3AMBA

Protein kinase a sixfold mutant model of aurora b with inhibitor vx-680
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
340
Chain Sequence
b'AAAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIRTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRIQQAVNFPFLVKLEFSFKDNSNLYMVLEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Mutants of protein kinase A that mimic the ATP-binding site of Aurora kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ambA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ambA02
3NLBA 1R0PA 3MPTA 4L42A 2FYSA 3EYGA 3HRCA 3QKMA 4C3FA 5AV3A 5CSHA 5JRSA 3DPKA 4TW9A 3VUKA 4N57A 4D2VA 2HZ4A 3BZ3A 3MH2A 5KMOA 5LOHA 3TUBA 3KK9A 3PXQA 4FYNA 4WT6A 4ZY5A 3LQ3A 1UKHA 4GW8A 4MHAA 3VS1A 2XUUA 2XMYA 3FKLA 2HK5A 3DJ7A 3KULB 3Q4ZA 4IB0A 4BVUA 2ACXA 3Q9YA 2HIWA 4QMLA 4WIHA 5CALA 3SGCA 4EOMA 5AR5A 3BU3A 3NUAA 3R1NA 3DCVA 2H6DA 1E9HA 2ZB0A 4IVBA 3R7EA 1R78A 5IUHA 4EHVA 4QYGA 5HOAA 5HTIA 3FQSA 4GJ2A 3PA3A 3KVWA 2IJMA 1M17A 3JPVA 5E8WA 2OIBA 4BIEA 5D41A 3BYVA 4DF3A 4J71A 1PMNA 2IZRA 2PY3A 4FX3A 4QP3A 3ZUVA 1ZYDA 2OJ9A 4FNWA 4AGUA 4RFYA 3NW5A 3RK5A 3TL8A 1OZ1A 3PRFA 4XV2A 4JNWA 5IQAA 1UWJA 4I4FA 4UWBA 4O6LA 4BYIA 1ZMVA 4XYFA 5BVWA 3A60A 3U6IA 4WNKA 2X8IA 2QVSE 2V22A 4P4CA 1BI7A 2R3MA 2XM9A 4XG2A 4PTEA 3N4UA 4BCNA 5LCKA 4BR3A 5CEKA 4RA4A 3I6UA 3LFCA 3CC6A 5HESA 5CF6A 3LM5A 4HOKA 3RP9A 4H05A 2BPMA 4FZAB 4L45A 4YGAA 4F9WA 3DK3A 4M15A 4AGDA 3LMIA 3FI4A 3NEWA 5F9EA 4BB4A 1R1WA 3EKNA 4FV9A 4YJUA 5DLSA 3R9NA 4AWIA 2B0QA 2VWZA 4DEHA 4MXCA 5CY3A 4OTIA 2UW0A 2XBJA 1ZLTA 3L9PA 3ZUTA 4NW6A 1ATPE 3JR1A 1O6LA 4K33A 1LEZA 3QX2A 5M4IA 5DT4A 4EOKA 4K18A 3MWUA 5E9EA 3R7VA 3I7BA 3MIAA 4M69A 1GIIA 3WZDA 4C57A 4RJ7A 3VJNA 2QO9A 4CD0A 2XEZA 5AR2A 2WMSA 3FMNA 3EQFA 1YXTA 5K5XA 4CFMA 4O7RA 2AUHA 4U6RA 4RG0A 3PXRA 4YJOA 1Y57A 3BE9A 5M53A 4TKSA 3EIDA 5FG8A 4C4HA 5CAUA 3LXPA 1JSUA 3H3CA 2VRXA 4B7TA 4PNKA 4ZTRA 4X6QC 4PTCA 3TN8A 3QCSA 2XYUA 2PUPA 4Q5HA 1OIRA 1XH5A 5LWNA 2C3KA 1X8BA 2I0EA 5C03A 3DKOA 4CMOA 4D2TA 4FSMA 4JIKA 2F7XE 5AP6A 1PXOA 2ZDUA 1QPDA 5EI2A 3DAKA 5I9VA 4ITJA 3KRRA 4KS7A 4QP6A 3T3VA 4Z7HA 4PDPA 3V5QA 5EDQA 1J1CA 5B2MA 4AT5A 2IZSA 4I23A 3RM7A 3MFRA 4PL5A 3KRLA 3UVPA 4CKJA 4H58A 5LJJA 3D5UA 4ZIMA 4FKGA 4EQCA 4IACA 3TV4A 4UX9A 2ETRA 4JDJA 3KRJA 2RFEA 2E9PA 3NDMA 2NRUA 4PV0A 2HWOA 5KCVA 1WBNA 2OICA 3COIA 4DEDA 3VS5A 1BUHA 2XNMA 3IS5A 2BZHB 3DS6A 4L8MA 4NUSA 4PL3A 2JFLA 4B6LA 3HP2A 4YJVA 5IA1A 3FSFA 3UMWA 4QP1A 4TYEA 5A4EA 5I4NA 3LQ8A 3RNYA 3F3TA 5KMIA 5CEOA 1ZYLA 2OIDA 3RINA 4B9DA 4D1SA 4JLCA 5AR7A 3UTOA 4FKSA 4E5WA 4IAZA 3PXKA 5G6VA 2RF9A 3DY7A 5EG3A 2O3PA 4LUDA 2QNJA 4RLKA 4IFCA 3C7QA 4C4FA 2YAKA 2YZAA 1Q24A 3ZLXA 4UZDA 3V6RA 3FMEA 4YZDA 3BHHA 5CXZA 1OL7A 4JDIA 3F7WA 5A6OA 1R0EA 4ZS0A 1PKDA 1NXKA 3MH3A 3EN5A 2OF4A 4X3FA 5H8GA 4EQUA 3F5PA 4Z7GA 4YZ9A 3QXPA 3OCTA 4R8QA 3ORTA 4AE9A 1WVYA 3CE3A 3EZVA 2JEDA 3LM0A 3DFAA 4NCTA 1I44A 2ITZA 5KZIA 1GIHA 1DM2A 2VTJA 1WBSA 2V0DA 4KIQA 2I1MA 3FC1X 4RZWA 4XCUA 3VBXA 3SOCA 2VNYA 5E8XA 3AT3A 3LFEA 2OZOA 4DEAA 4E73A 3GOKA 5HZNA 3A7JA 4HCVA 1RW8A 3E64A 5CZHA 3FXXA 2G15A 5CU2A 4AGCA 3E7OA 4CFWA 2BRBA 4F63A 3EFKA 4UBAA 1SM2A 2XRWA 2WZJA 2YIXA 3ZCLA 4KRDA 4J8MA 3BU5A 3AG9A 4ZP5A 3ZLYA 3LFFA 4L9IA 5HG5A 4AP7A 4XJ0A 2XZSA 4S31A 3RPRA 5KMMA 4M69B 2UZTA 2UW6A 1KWPA 3ZMMA 3ROCA 3L9NA 2OXYA 4CEGA 3DLSA 4W8DA 4C36A 2GNLA 4RWKA 5HG9A 3MS9A 3I5NA 1GZOA 2OFUA 3L8VA 2PUUA 2OSCA 2OJIA 3DBCA 4U3YA 1V0OA 5E8TA 1H26A 5J9ZA 1REKA 2C1BA 2W5BA 1GZKA 2BHEA 3G6HA 1YXUA 5FM3A 3H0ZA 3PYYA 3NVMB 3U55A 2HW7A 4QP2A 3NYOA 4TPTA 3DK7A 5FUTA 2BZJA 1OKWA 3QLFA 3COMA 3BLRA 3TZ7A 4CG9A 4YNEA 3ORPA 5JZJA 2DQ7X 4G3FA 4NZWB 4FTTA 3P0MA 2VV9A 1T46A 3PVWA 4MCVA 4GYGA 4IX4A 4LFIA 4AZTA 5AMNA 2ETMA 4ACMA 4YLLA 4YPDA 4EYMA 5GZAA 4H3BA 3TG1A 2OLCA 4I4EA 5CVFA 3QQJA 2H96A 4Q2AA 3SKCA 5IQGA 3OTUA 1FMOE 3TTJA 4B0GA 4C35A 1ZOGA 3FDNA 1H1RA 4WNPA 2BDFA 4RFZA 4PPAA 3TV7A 1PRYA 2VTNA 2A0CX 2UZNA 2HZ0A 3NNXA 4MKCA 4NT4A 5C4LA 3EB0A 4M13A 1PXIA 3I4BA 2VX3A 3LCTA 1BMKA 2I40A 4G6NA 3G9NA 2B55A 4NM3A 4CTBA 4TN6A 1M2QA 2WTDA 3FWQA 4MXOA 2PE2A 4RVMA 5ETAA 4ZZMA 4MEDA 4XHKB 3FKNA 4Z55A 4OGRA 5IQCA 5BVNA 4IW0A 3FZSA 4D5HA 4LV5A 5CENA 4FKWA 2UZUE 4AZWA 3UPZA 4EJ7A 3NNWA 5DYJA 2P0CA 4E5BA 2ITPA 4O0TA 3WF5A 2X9FA 2GHLA 3S3IA 4EH5A 3LMGA 1ZMUA 3QWJA 5JGDA 4GKHA 3D7ZA 4R7HA 3WZJA 1YXVA 5KX8A 5JFSA 4QQCA 4RJ5A 5J5SA 1YI4A 1FQ1B 4DTAA 3BI6A 5DIAA 4DEGA 3KK8A 5J8IA 4DCEA 2EB2A 5FXQA 4YJPA 3UIBA 3W2RA 2J0KA 2OFVA 4FKVA 2XF0A 4MXZA 3ZYAA 1B38A 2WAJA 2X1NA 3BYOA 4K8AA 4X3FB 1IA9A 3QF9A 2PE0A 1YQJA 5IZFA 2WIPA 3HV4A 3I81A 2RFNA 1MQ4A 3O7LD 3HP5A 4WUNA 3MA3A 4ZTHA 4EEVA 4L01A 3MFSA 4NEUA 3V3VA 4E5AX 4U5JA 4GK2A 3W33A 2XCHA 4QYYA 4KKEA 5FWKK 4BZDA 3R21A 5FBNC 4MD9E 4QMTA 1O6KA 2JIUA 5DN3A 1W7HA 2B4SB 3TI1A 4DFNA 4F7LA 3B8QA 3DT1A 3FUPA 2X6EA 4FSNA 3QTWA 4FVPA 4RZVA 5DE2A 3R7UA 4APCA 5JN2A 5DPVA 3TNWA 3HECA 4JBOA 5HE2A 1OL1A 2E9UA 3T9TA 5M57A 2R3GA 2WKMA 4DYMA 4UB7A 4O7ZA 3HVCA 4J99A 2XM8A 2Z2WA 5EK7A 5J95A 1OUYA 1XH7A 5FLFA 5HKMA 1APME 3WZKA 3CD3A 