3AMBA

Protein kinase a sixfold mutant model of aurora b with inhibitor vx-680
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
340
Chain Sequence
AAAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIRTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRIQQAVNFPFLVKLEFSFKDNSNLYMVLEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Mutants of protein kinase A that mimic the ATP-binding site of Aurora kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ambA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ambA02
3G0EA 4G3EA 2FVDA 1UU3A 3O23A 4J99A 4HJOA 3UMWA 3RBWA 4I0SA 3VVHA 3WF9A 3NVMB 3GU7A 3PSBA 3BE9A 5ETAA 3LQ5A 1XKKA 3VHEA 3FSKA 3OG7A 3QCSA 1CKJA 3I81A 3DJ7A 3OEZA 5IQBA 4FZ7A 2X2KA 5AR7A 4FVQA 2CN8A 3MN3A 4H58A 4B8LA 5LOHA 5HLWA 4QMVA 5M4CA 1XR1A 3VQHA 4G6OA 3FKOA 4U81A 4I1ZA 1TQIA 4IB0A 5DBXA 4QYEA 1PXOA 4NW5A 4I3ZA 2E2BA 1Q62A 2OIDA 4UYAA 3BYMA 2UW4A 3E62A 4YPDA 4IAFA 4U41A 5HKMA 3OXTA 4F7NA 1APME 3TZ8A 4U79A 4EHEA 4DGMA 1FOTA 2J50A 2PVKA 4YJUA 4IC7A 2C0OA 2BFXA 4OT5A 4WNKA 2VWXA 4L3PA 4LYNA 4QYGA 5F9EA 1FINA 4HNFA 5KNJA 1M17A 4YURA 3A4OX 5CAOA 4K18A 2YFXA 4YSJA 2QLQA 3ORLA 5FBOA 4DT9A 3M2WA 3I0OA 4IVAA 4AACA 4C02A 5CT7A 2O8YA 4M13A 2ZV9A 1H01A 5CZIA 3UPXA 3FUPA 2GTNA 4D0WA 3ACJA 3QQUA 3KRXA 5AX9A 4IX6A 2X9FA 4AE9A 1Y91A 3C7QA 3TEIA 4TYIA 3MH1A 3Q4TA 3HRCA 3BLQA 3OW3A 5HORA 3QRIA 3ORZA 2UUEA 4QMQA 5C4KA 3ZSIA 4XYFA 4D4VA 5FP6A 4CG9A 2ITUA 3BBTB 4FKUA 1M2QA 1ZOGA 2UVYA 4LUEA 2OBJA 4ASXA 4DGGA 4EORA 1NVQA 2RFNA 5FXRA 1FBNA 4BDEA 2FSLX 1P5EA 2OZOA 1H0VA 3NSZA 4OTRA 4JBOA 4TNBA 5H8EA 5CF5A 2QOFA 3DJ6A 3PRIA 2C1AA 4V05A 5IA3A 5DR2A 4N57A 3UOJA 4I24A 3OBGA 4YSMA 3E87A 2LAVA 4CMTA 1SVGA 3B8QA 4FKVA 2LGCA 3KK8A 4ID7A 4O1OA 5E7RA 5EG3A 5A4TA 5C9CA 3BYOA 3QTXA 2WMUA 3D94A 3I0QA 1Q99A 1SMHA 1LP4A 2FH9A 4R8QA 3BGZA 3QZHA 2O64A 4G3DA 4JR7A 4QNAA 1DAWA 1Y8GA 2OIBA 4NTTA 4U6RA 5HCXA 4NUSA 4L00A 4PPBA 4H1JA 3SG8A 2FA2A 4LV5A 5AR4A 2CPKE 3OWPA 4IWOA 5T6KA 4RA4A 4BBMA 3SGCA 4NFNA 5EM5A 4EKKA 3NLBA 2QOBA 2WELA 1PKDA 3SLSA 1YI6A 4PQNA 4EWQA 4RWLA 4S33A 2E9NA 2HCKA 3FMNA 4D4YA 4BGQA 4F7LA 1GZNA 3HDMA 5EQYA 4DLJA 1JWHA 5LWNA 4GT5A 4QP3A 4RBLA 3F5GA 2B9IA 2VU3A 4RFYA 2QCSA 1W82A 3EQGA 3R7EA 3O7LD 2UZTA 4I6QA 3VC4A 3K3JA 4QP2A 3VUHA 5IU2A 2XVDA 1YDTE 4CTBA 3QCQA 3FL4A 3SC1A 4DCAA 3KXXA 1H25A 4B99A 3UZPA 4OAUC 3DAKA 5CU3A 2BRNA 1MRVA 4G17A 3FV8A 4GFMA 4YGAA 3GI3A 4UMTA 5H8BA 3LLAA 4CG8A 5LMAA 3KB7A 4EK6A 2V7OA 3MI9A 4HVSA 3GFWA 2GFSA 5C8MA 4MXYA 3PIYA 3IKAA 5EOLA 3ZC6A 3GC8A 2O3PA 4M66A 1XH8A 5DRDA 4GCJA 1KWPA 3ZRKA 2PVHA 3DB6A 3L1SA 4L3LA 3WF5A 4AG8A 3NW7A 3FPMA 5JMSA 5E8TA 4I6BA 3TV6A 3FLZA 4QPMA 4RX7A 4XBUA 2VO0A 4QRCA 5IPJA 4TYGA 4R7BA 5FEEA 3UP2A 1SYKA 4FBXA 4L7SA 2FGIA 3CGOA 4L44A 3TNWA 5KKRC 1DS5A 2X8DA 4RIYB 4RIYA 4WG3A 2OSCA 4FI1A 2EWAA 3IW8A 3DXNA 1CKIA 2A0CX 4RWJA 4B7TA 1YKRA 3BEGA 5CEPA 3DBFA 2XEZA 4MEDA 4PPAA 3HAVA 4K6ZA 4YO4A 3FXZA 4DFYA 5EHLA 4TYJA 4O7NA 3QQFA 3D5WA 4YJVA 4EBWA 1QCFA 1YXTA 1IRKA 2WAJA 3S00A 3LMIA 3PXRA 4FGBA 1GIJA 4FTRA 1LEWA 3KF4A 5DPVA 3VUKA 2GNJA 5IEYA 3ID6C 1P2AA 4RWIA 5IDPA 2YM6A 4QO9A 1FMKA 4DEDA 5L2QA 2F9GA 3DLZA 3OD6X 4PL5A 5E8WA 4BY9E 5AP0A 5LVOA 5AA9A 4HVHA 2ETKA 3DOGA 2BVAA 3BHUA 3LFNA 5FGKA 3Q2MA 3ALOA 3EN6A 3W8LA 2IPXA 3FWQA 4M0ZA 2P2IA 2DYLA 4IZAA 4BDCA 2BZIB 4C35A 3ZUVA 2C6MA 3OY3A 3HMNA 3CQUA 5KZ0A 4CQEA 2YIWA 2CGXA 1PXNA 2YM8A 4F9WA 2V55A 2CKOA 4O7VA 3U55A 1VR2A 4E5WA 1BL7A 3EQFA 3LLTA 4FG7A 3LPBA 5CNOA 5I3OA 4CFXA 4CFVA 4D0XA 4Q9ZA 4XG6A 1W0XC 1IEPA 2VTJA 4N0SA 5KMOA 3HLLA 3A8WA 4C38A 3LFQA 4JLCA 4IVBA 4A9RA 2H96A 3KGAA 2YLFA 3R8ZA 3QALE 4ZZNA 5AV4A 4YO6A 2X9EA 3CTJA 4KNBA 3ZM9A 2Y9QA 3FKLA 2OW3A 2RFDA 5C01A 3QU0A 4F6UA 2JEDA 3QXPA 4TYHB 4H1MA 4TYHA 3W2OA 2QO2A 3NPCA 2P2HA 2W1EA 2X8EA 3PXKA 4U40A 1P4FA 5KHWA 3F9NA 3R1SA 3G9NA 4YPSA 4DITA 4RFZA 3Q9WA 3FSFA 3BV2A 4QOXA 3SX9A 4AGDA 5HTCA 4QMPA 2WMWA 2QO9A 2XEYA 2VTHA 4AT5A 4JG7A 3I7CA 3BLRA 1CM8A 3FE3A 5K0KA 2QR7A 4I21A 3WIKA 1Q97A 2GS6A 4FG8A 4X2GA 3FMKA 2X1NA 5EI6A 2I0EA 3EQPA 4FKWA 3QGWA 4I0TA 1ZYLA 3OWJA 4IEBA 3BWFA 3C51A 5J87A 3TI1A 4CV8A 3G15A 4RSSA 2REIA 5BX0A 4Z7HA 4C2VA 3HV3A 3RPOA 2XKEA 3B2TA 1CSNA 4WG5A 3MH2A 4UMRA 2ITPA 4HOKA 2F2CB 5JN2A 4O0SA 5EDPA 2VD5A 3DFAA 3E88A 3O2MA 4UYNA 3FQHA 4YLKA 5DN3A 3II5A 2WQEA 1H26A 1UNLA 2BPMA 4Z3VA 3GP0A 4ZLYA 1PHKA 3LXPA 2HYYA 2GFCA 3FAAA 3VS6A 2YEXA 4L3JA 2CMWA 4GKHA 4MK0A 3ZSHA 2C47A 1M7QA 4XRJA 2VNYA 3T9IA 5A54A 2R3LA 4FG9A 2JDVA 2WIPA 3UG1A 3IECA 3HV7A 3MY5A 2IZSA 4F08A 4EOOA 2C5XA 5EI8A 3GQIA 5CSHA 2W5AA 4IWDA 4J98A 4JIKA 5ETIA 4AZFA 4OBOA 5M09A 5K0XA 4HW7A 2EXCX 1QMZA 4A7CA 4EH3A 5HQ0A 2NPQA 3S3IA 4EZ7A 5FDPA 2BTRA 5AUXA 3LFFA 3OWKA 2WQBA 2XJ1A 4ALVA 3PYYA 1NA7A 2J2IB 3GUBA 4RGJA 1H00A 3VUIA 2Z60A 3O8UA 4A9UA 5DNRA 3GBZA 4BDGA 2AUHA 2ESMA 2JFLA 2YJRA 4KRCA 4MD7E 4NWMA 4YZDA 3W2QA 4EK5A 2W9FB 3TUCA 3PXQA 3ZSGA 2W9ZB 1H1RA 3DBEA 2HELA 5CZHA 3A62A 4G6NA 4BI0A 2QURA 3R8PA 3F3ZA 4UALA 4Q9SA 3IPHA 2XIKA 5DLSA 4DBNA 1J7LA 2CNVA 4ONAA 1Q8ZA 3D7ZA 1Q8UA 4HGEA 3EN4A 5CT0A 5CTPA 4DEGA 