9A 5AUVA 2X81A 3BRBA 5ETIA 5JGAA 2PYWA 3HV5A 2JAVA 3OXTA 4U44A 3WILA 3WZJA 1KE6A 4NU1A 4RX9A 2RSVA 3FMJA 3PXYA 3DAJA 2EWAA 3TUBA 5J7BA 2PVLA 3O2MA 1ZZLA 2GMXA 3QLFA 1XH4A 1JLUE 3KC3A 3LFBA 1AQ1A 2XK4A 3MA3A 4FV3A 4I1ZA 4ACCA 4D2VA 3CTHA 4IB3A 2ZFYA 4JAIA 3AD5A 2W96B 4A4XA 5D1JA 4EKLA 3SRVA 5BUEA 3UQCA 5C27A 1WBWA 1G8KA 4PL4A 2C5NA 4QMXA 3TV4A 3EL8A 4QNAA 3SW7A 3ACKA 5FXRA 3VONA 1QCFA 2JDRA 4NWMA 4AOIA 4H05A 4UB7A 4XJ0A 5E8TA 4U43A 1DM2A 3ORIA 4IWQA 4YC3A 2IG7A 3W0OA 1G8AA 3SA0A 3QYWA 2P3GX 4FRFA 3CS9A 3ZSHA 4U80A 4YJNA 3UOKA 3NZ0A 3RJCA 3GCSA 5KMOA 1P4OA 2C6LA 3QUPA 4EKKA 4AOTA 4YJVA 1KSWA 1YI3A 3DDQA 5E7RA 3IDPA 4UMUA 2ETRA 2VTLA 1FINA 3UPZA 4FK3A 2P4IA 3OCTA 2FUMA 1CM8A 4Y46A 5HU9A 4FT9A 3O5AA 3C1XA 5DRDA 3PJ3A 2ERKA 2W5HA 4QD6A 5CXHA 3NUUA 4BDHA 3DAKA 3IW5A 5CVGA 3PIXA 3Q5IA 2XEZA 4UBAA 2CLXA 4FYNA 3QTWA 3L9MA 4AW5A 2PPQA 2VTPA 4F7JA 4RC4A 4FZFB 2IW9A 3ORZA 3HV4A 4ZAUA 4BTKA 5CXZA 1P4FA 4NJDA 3PYYA 4BICA 5IUGA 2FVDA 3UG1A 5FTGA 3MTLA 3PA3A 2YWVA 3GU8A 2C6IA 4GK4A 4M0ZA 4RA5A 4RFYA 4BTMA 4IAZA 4RZWA 4DEDA 5E92A 2XIXA 2GDOA 2VWVA 3FV8A 2XB7A 4X2FA 2QOBA 3TJDA 1Q61A 4IX6A 2YERA 3DPKA 3FLQA 5EHOA 2XALA 2BTSA 4FZAB 4WUAA 1CTPE 2BFYA 4JG6A 3SVVA 4ZJJA 3FYKX 3GC7A 3NEWA 5EW3A 3UVPA 2OJ9A 3VBWA 3WIKA 2XNEA 4PPBA 5HG5A 4E3CA 3PY0A 4TWOA 3EJ1A 2C6OA 1ZMUA 2G1TA 1W84A 1K2PA 4MBLA 4MHAA 4YZMA 5EDQA 5FEEA 3QRUA 2OG8A 5L2TA 3UDSA 2R3LA 3FZPA 3KK8A 3PPZA 4AZFA 4KAOA 3GU7A 4O6EA 1Y8YA 2E9NA 2XK6A 5C4LA 2PMNX 3FDNA 3OROA 4OR5A 4ALWA 3MFRA 4IEBA 3MIYA 3ZUVA 4NKAA 3DNDA 5BYYA 4DG0E 4DHFA 3I5NA 2GU8A 4NT4A 2PE1A 5HVJA 3CY2A 3LZBA 4S30A 4UZHA 4YLJA 4JBVA 4YGAA 3K5VA 4DCEA 5L2WA 3OZ6A 3VW6A 2QR8A 4CTCA 4NM5A 1J7IA 3U87A 4GVAA 4YTCA 4NZWB 2WEIA 4MD8E 3SC1A 4D9TA 1PY5A 2BZJA 3DTCA 3DBQA 3CR0A 4M8TA 4P7EA 4ACDA 4M13A 3HGKA 4P2KA 4FTKA 2PVMA 1S9IA 2AUHA 4D28A 