1J7UA 3QRTA 5C8MA 4TL0A 3Q5IA 5IQIA 3G9LX 4D1ZA 3C0GA 3JXWA 5M06A 2XNGA 3PLSA 3W8LA 1IRKA 1IA8A 1KE9A 4OUCA 4UN0C 3PJ2A 3C4WA 3CTHA 3CQWA 4WD5A 4Z9LA 3FMDA 2UVXA 3HV5A 4EORA 4BKZA 2GDOA 2CGWA 4RFMA 4QTAA 3WARA 4O2PA 4HCUA 4ALVA 2IG7A 2XJ2A 2VO7A 4AFJA 1VYZA 1YOLA 2BFXA 4KINA 3TKHA 5EKOA 5AFVA 4IWQA 2X7OA 5FP5A 5LVNA 5HX6A 4UALA 3II5A 3JY0A 3OCBA 4IC8A 4JOAA 5FBOA 3LFSA 2LAVA 4U81A 3FMMA 1PJKA 5K0KA 4LYNA 2QOIA 4RC2A 4XP0A 4DTKA 5CU4A 4ZAUA 2C68A 3BLHA 5DG5A 4ERKA 2WTKC 3R7IA 1Q3DA 4QQ5A 2WOUA 3W10A 4RX5A 2X4FA 4O0RA 1ZARA 5LVOA 3RWPA 4FODA 3GP0A 2V7OA 3PVGA 3AMAA 4MD7E 3RAIA 2WQBA 4M84A 4RWJA 4XG6A 1H4LA 3JVRA 3BQRA 4DLIA 4GS6A 4BF2A 2E2BA 3ZSGA 5KO1A 3IDPA 5HG8A 4FTRA 4X3JA 4K0YA 4R78A 1XQZA 4FTAA 4OTQA 1KV2A 5HU9A 3CCNA 4MF1A 5EQPA 5CSXA 5C4KA 3R2YA 5JK3A 4FTQA 1LP4A 3HL7A 5AAFA 4DBNA 5K5NA 2PHKA 1LR4A 4HZSA 2CNUA 4XG3A 2GFCA 3CQUA 2UVYA 4RC3A 5HVYA 4O7SA 2C3JA 2JIVA 3FPMA 4J1RA 2F57A 4JT3A 3NX8A 4UYAA 3E88A 4I6QA 3WOWA 3BRBA 3UQCA 4I6FA 4J7BA 3IPHA 3R8UA 3FXWA 1OM1A 4NM7A 3IOKA 4GT5A 3D83A 3O7LB 3HMIA 4KWPA 4BTMA 3GCPA 4XEYA 4IB1A 3LZBA 4FIHA 2BIYA 3PWYA 4XRJA 4BTJA 2ZJWA 4KKGA 4LG4A 2WHBA 4GG7A 5AP3A 3A7IA 4QTEA 5E4HA 4F7JA 4EH8A 1FPUA 3FYKX 4ZTSA 3WIGA 3QD3A 1JVPP 3PUPA 4GK4A 4PPBA 5EFQA 2ITYA 5ACBC 2C3IB 2XNOA 3GB2A 4FZ7A 1GZ8A 3CEKA 5LARA 5IUGA 4XG9A 1UNLA 4FTNA 2PSQA 5J1VA 3EZRA 4BICA 3UZPA 1KSWA 4N6ZA 5CASA 2ITTA 2OJFE 4AG8A 4KD1A 3ACJA 2XJ1A 4IWDA 4HZRA 4DGNA 4YTHA 5HHWA 5HLPA 3EL7A 1K2PA 3Q4CA 4AT3A 2C6IA 5HNGA 4E3CA 2WQMA 4F6UA 3P7BA 3E92A 3FMKA 3IW8A 3MN3A 3UG2A 3MTFA 2GHMA 4FEQA 4YR8A 2R3KA 3SA0A 3ZSIA 2R2PA 2WB8A 2VZ6A 3HLLA 5F1ZA 5AX3A 1Q8ZA 5HE3A 3CQEA 3D2KA 3Q2MA 3ZXTA 5G1XA 4ANLA 2O2UA 3C0IA 3HMOA 4C61A 3BU6A 3OMVA 4LRJA 2O65A 4EH7A 2CCIA 4V01A 2UZDA 4FTMA 4CKRA 2UV2A 4C37A 3LFBA 2R4BA 3QRIA 3NYVA 1PXKA 3G90X 4GVJA 4K77A 3DGKA 3K5UA 4F1OA 2HZNA 3NSZA 3UP7A 4NL0A 2V55A 3CY2A 1YWRA 4EC9A 5IA4A 4G2FA 3GQLA 5HG7A 2JBPA 1Q97A 4Y8DA 3FLSA 4C02A 1H1PA 4LGHA 2YCFA 4FV0A 3EN6A 4O7TA 5DWRA 3HRBA 3QBNA 2Z7SA 5ANIA 2ONLA 3ZZWA 3PSBA 3E7VA 4IIRA 3OC1A 5CS6A 2C6LA 2EXCX 3CP9A 4FKPA 3MTLA 5T3QA 2V62A 3W2SA 5D7AA 3CJGA 1ZXEA 3PP0A 4BDGA 4EWHA 1G3NA 2UZBA 5EOBA 3ID6C 4OR5A 1WZYA 2BIKB 4YHTA 3SVVA 3GEQA 3A8XA 5GJGA 5K4IA 3W2QA 3QGWA 3WF7A 3GUBA 5FEQA 1Q61A 4O0SA 3HV3A 3DLZA 4QYHA 5CEQA 3G15A 4C2WA 5HE0A 4XLIA 1HCKA 5TOZA 2WMXA 4FT3A 3R6XA 1REJA 4IB5A 1Y91A 2PZ5A 2W1GA 4Y46A 2R9SA 2GS7A 5A4TA 5K0XA 2WELA 1XO2B 2C5XA 3BHUA 5KBQA 2O0UA 3ORXA 4GU6A 4FR4A 2JIIA 5HIDA 3OXZA 3OOMA 3GU8A 2PE1A 3B2TA 3JUHA 2Y6OA 3PPZA 1CSNA 3KEXA 3QQFA 5E92A 3SAYA 2F7EE 3RAKA 3VUDA 3ZS5A 4DE4A 2QOQA 3GGFA 2ZDTA 2WTVA 3TEIA 2YM7A 4AU8A 1CKIA 3B2WA 5E1SA 4E6QA 1CMKE 3ZDIA 4Y5QA 4X2JA 1WFCA 4K11A 3ZXZA 2EB3A 3A7FA 1M14A 5J5TA 4FEUA 1U54A 1DS5A 3ENHA 3R63A 5M08A 2R5TA 3HMMA 3V04A 2I0YA 4ZLZA 4IVDA 3S0OA 2UZEA 2FA2A 5IUIA 3MVJA 4CKIA 2UZOA 3CLYA 5LVMA 2PPQA 3U54A 2QOBA 4QMNA 5H8EA 3R71A 4YMJA 3VW6A 1WBWA 5DRBA 1OL5A 3ZO1A 3UIUA 5E7RA 2XP2A 3TUCA 4EHZA 2OW3A 2Y4IB 4GT4A 1YXSA 2C0OA 5CWZA 2VD5A 5AV2A 3REPA 4AN9A 2ZOQA 5JMSA 4X2KA 5L6WL 3VBWA 3AQVA 2P4IA 3JS2A 4ZSGA 4A9SA 2CNVA 3OS3A 2VN9A 2J0MB 4MF0A 5CT0A 3NVKI 2HZIA 4LRKA 3TNQB 3RALA 3MYGA 2WMTA 1W0XC 4I6BA 4HNIA 5LVLA 3QTQA 4QMPA 4PUZA 4FIFA 3QGYA 3KC3A 3O8TA 4ZZOA 4HGSA 3E87A 2WEVA 4CV9A 4FGBA 3I7CA 1QPCA 2W4KA 2PVRA 1WVWA 4W8EA 3P5KA 3FQHA 5HLWA 1BLXA 2QOCA 3VS0A 4E7WA 2YN8A 5ICPA 4ZOGA 4ANSA 3O17A 4RJ4A 3B8RA 4ACCA 3MH1A 2QQ7A 3R73A 2X81A 3MIYA 3UIXA 4JQ8A 4O7NA 2GNIA 5HLNA 4O83A 3H30A 4A9UA 4YUQA 2QURA 3QHWA 4M3QA 2WMVA 4P7EA 3TZ9A 4EK5A 3WYYA 2W05A 4G17A 2W4OA 1H01A 3ACKA 3RAWA 1T45A 2P33A 2GQGA 2QOLA 3F5UA 4DGGA 4FIGA 4KRCA 3M42A 4QD6A 4TYGA 5CI7A 3KVXA 2VX0A 4HVHA 1JNKA 4KSPA 3UQFA 1PMEA 1JKSA 4MAOA 3VC4A 2VTTA 3ZBFA 4FK6A 5ANEA 3D9VA 4IXPA 3ODYX 3LKMA 4MBJA 4XLVA 2QO2A 4DITA 1QCFA 3KXZA 3HNGA 1TQMA 3NIZA 4L53A 4PMTA 4WG4A 3ZM4A 1YOJA 2VWBA 1F0QA 3WF8A 5CU6A 3KN6A 4FV8A 2UVZA 4R1YA 5FEDA 3RNIA 4M0YA 2Y6MA 3E8EA 1XH9A 2BAJA 1UU3A 3GC9A 2X2KA 3F7ZA 5AM6A 5AP1A 3Q96A 3RCDA 4AW2A 5J9YA 4JG7A 2J0LA 2EXEA 4V04A 3IDCA 3RJCA 3GC8A 5A4CA 2W06A 5DR6A 1G5SA 4M66A 4XOYA 2XB7A 2BRGA 5EM7A 1S9IA 3GC7A 5I9YA 2VAGA 2X6DA 4NM0A 3G5DA 3EYHA 3R02A 4D5KA 3Q32A 3QAME 2XIKA 5JRQA 3CS9A 2YIQA 4LM5A 1U54B 3QRJA 4GUBA 2WMAA 2QG5A 3AT4A 4FTIA 1OB3A 2X7FA 2P55A 1YI6A 3F82A 1OPLA 5DH3A 1ZAOA 2R3OA 3PE2A 4BZNA 1DI8A 5GIPE 2C47A 2VO6A 5AUUA 4EOSA 4FL2A 4BDCA 3HX4A 2JLDA 4EKLA 5EDRA 3U6JA 3KN5A 1YDSE 3QZGA 4AW1A 2GS2A 4CV8A 2Q0BA 4R3RA 1SZMA 3FPQA 4A9TA 4F0FA 3LXNA 1URWA 4CCBA 4RQKA 4IWOA 3PTGA 4LOOA 1ZZ2A 2O64A 3OUNB 4BFMA 5KKRB 5LXMA 4D2WA 1ERKA 3Q5ZA 1KOBA 5F95A 4ANBA 5HD4A 2ETKA 2EU9A 4EK6A 1PXJA 1KUTA 2WFYA 5EQYA 4G3CA 4DH1A 3KA0A 3RI1A 3OEZA 2CN8A 4CNHA 4UY9A 4R5YA 3UMXA 1Q8TA 4L68A 5HO6A 4Q9ZA 4FSZA 2QC6A 2NO3A 3OROA 4FYOA 4UEUA 3RPVA 3TXOA 3V5JA 4BCHA 4DTBA 2W1ZA 1Y8GA 5BQ0A 4CTCA 4DFZE 2X4ZA 3RPSA 4E4NA 2UW4A 2ZMCA 3OWLA 2W9ZB 2BTSA 3OZ6A 3MFUA 4PDOA 2YWPA 4BI0A 4Y83A 2BALA 4QRCA 3R0TA 3H9RA 3RK7A 5LVPA 3SLSA 4IZ5A 