4O7YA 3U54A 4QMMA 1M2RA 2J90A 4R1VA 5HG7A 2PY3A 1Y6BA 3AT3A 3OUNB 5M53A 2QOCA 3QHRA 2W5BA 3PE1A 4C4FA 3QBNA 3FLSA 2RKUA 2R9SA 3OBJA 3C1XA 2ITOA 4BCGA 2YA9A 4ZMEA 2XJ0A 2VX0A 3D2IA 4ASDA 3RHKA 1REKA 4L68A 4FUYA 2VTLA 4R3RA 3DNEA 2B53A 3BU6A 1QPEA 5L2WA 5FEQA 3PG3A 4XG7A 4YTIA 4F09A 4DTAA 2WMXA 3BQRA 3LCSA 2WTWA 3MS9A 1YWVA 2B9FA 3EYGA 1SNUA 4HZSA 4YC3A 3SDJA 5HU3A 3AT2A 5JQ8A 2R3KA 4LM5A 3GCVA 3THBA 4KA3A 5D41A 1LR4A 4BTMA 2PVNA 2W4JA 5DRBA 1YI4A 2HWPA 4XMOA 5KMKA 3MGYA 4NKSA 4RRVA 4FIJA 3WZUA 1MRUA 2WU6A 4KBKA 3KN5A 4HGSA 5HBJA 4YTFA 5HICA 4Z7GA 3PP0A 4NZWB 4CCBA 4L7FA 2I6LA 2VO7A 4NJDA 4KABA 4AZEA 3LCKA 3EYHA 4BTFA 1WMKA 3RAKA 3MPAA 3KXGA 4ZY6A 4YBJA 4UV0A 4M8TA 5HVYA 3BHTA 4PV0A 4R3CA 3CKXA 3IQ7A 4HCVA 5AP5A 1WVXA 3W55A 4M14A 2I7QA 4ZIMA 4O2PA 3CQWA 2PTKA 3S95A 3VS1A 4IACA 5FLFA 4EOQA 5BQ0A 3AT4A 5G6VA 4USFA 3SG9A 2VTIA 4Q5HA 2WPAA 4HZRA 1ZMWA 3HL7A 3FY2A 3QZIA 4JRNA 5FDXA 2J4ZA 4C4HA 2C5YA 4ZAUA 1F3MC 5IG1A 2IG7A 5CSWA 4F0FA 3W10A 3V8TA 3FZRA 4FTAA 4JX7A 2VX1A 3VHKA 4BIDA 3K3IA 4NSTA 2OJFE 3VBVA 2GHLA 2Q0BA 4UBAA 2W1IA 5GJFA 1U5QA 5A6OA 1TQPA 4AZWA 1B39A 4IFCA 5LVLA 1SZMA 3GU5A 4HNIA 3FKNA 3VBWA 3OZ6A 3ULIA 5KUPA 3TWJA 2F57A 3KRLA 3QQGA 2FB8A 4AW0A 3EQRA 4BWKA 4GEOA 2C0IA 4D55A 4Q2AA 1YHWA 1O6LA 4BCHA 1ZAOA 3KEXA 5B2LA 4AF3A 3ZEWA 3HA6A 3A7HA 2ERKA 5HESA 2WTKC 5C1QB 3R9DA 1YWRA 3BYUA 3LXKA 4IBMA 2YDJA 4G3CA 3T8OA 1J3HA 4I41A 3RPSA 5EYDA 4H05A 3N51A 5JT2A 3KXZA 4XH6A 3Q5IA 3RPRA 5LARA 2XCHA 5D1JA 4BTJA 4YP8A 4MCVA 3W2RA 1XHAA 2JDRA 4M68A 3MW1A 3ANQA 4UZDA 2XNBA 5I9ZA 3FZSA 3IW4A 3I7BA 4P2KA 3GU6A 2ETMA 5JH6A 3DK7A 2ZV8A 1OMWA 4FTKA 4LGHA 2VTTA 3TL8A 3QCXA 4BHNA 2G15A 4FZ6A 5CANA 1Q8WA 4ZSAA 2VTMA 3QX4A 4ORKA 2BKZA 3C0IA 2XK9A 3U9CA 2QR8A 4HYHA 3QD0A 3UVQA 3CPBA 2Z8CA 3Q4UA 3QWJA 5KMJA 5AA8A 1PRYA 4HPTE 5J7HA 4EJ7A 2WFYA 4C7TA 1J1BA 3Q9XA 4APPA 5FEDA 4LMUA 4P90A 4F70A 4IJ9A 3EZRA 4D4SA 5IUHA 2G2IA 3LCDA 2C6IA 3EKKA 3HKOA 3A60A 3H4JA 4XNEA 3VBTA 4BB4A 2J0LA 3GC0A 3MESA 4AW2A 4KKEA 2ZDUA 3F7WA 4S30A 3TN8A 4GYIA 3UVRA 3QQJA 3EN7A 1JPAA 5AFVA 4J53A 4ACHA 4O7ZA 1BUHA 4XOYA 5AP7A 2XNMA 4DEAA 2YIYA 4N6YA 2PMNX 4JOAA 4MBLA 3RAWA 5FTGA 3R28A 2XYUA 4DEBA 5C8NA 2VRXA 3LQ3A 2FUMA 4MXZA 4D2VA 4X6RA 3SA0A 2C1BA 3KL8A 4GIIA 1ATPE 1E1VA 3MPTA 2DUVA 2RSVA 2JKKA 3VUMA 5DT0A 2HZ4A 1YHVA 3C13A 4TRLA 1PXMA 4JL9A 3GU4A 4AP7A 4PMMA 4YLJA 4PMPA 3R71A 3EZVA 3QQKA 3V3VA 3NNWA 4FZFB 3R8VA 4XG9A 2ACXA 4RVKA 3R8LA 4U42A 1W8CA 1A9UA 2UZWE 4X2JA 1XJDA 3FJQE 5ANKA 3ZHPC 4O7LA 3BX5A 4DH8A 5JEBA 4XG4A 5E91A 2VZ6A 5FBNC 2ZM4A 1FQ1B 4R77A 3IO7A 3IOPA 1J7IA 2IJMA 3KKVA 2WMQA 2BROA 4PRJA 5CQUA 4FTLA 3DS6A 5GNKA 4XV9A 3UG2A 3CKWA 5EW9A 5E8YA 4ZTNA 4F7SA 4NTSA 3MVLA 3NR9A 3DTWA 4CFMA 4JVGA 1BYGA 2QLUA 1PXJA 2BAQA 3DNDA 3VS3A 5GZ9A 3S4QA 1DI8A 4ANSA 5IH4A 5CQWA 2XBJA 2ZB1A 1Q4LA 1QPDA 2R3QA 3PXYA 4IDVA 4EH7A 3UE4A 4YUQA 4BBFA 4WBOA 2PUUA 3VUDA 2PUNA 4E1ZA 3FMHA 5DR9A 3SQQA 4F63A 3A61A 3E7VA 3ZUUA 2UZVA 1BMKA 4D2WA 4UMUA 1FVVA 3WZEA 3AGMA 2UW9A 2FSTX 3WBLA 5D11A 2PVFA 4ENXA 2EU9A 4K8AA 4EI4A 4P5QA 3JR1A 1JVPP 1PJKA 3R8UA 2ZM1A 1PMNA 3HGKA 3ZZEA 3JY9A 4EL9A 3KRWA 4CCUA 4CYJA 1KE6A 4RIOA 4C4GA 1Q5KA 2XP2A 4KRDA 4AOTA 1ZZ2A 4D1XA 5HX8A 5M55A 2B1PA 4YR8A 5HEZA 4ANOA 4APCA 3ZU7A 3F3UA 1VZOA 4HGTA 3R8MA 4FL3A 4JG8A 3I60A 2PZPA 4W4YA 2YAKA 4D2PA 4F64A 3PVGA 4XJ0A 5HG5A 2PZRA 5K9IA 1IG1A 4C2WA 4QNYA 1WBNA 3R9RA 4XG3A 3GCUA 4FSNA 1TQMA 5L2SA 5FUTA 3QHWA 4EOIA 4AFEA 4PPCA 5I4NA 4QMWA 4XV2A 3FYKX 5HIDA 2B4SB 5D7AA 4G5PA 5M06A 3Q6UA 3PE2A 3D14A 4YJSA 3PIZA 4GMYA 4S34A 4M3QA 4DF3A 2F4JA 4AU8A 5KKRB 2BFYA 2BZHB 2Z7QA 5HCZA 3C4ZA 2W4KA 4MWIA 2YCQA 3LXLA 5JRSA 1V0PA 2QOLA 2W06A 3ORMA 5CU4A 4D1SA 2PUPA 4I5MA 3MFSA 4RLKA 3UNKA 3PG1A 2XA4A 4F1MA 1REJA 3R22A 4RC4A 5FXSA 5CF8A 3TUBA 1Z5MA 4UB7A 2XF0A 3OUKA 2IVSA 3QZFA 3QD2B 4IVDA 4FSTA 2OJIA 3FMMA 3W16A 1KE7A 1ZYCA 4FSQA 2B7AA 3RPYA 4FKRA 2WGJA 5FWKK 3W2SA 3TTIA 5J9ZA 3H9RA 1X8BA 4OTDA 3QLFA 2PVMA 3DTCA 3PWYA 2E9OA 1EH4A 1SM2A 3EWHA 2O65A 4JBQA 4OTGA 4PTCA 3R7UA 4GUEA 4JDJA 4GFOA 3ORKA 1S9JA 2J9MA 1PW2A 1OUKA 2QU6A 4TYEA 4GIHA 3Q96A 2ITZA 4EJNA 3SVVA 3N4TA 5C8KA 3DU8A 4KSPA 4OT6A 4I92A 4U43A 4BBEA 3ZRMA 4DH1A 3FZTA 4FNWA 1S9IA 5EH0A 3ZYAA 4DN5A 2G9XA 3EL7A 5EW3A 5KBRA 2BRMA 3ZRLA 2Z7LA 4BDDA 4RA5A 3UODA 2ZJWA 4YJNA 2HY0A 5AR2A 3RAIA 5F1ZA 4OTQA 5BNJA 2PUIA 5LVNA 3U6JA 2UZEA 4CT1A 3PRFA 5IQFA 4UMPA 4EBVA 4V0GB 4AFJA 4V0GA 3TKUA 3SAYA 3U6HA 1RW8A 2UW7A 3MY0A 4QMYA 4OTIA 2R3HA 4FK3A 4QP9A 4BTKA 4NK9A 4FYNA 3OT3A 4FSUA 4B4LA 3ORIA 3OFMA 4FKGA 2WD1A 2WOTA 1NVSA 2GS7A 4RMZA 2IWIA 3AOXA 4Y95A 4X0MA 4B9DA 3PP1A 2IW6A 5HLPA 3TZ7A 3UVPA 2W7XA 4BDKA 2W1CA 2R3MA 3UIMA 4TXCA 2RFSA 3EQCA 3NUAA 3EB0A 4O6LA 3FZOA 4FICA 3VRZA 4AQCA 4J71A 4RLLA 1P4OA 1KUTA 1RE8A 3O50A 3PJCA 4ZSJA 4ZTSA 5HE0A 3W2PA 3CCNA 3JYAA 3LFCA 4IFGA 5CXZA 4D2SA 2XUUA 3PXFA 5E8VA 4ZTMA 3OEFX 3CY3A 4FIIA 5F20A 3BRBA 3CTHA 3HEGA 4XUFA 2X6DA 3QTZA 3P7CA 3W32A 3WF8A 5HNIX 3VRYA 4LGDA 2ZOQA 5TE0A 2XK4A 1QL6A 2Z02A 2C6LA 2QKRA 5DR6A 4GJ3A 1YWNA 1UVRA 4QP8A 4LGGA 3JS2A 4II5A 5ANEA 1UA2A 2UV2A 