3U9CA 3EN7A 4OTWA 3VHKA 3JPVA 4C3RA 4CQGA 4PMPA 4IDVA 4GRBA 4F7LA 2OF4A 3HECA 2WMUA 3BEGA 4S33A 4AZVA 4KNBA 1OIRA 2GQRA 4QP9A 5E9EA 5IMXA 4YTHA 5EM8A 2FSLX 2IN6A 3MIAA 4OBPA 4PMTA 2C3IB 3R21A 3W8LA 4C58A 4EBVA 5IQFA 4QMUA 2XRWA 4IWPA 5C8MA 4EH8A 5GNKA 2WTDA 5IEVA 5C03A 4EK5A 2ZOQA 4KB8A 2W4OA 4O0SA 4OGRA 5A54A 1W2FA 3PXQA 4J53A 3KXGA 2G2IA 3S4QA 4YJUA 2C69A 3DKCA 2WIHA 4ERKA 4YO4A 3UO5A 2JBPA 4DH1A 5L2IA 3Q5ZA 4QP2A 1X8BA 4BDJA 5IU2A 3CP9A 1FGKA 1ZY5A 4O4CA 2YM7A 3PJCA 3VUMA 2B52A 2UW4A 2PVNA 4L7SA 4HVGA 1G8JA 4GT5A 3VS6A 3VUDA 3PSCA 5J9ZA 5K4IA 1WBOA 3R6XA 4KBAA 5D11A 2R3PA 4V0GA 2BRHA 4EOKA 3TL8A 4C35A 2EU9A 3BGPA 3MDYA 3NUAA 1Q8WA 2UVYA 4QP4A 3AT4A 1URWA 3ORPA 4U45A 5KX8A 4DDIA 1OKVA 3PLAE 1Y57A 3D9VA 5CZIA 3L8XA 1P14A 4AW2A 2YEXA 4FTAA 5ACKA 3G6GA 3NUPA 4BGQA 4R3CA 2UW9A 1VYWA 5AWMA 2R3JA 4CSVA 4YJPA 4KIKA 3FZTA 1Q8TA 2C1AA 1ZARA 4BWKA 1Z5MA 5M4FA 4AZWA 2YITA 3R28A 3SHEA 4XCUA 2OK1A 3H30A 4DAWA 4AFJA 4LL0A 4ZZNA 4WRGA 3F5XA 4GV1A 1J1BA 2B1PA 3QD0A 2C5VA 1NY3A 2XIKA 3EQPA 3ZONA 2V22A 3ZOSA 3UOJA 4HCVA 3TKHA 4DFYA 4USEA 5LCKA 3O23A 3KCFA 3BCEA 1FVVA 4NH1A 5EW8A 4JRNA 4I6LA 5BVEA 5G6VA 1S9JA 4WBOA 4C59A 4WRSA 4AP7A 3AC4A 3RAWA 3HKOA 2XKFA 2R3IA 3PZHA 3UIXA 4ANLA 3ORTA 5L2SA 2Y4IB 2XP2A 3PA4A 4RA4A 5T6KA 3G6HA 5J8IA 4RJ3A 2WXVA 2B9JA 2R3NA 4G5JA 5LXMA 4CT2A 4AUAA 2O2UA 4JG7A 2QCSA 3D5XA 3ZUTA 2BR1A 3OF0A 4H3BA 4ANBA 2PE2A 3F66A 4EOPA 5AV0A 3HEGA 5G1XA 4TYGA 4FX3A 5HLPA 2PSQA 4BIEA 4FKTA 3D2IA 4IFGA 5DRBA 4GUEA 2W1DA 3R9RA 3I1AA 5A4CA 1FQ1B 4I0RA 1CKIA 1QPCA 4XMOA 4H1MA 3RK5A 3WBLA 4JQEA 5ANKA 4BHNA 5HTBA 1OMWA 5ANGA 3CPBA 3FC1X 5EQPA 2C0IA 3WOWA 4KKEA 3RNYA 2WQNA 3E7OA 4S32A 5IMEA 1STCE 4NM0A 2W06A 3T3VA 2Y4PA 2ZV7A 4XG6A 4W4VA 1HOWA 2W7XA 4ZLOA 3P23A 4NW5A 3VJNA 4BYIA 4F6SA 5HCXA 4D4SA 3W55A 2YM3A 1ZMWA 5L6OA 1TKIA 2PZPA 1YDRE 3DTWA 