3F2RA 4DG2E 1YHVA 4I20A 4ZLOA 4KBKA 3CJFA 5EW3A 5T6KA 3F3WA 4L52A 1U5RA 4NK9A 3C0HA 3GI3A 3UNJA 2O8YA 2YIWA 4JQEA 1A48A 3BHVA 2R3QA 3PP1A 4LQMA 1KE8A 4KBAA 2PVJA 4JS8A 2VWXA 3VRYA 2YWVA 3HAMA 1YI3A 4G5PA 4H3PA 4FZDB 4GUEA 4AA0A 4CZYB 4DEIA 2OWBA 2XNBA 3GFWA 3R28A 2XBAA 4FTOA 4LL0A 3KF7A 4O22A 4L00A 4QTCA 4YJQA 3PXZA 5AR4A 4V0GB 2W4JA 3MY1A 5DOSA 4LGDA 1G8AA 4AOTA 5IMXA 5IF1A 4QYFA 3C4XA 4E20A 5C8NA 2XRUA 2XKDA 3MGYA 3Q9XA 5I9ZA 5LCJA 4AW0A 4U3ZA 3EQRA 2IPXA 2C3LA 3FI3A 2FSMX 3L9LA 4RRVA 4ZK5A 5D12A 2XK6A 4G16A 4OLIA 2XKCA 3DXNA 4BWPA 5CLPA 5AP2A 2YEXA 3VUTA 5CNNA 4NM5A 1P14A 2W9FB 4K6ZA 3QCYA 5FDXA 4ORKA 3BYMA 4FT0A 1ZYSA 3PLAE 3EQDA 1SMHA 3OUKA 5HBHA 2WQNA 5CEIA 3ZLSA 5EHOA 3MFTA 4M12A 4PP9A 3EFLA 3E8CA 2OF2A 3R00A 4NJ3A 1H1QA 3OY3A 3ZHPC 4JAIA 4CMUA 5JH6A 5AM7A 1H28A 5A14A 5F20A 2CKQA 2RKUA 4M97A 1PXNA 2XIYA 3RWQA 3R04A 4C4JA 2FSLX 2WMRA 3Q9WA 1M7QA 4RPVA 1AD5A 3BWFA 4NTSA 1PMVA 1WCCA 3RHXA 2QCSA 2I7QA 1OMWA 1ZY4A 2EUFB 3BEAA 4FEVA 4O6EA 2IZUA 4WBOA 2XH5A 3VQUA 4F64A 2JDSA 4AN2A 4BHNA 3V5WA 1PYEA 2FH9A 2C69A 5AJQA 2OH4A 2WXVA 4FTJA 2DYLA 3IGOA 4C3PA 3BLQA 3DA6A 5D9HA 2RGPA 2XVDA 3EQPA 2C1AA 2JKKA 4UMTA 4BGHA 5IG1A 3UP2A 1VYWA 4E4LA 3PZHA 4YZBA 1W82A 3PRIA 4ZY4A 5L8LA 4EOPA 3FL5A 3OTVA 5CSWA 3HA8A 4O81A 1S9JA 2YCRA 4PWNA 2BR1A 4YJTA 3V8TA 4UMRA 3N51A 2VWUA 2Z7LA 3NUUA 3EHAA 1E1XA 3PPJA 4CLJA 5IEXA 5AUZA 3V6SA 2E9OA 4RC4A 3R30A 2QU6A 3NPCA 1DAWA 3F61A 3C13A 3LMHA 3QTRA 3NYXA 2O5KA 4FT7A 2J0JA 3QUEA 5JQ8A 3ORMA 4IZ7A 1U4DA 5EKNA 4CYJA 3FI8A 2XYNA 4X2GA 1TQPA 3R7OA 4C58A 4D58A 4U42A 1OPKA 4FUYA 4ALUA 3UJGA 4I94A 2OG8A 4XBRA 3ZBXA 2XK7A 5EHLA 3KQ7A 2R3LA 1XWSA 3NYNA 4BIBA 3PE1A 3PG1A 4OBQA 2X9EA 1SNUA 4I0RA 4FMQA 3CKXA 1J91A 4FVRA 4G5JA 3MA6A 3Q4TA 4PX6A 3ZDUA 1OKYA 1PF8A 2JDOA 3EQGA 2ITXA 4D9UA 4UZHA 1VEBA 4F9CA 5CT7A 5ITAA 5FXSA 3FBVA 2QOOA 1JAMA 2IWIA 4EH3A 1OKZA 4M67A 5AUXA 5IDPA 1QPJA 3GENA 4BC6A 4IEBA 4ID7A 4D2SA 2WGJA 1VZOA 4G6OA 5BVEA 2J5EA 3RMFA 1MP8A 2R3HA 3RKBA 2JGZA 1AGWA 5M4CA 4G34A 3GNIB 4B4LA 3FZOA 5M44A 3FZ1A 2OI4X 4IM2A 3GFEA 3BKBA 4O96A 5B2LA 1B39A 4AZEA 4C3RA 5JQ5A 2YAAA 4FKUA 3SC1A 4BGGA 3H4JA 4BDJA 4BBEA 2JITA 4CFUA 5E91A 2Z7RA 3D0EA 3ORNA 4CXAA 4F7NA 4GT3A 3QALE 1KE5A 3R9OA 4CMTA 5TKDA 3OHTA 3QQUA 3E62A 4JBPA 1F5QA 2C5NA 4FG9A 5HVJA 3FV8A 3I0QA 2R3FA 4USDA 2BAKA 3DZOA 4QQTA 3RZBA 4NWMA 4E1ZA 2WTJA 2B9HA 4ZJJA 2UZVA 1U5QA 2AC3A 4ZZNA 2BKKA 5HQ0A 3EOCA 1AQ1A 2X0GA 3ORKA 2YLEA 4OAUC 4L67A 4NKSA 4GKIA 3C50A 3R8LA 5BPYA 4NFMA 5CVHA 1UU8A 2HXLA 4TTHB 4RX9A 3GU7A 3QZFA 2J2IB 5FM2A 4A4LA 3FY0A 4EOQA 5L2WA 5CU3A 2B9IA 1IAHA 2R3RA 2XA4A 3FE3A 4O7VA 3CBLA 5HNBA 2BRHA 1BL7A 2ZM1A 3ANRA 3VRZA 5I9WA 2CKPA 3D94A 5AV1A 4K9YA 2NPQA 4FV4A 1WBOA 3LW0A 4FOBA 3DKCA 1H0VA 3IGGA 4FNXA 2HOGA 2JAMA 4FGRA 5EDPA 2CNQA 3MJ1A 5T68A 2XCKA 3ZEWA 4O0XA 3V01A 4JL9A 4EHGA 4L7SA 3R9DA 3H10A 4WNMA 1U46A 2W1CA 1H24A 3ITZA 3Q60A 2GQRA 4MTAA 1EH4A 5CANA 3LCDA 2GS6A 2W1DA 3TCPA 3P7CA 5CF8A 1M7NA 1FVRA 3WF9A 4KABA 4I5PA 1JPAA 1Z57A 3IG7A 4E6CA 4F08A 3QQHA 4QMQA 3GOPA 2C5VA 4BDEA 2JKQA 1QPEA 1OI9A 4I22A 4P5ZA 3ORZA 1J3HA 1Q8UA 3ZRLA 3AXWA 1P2AA 4H1MA 4ZSLA 1LUFA 3EWHA 3PY1A 1GY3A 4J8NA 4BRXA 4QT1A 4RIYA 4ZJVA 1JBPE 4F99A 2ESMA 5HTCA 4K2RA 5H8BA 5KMJA 1XR1A 4FTKA 2Z02A 2BILB 5HTBA 1WAKA 1OITA 4C62A 3NCGA 5FD2A 3UYSA 4O7LA 4E4XA 4N4SA 1IEPA 2A27A 5C1QB 4H36A 4JR7A 4PNIA 5KMLA 2CLXA 5BMMA 4R7BA 2Z7QA 5CF4A 3G0FA 3LJ2A 5K9IA 5HVKA 3LQ5A 5AA8A 2IVTA 2QG7A 2CMWA 3DDPA 4NSTA 3OT8A 2EVAA 4XS2A 4RIOA 3VO3A 2W1FA 3KXGA 4QP7A 4BKJA 4PQNA 2J51A 3GCUA 3TNPC 4QP8A 4WG3A 3HV6A 4E26A 5EOLA 4PDSA 3EJ1A 4YPSA 4AE6A 2G01A 4GMYA 3P1AA 2HCKA 4WG5A 5CQWA 4DFBA 2PWLA 1H0WA 4JAJA 3WIKA 3ZONA 3EFWA 5GZ9A 4FIEA 5HCYA 1H8FA 4RSSA 3FQEA 4YP8A 2GNHA 3F3UA 2HYYA 2AC5A 3HV7A 2IW8A 2W5HA 1O6YA 4LV8A 2F9GA 1H00A 4MK0A 2RG5A 4S34A 3QQGA 3UIMA 2B53A 3OWJA 3PJ8A 5JZNA 3EQIA 3PA4A 3RM6A 4AW5A 2YFXA 2WD1A 4D2RA 3QXOA 3LJ1A 4IX5A 3UNZA 2X39A 5CAOA 4D4SA 4J53A 4YJNA 4XP3A 1PMUA 3RZFA 4FL1A 5L2SA 1E1VA 1OUKA 4U43A 3P08A 4XNEA 4I5CA 4BTKA 4RMZA 3AC1A 2R3NA 5H3QA 3BEGA 4XG8A 5EW8A 1RQQA 3PFQA 5M55A 3R8VA 1WMKA 5GINE 3JVSA 3CXWA 3FMJA 4GRBA 3T8OA 3ZSHA 4O1OA 4H39A 4R1VA 2GHGA 1LPUA 2VWYA 1KE7A 4U9AA 3MPAA 1A06A 3E8DA 4O2ZA 4NFNA 5AV4A 2WTKB 4I0TA 3K54A 3DFCB 1NW1A 1FGIA 1GOLA 3C4EA 3I0OA 4NKAA 2B9FA 2SRCA 4FV3A 1A9UA 3DXQA 5E8VA 4YBKA 3WE8A 2QD9A 4ZSEA 4PPCA 3A2CA 4E8AA 3NS9A 4BIDA 5AV0A 5K4JA 3QKKA 4S33A 3HUCA 4YBJA 4IBMA 2C5YA 3VN9A 4IHPA 2P2IA 2OXDA 5HI2A 5JEBA 2CJMA 3VNTA 2GNGA 3PJ3A 3ROYA 4A9RA 3OVVA 2CLQA 5BYZA 5LMKC 3BV2A 4AA4A 3UOLA 3VBVA 4Y85A 3WI6A 1XH4A 4NW5A 4RX7A 4F65A 2R7IA 2WIHA 4FT5A 5D7VA 4PMMA 2BVAA 3RVGA 2E9VA 4MXXA 3Q04A 3DU8A 2YITA 4RIYB 5J1WA 2W1HA 1SVEA 2WMWA 3BE2A 3UOKA 4F09A 4BY9E 5EH0A 3KMWA 4GH2A 4ANOA 1GNGA 2YA9A 4HGEA 4QMXA 2JKMA 1UNHA 2PTKA 2VWVA 4ITHA 4R3CA 5IEVA 2QLUA 5DR9A 1GJOA 3ORIA 2JD5A 3ZFYA 4M0ZA 3K3IA 5ACKA 1OGUA 5IA5A 4EL9A 3PIZA 4TY1A 4YLJA 2BAQA 3THBA 4KNBA 4ASXA 4AGWA 3LXLA 1NA7A 2ZB1A 3MDYA 3O71A 4QNAA 1H25A 4ACDA 2VX1A 4M8TA 1MQBA 2WTWA 1XJDA 3LAUA 