1KOAA 5FM3A 2PVJA 3D4QA 4Y46A 4O1PA 4G6LA 4KBCA 4F65A 3GFEA 5JFVA 2YZAA 2PE1A 4RJ6A 2G2HA 5H3QA 2CDZA 4AA0A 3OVVA 5CWZA 4JT3A 2A1AB 1OPLA 2H34A 1ZZLA 4RT7A 3DDQA 3SXSA 5AMNA 4DFNA 3P7AA 4U8ZA 1CMKE 2WMAA 2YDKA 5HTIA 1NVRA 2YHVA 4FSMA 1GIHA 5I9VA 4DFLA 2R3RA 2XNPA 2RGPA 4ITHA 3WOWA 1VYZA 2XIXA 3QWKA 4MAOA 3RMFA 3C4FA 3BZ3A 4MNFA 2OLCA 4H3BA 4L53A 4CZTA 2BTSA 5DT4A 5IISA 2C5NA 3IOKA 3RJCA 3B8RA 1JAMA 1WBSA 3W33A 3DZOA 3NUNA 2GNFA 4UMQA 5E8UA 3LFAA 4GFGA 3MVHA 3TCPA 4O22A 4W8DA 3PA4A 1R39A 3UJGA 3QUPA 2C4GA 2YWPA 4NEUA 4FVPA 3R1QA 3MPMA 4PTEA 3SV0A 1OM1A 3BE2A 2IO6A 5D12A 4ANNA 4AXAA 4AGCA 4O91A 1OL1A 2CHLA 3HMMA 5FTOA 4AAAA 3VS5A 4J95A 4EH6A 3PVBA 5IA4A 3NAXA 3F3TA 3Q9YA 4IADA 5IMEA 5AUUA 4LMNA 3N4VA 2R3FA 3IGGA 3Q53A 2C3KA 1SVHA 4L43A 5IA0A 2C5VA 3D15A 3VW6A 5HIEA 5E90A 4FKTA 4D2RA 4TTHB 4I20A 3WIGA 3M1SA 3TNQB 4HCUA 2OI4X 4MHAA 2BIYA 4MTAA 2ERZE 3VS4A 4AOIA 4FEWA 3UZRA 2X7OA 3FXXA 4IWQA 5LJJA 3TDWA 5J1VA 5A46A 4FIGA 4U3YA 3P78A 4ZSEA 4LL0A 5BVDA 2PWLA 4O21A 3NCGA 4QMUA 1PXLA 3O71A 4J97A 3QTUA 5AX3A 4QTEA 1A06A 3LJ2A 2W99B 1U4DA 5AUWA 4EC9A 3QKKA 4DFXE 4GJ2A 3UYSA 4S2ZA 1YHSA 2PE2A 4CMOA 5FP5A 3CQEA 3PVWA 3P23A 1HCLA 4L6QA 5E1SA 5A4QA 2QG5A 4BWXA 3FC2A 2JLDA 3O8PA 2QOHA 5CNNA 4ALWA 2WXVA 4DLIA 5A14A 5F94A 2XB7A 2OXXA 3TKHA 5BVFA 4FT7A 4FTUA 3SOCA 1W98A 3FI4A 4I5PA 3UNZA 4EH5A 3PZHA 5CAVA 4FGRA 3COKA 1ND4A 4ZJIA 5C4LA 1CDKA 4XG2A 3GEQA 3C4CA 4GYGA 4WNOA 3HMIA 5I9YA 3V51A 4FV8A 2JGZA 4JQ8A 4NIFB 4OW8A 2WMVA 4NIFA 1LPUA 1UWJA 5AIKA 4C4JA 3V5WA 2EVAA 2R2PA 4S32A 5AJQA 5IZFA 5KBQA 2ZVAA 5EI2A 4AUAA 2YITA 5LCKA 2A27A 4KIQA 1WZYA 3AMYA 1L8TA 3R1YA 2V7AA 4O38A 3CJGA 3RNIA 3PPKA 3TT0A 2QOOA 2ZYBA 4NM3A 1OL6A 4KIPA 1PMVA 3CD8A 3C5IA 2RIOA 5M4FA 3PIXA 3F5UA 3TZMA 3VULA 4EH4A 3RZFA 2CJMA 3C4WA 5KMLA 1H08A 2XNEA 3HP2A 3DQXA 1XH4A 1ZLTA 5CXHA 5ETFA 5LVMA 2QONA 3VJOA 5DA3A 4BC6A 2WKMA 3CGFA 5G1XA 4FOCA 4XRLA 4CRLA 5K3YA 1YXVA 4CLJA 3F88A 2PL0A 3PJ3A 3V5LA 4A4LA 2PSQA 4OLIA 4EC8A 1UU9A 3Q5ZA 4TKSA 5D7VA 2B55A 4HYUA 2CLXA 4EQCA 3A2CA 1E1XA 3AC3A 4WRSA 5CVGA 2VWZA 2I0YA 3GNIB 1LUFA 2XKFA 4QD6A 3E8NA 3P79A 1J1CA 2CKPA 3HA8A 2XNGA 4XHKB 5GZ8A 2BALA 2CLQA 4FV9A 2BMCA 3OTVA 4E7WA 1P14A 5HVJA 2VTQA 2VTPA 4L46A 5IF1A 5J5SA 3O0GA 3BWJA 2YZLA 3IDPA 2W17A 3FDNA 4BL1A 4H3QA 2WTKB 3N9XA 4GVAA 3KXNA 3I5NA 4O0RA 2Z2WA 4RJ7A 4C57A 2E9VA 4WOVA 5EHOA 3SRVB 3SRVA 5L8KA 2YABA 5ANIA 3KN6A 4GS6A 1DI9A 4GT4A 4A4XA 2B52A 3UMXA 2WOUA 2HXLA 1RJBA 3NYXA 4KB8A 2BAKA 5BUJA 4AA5A 3ZMMA 5AR8A 4MQ2A 3S2PA 1XWSA 4BYIA 2XKCA 3E7OA 1XO2B 4FTQA 2OH0E 5CVFA 4E93A 3HV6A 5E1EA 4KINA 1XQZA 1ERKA 2P4IA 5GJDA 4CVAA 4MF1A 5HLNA 3LFBA 4UXLA 5LMKC 4QQCA 2QC6A 2DQ7X 2OKRA 4PDOA 2NP8A 2OU7A 4DT8A 4EONA 4PNKA 3ZDIA 3MA6A 3HRFA 2BHHA 3Q4CA 4ZJVA 1OKYA 4FTTA 2I40A 2PMOX 3E3PA 4FV2A 3E8EA 3V04A 2WTCA 3DAJA 3MFUA 1HOWA 4GK3A 1IR3A 1WBPA 1GZ8A 4Y8DA 5CS6A 4JS8A 5FG8A 2QOKA 2RG6A 3EJ1A 4FTJA 3ZTXA 3NEWA 2ETRA 3VUTA 4PF4A 4E20A 3BBWA 2R3JA 2XIRA 3RHXA 1GNGA 3OW4A 1R1WA 4YNOA 4W9XA 1PXPA 2H6DA 5CU2A 5HU9A 4OTHA 4I5CA 2FSOX 4EH2A 2VTOA 4LI5A 4EOJA 3GQLA 2GNHA 1QPJA 2BR1A 3WF7A 4HVGA 5ITAA 4K33A 1JKTA 3OCSA 3P08A 4BDJA 4RIXB 4ACCA 4RIXA 3SD0A 3H9OA 2WQNA 4FV7A 3ENMA 4FC0A 5BVNA 5BVEA 4AT4A 2ITNA 5FTQA 2JIVA 5AAGA 4DTBA 3C5UA 4FTNA 3UOKA 1OB3A 3K54A 2UZBA 2R7BA 4TWCA 4U45A 4U3ZA 4RVMA 3FI8A 4HCTA 5CENA 3ZFXA 3OROA 2RF9A 1OVEA 4J8NA 3FQSA 5TF9A 3V6RA 2YCRA 3DT1A 4YJOA 1GZOA 3C9WA 4WRGA 1Q8YA 5I9UA 4ZZMA 2PPQA 1TVOA 2H9VA 1Q3DA 5B7VA 1UWHA 2C69A 5CSXA 4W4WA 1NY3A 4C3PA 2BRBA 1W7HA 3MB6A 3TM0A 3LZBA 4NM0A 4EOLA 2AC5A 2VTNA 4D5KA 3EFLA 4IM0A 3BEAA 3QRTA 1IA9A 3DPKA 3BYSA 2BZJA 4IZ7A 1H4LA 2V62A 4TNDA 3SOAA 4QYFA 3CD3A 4YJPA 3LJ0A 2JKQA 3D9VA 3HRBA 1ZY5A 3ORTA 4L8MA 5HX6A 1OGUA 3G90X 1CTPE 5AP1A 5EK7A 4G9RA 3RPVA 4CQGA 4CYIA 3UZTA 2P55A 4ZSLA 5DOSA 5HCYA 4ZP5A 4YJTA 3UOLA 4EZ3A 5L8LA 4PY1A 5EOBA 5CI7A 4QTDA 4C34A 1ZYJA 4FTOA 4P5ZA 4GH2A 3C0HA 3WZDA 4D5HA 3U4UA 4IM2A 4O0UA 2XK3A 4LRJA 4RVLA 5CF4A 3QTRA 3LCTA 3IW5A 3SW4A 3CEKA 2X7GA 4KIKA 4KIKB 4WUAA 5DVRA 4EH9A 2VO6A 3BPRA 2X81A 5DG5A 4BKYA 5LXMA 3LIJA 3MA3A 3WZKA 4A06A 3QA8A 3R00A 3B2WA 5DIAA 1ZY4A 5C26A 2JITA 2OFUA 3RK7A 4QMZA 5BUIA 4I5HA 3O8TA 2AC3A 3FYJX 3HZTA 3LCOA 1BI8A 2R5TA 1UNGA 2F7XE 3OCBA 3LW0A 4XX9A 4UEUA 3R9NA 3PPZA 5M56A 4IJPA 3RKBA 2C6OA 2R0IA 3L9NA 3BCEA 3V01A 4D1ZA 2VN9A 4EYJA 3NMUF 4ZK5A 2X0GA 1BL6A 3TZ9A 4BCPA 5J5TA 5CU6A 3KCFA 4BCOA 2WZJA 1YOMA 2J51A 3G6HA 4YTCA 2PMLX 4M12A 2AYPA 3MDYA 4MBIA 3NW6A 3NYNA 4GK2A 4ANLA 4Z55A 5T68A 3MBLA 3RM7A 5HNGA 3QD4A 1H24A 1URWA 3ERKA 5FQDC 2XS0A 3U9NA 2PZ5A 3G33A 3OMVA 3Q32A 3FMLA 4J8MA 2B54A 4V01A 5HOAA 3RI1A 2V0DA 5BVKA 2OJGA 4FZAB 5I9XA 4X21A 1G8SA 4FT5A 2Y4PA 4IX5A 3P1AA 3QX2A 3ULZA 4MQ1A 5B2MA 5HD4A 5IDNA 1O6KA 3VO3A 3C50A 3OOGA 3VS2A 1KE5A 3FPQA 1ZRZA 2ZMCA 3RTPA 3VBYA 2HIWA 2V22A 4IANA 2O2UA 3FC1X 4B6LA 1WCCA 2QOQA 4LQMA 1JKKA 3ROYA 2YCSA 3EQIA 3A7GA 4PWNA 1KV1A 5IQDA 5CEOA 3GB2A 1PY5A 4FKIA 4ZZOA 4ZY4A 4USEA 5HO7A 3FY0A 3R7OA 5DGZA 5L2TA 4FIFA 3R9HA 4ZXTA 3BGQA 3NIEA 4C36A 1STCE 3QTIA 1K3AA 