3AMBA

Protein kinase a sixfold mutant model of aurora b with inhibitor vx-680
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
340
Chain Sequence
AAAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIRTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRIQQAVNFPFLVKLEFSFKDNSNLYMVLEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Mutants of protein kinase A that mimic the ATP-binding site of Aurora kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ambA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ambA02
4BF2A 5DOSA 4UWYA 3ZRLA 4BKZA 3EJ1A 5IA4A 3F5XA 3WF5A 2X6DA 3H30A 4ZZNA 4IAIA 3WIKA 3ZM9A 2OI4X 2W17A 2WMBA 4FTNA 4TYIA 5HLNA 3IOKA 2XZSA 4C8BA 5KMMA 2V55A 2IJMA 1H28A 4ZJIA 3D5WA 1U4DA 4GKHA 3RPOA 5HU9A 2FH9A 2Y9QA 5CU0A 3OFMA 1GJOA 4BKYA 2CCHA 3LAUA 4PP9A 1BI7A 3VS4A 2EB3A 1KV2A 3DA6A 3VF9A 4IC7A 2R0IA 4G5PA 3R9HA 4RJ5A 3PXKA 5DA3A 4D0WA 1LP4A 3BEGA 3LFEA 2E9PA 3UOLA 4ANOA 4ASEA 4FK3A 5CF6A 3GI3A 4FSWA 4FKLA 5EW8A 5AV2A 3R7VA 4F7JA 2OJJA 5AP6A 1E1VA 1XH7A 4IZYA 1IG1A 5FGKA 4ENXA 1XQZA 5LOHA 1DI8A 4L3PA 2B9FA 5HIDA 3LCKA 2W5AA 4HW7A 5AAEA 3PZHA 4BCKA 4D5KA 3P1AA 1ZYJA 2PVKA 3QUDA 5KMLA 2XNNA 2PMNX 4QP6A 4F09A 1JPAA 3NYXA 2RG6A 4M14A 2B9JA 3IW8A 1ZXEA 3OY3A 1DS5A 3Q60A 3HEGA 4JQ7A 4KINA 4NK9A 1IA8A 5E8TA 4BCJA 2GNFA 2X1NA 4YZCA 3UTOA 4YO6A 1VYZA 4MEDA 3PVUA 5KUPA 2Z2WA 4F7NA 4QD6A 4OTWA 1XWSA 2P0CA 3A61A 5EDPA 1ZMVA 3SDJA 5CAPA 2E9OA 3NZ0A 3FZTA 3K5VA 4GUEA 4I5HA 4E5AX 4PTCA 5M51A 3MTFA 2E2BA 3CS9A 2QOHA 3VBVA 4BI2A 4BTKA 3HLLA 4RA5A 4IVAA 5F1ZA 3MH1A 2GNHA 3BQCA 3VRZA 4FV3A 3CQUA 1ZLTA 5CU3A 4OLIA 3UOJA 2R3HA 4WA9A 5DE2A 4I3ZA 2ITNA 4UY9A 5AUVA 2HWOA 5GIOE 4TL0A 5M08A 3SD0A 4ACMA 3MI9A 2XRUA 3PFQA 3R9DA 3WZKA 5AA8A 3FC1X 3EH9A 