5CZIA 1P5EA 2IVVA 3VVHA 3JY9A 1J1BA 4G9CA 4MH7A 3R2BA 4F0GA 4QPAA 4ZY6A 3UO5A 4NH1A 4QTDA 2FUMA 2QO7A 4BDAA 3FAAA 3QD0A 4JVGA 2RSVA 5AP4A 4GIIA 4QMSA 4EKKA 4Q9SA 4DH5A 4EH9A 3NUSA 4EOIA 3H0YA 1WBPA 3WBLA 3GBZA 1SVGA 4L43A 1JQHA 4BBMA 3DTCA 5KBRA 4IE9A 4MQ2A 2CDZA 4D0XA 4DFLA 1IG1A 4ITIA 4ZTNA 4USFA 3SV0A 3KKVA 3MY0A 4Z16A 2QR7A 2C6EA 1Y8YA 4FKTA 4JG6A 3AD4A 5AIRA 4OTWA 4ZS4A 4BDIA 4YC6A 1CKPA 2F7ZE 4TXCA 4HVGA 2YM3A 4MWHA 3UOHA 4IANA 4BL1A 3GCVA 2X2LA 3EN9A 1KOAA 5M07A 3ALOA 4RVKA 3A61A 3VF8A 3A7HA 3EQBA 4XRLA 4RJ3A 3ZTXA 3ZOSA 3QQKA 3O51A 2QKRA 3G2FA 3FLWA 4IQ6A 2J4ZA 2QOFA 5DFPA 4EZ3A 2PVKA 1GZNA 3DXPA 4UWYA 5M56A 2J6MA 1W98A 1UNGA 3A8WA 4PRJA 1YKRA 4CYIA 2YISA 3KREA 1Q4LA 4IC7A 3QFVA 3ZO4A 3HMPA 5J7BA 5JGAA 2ERKA 4TNBA 4X2FA 5DT0A 3O2MA 5LQFA 3UQGA 1F3MC 3NUXA 5GJFA 3PG3A 5HBEA 3VHEA 4AZFA 4O38A 2PZRA 5L2QA 4DHFA 4ASZA 3AT2A 5E8ZA 3PA5A 3NNVA 5HIEA 2PVLA 2HW6A 3SXSA 3P4KA 2BMCA 2IVSA 2ZAZA 2X2MA 3BGZA 3NWWA 2RFDA 2F49A 3ZRKA 4DBXA 4GCJA 1OL6A 2XIXA 5TR6A 5EM5A 4BDFA 5A4QA 3C5IA 2H34A 4NU1A 3F3ZA 2PVFA 1CKJA 4C34A 3AC5A 1JOWB 4EYJA 4IZYA 1NVSA 2R64A 2PL0A 1UU9A 3LXKA 4H1JA 4HPUE 4CT1A 4FV6A 4I5MA 4RJ8A 4EOJA 4Y5HA 4D4YA 3ZRMA 3NUPA 2PMNX 3HA6A 3DNEA 4Q5EA 2PMLX 3NNUA 2G9XA 3S4QA 1OBDA 1Q8YA 4I1ZA 4RQVA 2B9JA 4EBVA 4YC8A 3QTUA 4CRLA 5IQDA 1RE8A 2HY0A 4P2KA 3PJ1A 4TYHA 1Q62A 4F9YA 2GNFA 4ANMA 3AGLA 3LOKA 3PSDA 4JX3A 4DLJA 2WU6A 3BELA 4U8ZA 4LRMA 3HAVA 3R1SA 5D10A 2GPHA 2CSNA 2YABA 4BCKA 2IW9A 1NT2A 3KXNA 3PVUA 4LMUA 2ERZE 5C26A 1V1KA 3BGPA 4FKRA 4WRGA 1ND4A 2OJGA 3M11A 4A07A 3UO4A 4CGAA 3KL8A 4JRVA 4S32A 5LMAA 2DUVA 4F1TA 2VUWA 2ZVAA 2X7GA 4UMUA 5C01A 4I3ZA 2HAKA 3SXFA 3L8SA 1BL6A 5L4QA 1XKKA 2W17A 2BRMA 4IAFA 4RWIA 2E9NA 2WNTA 3LFNA 3OWPA 3U4UA 4IX6A 5EYMA 3CPCA 2CKOA 4RA5A 4XV9A 1OIYA 3CTJA 4O86A 1MRVA 2C6MA 4ANNA 3EQHA 2UW8A 3SXRA 4AF3A 2Z60A 2GFSA 2IN6A 4DH7A 4E4MA 5CAQA 4IAYA 3QHRA 3GQIA 3SW7A 4CQEA 2ITNA 4PDYA 3G0EA 3PVBA 3LJ0A 5IA0A 3R1YA 2C6KA 5E8SA 3UOJA 2OZAA 4IWPA 5I9UA 4R3PA 3SG9A 2QODA 2C6OA 3CD8A 3CIKA 3IW7A 3QYZA 4MNFA 5HIBA 1O9UA 2QHNA 4I21A 4UV0A 3TDWA 1I09A 3PIXA 4D9TA 3MV5A 4YTIA 3SW4A 2VTOA 2RG6A 3OCSA 3WZEA 4U40A 4O82A 5CI6A 4MXYA 3HEGA 4AS0A 2VTSA 5AR3A 4HVIA 3M1SA 4L7FA 4CFXA 2UW9A 4EOLA 1OKVA 2UW5A 2Y9QA 4HYIA 1MRYA 3RTPA 5M51A 4PMSA 3VUHA 2PVHA 4C33A 5J79A 4II5A 1BX6A 4AFEA 3ZFMA 4WSQA 4J97A 2G2IA 2WPAA 4PTGA 4TZRA 3RCJA 3VS4A 4XUFA 4D1XA 2WMUA 3O8PA 3QTXA 4RVTA 3Q6UA 4G3EA 4C8BA 3G6GA 3IKAA 3COKA 5BVFA 2VTAA 5GJDA 2W1IA 5A6NA 4DH8A 3UBDA 4L3JA 4ASEA 5CX9A 3ANQA 1ZZLA 4EZ5A 4L6QA 1J7LA 4EH6A 1FVVA 3VUGA 3FEGA 2WMBA 4DCAA 4IM3A 4U41A 3TTIA 3OCGA 3HDMA 3N4TA 4W4VA 2YM8A 4MWIA 3F6XA 4FG7A 2DS1A 2YCQA 3C4CA 3IK3A 4EK3A 4RBLA 5AADA 2PZYA 2W1EA 4WKQA 4X21A 2P3GX 2PZPA 2XK4A 3NGAA 5AUYA 5AAGA 3QTSA 4JX7A 1HOWA 3ZO3A 4X7QA 4J95A 5ANGA 2CGXA 2HWPA 3DB6A 4E6DA 3AC3A 3MI9A 4CFFA 2KULA 5AP7A 2RIOA 1LEWA 2W0JA 5I3OA 4CFNA 3SDJA 2YM4A 2YCSA 4ONAA 4W9WA 5AWMA 3H9FA 3UE4A 3VQHA 2PZIA 3R7GA 4DEBA 4FZFB 2PVNA 3GVUA 4O0YA 4FTUA 4OTHA 4TYHB 3RK9A 3ZZEA 4C38A 1H1WA 3EQCA 2UW7A 4YHJA 5DR2A 4AUAA 2PK9A 3F5XA 2VNWA 3ZH8A 3C9WA 3EN7A 2XNPA 3IW4A 5ANOA 4XG7A 5E8UA 2AYPA 2XKFA 3PPKA 5CAVA 4YU2A 4MNEA 3DKGA 2ITVA 2QU5A 4HYUA 5J9LA 1OIUA 1YDRE 3BWJA 3OF0A 4EUTA 3TNIA 5HBJA 4FF8A 3QUPA 3E93A 4HGLA 3POZA 1JKTA 4BYJA 2PUNA 4XH6A 4WHZA 1K3AA 2FGIA 2A19B 4WRSA 3HDNA 2CGVA 4LGGA 2XK9A 2WOTA 2JDVA 3OD6X 5DRDA 3SD0A 4IVAA 2BZIB 4CLIA 1G8SA 4O0VA 2Y0AA 4IVCA 4HYHA 3PIYA 3R01A 1M2PA 5I5ZA 2J0IA 4DG3E 3UZRA 3KMUA 2YACA 1H08A 2VO0A 1ZY5A 1JLUE 4BCQA 3WF6A 5IQFA 3LIJA 2OZAB 4DT8A 1FGKA 4BCGA 4QYEA 4BZOA 3T3UA 2QR8A 2CGUA 3R8PA 5EYKA 3A4OX 3QUDA 3MESA 3QZHA 5L8KA 4X2NA 4OW8A 4M7IA 4FEXA 1TKIA 3FLZA 4CG8A 3OFMA 2I6LA 4S30A 5JGBA 1DAYA 4F6SA 2O63A 4LOQA 4A7CA 2HY81 3QD4A 3TIZA 1SNXA 5FTGA 5LMBA 3DBFA 3G51A 3W18A 3W32A 3MH0A 4I6HA 5CQUA 5L6OA 4DAWA 4BCJA 1PY5A 4ZXTA 4O7YA 1PXPA 2ITUA 5L3AA 4IFGA 4FSWA 2YERA 4CVAA 4ZTLA 4D2PA 4BTFA 4QP9A 4HYSA 5DI1A 3UGCA 2GQSA 4FV7A 3R9RA 3KF4A 4HJOA 3R8ZA 3P9JA 3TNHA 5IEYA 3HKOA 5TF9A 5FGKA 3F69A 4IAAA 4QMWA 5DA3A 3FYJX 1MRUA 2C6DA 3A99A 3IOPA 1YRPA 4JBVA 4LL5A 5AP0A 5D1JA 5IISA 2XK8A 2WQEA 2XNEA 2QOHA 3QWKA 4W4WA 2UZWE 5CU0A 3C4ZA 4RWLA 4FKIA 4IAKA 4IX3A 3V5LA 4N0SA 1J7IA 1RJBA 3CGOA 4OBPA 2JDTA 4YSJA 3U9CA 2B54A 5ANKA 3OXIA 4C4IA 2R3IA 3E3PA 2QHMA 5IDNA 1IAJA 5L6PA 1XBAA 4G31A 3ZLWA 1ZYCA 3FL4A 4BCFA 4S2ZA 4HCTA 3I1AA 1M2RA 3MVMA 4IAIA 2BUJA 4AT4A 3VUMA 2G1TA 2VTRA 4FSUA 5E1EA 4EJNA 4O0UA 4DFUA 3FHRA 5BMSA 1NVQA 2R3PA 3ORLA 2FO0A 5FQDC 4BI1A 5F94A 4YTFA 5KHXA 3PJCA 2YM5A 4LOPA 4A4OA 4I24A 2DWBA 4EONA 4DINA 5ANJA 3DBDA 1XH6A 2NP8A 3KFAA 3OXTA 2VTIA 1WVXA 4W4YA 3TJCA 2CKEA 4EWQA 5A54A 3BCEA 5HICA 4R7IA 4Y73A 4GG5A 1R3CA 3AC8A 4ENYA 4OBOA 1UV5A 5DHJA 1Q41A 3TV6A 1YDTE 3R22A 3PXFA 5EI8A 4OAVB 3VUIA 3S2PA 3EFJA 3M2WA 3VHKA 4MNEB 4UXQA 5IH4A 3UZTA 4BWKA 2ZV7A 3AOXA 3JYAA 4ZEGA 4CFVA 4FTCA 1NY3A 2RL5A 4PMPA 1RDQE 4C4EA 3N4VA 5TT7A 4GFMA 4YO4A 3DK6A 4TRLA 4BCPA 3L1SA 4IM0A 3OEFX 1UKIA 3OP5A 2HENA 4FBXA 3NAXA 3PY3A 