3QUDA 4QYHA 5JFSA 3ANRA 4E4NA 1NXKA 1VYWA 4GG5A 2J5EA 2VNWA 5I3RA 5I0BA 1AGWA 2R3PA 3IK3A 3ALNA 2HXQA 3KA0A 2BAJA 5AR3A 3AMBA 3OCTA 4XP0A 4GKIA 3MFRA 1OITA 2HW7A 4OBPA 1RDQE 3PWDA 4PP9A 1HCKA 3ATSA 3IDCA 4HYSA 4MXAA 3KMUA 3A4PA 4MH7A 3TNHA 4DA5A 1FVRA 4RFMA 2G01A 3CIKA 5HNBA 3F5XA 1OKZA 4IAAA 3OY1A 4BCNA 5HE1A 5DEWA 3NNXA 5JGDA 1AD5A 3NDMA 2X6EA 2W1GA 4BGGA 2HOGA 1K9AA 2XK7A 4RQKA 3WYYA 2W0JA 2QO7A 4KD1A 5H2UA 1WBVA 1WBOA 1DM2A 4CEGA 1H27A 3KCKA 3ORXA 1J91A 4YZMA 4C8BA 4EOPA 3PLAE 4NKAA 5IA2A 2EB2A 5GJGA 3COHA 5I5ZA 3QTSA 1DAYA 4G31A 4PTGA 2XIZA 3WI6A 4EH8A 3DXQA 4Z9LA 3VUGA 3PUPA 2EB3A 2WEIA 4DH3A 3GC7A 3PY1A 4G5JA 4QTBA 5E8SA 2OXYA 4O0XA 1YVJA 3IS5A 4RVTA 4IXPA 4YZNA 1OL7A 1U46A 1G5SA 4UWCA 4DINA 2C3JA 4C4EA 3ATTA 3ET7A 2VX3A 3UC3A 4ASZA 2XM8A 3WYXA 1BLXA 3QC4A 4QTAA 3NUUA 3UOHA 4RWKA 5K5NA 3L9PA 4AN2A 4L52A 5K4JA 4BN1A 2WIHA 4FNXA 2JBPA 3UO5A 1IASA 3LFEA 2RFEA 5AM7A 4BDBA 4IAIA 3ODZX 3A7IA 4RZVA 2XK6A 4I6FA 4IB3A 4KS7A 5DHJA 4QPSA 2Y8OA 4C58A 2F49A 1FPUA 4OR5A 4DGNA 1SVEA 3S1HA 2J6MA 2WQOA 4GRBA 4IM3A 4F9BA 5GHVA 1F5QA 4LRKA 2NNWB 3OWLA 1WBTA 4CGAA 2UZLA 1IAJA 3HV5A 2R3NA 2GPHA 3PLSA 4JBVA 4E6AA 3WILA 3DKGA 3TUDA 2A19B 1PMEA 4KIOA 3U4WA 1URCA 3NUSA 4EKLA 3SHEA 3HX4A 3QYZA 3TIYA 5CEQA 2YCFA 3SKCA 1YQJA 4WSYA 5AUTA 4AZVA 3L8VA 5M07A 4GL9A 4BCMA 2GQRA 4FTCA 4QP7A 1PKGA 5J9LA 2ONLC 3L9MA 4CSVA 2WEVA 2I0VA 3ZS5A 4KKHA 3DFCB 3TACA 3AC5A 3QRKA 5AM6A 3TV7A 4E5AX 4EUUA 1OBGA 5KHXA 3R0TA 1FGIA 3RVGA 2PHKA 3C4XA 3NNUA 5KCVA 2KULA 5ACBC 2UZDA 4QQ5A 2VWIA 3KVXA 4IHPA 4OTFA 1UKIA 2X4FA 5ANJA 2QHMA 3TXOA 1U5RA 2C3LA 5BMMA 3RWPA 3ZC5A 3ZZWA 4YZCA 3O7LB 1U59A 3R63A 4PDPA 3E64A 5AP2A 4GV1A 3TKIA 4IDTA 5EYKA 1XH6A 4MYGA 3ROCA 2YN8A 3Q2JA 3ZCLA 2P0CA 2GNLA 4FTIA 4R3PA 4BZNA 4DE4A 4U0IA 5AUVA 4FIEA 4FEVA 1M52A 3MWUA 2BILB 1B38A 2ITXA 3LXNA 5BYZA 4F9YA 5A6NA 4JQ7A 4C4IA 4BIEA 3VAPA 3OF0A 2DWBA 2QG7A 3QLGA 2YM5A 4YTHA 4CZUA 4W4XA 4GW8A 3O96A 4IMYA 2UZUE 4LFIA 4BCIA 2YISA 1XH5A 2W1DA 4FOBA 4FV1A 4EQUA 2O0UA 4HYIA 2FYSA 1WVYA 4A4OA 5JQ5A 2ZB0A 5JGBA 1YXXA 2H8HA 5HBEA 3ZO3A 3U87A 2UW6A 3QQLA 3DBDA 2CGUA 5JRQA 3IW6A 1WAKA 4G9CA 4O82A 1JKLA 2R7IA 4BKZA 5EM8A 4R7IA 3LVPA 4IX3A 1ZYSA 1OIRA 2WMRA 3KU2A 3L9LA 3F2AA 4JQEA 4LRMA 4ZTHA 1MUOA 3Q60A 5IQGA 3FHIA 2OH4A 2GDOA 5B2KA 1PXKA 4YZBA 2WMSA 2OZAB 3QQHA 1UKHA 2OZAA 2C68A 5JKGA 3NYOA 3P86A 5LQFA 2GTMA 3H3CA 3AC4A 3F5PA 3MVMA 4EK4A 3M42A 3VWAA 5CSVA 3ZLSA 1KSWA 2WMTA 2F2UA 4C59A 4QP6A 5EM7A 4UWYA 3E8CA 3RGFA 2X4ZA 2B9JA 2C6KA 5TKDA 3DXPA 3PDTA 3CS9A 2R64A 3IG7A 3NUYA 4QMTA 4CZYB 3NVKI 3UC4A 3MH3A 4AS0A 5CEIA 1BI7A 2JAMA 1ZARA 3OT8A 4RZWA 1MQBA 3MTLA 1OUYA 3RCDA 4X2NA 4QMLA 4X3FC 4QTCA 5J8IA 5ACKA 4CRSA 1V1KA 5J7BA 3F66A 3ETAA 3DDPA 4C3FA 4TWNA 5AR5A 5JK3A 1WBWA 1JSTA 2YM4A 2CSNA 2HK5A 3POZA 4N70A 3OTUA 4U80A 4U44A 4RX5A 5GZAA 5IEVA 4CXAA 3CPCA 1O9UA 4M15A 3FHRA 3L8SA 3ZUTA 4EHVA 4ITJA 4AZTA 5A4EA 5E9EA 4HVDA 4RJ4A 1IAHA 1R3CA 5ANOA 3ZDUA 4PL4A 3H30A 3BLHA 2XCKA 5DI1A 4CFFA 5A4LA 5JSMA 3G2FA 3DLSA 3QC9A 3BU3A 5E4HA 4O0VA 3KULB 3KULA 3GT8A 4IB5A 2BZKB 1JKSA 3ZLXA 1YI3A 5CALA 4JJRA 3Q4ZA 3IGOA 4IAZA 3LMHA 4IIRA 3C0GA 5FRIA 2BCJA 2OWBA 3Q04A 4X6QC 4ARKA 2PU8A 4CTCA 4DAWA 3RCJA 3FLWA 1KE9A 1A48A 3RZBA 2YM3A 5JFXA 3VIDA 4P7EA 3HYHA 3RALA 1FMOE 2VO3A 3DK3A 5L4QA 4PP7A 3QTWA 2YJSA 2YM7A 4ACDA 4EK3A 2HENA 4KS8A 4DEHA 4A07A 5LMKA 3H0ZA 4KKGA 4NFMA 4GG7A 1XBBA 3DCVA 4QYYA 2PVLA 4N6ZA 4F9CA 4JDIA 1LEZA 3MIAA 2BKKA 4JR3A 5AV0A 5BUEA 2XH5A 3FLNC 4HGLA 5BMSA 4YHFA 2XKDA 4I22A 5FXQA 2JDSA 4RG0A 3GCPA 4CT2A 5M4IA 3MV5A 4WBBB 5HVKA 3ELJA 3JVSA 2OGVA 1GIIA 3LHJA 4U5JA 3KMWA 5LWMA 5HBHA 2HW6A 2UZOA 4CV9A 3FBVA 1ZYDA 4FEQA 2XK8A 3D0EA 3HECA 4L67A 4XLIA 2IZUA 2UVZA 4A9TA 2J0KA 1R78A 3V5JA 3ZBFA 4ANBA 2C6DA 2HY81 3G0FA 5KE0A 4DTKA 3NNVA 3BELA 4XP3A 5CY3A 4C33A 3MSSA 3WZJA 3K5VA 2HZNA 3TNIA 2OXDA 3KMMA 5TR6A 4YJQA 3AC1A 4O0TA 4JBPA 4ENYA 2WQMA 4IX4A 1G3NA 4FKPA 4I94A 4I4EA 3AD5A 5HZNA 4FE2A 4FV6A 2ZM3A 4O27B 3UIUA 2IVTA 3A7FA 2IVVA 5CF6A 2VWWA 1XBCA 4FL1A 4FKJA 5HIBA 3VNTA 1H8FA 3PXZA 4ZTRA 2VWYA 3JVRA 4HVIA 5IQHA 5F95A 4E5BA 3ZH8A 4LV8A 2VV9A 2CCHA 4E6QA 3KVWA 3OXIA 1M7NA 2RL5A 4RIWB 4RIWA 3W8QA 3LQ8A 5IQAA 4F99A 3OXZA 4AE6A 2V5QA 4ZEGA 3DZQA 2VTAA 5HE3A 1R0PA 3U51A 4KWPA 3EHAA 2GHGA 5AUZA 4CLIA 3VBXA 5AADA 4FKOA 4ZOGA 4DH5A 2BRGA 2ZV7A 2YIRA 3PJ1A 4W8EA 3PSDA 2NO3A 3DB8A 3R1NA 1Q8TA 1L3RE 2P33A 4EHGA 3WARA 4ERKA 3GC9A 1WVWA 5BVOA 4AX8A 1J7UA 3RP9A 5AV3A 3CP9A 5F4NA 2F7EE 4IQ6A 4R7HA 3POOA 5AV2A 3CC6A 3CTQA 3PTGA 4JI9A 4L45A 3VN9A 4BI2A 3EFWA 2ITVA 4M84A 2QNJA 2BDWA 2EUFB 3DK6A 4IWPA 4O7SA 2UW8A 4QMSA 1MRYA 5HO6A 4MBJA 3AG9A 3Q6WA 2E9UA 4L9IA 5ANGA 2W1HA 2QD9A 3LJ1A 4DEEA 3MVJA 4FV3A 4F0GA 2G2FA 4DGOA 4OBQA 4BDFA 3U8WA 4NU1A 1Z57A 1M2PA 3UGCA 3TIZA 4F6WA 1JOWB 1T45A 2JAVA 3R6XA 4QMNA 5K4IA 4FYOA 3EFKA 4FZDB 5IUIA 2ZAZA 2ZMDA 4O0WA 1H28A 4ZSGA 3U6IA 4FSWA 4J96A 3TNPC 3VF9A 4YBKA 2ZV2A 4TN6A 3PVUA 1YXSA 3JXWA 4WO5A 1I44A 4U7ZA 4DG0E 4RJ3A 3ZLWA 4NCTC 3K2LA 4BICA 2XNOA 1FGKA 4LG4A 4F7JA 4FV4A 4OTWA 4MD8E 2X2MA 4BYJA 2A4LA 3BU5A 