4YZ9A 3PP0A 4O82A 1KE8A 4YHFA 1OB3A 1XHAA 1NY3A 2V22A 4PMTA 4DLJA 4F0FA 2BMCA 4WT6A 1OBDA 2GS2A 1KE7A 4ENYA 5AWMA 4AX8A 3DXPA 2Y7JA 3LVPA 1YOJA 4I22A 4CFWA 5HG7A 2QOKA 5FEQA 4WOVA 4YC3A 4F1MA 2W1EA 4TPTA 3VBYA 3OY1A 4LRMA 4AGWA 4CFVA 3LXLA 3AT3A 5FP6A 4R1VA 5BVOA 4U3ZA 3FQEA 4DFLA 1REKA 3HA6A 1IASA 4O0RA 2JGZA 4IMYA 4C3FA 4BVUA 5A54A 2JDSA 2X4ZA 3CE3A 5FDXA 1M2PA 3V51A 4F99A 5HI2A 4XNEA 4Y8DA 4NFMA 3F82A 3Q6WA 2UW8A 4NM5A 2WIPA 3EB0A 1REJA 2Z7SA 4EOMA 5F4NA 5BVEA 4FKQA 3BQRA 4EQCA 3ZUTA 2JDTA 2XS0A 5I9UA 2QR8A 3AMAA 4E1ZA 2DYLA 4MBIA 5DT4A 4FTKA 5HBJA 3F3VA 5DEYA 3CLYA 3U6JA 2J4ZA 3NAYA 2BILB 2WFYA 1M7NA 3LFBA 4Y5QA 4ZY5A 3OZ6A 4RGJA 3NNXA 3NWWA 4IDTA 4JRNA 2VTTA 1WVXA 5IH4A 5LMKC 4ANLA 4JJRA 2V62A 5CVGA 4X3FC 1OIUA 1OIRA 5CVFA 3T3UA 2GSFA 2YFXA 2PVFA 2WNTA 4IACA 4G3FA 4F9YA 4OAVB 4FT7A 3Q4UA 5EYMA 2XJ1A 5H3QA 1OKWA 3E8DA 3G6HA 4JDHA 3QTUA 1UU7A 4NKAA 3TZMA 3LXNA 3ZFYA 3D7ZA 4C61A 4AG8A 2QQ7A 3Q32A 4GH2A 2B0QA 2CMWA 4MCVA 3KRRA 3LCOA 2ETMA 5TF9A 2R7BA 5HEZA 5HIEA 3UPZA 5IQBA 2J2IB 1V1KA 4UEUA 4RVKA 3VVHA 1BI8A 2PULA 2OWBA 4JS8A 5E8WA 3P23A 3KXGA 5CXZA 4YGAA 4E7WA 2ESMA 5CT7A 3MTLA 3FI2A 4APCA 1XH9A 4QMZA 1WZYA 2RIOA 3KRXA 4C2VA 4AOJA 2WZJA 4MD8E 3GCQA 2CNQA 2OIDA 4PDOA 3BGQA 3QX2A 1Q41A 3QCSA 4PDSA 3R8VA 4BZNA 2HZIA 1Q8ZA 3N4TA 1Z9XA 2OJ9A 3OF0A 3F3UA 3DXQA 3AMYA 4CT1A 3HMOA 4CRSA 3O50A 4Z3VA 4L43A 3AGLA 4MAOA 4OTHA 4AT4A 2CKOA 2PYWA 3V01A 3ZUVA 4EHZA 2PSQA 4YU2A 2O8YA 4NW6A 3ENHA 4IFCA 3R0TA 3CY3A 4HGLA 4QYGA 4QT1A 3QRKA 2CLQA 1M52A 5LXMA 2EXEA 3QCQA 5IUIA 5M57A 3KC3A 4RIXA 5EYKA 3SLSA 4A4XA 3V5QA 3GCPA 4MK0A 3I6WA 1YXXA 4BGGA 5L8KA 3RM7A 4FYOA 4N6YA 4XUFA 4ID7A 4IW0A 4YURA 2IVVA 3A7JA 2YCQA 3KCFA 4ASDA 4BDKA 2XK9A 3DQXA 3ETAA 1G3NA 2BZKB 2XEZA 3C4ZA 