2PYWA 5CEMA 5TO8A 5BUEA 2ZM4A 1XBCA 3C4FA 4MBIA 5E90A 3TM0A 5DEWA 4AACA 2CPKE 2OK1A 3KMMA 3V8WA 1Z9XA 3ERKA 4KKHA 4OTGA 3UDBA 3UVQA 2WQOA 4I93A 4C59A 2PULA 4KA3A 3AC4A 2R0IA 2LGCA 2YJSA 4MYGA 2A2AA 4NIFA 5JFVA 3AD5A 3L9MA 3QLGA 4YHFA 3W2OA 5KMKA 3UNKA 3UPXA 4EH2A 3FXZA 3EKKA 1OECA 2YDIA 5HCXA 2J50A 1BKXA 4ANQA 1YW2A 4IDTA 1H1SA 4IMYA 4C2VA 4ZMEA 4FKOA 1OBGA 3QQLA 4G1WA 2ZV8A 2OXXA 4U79A 1YHSA 4J96A 2ITOA 3F9NA 3VF9A 2PMIA 3OY1A 3OW3A 4QMUA 5HCZA 4FIIA 3S1HA 3MSSA 3ATSA 3RPOA 3F5GA 4XX9A 4L3LA 4HNFA 5M4UA 2QKWB 3BHTA 4FOCA 4CQGA 1Y6AA 4OTRA 1YOMA 1VJYA 4F0IA 3MVHA 5I9XA 2CN5A 3FLNC 4JQ7A 2EXMA 2JDRA 3FJQE 3L8XA 1OIQA 1UU7A 4F9BA 2YIRA 4D4VA 5JSMA 5KZ0A 2IZTA 5DVRA 2W5AA 3MB6A 1WBTA 1FINA 3BQCA 4HGTA 1FVTA 4R5SA 3D5WA 4L3PA 3WZUA 3VIDA 3P23A 5GZ8A 2IO6A 3S95A 3KXMA 3CR0A 1URCA 2YJRA 2OKRA 3ZUUA 3CSVA 5D11A 3DQXA 5H9BA 2XNNA 1V0PA 2NRYA 5BNJA 4X0MA 1Z5MA 4ARKA 4AOJA 4FA2A 5KUPA 2WU7A 4NYEA 3E3BX 2X8DA 3OBGA 4O0WA 5CYIA 3W8QA 4JXFA 3ZFXA 4BI2A 2YZLA 1ZYJA 4RIXA 2RFSA 4KIKA 1HCLA 3GT8A 3LLAA 4DT9A 2XS0A 1PYXA 4YZMA 4FKJA 2JKOA 4JDKA 1ZWSA 4MX9A 3PSCA 2VGOA 4R6VA 3HMNA 4APPA 4F7SA 4QMOA 3BYSA 4J98A 1ZMWA 3RBWA 1L3RE 2YLFA 3MB7A 4M14A 3MJ2A 1P4FA 3HUBA 5BUJA 3QL8A 4X3FC 4V05A 4BGQA 2BRNA 3NW7A 3PZEA 5IU2A 3OT3A 1YHWA 1JSVA 4JBQA 4NCTC 5B2KA 4DFXE 2ITWA 4MQ1A 2CHLA 3PDTA 2B52A 4FNYA 2XIZA 2BFYA 4UMQA 4ZTQA 5EYDA 5IQBA 4OTFA 2ZM3A 3NW6A 2B7AA 3UG1A 2C0TA 3D15A 4F4PA 3TUDA 4UMPA 4AXAA 3I6WA 3FZTA 5IQEA 1W83A 3OW4A 3Q52A 1FMKA 3G33A 2WEIA 3QYWA 5GHVA 3QRKA 4FK3A 5DEYA 2BHHA 5DBXA 3QU0A 3U6HA 3KCFA 4L44A 5I0BA 4RIWA 1QL6A 4IDVA 3ZC6A 1PW2A 3QC9A 5GIOE 3QZIA 3FI2A 2GU8A 4B8MA 4XV1A 4G3DA 4QPSA 4YO6A 4YNOA 2HXQA 2VTLA 4XMOA 4YZNA 2JBOA 5J7HA 2R3JA 3CTQA 5M4FA 3NUNA 5AA9A 2OJJA 4TWOA 2H9VA 2PVMA 1YVJA 4N6YA 3U8WA 3LLTA 4NIFB 5FTQA 5KE0A 3VBYA 4CT2A 4MXAA 1JWHA 4UYNA 5IPJA 5GNKA 5EQEA 2FSTX 3AD6A 4A4XA 5CNOA 3HYHA 4B8LA 1XBBA 2VTMA 3MPMA 5EI6A 5LMKA 4TNDA 3DAEA 4R77A 4BCIA 3TZMA 4ZTMA 3COHA 1DI9A 3GCSA 4AZSA 5KNJA 2JAVA 4DC2A 4JG8A 3QRUA 3ODZX 4KSQA 3QCQA 3LVPA 3DBEA 4JIAA 4O27B 4ALWA 1UVRA 5AIKA 1YWVA 3C1XA 2ITQA 2R0UA 4LUEA 2BDWA 3ETAA 3LE6A 4BDKA 2XIRA 4U45A 3FSKA 3KXHA 3O0GA 4RT7A 3U87A 5BVOA 1Q8WA 2PMOX 4TWNA 4N70A 5BVDA 4B99A 3S00A 2X8EA 4TT7A 4TYJA 3GU6A 5BUIA 5BVKA 3C51A 5HD7A 3EL8A 3T9IA 3DQWA 5H2UA 5K3YA 2Q0NA 3CY3A 3UODA 3TACA 3Q3BA 4BKYA 4BN1A 3O23A 2ZV9A 3AC2A 4HVDA 2WO6A 4GU9A 4AQCA 3UO6A 1VR2A 2A1AB 5BYLA 3D5XA 3D7TA 4QTBA 3IO7A 3QA8A 3EMGA 4RIXB 4QP4A 4DGMA 2KTYA 5AP5A 3DZQA 4XP2A 4KIKB 4EI4A 2NNWB 3LCKA 4QOXA 5AUVA 5HX8A 2GTNA 4WSYA 4GSBA 3OWKA 2VGPA 5A9UA 3KGAA 4RX8A 3BV3A 3PXYA 4K1BA 3VULA 4PY1A 4AX8A 2YIYA 4I92A 1YXXA 3D4QA 5ETIA 4O7WA 4WUAA 3FZPA 4ZLYA 3RPYA 3Q53A 3NAYA 4HVSA 3U9NA 3MBLA 1PXMA 3R7YA 3DKFA 2QOKA 2F4JA 1OVEA 1ZRZA 1TVOA 3UYTA 3Q4UA 4AZVA 4FKLA 4TWPA 5J87A 4EK4A 4KAOA 3K2LA 3FHIA 3K5VA 4YLKA 5CSPA 5IA2A 5JKGA 2Q83A 5CXHA 4NTTA 1XH8A 3V5PA 2PVYA 3MVLA 3EH9A 3NZ0A 3RGFA 2F2UA 3D2IA 2I0VA 4QMMA 3DJ6A 5CAPA 3TJDA 1WBVA 3R9HA 3E63A 1PKGA 3I60A 4JI9A 2WTIA 3FLYA 5FEEA 4BCMA 2IW6A 4D28A 4KS8A 4PL4A 4TWCA 3TWJA 1JKKA 1OPJA 2A4LA 1JKLA 2G2HA 4DEEA 4OT5A 4AN3A 2C0IA 4JR3A 4KB8A 4RIWB 4AA5A 4EZ7A 4ZMFA 2YDKA 3O8UA 5CVGA 2VWWA 4U7ZA 4F6WA 3BBTB 3IW5A 3AMYA 4FICA 3IW6A 5FTOA 3ALNA 4EK8A 3O50A 3NRMA 2JC6A 4DA5A 2WMQA 2G2FA 5BX0A 2GSFA 2BCJA 4Z3VA 4BDHA 4TYIA 5AUTA 2OU7A 4LI5A 2BDJA 4QPMA 3I5ZA 3F2AA 4XBUA 5EHYA 3LFQA 4HW7A 4DFYA 3QA0A 3W55A 5HORA 3O96A 2OIQA 3VS6A 4BHZA 4IJPA 2C6TA 4JDHA 4KIPA 3LFDA 3MW1A 2R7BA 3QTZA 2PU8A 5CF5A 3V5TA 4P90A 3DDQA 2PUIA 2I0HA 4D0WA 3CPBA 4FSYA 1B6CB 3QC4A 3AGMA 3I79A 3ULZA 4FZ6A 4QO9A 3R83A 5FRIA 4RGJA 2Y8OA 4HPTE 1H07A 1MUOA 5HU3A 4E6AA 4GK3A 2GCDA 4QMZA 1SVHA 4YTCA 3SRVA 2YDJA 3SG8A 3V8SA 3ENMA 4F70A 5HO8A 3KXXA 4ZSAA 5IA3A 5IH6A 3WILA 4CZTA 5FDPA 4G9RA 2FB8A 5L8JA 5DNRA 3EN4A 4C7TA 4KBCA 3ZM9A 5C9CA 3U4WA 5EW9A 2BTRA 4YJRA 4BBFA 3Q2JA 4FTLA 1KE6A 2OBJA 3OBJA 1PXLA 2VU3A 4FL3A 4QMVA 4USEA 3A62A 3A7GA 3FKOA 1SYKA 3NR9A 2J7TA 3ZO2A 4IB3A 3ULIA 3DBQA 3ELJA 1GIJA 3MY5A 5F4NA 4EUUA 3KRXA 4RJ6A 2JFMA 5AX9A 2IVUA 3DOGA 3F88A 3D7TB 3L8PA 2UUEA 4QQJA 5A3XA 3R8MA 4C4GA 4YSMA 5AAEA 4FIJA 3TT0A 5L2TA 1XHAA 3BPRA 4L46A 4MBLA 2C5OA 2ZYBA 1K9AA 4FSQA 3Q9ZA 3VS3A 4CZUA 2UW3A 3LCSA 5ETFA 3KCKA 2B1PA 5B0XA 4C0TA 1IR3A 4X6RA 4O84A 4FC0A 3QD2B 1ZOHA 2QI8A 2C4GA 3IQ7A 4FI1A 4WOVA 4YURA 2Y4PA 3BIZA 4MVFA 5L2IA 3NMUF 1FBNA 5HE1A 4FE2A 4QNYA 3AMBA 2XKEA 1W8CA 4DN5A 2OO8X 3H9OA 4D55A 3WYXA 4IH8A 5JT2A 3CKWA 4YC3A 3V51A 3C5UA 4GFOA 4FUXA 1UA2A 3FZRA 2Z8CA 2VWIA 2QLQA 3KU2A 4Y95A 3BX5A 2YM6A 5AEPA 3FY2A 1OL2A 4IADA 4A06A 1M52A 1ZOEA 3GC0A 3F2NA 4BDBA 4I5HA 1PHKA 3NIEA 4EH4A 3CGFA 2P2HA 2Y4IC 4FV5A 3W2PA 2GNJA 4FSTA 4FSRA 4GFGA 1Q3WA 1Y6BA 2FSOX 5ANDA 4ZJIA 3D14A 3DB8A 3KRWA 5HO7A 4EQMA 2BZKB 4FEWA 3POOA 3ZU7A 4I41A 3N9XA 1QMZA 4M68A 5C8KA 3SOAA 4KIOA 1GAGA 3OG7A 2F2CB 4LMNA 1FOTA 5CTPA 5EM8A 3D5VA 4RVLA 4FG8A 3TIYA 4AAAA 3IONA 2Y7JA 5LWMA 4DGOA 4D4RA 4YZCA 2C30A 4ACHA 5BYYA 3BGQA 3IECA 3DAJA 3DJ5A 2GTMA 3SQQA 