3FMDA 2CGWA 3L8PA 3QKMA 2X8IA 4NH1A 1UU7A 4IW0A 2QI8A 5CSPA 3VF8A 4MVFA 5H9BA 4PDYA 2JC6A 2OG8A 4E8AA 1OECA 2CGVA 2I1MA 3PY3A 3TDVA 4FF8A 3KF7A 3NYVA 3IDBA 4IE9A 1OIUA 5JFWA 3Q9ZA 4WT6A 2JBOA 1GOLA 4X7QA 4C0TA 4WKQA 3OS3A 4TL0A 1YW2A 3NAYA 3DBCA 4QQTA 3SXRA 1YDSE 1B6CB 3P7BA 1JSVA 4J7BA 4Y72A 3RWQA 1R0EA 3TG1A 3EH9A 4C62A 4D58A 3F2RA 4U9AA 2OF4A 5LVPA 5EDQA 2Q83A 3BHHA 3OHTA 3ZOSA 3EOCA 2XJ2A 4TW9A 3IW7A 5CAQA 3ZO1A 3HUCA 2VUWA 4WNPA 2UW0A 4FKSA 1GAGA 1YRPA 1QPCA 4WIHA 2Y4IC 5CI6A 4F4PA 2G1TA 4NW6A 3EIDA 1V0BA 3R7GA 1CKPA 4YZ9A 5T3QA 4V04A 1Q61A 4YHTA 1GZKA 5EW8A 4Q5EA 4ALUA 4AW1A 1UNHA 2F7ZE 3LMGA 4DG2E 5DYJA 4MXOA 3CR0A 5EKNA 4BCFA 3A99A 4O86A 2PMIA 5GIOE 2C6EA 4EZ5A 1RQQA 2IW8A 4FV0A 4A9SA 5E8ZA 2GNIA 3NW5A 3NUPA 4EYMA 4O83A 4ZTQA 4AWIA 3GCSA 4IAYA 3TJDA 3VS7A 2FO0A 1H1PA 1KV2A 4L01A 3HVCA 4XV3A 4EOKA 4UN0C 3JPVA 3AC2A 4Y5QA 4FSYA 2WNTA 3LM5A 2YACA 5E92A 5L6PA 5L6OA 4RC2A 4FT3A 3NUXA 4O7TA 2XNNA 3UTOA 4QP4A 5L2IA 4EHZA 2C5OA 2WB8A 4RQVA 3RK9A 4FT0A 4PDSA 3OC1A 4MF0A 3EKNA 3FMJA 3ZONA 4TY1A 3E3BX 4XP2A 4E4LA 4MWHA 3LFDA 3TJCA 4O84A 4O81A 4FEUA 3HMPA 4CD0A 5HE2A 2W05A 4J52A 1PYXA 3E5AA 3R02A 4O7RA 2W96B 4DEIA 4I6HA 3P4KA 2GQSA 4DH7A 4QMOA 1PYEA 5L8JA 5BPYA 5EQEA 4TWPA 2JIUA 2HZIA 2IZTA 4GT3A 2X7FA 4AA4A 4DCEA 4WNMA 5EDRA 4EK8A 2R3IA 3ODYX 5AEPA 2A2AA 4Z16A 4AN9A 2X2LA 4FUXA 4QQJA 3GU8A 2OICA 4FKLA 3O51A 3G5DA 4QP1A 4E6CA 4FNYA 4FODA 2W1FA 2YAAA 4DHFA 4TZRA 4R6VA 1XBAA 4XLVA 5KMIA 2NRYA 3FZ1A 1OIQA 3UQCA 3E8DA 2PYWA 1Y6AA 4ZTLA 3DKFA 1Q3WA 2YIXA 3DQWA 3DV3A 4CFNA 5L3AA 4M7IA 4G2FA 2UW5A 2BDFA 3AD6A 4LOOA 3AGLA 5HGIA 3R7VA 2R3GA 3SW7A 4LL5A 3FZPA 5CLPA 5J1WA 1OI9A 2WO6A 2VWUA 1ZWSA 1BX6A 5TT7A 4D9UA 2CCIA 4D2TA 2ITYA 1AQ1A 4I4FA 1JLUE 4MD9E 5DE2A 4NM5A 1H0WA 2GCDA 3E93A 1OPJA 4X2FA 1W84A 2OIQA 4TPTA 2J7TA 4NM7A 3EQHA 4NL0A 3MY1A 4X3JA 2YLEA 3GCQA 3NX8A 4TT7A 3HP5A 4XG8A 3QFVA 3FMEA 1H07A 3RM6A 3NRMA 3QAME 3AMAA 4CNHA 2OF2A 2ONLA 4ZLZA 4CMUA 4LOQA 5IH5A 3W1FA 3FI2A 3GGFA 4Y85A 3EMGA 4JAIA 4ITIA 1MP8A 4JG6A 2BHEA 4GUBA 2OO8X 4W9WA 4DFBA 2QODA 1IA8A 4UXQA 4PUZA 4KSQA 4PMSA 5BYYA 2PK9A 4G16A 4G1WA 5EM6A 3PJ8A 3UQGA 2J0MB 2PVYA 2IZRA 2JKMA 2YIQA 3A8XA 3QD3A 5A9UA 2QVSE 2VTRA 3FQEA 2PZIA 5K5XA 2KTYA 1OIYA 2B0QA 1OKWA 3G9LX 4FSZA 5TO8A 5HI2A 4OGRA 5D10A 5ANDA 4I0RA 4F1OA 4MXCA 4FSRA 4BF2A 3I1AA 5DT3A 4O96A 3CE3A 4OTPA 3LE6A 5CYIA 5JZJA 1OBDA 4GK4A 2UZNA 3QGYA 3DA6A 3T9TA 2PVRA 3F2NA 3VW8A 3UIXA 3R83A 2P3GX 4JAJA 4USDA 1ZXEA 2JDTA 3HDNA 4C3RA 1OL2A 3I79A 4R5YA 3Q52A 2GSFA 4E73A 3ZM4A 4CKRA 2JD5A 4DFUA 2GMXA 3EN9A 4EOMA 3PY0A 3KXHA 5DMZA 3HUBA 5EQPA 3KQ7A 5AP6A 4WG4A 4KAOA 2XRUA 3NGAA 4G3FA 4F6SA 5C27A 4UWBA 5C03A 5FD2A 3BYVA 1YOLA 4YHJA 5KMMA 3COMA 3UYTA 4B0GA 3MYGA 1XH9A 3F6XA 4ZS4A 1BKXA 4IAKA 4DYMA 2GHMA 3OOMA 3MJ2A 2B9HA 5HHWA 3G51A 2QHNA 3NIZA 4L42A 1XH7A 3EQDA 4M0YA 4A9YA 5EKOA 4KUJA 4IB1A 4F0IA 3BI6A 2C0TA 3AC8A 3BQCA 5LCJA 3PFQA 1GY3A 3T3UA 1FVTA 3N4UA 4BFMA 3R73A 3R01A 3UBDA 3F61A 2IVUA 3R30A 5DH3A 4ASEA 1Q24A 4AN3A 2WTVA 3I5ZA 2XBAA 3QCYA 5L6WL 4U97A 2BIKB 3GENA 3MB7A 2SRCA 2I0HA 3KY2A 4BR3A 1H1SA 4XOZA 5EFQA 3QYWA 2UW3A 3MJ1A 3WE4A 3FXWA 4D9TA 1NT2A 3UP7A 3AQVA 3HNGA 4J1RA 2ITQA 2VWVA 3UO6A 4E6DA 3D2KA 3GXLA 4X3FB 4X3FA 4WA9A 4I93A 4UX9A 4GVJA 4WSQA 4AOJA 2XRWA 3SXFA 3KREA 4IVCA 3PJ2A 1M14A 5IQIA 5DWRA 1YOJA 3GOKA 1VEBA 4YU2A 3I4BA 2GQGA 4FIHA 3ZXZA 4HPUE 4O6EA 5JZNA 3ACKA 1ZMUA 3VQUA 3CJFA 2OJJA 4EOSA 5IEXA 3C4EA 2ITWA 5EYCA 3RINA 4FTMA 4OUCA 2R4BA 4AZSA 2VWBA 3H0YA 4MNEB 4MNEA 4CKIA 5CVHA 1OZ1A 4DG3E 3ZLYA 1ZOEA 4B8MA 3OCGA 3EL8A 4K9YA 4BZOA 4FA2A 3DGKA 2JDOA 2XYNA 3JY0A 3O17A 5E8XA 2ZDTA 4FV5A 4LUDA 3R9OA 2W1ZA 2VGOA 4MKCA 3DY7A 2GS2A 2E9PA 4YNEA 4TWOA 4H36A 1UU8A 2XZSA 2Z7SA 5HG9A 4H39A 3DKCA 4NT4A 4M67A 4BCKA 5LMBA 4JXFA 3V5TA 4BI1A 5CAPA 3KRRA 5HG8A 3ORNA 4MXXA 3WF6A 5J79A 5KMNA 5CASA 4EEVA 2RG5A 3COIA 4JDHA 4YC6A 1OKVA 2OFVA 2X39A 4G3GA 3VS0A 3DAEA 5CX9A 3W18A 2PZYA 1JNKA 1G8AA 3ITZA 4ACMA 4F9AA 5IH6A 2GNGA 4BDIA 5HO8A 4I23A 5AWMA 1KOBA 2J5FA 5AV1A 3LKMA 1PF8A 5A4CA 3F69A 5FM2A 3D5UA 2C6TA 3P5KA 1I09A 4ZJJA 4C37A 4CKJA 3AXWA 3D7TB 2JKOA 3D7TA 3QZGA 5D9HA 3RK5A 4O7WA 3D5XA 4ZY5A 3QRJA 5CEKA 5AUYA 4BVUA 5AIRA 2CNUA 4IZYA 3LM0A 4M69B 4M69A 3KK9A 4NJ3A 4PX6A 5HD7A 3PSCA 4JRVA 4PMTA 4DBXA 3DKOA 5IUGA 3NCZA 3HV4A 3R2YA 4KBAA 2W4OA 2DS1A 4K77A 3ORPA 4E26A 3QXOA 3S0OA 3QUEA 3FLYA 3HAMA 3H9FA 3V5QA 4AGWA 3V6SA 1YXUA 3CXWA 4EWHA 3LAUA 5IMXA 2JIIA 4ANQA 3T3VA 3QKLA 4DFZE 3Q3BA 3I6UA 5DFPA 3LOKA 4BDAA 5M57A 2QU5A 4FX3A 3R2BA 4GSBA 3E63A 4BGHA 3I6WA 3R7IA 4WHZA 2VTSA 3ZFYA 1KE8A 4FL2A 4BHZA 1GJOA 2BDJA 2WHBA 1PXIA 3UDBA 2Y6MA 3KC3A 3MFTA 4E3CA 4YC8A 4P4CA 5ICPA 2YDIA 5J9YA 5AAFA 1PMUA 2Q0NA 1TKIA 3W2CA 1ZMVA 2XIYA 4BRXA 5I9WA 5KX8A 2O63A 3RAHA 3D5VA 5A3XA 4BWPA 2IN6A 2Y0AA 1JSUA 3CY2A 4BKJA 3R04A 1YDRE 5KZIA 3FI3A 4D28A 1Y57A 1F0QA 3GVUA 2WTJA 3PZEA 4EUTA 2GU8A 3K5UA 3BHVA 4FVRA 4AT3A 4K11A 1OL5A 2XMYA 3ZXTA 5GIPE 2FSMX 3F7ZA 3FEGA 4QPAA 5GINE 4RX8A 3JUHA 3V5PA 5M4UA 2W5HA 4Y83A 4H3PA 4YMJA 2CKQA 4GU9A 4R1YA 4RX9A 4BDHA 5DEYA 