4X2NA 3GEQA 4HYIA 2X4FA 2XNOA 1ZARA 5ETIA 5JFVA 4GT3A 3CGFA 4ZTLA 4R7IA 3OXIA 4W4WA 3R1NA 2YDJA 2YCFA 4NIFA 2VTQA 3G33A 1PXNA 4GT5A 3W2PA 3RZFA 2ONLA 1OI9A 4YTFA 1R0EA 2X8DA 5FXQA 5AX3A 1CKIA 2WMWA 5BUEA 2XP2A 3FMJA 4MXZA 4QPAA 5EHYA 2BZJA 3QXPA 5DVRA 2J51A 4MQ2A 3UVQA 2WTIA 1PKDA 3NIZA 4IZAA 4Q9SA 3PPJA 5C8KA 4I5MA 3DK6A 3NCZA 3DJ5A 3GVUA 4GCJA 4ZY6A 5T3QA 1XBBA 4ONAA 3RJCA 1UU8A 3PVGA 4AW2A 5JKGA 1SVHA 3BWFA 1JNKA 4TW9A 3VUKA 5JRSA 1XH5A 3NYVA 4KIKB 4OT6A 3VBXA 5IUGA 5DYJA 4V05A 3KXZA 3EN9A 4NCTA 4J95A 2PVLA 4QMPA 5IISA 4EWHA 1OBGA 5CF5A 2BZHB 3R22A 4R6VA 3T9IA 3TV6A 1ZMUA 2YIWA 1H0VA 1YRPA 2PUPA 4E6DA 4L68A 5AM6A 3PG3A 2R3OA 3PTGA 1UNGA 2H34A 4M13A 3OEFX 3QTSA 3ALOA 1GNGA 2UZTA 4RX9A 3TNQB 5IH6A 3H3CA 4LRJA 1W98A 3W2RA 3C0GA 2J5FA 3ZONA 1J7UA 2JKKA 4EJ7A 3QD4A 1YOMA 4MXAA 4KRCA 2C69A 2QCSA 2XM9A 3QLGA 4O6EA 5D9HA 2PZRA 3A62A 2X0GA 2X7GA 2VO0A 4MNEA 2ZAZA 4JBOA 3E7OA 3FXXA 4EC8A 5CWZA 4PL4A 4AP7A 3LKMA 3IW7A 3NNVA 5IPJA 1TKIA 1T45A 5M4FA 4EK3A 4WNOA 3GGFA 4IBMA 2W5BA 4A9UA 4J8MA 3UP2A 3KCKA 4LM5A 2WMTA 2WTKC 1J7IA 3C4WA 3MB7A 1J1CA 3I5ZA 4GEOA 1CKPA 4FNWA 3UNKA 2YISA 3H9OA 3LQ5A 4F6WA 5AIRA 2X7OA 4FKSA 2X9FA 4IWOA 4KNBA 4M67A 4EQUA 3GP0A 3W1FA 5EI8A 4PL5A 1A06A 3TNIA 4EI4A 4F65A 4BZDA 2B9IA 3R04A 4XG3A 2BAJA 4MQ1A 4G31A 4K0YA 3JVSA 3W8QA 5M4CA 5I9ZA 4KWPA 2C30A 2GMXA 2RKUA 4X3FB 5E1EA 5HG8A 4FKTA 3UIXA 1OIYA 4PNKA 3W2CA 2J7TA 5EW3A 3AQVA 3R8ZA 3O8UA 3SOCA 4ZY4A 4R3CA 3DAJA 3AD5A 2C3LA 4D2SA 4IJ9A 4O22A 4WKQA 2KULA 3VHEA 4CEGA 3RM6A 2VTSA 4CQEA 5LMBA 2CGWA 1PYEA 3VWAA 2R7IA 2G2HA 3JPVA 3OCTA 2YAKA 3BIZA 1ZY4A 5KHXA 3E5AA 4D2WA 4CFUA 5M09A 1Q5KA 3IK3A 3QTXA 5JQ5A 3T9TA 4C37A 5JMSA 3O23A 5EDQA 3B8RA 4FIIA 4JX3A 1TQPA 2JDRA 3BYUA 2EU9A 4YZMA 3FZSA 4BDHA 4ERKA 