5FXRA 5JFWA 3QCXA 3GCQA 3QX4A 2J9MA 4U0IA 4FT9A 2J90A 3BBWA 4CSVA 2EWAA 4I0SA 3KULA 2V5QA 3VBQA 3BYUA 3U51A 1Q99A 4O91A 3F3VA 3PWDA 3LPBA 1TQIA 1KV1A 1BI8A 4QMYA 3VWAA 2W7XA 5E8YA 4KUJA 4GYIA 4XOZA 2H8HA 3VBTA 5TE0A 2VO3A 3GU5A 5AR8A 3FMHA 5KMNA 4U80A 2V7AA 4IZAA 3IDBA 3WE4A 2YHVA 5CSVA 3UC4A 4WO5A 3SHEA 1P4OA 3P78A 3DNDA 3SRVB 4OT6A 2ZV2A 3FC2A 5JFXA 2ONLC 3QKLA 3FMLA 5AUWA 1STCE 3ZEPA 4UWCA 4RLLA 4WNOA 1R39A 4GVAA 3NCZA 4WBBB 5IKWA 3VJOA 2BROA 4DGLC 4XG4A 4O1PA 2XEYA 3ATTA 4MD8E 3QTIA 3E8NA 3VW8A 3UVRA 5DGZA 4J52A 4ERWA 3FLQA 1L8TA 4NJDA 5FP6A 4GIHA 4UXLA 4Y72A 5C27A 2CCHA 4PF4A 5A46A 4G6LA 3TDVA 5DT3A 4BWXA 1UWHA 5HNIX 4BDDA 4FVQA 4FV1A 4ZSJA 3PY0A 4IJ9A 5HGIA 3RHKA 3W1FA 2VTPA 4CCUA 2FVDA 4W4XA 4CRSA 2XK3A 2J5FA 4A9YA 3A4PA 3DV3A 4BCOA 3SX9A 4F1MA 1U59A 5IQHA 3W2CA 5IH5A 3ZC5A 4GV1A 5IMEA 4EC8A 4P5QA 2OH0E 3KB7A 2GMXA 2REIA 5EM6A 5HEZA 1CTPE 2QONA 2VTQA 1CM8A 3UC3A 5DMZA 4V0GA 3P86A 3E5AA 4JRNA 1CDKA 3LHJA 3HRFA 3LFAA 4ACGA 3ET7A 3K3JA 3LCOA 3KY2A 3RAHA 1W84A 3R1QA 4DG0E 3TZ8A 3Q6WA 4JJRA 4U44A 5A4LA 3GXLA 4GEOA 4O21A 1H27A 4FKQA 4G3GA 4EHEA 5M09A 5I3RA 3P79A 4EOOA 3OOGA 3TKIA 5ETCA 3HGKA 3W16A 3NUYA 4FV2A 2UZLA 1V0BA 4DH3A 5CEPA 3DTWA 2W96B 4XV3A 2XJ0A 5EYCA 4FNZA 4ENXA 1IASA 1YWNA 1BYGA 2WTCA 4OTPA 4E93A 4GJ3A 4EBWA 4H3QA 2OGVA 5B7VA 3VS7A 4AOIA 2BKZA 4W9XA 3VAPA 2HELA 3F66A 4GL9A 3VS2A 3HZTA 4PP7A 5KHWA 5KKRC 1JSTA 2VTHA 2W99B 3GU4A 4U97A 4YJSA 3P7AA 2ZMDA 4WA9A 4OTDA 3TKUA 1Q5KA 1NVRA 4ASDA 3BHYA 4F9AA
chains in the Genus database with same CATH superfamily
3NLBA 1R0PA 3MPTA 4L42A 2FYSA 3EYGA 3HRCA 3QKMA 4C3FA 5AV3A 5CSHA 5JRSA 3DPKA 4TW9A 3VUKA 4N57A 4D2VA 2HZ4A 3BZ3A 3MH2A 5KMOA 5LOHA 3TUBA 3KK9A 3PXQA 4FYNA 4WT6A 4ZY5A 3LQ3A 1UKHA 4GW8A 4MHAA 3VS1A 2XUUA 2XMYA 3FKLA 2HK5A 3DJ7A 3KULB 3Q4ZA 4IB0A 4BVUA 2ACXA 3Q9YA 2HIWA 4QMLA 4WIHA 5CALA 3SGCA 4EOMA 5AR5A 3BU3A 3NUAA 3R1NA 3DCVA 3W0NA 2H6DA 1E9HA 2ZB0A 4IVBA 3R7EA 1R78A 5IUHA 4EHVA 4QYGA 5HOAA 5HTIA 3FQSA 4GJ2A 3PA3A 3KVWA 2IJMA 1W2DA 1M17A 3JPVA 5E8WA 2OIBA 4BIEA 5D41A 3BYVA 4DF3A 4J71A 1PMNA 2IZRA 2PY3A 4FX3A 4QP3A 3ZUVA 1ZYDA 2OJ9A 4FNWA 4AGUA 4RFYA 3NW5A 3RK5A 3TL8A 1OZ1A 3PRFA 4XV2A 4JNWA 5IQAA 1UWJA 4I4FA 4UWBA 4O6LA 4BYIA 4AAYA 1ZMVA 4XYFA 5BVWA 3A60A 3U6IA 4WNKA 2X8IA 2QVSE 2V22A 4P4CA 3TMOA 1BI7A 2R3MA 2XM9A 4XG2A 4PTEA 3N4UA 4BCNA 5LCKA 4BR3A 5CEKA 4RA4A 3I6UA 3LFCA 3CC6A 5HESA 5CF6A 3LM5A 4HOKA 3RP9A 4H05A 2BPMA 4FZAB 4L45A 4YGAA 4F9WA 3DK3A 4M15A 4AGDA 3LMIA 3FI4A 3NEWA 5F9EA 4BB4A 1R1WA 3EKNA 4FV9A 4YJUA 5DLSA 3R9NA 4AWIA 2B0QA 2VWZA 4DEHA 4MXCA 5CY3A 4F78A 4OTIA 2UW0A 2XBJA 1ZLTA 3L9PA 3ZUTA 4NW6A 1ATPE 3JR1A 1O6LA 4K33A 1LEZA 3QX2A 5M4IA 5DT4A 4EOKA 4K18A 3MWUA 5E9EA 3R7VA 3I7BA 3MIAA 4M69A 1GIIA 3WZDA 4C57A 4RJ7A 3VJNA 2QO9A 4CD0A 2XEZA 5AR2A 2WMSA 3FMNA 3EQFA 1YXTA 5K5XA 4CFMA 4O7RA 2AUHA 4U6RA 4DHZA 4RG0A 3PXRA 4YJOA 1Y57A 3BE9A 5M53A 4TKSA 3EIDA 5FG8A 4C4HA 5CAUA 3LXPA 1JSUA 3H3CA 2VRXA 4B7TA 4PNKA 4ZTRA 4X6QC 4PTCA 3TN8A 3QCSA 2XYUA 2PUPA 4Q5HA 1OIRA 1XH5A 5LWNA 2C3KA 1X8BA 2I0EA 5C03A 3DKOA 4CMOA 4D2TA 4FSMA 4JIKA 2F7XE 5AP6A 1PXOA 2ZDUA 1QPDA 5EI2A 3DAKA 5I9VA 4ITJA 3KRRA 4KS7A 4QP6A 3T3VA 4Z7HA 4PDPA 3V5QA 5EDQA 1J1CA 5B2MA 4AT5A 2IZSA 4I23A 3RM7A 3MFRA 4PL5A 3KRLA 3UVPA 4CKJA 4H58A 5LJJA 3D5UA 4ZIMA 4FKGA 4EQCA 4IACA 3TV4A 4UX9A 2ETRA 4JDJA 3KRJA 2RFEA 2E9PA 3NDMA 1OGYA 2NRUA 4PV0A 2HWOA 5KCVA 1WBNA 2OICA 3COIA 4DEDA 3VS5A 1BUHA 2XNMA 3IS5A 2BZHB 3DS6A 4L8MA 4NUSA 4PL3A 2JFLA 4B6LA 3HP2A 4YJVA 5IA1A 3FSFA 3UMWA 4QP1A 4TYEA 5A4EA 5I4NA 3LQ8A 3RNYA 3F3TA 5KMIA 5CEOA 1ZYLA 2OIDA 3RINA 4B9DA 4D1SA 4JLCA 5AR7A 3UTOA 4FKSA 4E5WA 4IAZA 3PXKA 5G6VA 2RF9A 3DY7A 5EG3A 2O3PA 4LUDA 2QNJA 4RLKA 4IFCA 3C7QA 4C4FA 2YAKA 2YZAA 1Q24A 3ZLXA 4UZDA 3V6RA 3FMEA 4YZDA 3BHHA 5CXZA 1OL7A 4JDIA 3F7WA 5A6OA 1R0EA 4ZS0A 1PKDA 1NXKA 3MH3A 3EN5A 2OF4A 4X3FA 5H8GA 4EQUA 3F5PA 4Z7GA 4YZ9A 3QXPA 3OCTA 4R8QA 3ORTA 4AE9A 1WVYA 3CE3A 3EZVA 2JEDA 3LM0A 3DFAA 4NCTA 1I44A 2ITZA 5KZIA 1GIHA 1DM2A 2VTJA 1WBSA 2V0DA 4KIQA 2I1MA 3FC1X 4RZWA 4XCUA 3VBXA 3SOCA 2VNYA 5E8XA 3AT3A 3LFEA 4DHIB 2OZOA 4DEAA 4E73A 3GOKA 5HZNA 3A7JA 4HCVA 1RW8A 3E64A 5CZHA 3FXXA 2G15A 5CU2A 4AGCA 3E7OA 4CFWA 2BRBA 4F63A 3EFKA 4UBAA 1SM2A 2XRWA 2WZJA 2YIXA 3ZCLA 4KRDA 4J8MA 3BU5A 3AG9A 4ZP5A 3ZLYA 3LFFA 4L9IA 5HG5A 4AP7A 4XJ0A 2XZSA 4S31A 3RPRA 5KMMA 4M69B 2UZTA 2UW6A 1KWPA 3ZMMA 3ROCA 3L9NA 2OXYA 4CEGA 3DLSA 4W8DA 4C36A 2GNLA 4RWKA 5HG9A 3MS9A 3I5NA 3VONA 1GZOA 2OFUA 3L8VA 2PUUA 2OSCA 2OJIA 3DBCA 4U3YA 1V0OA 5E8TA 1H26A 5J9ZA 1REKA 1XMLA 2C1BA 2W5BA 1GZKA 2BHEA 3G6HA 1YXUA 5FM3A 3H0ZA 3PYYA 3NVMB 3U55A 2HW7A 4QP2A 3NYOA 4TPTA 3DK7A 5FUTA 2BZJA 1OKWA 3QLFA 3COMA 3BLRA 3TZ7A 4CG9A 4YNEA 3ORPA 5JZJA 2DQ7X 4G3FA 4NZWB 4FTTA 3P0MA 2VV9A 1T46A 3PVWA 4MCVA 4GYGA 4IX4A 4LFIA 4AZTA 5AMNA 2ETMA 4ACMA 4YLLA 4YPDA 4EYMA 5GZAA 4H3BA 3TG1A 2OLCA 4I4EA 5CVFA 3QQJA 2H96A 4Q2AA 2AEGA 1VLRA 3SKCA 5IQGA 4O4DA 3OTUA 1FMOE 3TTJA 4B0GA 4C35A 1ZOGA 3FDNA 1H1RA 4WNPA 2BDFA 4RFZA 4PPAA 3TV7A 1PRYA 2VTNA 2A0CX 2UZNA 2HZ0A 3NNXA 4MKCA 