4PL3A 2J0IA 2J0JA 4M97A 1Y8YA 4C61A 5M44A 3CLYA 4JIAA 3H10A 5BYLA 4OAVB 3ZBXA 3IONA 3QTQA 2Y6OA 4ZS0A 2NRUA 2OK1A 2Z7RA 3NZ0A 3PPJA 5EHYA 2HZ0A 5M51A 3QF9A 3TTJA 2CKEA 4BIBA 5H8GA 2QQ7A 1W83A 1JBPE 3P0MA 3UIBA 3QA0A 5CEMA 2VGPA 3BKBA 5IA1A 3AD4A 2WMBA 5ETCA 2WU7A 4WUNA 3GOPA 4NYEA 3MIYA 1WFCA 5EYMA 3V8WA 1H1QA 3ENHA 3BIZA 1VJYA 3EQBA 4R5SA 2YWVA 4QMXA 1UV5A 3BHYA 3R21A 4YJRA 4BCJA 5BVWA 3UNJA 4ZMFA 2HWOA 3OP5A 3VJNA 3DBQA 4Y73A 4YLLA 3F3WA 4S31A 4JDKA 3EN5A 4XV1A 4ACGA 1T46A 1OPKA 3LFSA 5CAUA 3UPZA 1NW1A 4FR4A 2PE0A 3FLQA 2QKWB 4G34A 1Z9XA 1H1WA 4XS2A 3M11A 3ZO4A 3ZFMA 5J95A 3MH0A 4NCTA 3HMOA 4XEYA 3A7JA 3VBQA 4CFWA 4BZDA 3PA3A 5JGAA 2PULA 4UZHA 3QL8A 4MX9A 4IH8A 5B0XA 3ZO2A 3PA5A 4CFUA 3CBLA 2BRHA 3EFJA 3FL5A 3F3VA 4IC8A 2CNQA 1SNXA 4DGLC 4K0YA 5KO1A 1ZOHA 4K1BA 3BV3A 1V0OA 4ERWA 2YERA 4IZ5A 2WTDA 4X2KA 5CU0A 2EXMA 4FNZA 3QRUA 4FT9A 4R78A 3R7YA 4PNIA 5IQCA 3KXMA 4RJ8A 2O5KA 4RPVA 5AP4A 4ZLOA 4AW5A 3F82A 3L8XA 4FMQA 3RNYA 1K2PA 2HAKA 5AAEA 4FKQA 1MQ4A 2R0UA 3TV4A 3MTFA 4JNWA 4XCUA 4EQMA 1O6YA 4JX3A 2JFMA 2C3IB 5IA5A 2CN5A 4O0YA 4N4SA 3V8SA 4D4RA 4GU6A 2Y7JA 2BUJA 2C30A 1E9HA 3KRJA 2EXEA 5AP3A 1JQHA 1Q41A 2VAGA 4WD5A 2IW9A 3UO4A 4BCQA 3UQFA 5M08A 4O2ZA 3NWWA 3WE8A 5IQEA 2UVXA 3BGPA 4AGUA 4LOPA 4UY9A 2Y4IB 3NS9A 3KFAA 4FK6A 5TOZA 4RC3A 4DC2A 4XBRA 5IKWA 4F1TA 4RJ5A 2OJ9A 2XM9A 5HTBA 3D83A 3P9JA 4QT1A 4E4XA 2ITTA 2WTIA 3ZEPA 4FEXA 3G6GA 2QOIA 4E4MA 4ANMA 4Y5HA 3REPA 4K2RA 4W4VA 3E92A 3CSVA 3DJ5A 1U54B 2R3OA 1U54A
chains in the Genus database with same CATH superfamily
3G0EA 4G3EA 2FVDA 1UU3A 3O23A 4J99A 4HJOA 3UMWA 3RBWA 4I0SA 3VVHA 3WF9A 3NVMB 3GU7A 3PSBA 3BE9A 5ETAA 3LQ5A 1XKKA 3VHEA 3FSKA 3OG7A 3QCSA 1CKJA 3I81A 3DJ7A 3OEZA 5IQBA 4FZ7A 2X2KA 5AR7A 4FVQA 2CN8A 3MN3A 4H58A 4B8LA 5LOHA 5HLWA 4QMVA 5M4CA 1XR1A 3VQHA 4G6OA 3FKOA 4U81A 4I1ZA 1TQIA 4IB0A 5DBXA 4QYEA 2A98A 1PXOA 4NW5A 4I3ZA 2E2BA 1Q62A 2OIDA 4UYAA 3BYMA 2UW4A 3E62A 4YPDA 4IAFA 4U41A 5HKMA 3OXTA 4F7NA 1APME 3TZ8A 4U79A 4EHEA 4DGMA 1FOTA 2J50A 2PVKA 4YJUA 4IC7A 2C0OA 2BFXA 4OT5A 4WNKA 2VWXA 4L3PA 4LYNA 4QYGA 5F9EA 1FINA 4HNFA 5KNJA 1M17A 4YURA 3A4OX 5CAOA 4K18A 2YFXA 4YSJA 2QLQA 3ORLA 5FBOA 4DT9A 3M2WA 3I0OA 4IVAA 4AACA 4C02A 5CT7A 2O8YA 4M13A 2ZV9A 1H01A 5CZIA 3UPXA 3FUPA 2GTNA 4D0WA 3ACJA 3QQUA 3KRXA 5AX9A 4IX6A 2X9FA 4AE9A 1Y91A 3C7QA 3TEIA 4TYIA 3MH1A 3Q4TA 3HRCA 3BLQA 3OW3A 5HORA 3QRIA 3ORZA 2UUEA 4QMQA 5C4KA 3ZSIA 4XYFA 4D4VA 5FP6A 4CG9A 2ITUA 3BBTB 4FKUA 1M2QA 1ZOGA 2UVYA 4LUEA 2OBJA 4ASXA 4DGGA 4EORA 1NVQA 2RFNA 5FXRA 1FBNA 4BDEA 2FSLX 1P5EA 2OZOA 1H0VA 3NSZA 4OTRA 4JBOA 4TNBA 5H8EA 5CF5A 2QOFA 3DJ6A 3PRIA 2C1AA 4V05A 5IA3A 5DR2A 4N57A 3UOJA 4I24A 3OBGA 4YSMA 3E87A 2LAVA 4CMTA 1SVGA 3B8QA 4FKVA 2LGCA 3KK8A 4ID7A 4O1OA 5E7RA 5EG3A 5A4TA 5C9CA 3BYOA 3QTXA 2WMUA 3D94A 3I0QA 1Q99A 1SMHA 1LP4A 2FH9A 4R8QA 3BGZA 3QZHA 2O64A 4G3DA 4JR7A 4QNAA 1DAWA 1Y8GA 2OIBA 4NTTA 4U6RA 5HCXA 4NUSA 4L00A 4PPBA 4H1JA 3SG8A 2FA2A 4LV5A 5AR4A 2CPKE 3OWPA 4IWOA 5T6KA 4RA4A 4BBMA 3SGCA 4NFNA 5EM5A 4EKKA 3NLBA 2QOBA 2WELA 1PKDA 3SLSA 1YI6A 4PQNA 4EWQA 4RWLA 4S33A 2E9NA 2HCKA 3FMNA 4D4YA 4BGQA 4F7LA 1GZNA 3HDMA 5EQYA 4DLJA 1JWHA 5LWNA 4GT5A 4QP3A 4RBLA 3F5GA 2B9IA 2VU3A 4RFYA 4QDVA 2QCSA 1W82A 3EQGA 3R7EA 3O7LD 2UZTA 4I6QA 3VC4A 3K3JA 4QP2A 3VUHA 5IU2A 2XVDA 1YDTE 4CTBA 3QCQA 3FL4A 3SC1A 4DCAA 3KXXA 1H25A 4B99A 3UZPA 4OAUC 3DAKA 5CU3A 2BRNA 1MRVA 4G17A 3FV8A 4GFMA 4YGAA 3GI3A 4UMTA 5H8BA 3LLAA 4CG8A 5LMAA 3KB7A 4EK6A 2V7OA 3MI9A 4HVSA 3GFWA 2GFSA 5C8MA 4MXYA 3PIYA 3O5AA 3IKAA 5EOLA 3ZC6A 3GC8A 2O3PA 4M66A 1XH8A 5DRDA 4GCJA 1KWPA 3ZRKA 2PVHA 3DB6A 3L1SA 4L3LA 3WF5A 4AG8A 3NW7A 3FPMA 5JMSA 5E8TA 4I6BA 3TV6A 3FLZA 4QPMA 4RX7A 4XBUA 2VO0A 4QRCA 5IPJA 4TYGA 4R7BA 5FEEA 3UP2A 1SYKA 4FBXA 4L7SA 2FGIA 3CGOA 4L44A 3TNWA 5KKRC 1DS5A 2X8DA 4RIYB 4RIYA 4WG3A 2OSCA 4FI1A 2EWAA 3IW8A 3DXNA 1CKIA 2A0CX 4RWJA 4B7TA 1YKRA 3BEGA 5CEPA 3DBFA 2XEZA 4MEDA 4PPAA 3HAVA 4K6ZA 4YO4A 3FXZA 4DFYA 5EHLA 4TYJA 4O7NA 3QQFA 3D5WA 4YJVA 4EBWA 1QCFA 1YXTA 1IRKA 2WAJA 3S00A 3LMIA 3PXRA 4FGBA 1GIJA 4FTRA 1LEWA 3KF4A 5DPVA 3VUKA 2GNJA 5IEYA 3ID6C 1P2AA 4RWIA 5IDPA 2YM6A 4QO9A 1FMKA 4DEDA 5L2QA 2F9GA 3DLZA 3OD6X 4O4BB 4PL5A 5E8WA 4BY9E 5AP0A 5LVOA 5AA9A 4HVHA 2ETKA 3DOGA 2BVAA 3BHUA 3LFNA 5FGKA 3Q2MA 3ALOA 3EN6A 3W8LA 2IPXA 3FWQA 4M0ZA 2P2IA 2DYLA 4IZAA 4BDCA 2BZIB 4C35A 3ZUVA 2C6MA 1VLRA 3OY3A 3HMNA 3CQUA 3W0SA 5KZ0A 4CQEA 2YIWA 2CGXA 1PXNA 2YM8A 4F9WA 2V55A 2CKOA 4O7VA 3U55A 1VR2A 4E5WA 1BL7A 3EQFA 3LLTA 4FG7A 3LPBA 5CNOA 5I3OA 4CFXA 4CFVA 4D0XA 4Q9ZA 4XG6A 1W0XC 1IEPA 2VTJA 4N0SA 5KMOA 3HLLA 3A8WA 4C38A 3LFQA 4JLCA 4IVBA 4A9RA 2H96A 3KGAA 2YLFA 3R8ZA 3QALE 4ZZNA 5AV4A 4YO6A 2X9EA 3CTJA 4KNBA 3ZM9A 2Y9QA 3FKLA 2OW3A 2RFDA 5C01A 3QU0A 4F6UA 2JEDA 3QXPA 4TYHB 4H1MA 4TYHA 3W2OA 2QO2A 3NPCA 2P2HA 2W1EA 2X8EA 3PXKA 4U40A 1P4FA 5KHWA 3F9NA 3R1SA 3G9NA 4YPSA 4DITA 4RFZA 3Q9WA 3FSFA 3BV2A 4QOXA 3SX9A 4AGDA 5HTCA 4QMPA 2WMWA 2QO9A 2XEYA 2VTHA 4AT5A 4JG7A 3I7CA 3BLRA 1CM8A 3FE3A 5K0KA 2QR7A 4I21A 3WIKA 4AAYA 1Q97A 2GS6A 4FG8A 4X2GA 