4FIFA 5CI6A 1GY3A 3NRMA 4LGHA 4UYAA 3SX9A 4EBVA 3V8WA 3LMIA 3VS7A 2GCDA 3D5XA 3F6XA 3H4JA 3H9RA 3PXFA 4N6ZA 4BWKA 4G9CA 2GNJA 4O38A 3IW4A 4HVHA 3T3VA 2OK1A 4ORKA 3MVLA 2ITVA 3AC4A 2NRYA 1PJKA 3MY5A 3WZJA 5JQ8A 3NVMB 3C0IA 2ONLC 3FZPA 4KS7A 3MH3A 4O0YA 4EK4A 4O7SA 4BICA 1IEPA 5KBRA 5LQFA 4EOJA 1PXKA 3WYXA 3FE3A 5CENA 2PPQA 4BBEA 5TOZA 1KSWA 3EWHA 4R1YA 1FVRA 4DFNA 3ITZA 4EHGA 3FL4A 1YVJA 4G2FA 4KB8A 2HZ4A 3OMVA 3UO4A 3ZRKA 2XIYA 3G90X 1FVVA 3ZS5A 3D14A 3V5LA 3UIUA 2Z8CA 5KKRC 3HYHA 4J52A 3KN6A 2YJRA 3NYOA 1WVYA 2BRBA 4NCTC 3C0HA 5LARA 3BE2A 4CYIA 3ZDIA 3PY0A 3QC9A 5CEMA 4CQGA 2PY3A 3OBJA 3QC4A 2C1AA 4DFBA 4EORA 2XBJA 4FKOA 4J8NA 2VWXA 4FSQA 4HYUA 4W4XA 4RC3A 5D1JA 4NWMA 3EKKA 3IDPA 3NUNA 5JSMA 2W9FB 2QLQA 3ZRMA 3F7ZA 3JY9A 3L9PA 3UOKA 5AAGA 3D7TB 2I0HA 3KXMA 3UO5A 5CEOA 2CJMA 4WUAA 3RAWA 1LEWA 3DNEA 3WZUA 3UZPA 4OT5A 3UBDA 1Z57A 4YLLA 5FBOA 3S0OA 3KGAA 3NUAA 5AUXA 4C36A 3RHKA 1VR2A 2YWPA 4QTBA 3R8UA 2I0EA 4U7ZA 4Y83A 1Q8TA 3G0FA 3ALNA 4JQEA 4RZWA 3I81A 2X6EA 5IQIA 4DT8A 3E8CA 4DITA 5EQYA 1Q24A 4R3RA 4AZTA 4QOXA 4EBWA 3EFLA 3WF7A 4B4LA 3PZEA 4DH5A 2REIA 3KULB 1Q62A 4CXAA 3VAPA 4FVRA 2BR1A 3Q2MA 4I5CA 2UZOA 4I93A 3TDVA 3DBEA 2IO6A 4RFYA 5AP4A 5DRDA 1Q3DA 3QU0A 4A9TA 4JI9A 3E64A 3HKOA 4QYHA 1R1WA 4E6QA 3R1QA 5AR5A 4EUTA 1YI4A 4FTIA 2UW9A 4P5ZA 4RWKA 4W8EA 4YJOA 1H01A 2DS1A 1YDRE 3UJGA 2IWIA 3DAEA 1YXUA 4KBCA 4TYEA 1L8TA 2BROA 4YNOA 4BB4A 5EM6A 1OKZA 4BDDA 4NT4A 1P2AA 2B53A 4CFFA 1NT2A 5C26A 3VUMA 4L3JA 5FM2A 5KHWA 3R2YA 2WMUA 3TI1A 3U6IA 5KZ0A 4PTEA 1ZOGA 2C0OA 5FTOA 2VTOA 3SXRA 1IRKA 4FEQA 2JAVA 2QHMA 1GZKA 3W2OA 1OUYA 3LXPA 4MBJA 4FT9A 4U97A 3BGPA 2HAKA 5IEXA 5E4HA 4D4SA 2O3PA 2UW3A 3DV3A 4L53A 3KRLA 1UU9A 3CP9A 1FBNA 4BWXA 3WOWA 4YJVA 4CNHA 2PZIA 1Q99A 