1MQBA 3EIDA 4K0YA 3NSZA 3UOLA 3Q4CA 1DI8A 1UWJA 3LJ1A 3P4KA 5AADA 4EWQA 1KOBA 3SGCA 2X0GA 5HBJA 2XKDA 5I9VA 2ITNA 1M14A 2QVSE 4O82A 3ULIA 4LRMA 4IVCA 5DYJA 2QHMA 3FY0A 3O8PA 4QMLA 5CQUA 4EUTA 2XJ2A 3DK7A 4CRLA 5KMIA 3LFCA 2X8DA 4DFBA 1FPUA 4KIQA 2GNJA 3RVGA 1CSNA 3ZO1A 3GCVA 4O7ZA 2IZTA 4O84A 3UQFA 2WHBA 5EW9A 4D2PA 1WBNA 2PUPA 3RP9A 2XM9A 4AA0A 3PY3A 2XNMA 5JSMA 3ZO2A 3W2QA 4DDGA 5A6OA 2VO3A 1Q97A 3NYOA 3R0TA 4FKSA 3UNZA 4RIOA 1A48A 2WQMA 2BRGA 4J95A 3UQGA 4ITJA 5CNOA 5T3QA 5AX3A 3DK6A 1H1RA 2HXLA 4O4FA 4DFNA 4Y8DA 2WMSA 4IC8A 1AGWA 1PXMA 4NKSA 4NFNA 2VUWA 3W33A 1H25A 3FYJX 2C3LA 4JDJA 2W9FB 4F1MA 3Q6WA 1PMEA 4JJRA 4MVFA 3QCQA 1VLRA 1J3HA 2C3JA 3R22A 3KXMA 4KKGA 2C1BA 2GHLA 3LQ5A 4W4YA 3AC2A 3PRIA 5AV2A 2QOLA 4I4FA 3FLNC 1WVXA 2Z2WA 2JKQA 2YWPA 1U5RA 4XP2A 5BYLA 4L53A 2C0TA 4TWPA 4QP1A 3BLRA 4PDPA 1BYGA 4RMZA 3DJ5A 4FTTA 4Y5HA 2X0PA 3DKOA 2XNBA 3Q9WA 2XK3A 3UYTA 2A1AB 3KMMA 1FMKA 4DH7A 4ALVA 3ROCA 3TJCA 5F9EA 3JVSA 2UW3A 2R0IA 4WKQA 2EUFB 3FL5A 5DGZA 3SX9A 4F1TA 3PXZA 4IX5A 3ZC6A 4F6UA 2VNWA 4R7IA 2QG7A 3W0MA 1DS5A 4QDVA 1H1SA 4U9AA 4A4OA 2BUJA 4AFEA 3CKXA 1RDQE 4IZYA 1GY3A 5CYIA 4IZ5A 4DGMA 1RJBA 2GTMA 5M08A 4NJ3A 3ZEWA 3IQ7A 5HOAA 4F7SA 5IUIA 5CALA 3S3IA 4QMPA 3RPRA 3LFFA 5C01A 2VGOA 3QQGA 4Z16A 4RIXB 4NIFA 4M69A 4K6ZA 2BVAA 3BE9A 4BI0A 1BUHA 2Y8OA 3AGLA 3FLYA 4G9RA 2O65A 2OXXA 4G1WA 4XG4A 3P5JC 3EQBA 1XH9A 4FTLA 3OWPA 4O6LA 1YOLA 3VS2A 4E6QA 4O0WA 3U54A 4BZNA 3BLAA 4J99A 2RF9A 4H36A 3ZFYA 3NVKI 1Q3DA 2XK7A 2IW6A 3OT3A 1TVOA 4FUYA 3MPMA 4AAAA 3D7TB 1ZY4A 4KRCA 4V01A 3V8WA 4BBMA 3ZLWA 5FTOA 3R1YA 3F3VA 4O7RA 4AAYA 3FLSA 3UODA 1AD5A 5BVNA 2BIKB 2H8HA 4X3JA 5CAOA 4CKJA 3RWPA 3SG9A 2FSMX 3NAXA 4QTAA 4XHKB 5EOBA 3BHUA 4KS7A 4AA5A 4D5KA 3JY0A 1DAYA 1O6LA 2ZVAA 3MH3A 2DUVA 4EK3A 4X2KA 3QQFA 2PZ5A 3GCUA 5M07A 3FMDA 2UZEA 1J7UA 2OZAA 4IAIA 