3FMKA 2X1NA 5EI6A 2I0EA 3EQPA 4FKWA 3QGWA 4I0TA 1ZYLA 3OWJA 4IEBA 3BWFA 3C51A 5J87A 3TI1A 4CV8A 3G15A 4RSSA 2REIA 5BX0A 2X0OA 4Z7HA 4C2VA 3HV3A 3RPOA 2XKEA 3B2TA 1CSNA 4WG5A 3MH2A 4UMRA 2ITPA 4HOKA 2F2CB 5JN2A 4O0SA 3UDSA 5EDPA 2VD5A 3DFAA 3E88A 3O2MA 4UYNA 3FQHA 4YLKA 5DN3A 3II5A 2WQEA 1H26A 1UNLA 2BPMA 4Z3VA 3GP0A 4ZLYA 1PHKA 3LXPA 2HYYA 2GFCA 3FAAA 3VS6A 4DHJA 2YEXA 4L3JA 2CMWA 4GKHA 4MK0A 3ZSHA 2C47A 1M7QA 4XRJA 2VNYA 3T9IA 5A54A 3W0QA 2R3LA 4FG9A 2JDVA 2WIPA 3UG1A 3IECA 3HV7A 3MY5A 2IZSA 4F08A 4EOOA 2C5XA 5EI8A 3GQIA 5CSHA 2W5AA 4IWDA 4J98A 4JIKA 5ETIA 4AZFA 4OBOA 5M09A 5K0XA 4HW7A 2EXCX 1QMZA 4A7CA 4EH3A 5HQ0A 2NPQA 3S3IA 4EZ7A 5FDPA 2BTRA 5AUXA 3LFFA 3OWKA 2WQBA 2XJ1A 4ALVA 3PYYA 1NA7A 2J2IB 3GUBA 4RGJA 1H00A 3VUIA 2Z60A 3O8UA 4A9UA 5DNRA 3GBZA 4BDGA 2AUHA 2ESMA 2JFLA 2YJRA 4KRCA 4MD7E 4NWMA 4YZDA 3W2QA 4EK5A 2W9FB 3TUCA 3PXQA 3ZSGA 2W9ZB 1H1RA 3DBEA 2HELA 5CZHA 3A62A 4G6NA 4BI0A 2QURA 3R8PA 3F3ZA 4UALA 4Q9SA 3IPHA 2XIKA 5DLSA 4DBNA 1J7LA 2CNVA 4ONAA 1Q8ZA 3D7ZA 1Q8UA 4HGEA 3EN4A 5CT0A 5CTPA 4DEGA 4O7YA 3U54A 4QMMA 1M2RA 2J90A 4R1VA 5HG7A 2PY3A 1Y6BA 3AT3A 3OUNB 5M53A 2QOCA 3QHRA 2W5BA 3PE1A 4C4FA 3QBNA 3FLSA 2RKUA 2R9SA 3OBJA 3C1XA 2ITOA 4BCGA 2YA9A 4ZMEA 2XJ0A 2VX0A 3D2IA 4ASDA 3RHKA 1REKA 4L68A 4FUYA 2VTLA 4R3RA 3DNEA 2B53A 3BU6A 1QPEA 5L2WA 5FEQA 3PG3A 4XG7A 4YTIA 3UDTA 4F09A 4DTAA 3P5JC 2WMXA 3BQRA 3LCSA 2WTWA 3MS9A 1YWVA 2B9FA 3EYGA 1SNUA 4HZSA 4YC3A 3SDJA 5HU3A 3AT2A 5JQ8A 2R3KA 4LM5A 3GCVA 3THBA 4KA3A 5D41A 1LR4A 4BTMA 2PVNA 2W4JA 5DRBA 1YI4A 2HWPA 4XMOA 5KMKA 3MGYA 4NKSA 4RRVA 4FIJA 3WZUA 1MRUA 2WU6A 4KBKA 3KN5A 4HGSA 5HBJA 4YTFA 5HICA 4Z7GA 3PP0A 4NZWB 4CCBA 4L7FA 2I6LA 2VO7A 4NJDA 4KABA 4AZEA 3LCKA 3EYHA 4BTFA 1WMKA 3RAKA 3MPAA 3KXGA 4ZY6A 4YBJA 4UV0A 4M8TA 5HVYA 3BHTA 4PV0A 4R3CA 3CKXA 3IQ7A 4HCVA 5AP5A 1WVXA 3W55A 4M14A 2I7QA 4ZIMA 4O2PA 3CQWA 2PTKA 3S95A 3VS1A 4IACA 5FLFA 4EOQA 5BQ0A 3AT4A 5G6VA 4USFA 3SG9A 2VTIA 4Q5HA 2WPAA 4HZRA 1ZMWA 3HL7A 3FY2A 3QZIA 4JRNA 5FDXA 2J4ZA 4C4HA 2C5YA 4ZAUA 1F3MC 5IG1A 2IG7A 5CSWA 4F0FA 3W10A 3V8TA 3FZRA 4FTAA 4JX7A 2VX1A 3VHKA 4BIDA 3K3IA 4NSTA 2OJFE 3VBVA 2GHLA 2Q0BA 4UBAA 2W1IA 5GJFA 1U5QA 5A6OA 1TQPA 4AZWA 1B39A 4IFCA 5LVLA 1SZMA 3GU5A 4HNIA 3FKNA 3VBWA 3OZ6A 3ULIA 5KUPA 3TWJA 2F57A 3KRLA 3QQGA 2FB8A 4AW0A 3EQRA 4BWKA 4GEOA 2C0IA 4D55A 4Q2AA 1YHWA 1O6LA 3NFGB 4BCHA 1ZAOA 3KEXA 5B2LA 4AF3A 3ZEWA 3HA6A 3A7HA 2ERKA 5HESA 2WTKC 5C1QB 3R9DA 1YWRA 4O4DA 3BYUA 3LXKA 4IBMA 2YDJA 4G3CA 3T8OA 1J3HA 4I41A 3RPSA 5EYDA 4H05A 3N51A 5JT2A 3KXZA 4XH6A 3Q5IA 3RPRA 5LARA 2XCHA 5D1JA 4BTJA 4YP8A 4MCVA 3W2RA 1XHAA 2JDRA 4M68A 3MW1A 3ANQA 4UZDA 3KIOC 2XNBA 5I9ZA 3FZSA 3IW4A 3I7BA 4AXEA 4P2KA 3GU6A 2ETMA 5JH6A 3DK7A 2ZV8A 1OMWA 4FTKA 4LGHA 2VTTA 3TL8A 3QCXA 4BHNA 2G15A 4FZ6A 5CANA 1Q8WA 4ZSAA 2VTMA 3QX4A 4ORKA 2BKZA 3C0IA 4AXFA 2XK9A 3U9CA 2QR8A 4HYHA 3QD0A 3UVQA 3CPBA 2Z8CA 3Q4UA 3QWJA 5KMJA 5AA8A 1PRYA 4HPTE 5J7HA 4EJ7A 2WFYA 4C7TA 1J1BA 3Q9XA 4APPA 5FEDA 4LMUA 4P90A 4F70A 4IJ9A 3EZRA 4D4SA 5IUHA 2G2IA 3LCDA 2C6IA 3EKKA 3HKOA 3A60A 3H4JA 4XNEA 3VBTA 4BB4A 2J0LA 3GC0A 3MESA 4AW2A 4KKEA 2ZDUA 3F7WA 4S30A 3TN8A 4GYIA 3UVRA 3QQJA 3EN7A 1JPAA 5AFVA 4J53A 4ACHA 4O7ZA 1BUHA 4XOYA 5AP7A 2XNMA 4DEAA 3PUFC 2YIYA 4N6YA 2PMNX 4JOAA 4MBLA 3RAWA 5FTGA 3R28A 2XYUA 4DEBA 5C8NA 2VRXA 3LQ3A 2FUMA 4MXZA 4D2VA 4X6RA 3SA0A 2C1BA 3KL8A 4GIIA 1ATPE 1E1VA 3MPTA 2DUVA 2RSVA 2JKKA 3VUMA 5DT0A 2HZ4A 1YHVA 3C13A 4TRLA 1PXMA 4JL9A 3GU4A 4AP7A 4PMMA 4YLJA 4PMPA 3R71A 3EZVA 3QQKA 3V3VA 1G8JA 3NNWA 4FZFB 3R8VA 4XG9A 2ACXA 4RVKA 3R8LA 4U42A 1W8CA 1A9UA 2UZWE 4X2JA 1XJDA 3FJQE 5ANKA 3ZHPC 4O7LA 3BX5A 4DH8A 5JEBA 4XG4A 5E91A 2VZ6A 5FBNC 2ZM4A 1FQ1B 4R77A 3IO7A 3IOPA 1J7IA 2IJMA 3KKVA 2WMQA 2BROA 4PRJA 5CQUA 4FTLA 3DS6A 5GNKA 4XV9A 3UG2A 3CKWA 5EW9A 5E8YA 4ZTNA 4F7SA 4NTSA 3MVLA 3NR9A 3DTWA 4CFMA 4JVGA 1BYGA 2QLUA 1PXJA 2BAQA 3DNDA 3VS3A 5GZ9A 3S4QA 1DI8A 4ANSA 5IH4A 5CQWA 2XBJA 2ZB1A 1Q4LA 1QPDA 2R3QA 3PXYA 4IDVA 4EH7A 3UE4A 4YUQA 4BBFA 4WBOA 2PUUA 3VUDA 2PUNA 4E1ZA 3FMHA 5DR9A 3SQQA 4F63A 3A61A 3E7VA 3ZUUA 2UZVA 1BMKA 4D2WA 4UMUA 1FVVA 3WZEA 3AGMA 2UW9A 2FSTX 3WBLA 5D11A 2PVFA 4ENXA 2EU9A 4K8AA 4EI4A 4P5QA 3JR1A 1JVPP 1PJKA 3R8UA 2ZM1A 1PMNA 3HGKA 3ZZEA 3JY9A 4EL9A 3KRWA 4CCUA 4CYJA 1KE6A 4RIOA 3W0PA 4C4GA 1Q5KA 2XP2A 4KRDA 4AOTA 1ZZ2A 4D1XA 2XAMA 5HX8A 5M55A 2B1PA 4YR8A 5HEZA 4ANOA 4APCA 3ZU7A 3F3UA 1VZOA 4HGTA 3R8MA 4FL3A 4JG8A 3I60A 2PZPA 4W4YA 2YAKA 4D2PA 4F64A 3PVGA 4XJ0A 5HG5A 2PZRA 5K9IA 1IG1A 4C2WA 4QNYA 1WBNA 3R9RA 4XG3A 3GCUA 4FSNA 1TQMA 5L2SA 5FUTA 3QHWA 4EOIA 4AFEA 4PPCA 5I4NA 4QMWA 4XV2A 3FYKX 5HIDA 2B4SB 5D7AA 4G5PA 5M06A 3Q6UA 3PE2A 3D14A 4YJSA 3PIZA 4GMYA 4S34A 4M3QA 2XALA 4DF3A 2F4JA 4AU8A 5KKRB 2BFYA 2BZHB 2Z7QA 5HCZA 3C4ZA 2W4KA 4MWIA 2YCQA 3LXLA 5JRSA 1V0PA 2QOLA 2W06A 3ORMA 5CU4A 4D1SA 2PUPA 4I5MA 3MFSA 4RLKA 3UNKA 3PG1A 2XA4A 4F1MA 1TFFA 1REJA 3R22A 4RC4A 5FXSA 5CF8A 3TUBA 1Z5MA 4UB7A 2XF0A 3OUKA 2IVSA 3QZFA 3QD2B 4IVDA 4FSTA 2OJIA 3FMMA 3W16A 1KE7A 1ZYCA 4FSQA 2B7AA 3RPYA 4FKRA 2WGJA 5FWKK 4BJJB 3W2SA 