4NT4A 5C4LA 3EB0A 4M13A 1PXIA 3I4BA 2VX3A 3LCTA 1BMKA 2I40A 4G6NA 3G9NA 2B55A 4NM3A 4O4FA 4CTBA 4TN6A 1M2QA 2WTDA 3FWQA 4MXOA 2PE2A 4RVMA 5ETAA 4ZZMA 4MEDA 4XHKB 3FKNA 4Z55A 4OGRA 5IQCA 5BVNA 4IW0A 3FZSA 4D5HA 4LV5A 5CENA 4FKWA 2UZUE 4AZWA 3UPZA 4EJ7A 3NNWA 5DYJA 2P0CA 4E5BA 2ITPA 4O0TA 3WF5A 2X9FA 2GHLA 3S3IA 4EH5A 3LMGA 1ZMUA 3QWJA 5JGDA 4GKHA 3D7ZA 4R7HA 3WZJA 1YXVA 5KX8A 5JFSA 4QQCA 4RJ5A 5J5SA 1YI4A 1FQ1B 4DTAA 3BI6A 5DIAA 4DEGA 3KK8A 5J8IA 4DCEA 2EB2A 5FXQA 4YJPA 3UIBA 3W2RA 2J0KA 2OFVA 4FKVA 2XF0A 4MXZA 3ZYAA 1B38A 2WAJA 2X1NA 3BYOA 4K8AA 4X3FB 1IA9A 4QDVA 3QF9A 2PE0A 1YQJA 5IZFA 2WIPA 3HV4A 3I81A 2RFNA 1MQ4A 3O7LD 3HP5A 4WUNA 3MA3A 4ZTHA 4EEVA 3W0MA 4L01A 3MFSA 4NEUA 3V3VA 4E5AX 4U5JA 4GK2A 3W33A 2XCHA 4QYYA 4KKEA 5FWKK 4BZDA 3R21A 5FBNC 4MD9E 4QMTA 1O6KA 2JIUA 5DN3A 1W7HA 2B4SB 3TI1A 4DFNA 4F7LA 3B8QA 3DT1A 3FUPA 2X6EA 4FSNA 3QTWA 4FVPA 4RZVA 5DE2A 3R7UA 4APCA 5JN2A 5DPVA 3TNWA 3HECA 4JBOA 5HE2A 1OL1A 2E9UA 3T9TA 5M57A 2R3GA 2WKMA 4DYMA 4UB7A 4O7ZA 3HVCA 4J99A 2XM8A 2Z2WA 5EK7A 5J95A 1OUYA 1XH7A 5FLFA 5HKMA 1APME 3WZKA 3CD3A 1J7UA 3QRTA 5C8MA 4TL0A 3Q5IA 5IQIA 3G9LX 4D1ZA 3C0GA 3JXWA 5M06A 2XNGA 3PLSA 3W8LA 4AXCA 1IRKA 1IA8A 1KE9A 4OUCA 4UN0C 3PJ2A 3C4WA 3CTHA 3CQWA 4WD5A 4Z9LA 3FMDA 2UVXA 3HV5A 4EORA 4BKZA 2GDOA 2CGWA 4RFMA 4QTAA 3WARA 4O2PA 4HCUA 4ALVA 2IG7A 2XJ2A 2VO7A 4AFJA 1VYZA 1YOLA 2BFXA 4KINA 3TKHA 4FRFA 5EKOA 5AFVA 4IWQA 2X7OA 5FP5A 5LVNA 5HX6A 4UALA 3II5A 3JY0A 3OCBA 4IC8A 4JOAA 5FBOA 3LFSA 2LAVA 4U81A 3FMMA 1PJKA 5K0KA 1TFFA 4LYNA 2QOIA 4RC2A 4XP0A 4DTKA 5CU4A 4ZAUA 2C68A 3BLHA 5DG5A 4ERKA 2WTKC 3R7IA 1Q3DA 4QQ5A 2WOUA 3W10A 4RX5A 2X4FA 4O0RA 1ZARA 5LVOA 3RWPA 4FODA 3GP0A 2V7OA 3PVGA 3AMAA 4MD7E 3RAIA 2WQBA 4M84A 4RWJA 4XG6A 1H4LA 3JVRA 3BQRA 4DLIA 4GS6A 4BF2A 2E2BA 3ZSGA 5KO1A 3IDPA 5HG8A 4FTRA 4X3JA 4K0YA 4R78A 1XQZA 4FTAA 4OTQA 1KV2A 5HU9A 3CCNA 4MF1A 5EQPA 5CSXA 5C4KA 3R2YA 5JK3A 4FTQA 1LP4A 3HL7A 5AAFA 4DBNA 5K5NA 2PHKA 1LR4A 4HZSA 2CNUA 4XG3A 2GFCA 3CQUA 2UVYA 4RC3A 5HVYA 4O7SA 2C3JA 2JIVA 3FPMA 4J1RA 2F57A 4JT3A 3NX8A 4UYAA 3E88A 4I6QA 3WOWA 3BRBA 3UQCA 4I6FA 3NFGB 4J7BA 3IPHA 3R8UA 3FXWA 1OM1A 4NM7A 3IOKA 4GT5A 3D83A 3O7LB 3HMIA 4KWPA 4BTMA 3GCPA 4XEYA 4IB1A 3LZBA 4FIHA 2BIYA 3PWYA 4XRJA 4BTJA 2ZJWA 4KKGA 4LG4A 2WHBA 4GG7A 5AP3A 3A7IA 4QTEA 5E4HA 4F7JA 4EH8A 1FPUA 3FYKX 4ZTSA 3WIGA 3QD3A 3AKJA 1JVPP 3PUPA 4GK4A 4PPBA 5EFQA 2ITYA 5ACBC 2C3IB 2XNOA 3GB2A 4FZ7A 1GZ8A 3CEKA 5LARA 5IUGA 4XG9A 1UNLA 4FTNA 2PSQA 5J1VA 3EZRA 4BICA 3UZPA 1KSWA 4N6ZA 5CASA 2ITTA 2OJFE 4AG8A 4KD1A 3ACJA 2XJ1A 4IWDA 4HZRA 4DGNA 4YTHA 5HHWA 5HLPA 3EL7A 1K2PA 3Q4CA 4AT3A 2C6IA 5HNGA 4E3CA 2WQMA 4F6UA 3P7BA 3E92A 3FMKA 3IW8A 3MN3A 3UG2A 3MTFA 2GHMA 4FEQA 4YR8A 2R3KA 3SA0A 3ZSIA 2R2PA 2WB8A 2VZ6A 3HLLA 5F1ZA 5AX3A 1Q8ZA 5HE3A 3CQEA 3D2KA 3Q2MA 3ZXTA 5G1XA 4ANLA 2O2UA 3C0IA 3HMOA 4C61A 3BU6A 3OMVA 4LRJA 2O65A 4EH7A 2CCIA 4V01A 2UZDA 4FTMA 4CKRA 2UV2A 4C37A 3LFBA 2R4BA 3QRIA 3NYVA 1PXKA 3G90X 4GVJA 4K77A 3DGKA 3K5UA 4F1OA 2HZNA 3NSZA 3UP7A 4NL0A 2V55A 3W0QA 3CY2A 1YWRA 4EC9A 5IA4A 4G2FA 3GQLA 5HG7A 2JBPA 1Q97A 4Y8DA 3FLSA 4C02A 1H1PA 4LGHA 2YCFA 4FV0A 3EN6A 4O7TA 5DWRA 3HRBA 3QBNA 2Z7SA 5ANIA 2ONLA 3ZZWA 3PSBA 3E7VA 4IIRA 3OC1A 5CS6A 2C6LA 2EXCX 3CP9A 4FKPA 3MTLA 5T3QA 2V62A 3W2SA 5D7AA 3CJGA 1ZXEA 3PP0A 4BDGA 4EWHA 1G3NA 2UZBA 5EOBA 3ID6C 4OR5A 2XAOA 1WZYA 2BIKB 4YHTA 3SVVA 3GEQA 3A8XA 5GJGA 5K4IA 3W2QA 3QGWA 3WF7A 3GUBA 5FEQA 1Q61A 4O0SA 3HV3A 3DLZA 4QYHA 5CEQA 3G15A 4C2WA 5HE0A 4XLIA 1HCKA 5TOZA 2WMXA 4FT3A 3R6XA 1REJA 4IB5A 1Y91A 2PZ5A 2W1GA 4Y46A 2R9SA 2GS7A 5A4TA 5K0XA 2WELA 1XO2B 2C5XA 3BHUA 5KBQA 2O0UA 3ORXA 4GU6A 4FR4A 2JIIA 5HIDA 3OXZA 3OOMA 3GU8A 2PE1A 3B2TA 3JUHA 2Y6OA 3PPZA 1CSNA 3KEXA 3QQFA 5E92A 3SAYA 2F7EE 3RAKA 3VUDA 3ZS5A 4DE4A 2QOQA 3GGFA 2ZDTA 2WTVA 3TEIA 2YM7A 4AU8A 1CKIA 3B2WA 5E1SA 4E6QA 1CMKE 3ZDIA 4Y5QA 4X2JA 1WFCA 4K11A 3ZXZA 2EB3A 3A7FA 1M14A 5J5TA 4FEUA 1U54A 1DS5A 3ENHA 3R63A 5M08A 2R5TA 3HMMA 3V04A 2I0YA 4ZLZA 4IVDA 3S0OA 2UZEA 2FA2A 5IUIA 3MVJA 4CKIA 2UZOA 3CLYA 5LVMA 2PPQA 3U54A 2QOBA 4QMNA 5H8EA 3R71A 4YMJA 3VW6A 1WBWA 5DRBA 1OL5A 3ZO1A 3UIUA 5E7RA 2XP2A 3TUCA 4EHZA 2OW3A 2Y4IB 4GT4A 1YXSA 2C0OA 5CWZA 2VD5A 5AV2A 3REPA 4AN9A 2ZOQA 5JMSA 4X2KA 5L6WL 3VBWA 3AQVA 2P4IA 3JS2A 4ZSGA 4A9SA 2CNVA 3OS3A 2VN9A 2J0MB 4MF0A 5CT0A 2X0QA 2HZIA 4LRKA 3TNQB 3NVKI 3RALA 3MYGA 2WMTA 1W0XC 4I6BA 4HNIA 5LVLA 3QTQA 4QMPA 4PUZA 4FIFA 3QGYA 3KC3A 3O8TA 4ZZOA 4HGSA 3E87A 2WEVA 4CV9A 4FGBA 3I7CA 1QPCA 2W4KA 2PVRA 1WVWA 4W8EA 3P5KA 3FQHA 5HLWA 1BLXA 2QOCA 2AQXA 3VS0A 4E7WA 2YN8A 5ICPA 4ZOGA 4ANSA 3O17A 4RJ4A 3B8RA 4ACCA 3MH1A 2QQ7A 3R73A 2X81A 3MIYA 3UIXA 4JQ8A 4O7NA 2GNIA 5HLNA 4O83A 3H30A 4A9UA 4YUQA 2QURA 4DDGA 3QHWA 4M3QA 2WMVA 4P7EA 3TZ9A 4EK5A 3WYYA 2W05A 4G17A 2W4OA 1H01A 3ACKA 3RAWA 1T45A 2P33A 2GQGA 2QOLA 3F5UA 4DGGA 4FIGA 4KRCA 3M42A 4QD6A 4TYGA 5CI7A 3KVXA 2VX0A 4HVHA 1JNKA 4KSPA 3UQFA 1PMEA 1JKSA 4MAOA 3VC4A 2VTTA 3ZBFA 4FK6A 5ANEA 3D9VA 4IXPA 3ODYX 3LKMA 4MBJA 4XLVA 2QO2A 4DITA 1QCFA 3KXZA 3HNGA 1TQMA 3NIZA 4L53A 