3GB2A 3VQHA 3SDJA 4TTHB 1ZYSA 4L3PA 3V04A 1H1QA 4IAYA 3TTJA 2GNIA 2PMLX 3AQVA 2YJRA 3GU4A 4B99A 3GC8A 3MVMA 3BHYA 5K5NA 4AT3A 3VS5A 4AZTA 1GNGA 1PXNA 1T45A 4EK6A 3EQFA 3H10A 3KL8A 1ERKA 3QFVA 3SXRA 1UKIA 5AJQA 4IW0A 5HBHA 3R8ZA 4CG8A 5A9UA 3BYUA 4AXFA 4FMQA 5EKNA 2WMXA 3FI4A 5ANJA 3CEKA 4BBEA 2XIZA 2C6MA 4FNXA 4XNEA 4E26A 2R0UA 3DBFA 3DXPA 5DA3A 3P7BA 5EH0A 5FGKA 4MNEB 3MBLA 1ZZ2A 3DFCB 4JLCA 1A06A 2BAKA 2FGIA 2PUUA 5EK7A 2BCJA 4OTDA 5HG8A 4DA5A 3P1AA 1WZYA 2WQEA 4I93A 4U3YA 2X6EA 4DGNA 5DN3A 2VTHA 3EN6A 3W16A 2Y6OA 1FVTA 4PTEA 2FSTX 1OBGA 2QO9A 5DBXA 1U54B 3E64A 3OG7A 1OL5A 4GT3A 4XEYA 5K3YA 4BKZA 1GZ8A 3BLQA 1ZRZA 3AD4A 3CQWA 4WO5A 4EH9A 1H0WA 1ZWSA 3D4QA 3KREA 4MQ1A 1L8TA 4JR3A 4FTRA 4ZSAA 5D12A 4IWOA 1CDKA 3VF8A 2W1CA 2XF0A 1OPKA 4MXZA 2EB2A 5IA4A 3K3IA 2FO0A 3PA5A 4U81A 4D0XA 2XK9A 4I6FA 4LFIA 5CT7A 4EH5A 1PHKA 5KHXA 4DT9A 4X6RA 1OL7A 2OW3A 3OOMA 4O4BB 4R7HA 2G9XA 1RQQA 2XUUA 3EH9A 3ZC5A 3HMOA 3D5UA 4H39A 2VO0A 3R71A 4OW8A 2HW6A 5EDPA 2ZDUA 4RWIA 4CTBA 4DBXA 3TIZA 5H9BA 1OGYA 4N57A 4RX8A 4ZLZA 3OCSA 4FGBA 5CEIA 1F0QA 2AYPA 4FIJA 4FKQA 2BRBA 2HXQA 3A99A 3NYVA 3FKNA 4LV7A 3OUKA 3TEIA 3IPHA 1M2RA 1IAHA 3A7GA 4FNWA 3P7AA 4IAFA 4BWPA 1OUKA 4EBWA 3R9HA 4ZTMA 4XRJA 4QDEA 1H0VA 1YXSA 1IG1A 3FQHA 4F09A 4C36A 4FC0A 4DLIA 2XNPA 4G3DA 4CKIA 2YZAA 3KKVA 4F9WA 3IOKA 2CSNA 4EYJA 3WF5A 3OXIA 1H24A 4JDHA 3R9NA 4AN9A 4ANNA 4AW0A 5M44A 2HZ0A 4UYAA 3MSSA 4E20A 3RINA 4N6ZA 3IGOA 4EONA 4I24A 4C4JA 3VS7A 2W99B 2QHNA 5CAVA 2IO6A 5GZ8A 3R9DA 2JITA 5EOLA 4CQEA 3R1QA 4C8BA 2G2FA 3KU2A 2R3FA 5CU3A 3PP1A 3VVHA 2XAMA 2UZBA 3MPAA 3NPCA 1JBPE 2WTKC 4GG5A 3OY1A 4QTEA 2Q0BA 4HW7A 1KUTA 1LUFA 3O7LD 5KCVA 3BYSA 4YTFA 3VUIA 5FP6A 4FSNA 5IH4A 2QOKA 2JEDA 1W2CA 5I9YA 5H3QA 4I21A 4WT6A 4EOJA 3U6JA 5BNJA 1Q4LA 2W1HA 4YZDA 5CI6A 2GS7A 5HORA 4WNPA 4A9RA 4E6DA 4JMQA 1FOTA