3TTIA 5J9ZA 3H9RA 1X8BA 2IEWA 3QLFA 4OTDA 2PVMA 3DTCA 3PWYA 2E9OA 1EH4A 1SM2A 3EWHA 2O65A 4JBQA 4OTGA 4PTCA 3R7UA 4GUEA 4JDJA 4GFOA 3ORKA 1S9JA 2J9MA 1PW2A 1OUKA 2QU6A 4TYEA 4GIHA 3Q96A 2ITZA 4EJNA 3SVVA 3N4TA 5C8KA 3DU8A 4KSPA 4OT6A 4I92A 4U43A 4BBEA 3ZRMA 4DH1A 3FZTA 4FNWA 1S9IA 5EH0A 3ZYAA 4DN5A 2G9XA 3EL7A 5EW3A 5KBRA 2BRMA 3ZRLA 2Z7LA 4BDDA 4RA5A 3UODA 2ZJWA 4YJNA 2HY0A 5AR2A 3RAIA 5F1ZA 4OTQA 5BNJA 2PUIA 5LVNA 3U6JA 2UZEA 4CT1A 3PRFA 5IQFA 4UMPA 4EBVA 4V0GB 4AFJA 4V0GA 3TKUA 3SAYA 3U6HA 1RW8A 2UW7A 3MY0A 4QMYA 4OTIA 2R3HA 4FK3A 4QP9A 4BTKA 4NK9A 4FYNA 3OT3A 4FSUA 4B4LA 3ORIA 3OFMA 4FKGA 2WD1A 2WOTA 1NVSA 2GS7A 4RMZA 2IWIA 3AOXA 4Y95A 4X0MA 4B9DA 3PP1A 2IW6A 5HLPA 3TZ7A 3UVPA 2W7XA 4BDKA 2W1CA 2R3MA 3UIMA 4TXCA 2RFSA 3EQCA 3NUAA 3EB0A 4O6LA 3FZOA 4FICA 3VRZA 4AQCA 4J71A 4RLLA 1P4OA 1KUTA 1RE8A 3O50A 3PJCA 4ZSJA 4ZTSA 5HE0A 3W2PA 3CCNA 3JYAA 3LFCA 4IFGA 5CXZA 4D2SA 2XUUA 3PXFA 5E8VA 4ZTMA 3OEFX 3CY3A 4FIIA 5F20A 3BRBA 3CTHA 3HEGA 4XUFA 2X6DA 3QTZA 3P7CA 3W32A 3WF8A 5HNIX 3VRYA 4LGDA 2ZOQA 5TE0A 2XK4A 1QL6A 2Z02A 2C6LA 2QKRA 5DR6A 4GJ3A 1YWNA 1UVRA 4QP8A 4LGGA 3JS2A 4II5A 5ANEA 1UA2A 2UV2A 1KOAA 5FM3A 2PVJA 3D4QA 4Y46A 4O1PA 4G6LA 4KBCA 4F65A 3GFEA 5JFVA 2YZAA 2PE1A 4RJ6A 2G2HA 5H3QA 2CDZA 4AA0A 3OVVA 5CWZA 2XANA 4JT3A 2A1AB 1OPLA 2H34A 1ZZLA 4RT7A 3DDQA 3SXSA 5AMNA 4DFNA 3P7AA 4U8ZA 1CMKE 2WMAA 2YDKA 5HTIA 1NVRA 2YHVA 4FSMA 1GIHA 5I9VA 4DFLA 2R3RA 2XNPA 2RGPA 4ITHA 3WOWA 1VYZA 2XIXA 3QWKA 4MAOA 3RMFA 3C4FA 3BZ3A 4MNFA 2OLCA 4H3BA 4L53A 4CZTA 2BTSA 5DT4A 5IISA 2C5NA 3IOKA 3RJCA 3B8RA 1JAMA 1WBSA 3W33A 3DZOA 3NUNA 2GNFA 4UMQA 5E8UA 4LV7A 3PFYA 3LFAA 4GFGA 3MVHA 3TCPA 4JMQA 4O22A 4W8DA 4MUQA 3PA4A 1R39A 3UJGA 3QUPA 2C4GA 2YWPA 4NEUA 4FVPA 3R1QA 3MPMA 4PTEA 3SV0A 1OM1A 3BE2A 2IO6A 4DHZA 5D12A 4ANNA 4AXAA 4AXCA 4AGCA 4O91A 1OL1A 2CHLA 3HMMA 5FTOA 4AAAA 3VS5A 2AEGA 4J95A 4EH6A 3PVBA 5IA4A 3NAXA 3F3TA 3Q9YA 4IADA 5IMEA 5AUUA 4LMNA 3N4VA 2R3FA 3IGGA 3Q53A 2C3KA 1SVHA 4L43A 5IA0A 2C5VA 3D15A 3VW6A 5HIEA 5E90A 4FKTA 4D2RA 4TTHB 4I20A 3WIGA 3M1SA 3TNQB 4HCUA 2OI4X 4MHAA 2BIYA 4MTAA 2ERZE 3VS4A 4AOIA 4FEWA 3UZRA 2X7OA 3FXXA 4IWQA 5LJJA 3TDWA 5J1VA 5A46A 4FIGA 4U3YA 3P78A 4ZSEA 4LL0A 5BVDA 2PWLA 4O21A 3NCGA 4QMUA 1PXLA 3O71A 4J97A 3QTUA 5AX3A 4QTEA 1A06A 3LJ2A 2W99B 1U4DA 5AUWA 4EC9A 3QKKA 4DFXE 4GJ2A 3UYSA 4S2ZA 1YHSA 2PE2A 4CMOA 5FP5A 3CQEA 3PVWA 3P23A 1HCLA 4L6QA 5E1SA 5A4QA 2QG5A 4BWXA 3FC2A 2JLDA 3O8PA 2QOHA 5CNNA 4ALWA 2WXVA 4DLIA 5A14A 5F94A 2XB7A 2OXXA 3TKHA 5BVFA 4FT7A 4FTUA 3SOCA 1W98A 3FI4A 4I5PA 3UNZA 4EH5A 3PZHA 5CAVA 4FGRA 3COKA 1ND4A 4ZJIA 5C4LA 1CDKA 4XG2A 3GEQA 3C4CA 4GYGA 4WNOA 3HMIA 5I9YA 3V51A 4FV8A 2JGZA 4JQ8A 4NIFB 4OW8A 2WMVA 4NIFA 1LPUA 1UWJA 5AIKA 4C4JA 3V5WA 2EVAA 2R2PA 4S32A 5AJQA 5IZFA 5KBQA 2ZVAA 5EI2A 4AUAA 2YITA 5LCKA 2A27A 4KIQA 1WZYA 3AMYA 1L8TA 3R1YA 2V7AA 4O38A 3CJGA 3RNIA 3PPKA 3TT0A 2QOOA 2ZYBA 4NM3A 1OL6A 4KIPA 1PMVA 3CD8A 3C5IA 2RIOA 5M4FA 3PIXA 3F5UA 3TZMA 3VULA 4EH4A 3RZFA 2CJMA 3C4WA 5KMLA 1H08A 2XNEA 3HP2A 3DQXA 1XH4A 1ZLTA 5CXHA 5ETFA 5LVMA 2QONA 3VJOA 5DA3A 4BC6A 2WKMA 3CGFA 5G1XA 4FOCA 4XRLA 4CRLA 5K3YA 1YXVA 4CLJA 3F88A 2PL0A 3PJ3A 3V5LA 4A4LA 2PSQA 4OLIA 4EC8A 3AKLA 3VONA 1UU9A 3Q5ZA 4TKSA 5D7VA 2B55A 4HYUA 2CLXA 4EQCA 3A2CA 1E1XA 3AC3A 4WRSA 5CVGA 2VWZA 2I0YA 3GNIB 1LUFA 2XKFA 4QD6A 3E8NA 3P79A 1J1CA 2CKPA 3HA8A 2XNGA 4XHKB 5GZ8A 2BALA 2CLQA 2IF8A 4FV9A 2BMCA 3OTVA 4E7WA 1P14A 5HVJA 2VTQA 2VTPA 1G8KA 4L46A 5IF1A 5J5SA 3O0GA 3BWJA 2YZLA 3IDPA 2W17A 3FDNA 4BL1A 4H3QA 2WTKB 3N9XA 4GVAA 3KXNA 3I5NA 4O0RA 2Z2WA 4RJ7A 4C57A 2E9VA 4WOVA 5EHOA 3SRVB 3SRVA 5L8KA 2YABA 5ANIA 3KN6A 4GS6A 1DI9A 4GT4A 4A4XA 2B52A 3UMXA 2WOUA 2HXLA 1RJBA 3NYXA 4KB8A 2BAKA 5BUJA 4AA5A 3ZMMA 5AR8A 4MQ2A 3S2PA 1XWSA 4BYIA 4AQKA 2XKCA 3E7OA 1XO2B 4FTQA 2OH0E 5CVFA 3W0RA 4E93A 3HV6A 5E1EA 4KINA 1XQZA 1ERKA 2P4IA 5GJDA 4CVAA 4MF1A 5HLNA 3LFBA 4UXLA 5LMKC 4QQCA 2QC6A 2DQ7X 2OKRA 4PDOA 2NP8A 2OU7A 4DT8A 4EONA 4PNKA 3ZDIA 3MA6A 3HRFA 2BHHA 3Q4CA 4ZJVA 1OKYA 4FTTA 2I40A 2PMOX 3E3PA 2X0QA 4FV2A 3E8EA 3V04A 2WTCA 3DAJA 3MFUA 1HOWA 4GK3A 1IR3A 1WBPA 1GZ8A 4Y8DA 5CS6A 4JS8A 5FG8A 2QOKA 5BV3A 2RG6A 3EJ1A 4FTJA 3ZTXA 3NEWA 2ETRA 3VUTA 4PF4A 4E20A 3BBWA 2R3JA 2XIRA 3RHXA 1GNGA 3OW4A 1R1WA 4YNOA 4W9XA 1PXPA 2H6DA 5CU2A 5HU9A 4OTHA 4I5CA 2FSOX 4EH2A 2VTOA 4LI5A 4EOJA 3GQLA 2GNHA 1QPJA 2BR1A 3WF7A 4HVGA 5ITAA 4K33A 1JKTA 3OCSA 3P08A 4BDJA 4RIXB 4ACCA 4RIXA 3SD0A 3H9OA 2WQNA 4FV7A 3ENMA 4FC0A 5BVNA 5BVEA 4AT4A 2ITNA 5FTQA 2JIVA 5AAGA 4DTBA 3C5UA 4FTNA 3UOKA 1OB3A 3K54A 2UZBA 2R7BA 4TWCA 4U45A 4U3ZA 4RVMA 3FI8A 4HCTA 5CENA 3ZFXA 3OROA 2RF9A 1OVEA 4J8NA 3FQSA 5TF9A 3V6RA 2YCRA 3DT1A 4YJOA 1GZOA 3C9WA 4WRGA 1Q8YA 5I9UA 4ZZMA 2PPQA 1TVOA 2H9VA 1Q3DA 5B7VA 1UWHA 2C69A 5CSXA 4W4WA 1NY3A 4C3PA 2BRBA 1W7HA 3MB6A 3TM0A 3LZBA 4NM0A 4EOLA 2AC5A 2VTNA 4D5KA 3EFLA 4IM0A 3BEAA 3QRTA 1IA9A 3DPKA 3BYSA 2BZJA 4IZ7A 1H4LA 2V62A 4TNDA 3SOAA 4QYFA 3CD3A 4YJPA 3LJ0A 2JKQA 3D9VA 3HRBA 1ZY5A 3ORTA 4L8MA 5HX6A 1OGUA 3G90X 1CTPE 5AP1A 5EK7A 4G9RA 3RPVA 4CQGA