4PMTA 1W2CA 4WG4A 1YOJA 2VWBA 3ZM4A 1F0QA 3WF8A 5CU6A 3KN6A 4FV8A 2UVZA 4R1YA 5FEDA 3RNIA 4M0YA 2Y6MA 3E8EA 1XH9A 2BAJA 1UU3A 3GC9A 2X2KA 3F7ZA 5AM6A 5AP1A 3Q96A 3RCDA 4AW2A 5J9YA 4JG7A 2J0LA 2EXEA 4V04A 3IDCA 3RJCA 3GC8A 3AKKA 5A4CA 2W06A 5DR6A 1G5SA 4M66A 4XOYA 2XB7A 2BRGA 5EM7A 3BLAA 1S9IA 3GC7A 5I9YA 2VAGA 2X6DA 4NM0A 3G5DA 3EYHA 3R02A 4D5KA 3Q32A 3QAME 2XIKA 5JRQA 3CS9A 2YIQA 4LM5A 1U54B 3QRJA 4GUBA 2WMAA 2QG5A 3AT4A 4FTIA 1OB3A 2X7FA 2P55A 1YI6A 3F82A 1OPLA 5DH3A 1ZAOA 2R3OA 3PE2A 4BZNA 1DI8A 5GIPE 2C47A 2VO6A 5AUUA 4EOSA 4FL2A 4BDCA 3HX4A 2JLDA 4EKLA 5EDRA 3U6JA 3PUFC 3KN5A 2IEWA 1YDSE 3QZGA 4AW1A 2GS2A 4CV8A 2Q0BA 4R3RA 1SZMA 3FPQA 4A9TA 4F0FA 3LXNA 1URWA 4CCBA 4RQKA 4IWOA 3PTGA 4LOOA 1ZZ2A 2O64A 3OUNB 4BFMA 5KKRB 5LXMA 4D2WA 1ERKA 3Q5ZA 1KOBA 5F95A 3ML1A 4ANBA 5HD4A 2ETKA 2EU9A 4EK6A 4JMQA 1PXJA 1KUTA 2WFYA 5EQYA 4G3CA 4DH1A 3KA0A 3RI1A 3OEZA 2CN8A 4CNHA 4UY9A 4R5YA 3UMXA 1Q8TA 4L68A 5HO6A 4Q9ZA 4FSZA 2QC6A 2NO3A 3OROA 4FYOA 4UEUA 3RPVA 3TXOA 3V5JA 4BCHA 4DTBA 2W1ZA 1Y8GA 5BQ0A 4CTCA 4DFZE 2X4ZA 3RPSA 4E4NA 2UW4A 2ZMCA 3OWLA 2W9ZB 2BTSA 3OZ6A 3MFUA 4PDOA 2YWPA 4BI0A 4Y83A 2BALA 4QRCA 3R0TA 3H9RA 3RK7A 5LVPA 3SLSA 4IZ5A 3F2RA 4DG2E 1YHVA 4I20A 4ZLOA 4KBKA 3CJFA 5EW3A 5T6KA 3F3WA 4L52A 1U5RA 4NK9A 3C0HA 3GI3A 3UNJA 2O8YA 2YIWA 4JQEA 1A48A 3BHVA 2R3QA 3PP1A 4LQMA 3UDSA 1KE8A 4KBAA 2PVJA 4JS8A 2VWXA 3VRYA 2YWVA 3HAMA 1YI3A 4G5PA 4H3PA 4FZDB 4GUEA 4AA0A 4CZYB 4DEIA 2OWBA 2XNBA 3GFWA 3R28A 2XBAA 4FTOA 4LL0A 3KF7A 4O22A 4L00A 4QTCA 4YJQA 3PXZA 5AR4A 4V0GB 2W4JA 3MY1A 5DOSA 4LGDA 1G8AA 4AOTA 5IMXA 5IF1A 4QYFA 3C4XA 4E20A 5C8NA 2XRUA 2XKDA 3MGYA 3Q9XA 5I9ZA 5LCJA 4AW0A 4U3ZA 3EQRA 2IPXA 2C3LA 3FI3A 2FSMX 3L9LA 4RRVA 4ZK5A 5D12A 2XK6A 4G16A 4OLIA 2XKCA 3DXNA 4BWPA 5CLPA 5AP2A 2YEXA 3VUTA 5CNNA 4NM5A 1P14A 2W9FB 4K6ZA 3QCYA 5FDXA 4ORKA 3BYMA 4FT0A 1ZYSA 3PLAE 3EQDA 1SMHA 3OUKA 5HBHA 2WQNA 5CEIA 3ZLSA 5EHOA 3MFTA 4M12A 4PP9A 3EFLA 3E8CA 2OF2A 3R00A 4NJ3A 1H1QA 3OY3A 3ZHPC 4JAIA 4CMUA 5JH6A 5AM7A 1H28A 5A14A 5F20A 2CKQA 2RKUA 4M97A 1PXNA 2XIYA 3RWQA 3R04A 4C4JA 2FSLX 2WMRA 3W0PA 2X0OA 1M7QA 3Q9WA 4RPVA 3AKLA 1AD5A 3BWFA 4NTSA 1PMVA 1WCCA 3RHXA 2QCSA 2I7QA 1OMWA 1ZY4A 2EUFB 3BEAA 4FEVA 4O6EA 2IZUA 4WBOA 2XH5A 3VQUA 4F64A 2JDSA 4AN2A 4BHNA 3V5WA 1PYEA 2FH9A 2C69A 5AJQA 2OH4A 2WXVA 4FTJA 2DYLA 3IGOA 4C3PA 3BLQA 3DA6A 5D9HA 2RGPA 2XVDA 3EQPA 2C1AA 2JKKA 4UMTA 4BGHA 5IG1A 3UP2A 1VYWA 4E4LA 3PZHA 4YZBA 1W82A 3PRIA 4ZY4A 5L8LA 4EOPA 3FL5A 3OTVA 5CSWA 3HA8A 4O81A 1S9JA 2YCRA 4PWNA 2BR1A 4YJTA 3V8TA 4UMRA 3N51A 2VWUA 2Z7LA 3NUUA 3EHAA 1E1XA 3PPJA 4CLJA 5IEXA 5AUZA 3V6SA 2E9OA 4RC4A 3R30A 2QU6A 3NPCA 1DAWA 3F61A 3C13A 3LMHA 3QTRA 3NYXA 2O5KA 4FT7A 2J0JA 3QUEA 5JQ8A 3ORMA 4IZ7A 1U4DA 5EKNA 4CYJA 3FI8A 2XYNA 4X2GA 1TQPA 3R7OA 4C58A 4D58A 4U42A 1OPKA 4FUYA 4ALUA 3UJGA 4I94A 2OG8A 4XBRA 3ZBXA 2XK7A 5EHLA 3KQ7A 2R3LA 1XWSA 3NYNA 4BIBA 3PE1A 3PG1A 4OBQA 2X9EA 1SNUA 4I0RA 4FMQA 3CKXA 1J91A 4FVRA 4G5JA 3MA6A 3Q4TA 4PX6A 3ZDUA 1OKYA 1PF8A 2JDOA 3EQGA 2ITXA 4D9UA 4UZHA 1VEBA 4F9CA 5CT7A 5ITAA 5FXSA 3FBVA 2QOOA 1JAMA 2IWIA 4EH3A 1OKZA 2X0PA 4M67A 5AUXA 5IDPA 1QPJA 3GENA 4BC6A 4IEBA 4ID7A 4D2SA 2WGJA 1VZOA 4G6OA 5BVEA 2J5EA 3RMFA 1MP8A 2R3HA 3RKBA 2JGZA 1AGWA 5M4CA 4G34A 3GNIB 4B4LA 3FZOA 5M44A 3FZ1A 2OI4X 4IM2A 3GFEA 4FJVA 3BKBA 4O96A 5B2LA 1B39A 4AZEA 4C3RA 5JQ5A 2YAAA 4FKUA 3SC1A 4BGGA 3H4JA 4BDJA 4BBEA 2JITA 4CFUA 5E91A 2Z7RA 3D0EA 3ORNA 4CXAA 4F7NA 4GT3A 3QALE 1KE5A 3R9OA 4CMTA 5TKDA 3OHTA 3QQUA 3E62A 4JBPA 1F5QA 2C5NA 4FG9A 5HVJA 3FV8A 3I0QA 2R3FA 4USDA 2BAKA 3DZOA 4QQTA 3RZBA 4NWMA 4E1ZA 2WTJA 2B9HA 4ZJJA 2UZVA 1U5QA 2AC3A 4ZZNA 2BKKA 5HQ0A 3EOCA 1AQ1A 2X0GA 3ORKA 2YLEA 4OAUC 4L67A 4NKSA 4GKIA 3C50A 3R8LA 5BPYA 4NFMA 5CVHA 1UU8A 2HXLA 4TTHB 4RX9A 3GU7A 3QZFA 2J2IB 5FM2A 4A4LA 3FY0A 4EOQA 5L2WA 5CU3A 2B9IA 1IAHA 2R3RA 2XA4A 3FE3A 4O7VA 3CBLA 5HNBA 2BRHA 1BL7A 2ZM1A 3ANRA 3VRZA 5I9WA 2CKPA 3D94A 5AV1A 4K9YA 2NPQA 4FV4A 1WBOA 3W0RA 3LW0A 4FOBA 3DKCA 1H0VA 3IGGA 4FNXA 2HOGA 2JAMA 4FGRA 5EDPA 2CNQA 3MJ1A 5T68A 2XCKA 3ZEWA 4O0XA 3V01A 4JL9A 4EHGA 4L7SA 3R9DA 3H10A 4WNMA 1U46A 2W1CA 1H24A 3ITZA 3Q60A 2GQRA 4MTAA 1EH4A 5CANA 3LCDA 2GS6A 2W1DA 3TCPA 3P7CA 5CF8A 1M7NA 1FVRA 3WF9A 4KABA 4I5PA 1JPAA 1Z57A 3IG7A 4E6CA 4F08A 3QQHA 4QMQA 3GOPA 2C5VA 4BDEA 2JKQA 1QPEA 1OI9A 4I22A 4P5ZA 3ORZA 1J3HA 1Q8UA 3ZRLA 3AXWA 1P2AA 4H1MA 4ZSLA 1LUFA 3EWHA 3PY1A 1GY3A 4J8NA 4BRXA 4QT1A 4RIYA 4ZJVA 1JBPE 4F99A 2ESMA 5HTCA 4K2RA 5H8BA 5KMJA 1XR1A 4FTKA 2Z02A 2BILB 5HTBA 1WAKA 1OITA 4C62A 3NCGA 5FD2A 3UYSA 4O7LA 4E4XA 4N4SA 1IEPA 2A27A 5C1QB 4H36A 4JR7A 4PNIA 5KMLA 2CLXA 5BMMA 4R7BA 2Z7QA 5CF4A 3G0FA 3LJ2A 5K9IA 5HVKA 3LQ5A 5AA8A 2IVTA 2QG7A 2CMWA 3DDPA 4NSTA 3OT8A 2EVAA 4XS2A 4RIOA 3VO3A 2W1FA 3KXGA 4QP7A 4BKJA 4PQNA 2J51A 3GCUA 3TNPC 4QP8A 4WG3A 3HV6A 4E26A 5EOLA 4PDSA 3EJ1A 4YPSA 4AE6A 2G01A 4GMYA 3P1AA 2HCKA 4WG5A 5CQWA 4DFBA 2PWLA 1H0WA 4JAJA 3WIKA 3ZONA 4AXFA 3EFWA 5GZ9A 4FIEA 5HCYA 1H8FA 4RSSA 3FQEA 4YP8A 2GNHA 3F3UA 2HYYA 2AC5A 3HV7A 2IW8A 2W5HA 1O6YA 4LV8A 2F9GA