4WBBB 4IB5A 4FI1A 2OG8A 3OD6X 4M8TA 4FV4A 3KVWA 4FTJA 4J71A 2WMAA 2QHNA 1YI6A 4RJ8A 4QTEA 3HRFA 4JL9A 4IZ5A 5J1VA 4CZUA 1OPJA 5IG1A 4B6LA 2FVDA 3CR0A 3R2BA 3ZO2A 4DG0E 3HAMA 4D58A 4F6SA 4O1OA 4RX8A 3C5UA 2F57A 3C13A 2YN8A 2OXYA 4FKPA 4AAAA 2GHMA 3DDQA 3U9CA 4WNPA 1FPUA 3DCVA 3BU5A 4JT3A 5BNJA 3MESA 3U8WA 2EB2A 2JC6A 2YM7A 3ZLSA 4YR8A 1R3CA 1H1WA 3OOGA 4LV5A 2PE2A 4FF8A 4A9RA 5AR8A 5HORA 4XLIA 2NNWB 2UZVA 4CZTA 4OTDA 3TZ8A 4AZEA 3KQ7A 2XKCA 3MB6A 4G34A 5FG8A 5AUZA 4MTAA 5A9UA 4MXOA 3VO3A 2FSMX 4TWPA 4AE6A 4BZOA 4PRJA 5CAUA 3BZ3A 3SG9A 2IPXA 5B7VA 1U46A 2FSOX 4XH6A 3SOAA 2QODA 4TYHB 2VWBA 4FG8A 1RE8A 4XHKB 4EJNA 2XYNA 4FA2A 1MRYA 3DU8A 2F7ZE 3ZSIA 5J7BA 1SNUA 1JKSA 5L2IA 1OITA 4ZJVA 3HP5A 3UIMA 4C3RA 4EH8A 3HUBA 3GC0A 2GTNA 3QRTA 4UYNA 4C02A 2VTAA 4NUSA 4G16A 5KE0A 4FTAA 3Q52A 4V01A 4EH7A 5J9ZA 5IA5A 5H8EA 3NPCA 2OBJA 3HV3A 4DG2E 2HK5A 3JYAA 4LMUA 5LVOA 2P2IA 3DXNA 2YM5A 4K11A 4ALUA 2VGOA 3UGCA 3G51A 3V6RA 4Y72A 1U54A 4NW5A 4DEDA 2WKMA 4JRVA 5GZ8A 4D0XA 4HJOA 1S9JA 2X2MA 3KFAA 4O1PA 2RGPA 2WQMA 4BCOA 3H0ZA 3E63A 5CSHA 3W55A 5JN2A 4QMQA 5M56A 4AT5A 4QP9A 3QTIA 4B99A 3ZSGA 3FHIA 3L9MA 2YCRA 3HRBA 2YCSA 5EKNA 1PMNA 1Q4LA 4L7SA 5EQEA 2GU8A 1QPJA 3EQDA 1YI3A 2OH0E 4AUAA 4MVFA 4R8QA 4CLIA 5BYYA 4IWQA 1MRVA 1B39A 4KIKA 2QOIA 4BGHA 4L6QA 3EHAA 3FY2A 3ZC5A 4YMJA 3FKNA 1KE6A 3Q9WA 4OTFA 1Q8YA 1LUFA 3CPBA 1F3MC 4C62A 2UZEA 5L8JA 3LFAA 3TCPA 4AF3A 2I1MA 4H3PA 4ZSEA 3W32A 2UW6A 3OCGA 4C4EA 5HG9A 3FZOA 3BKBA 3PWDA 4FTCA 5HO6A 2W05A 4GMYA 3ZFXA 2UVZA 2BTRA 2CKQA 2JFMA 1PXMA 1KOBA 2B7AA 4TKSA 4YLJA 3RP9A 4E4MA 4AE9A 3I5NA 3ODYX 4YZDA 3R7EA 2ZDUA 2P4IA 3MW1A 3I0OA 2Y8OA 3RNYA 3WYYA 3EN6A 4QMWA 3TNPC 1JSTA 2YIYA 3MBLA 1OVEA 4RPVA 1UU3A 3COMA 3KMWA 4K2RA 4HVDA 3GU4A 4IAZA 3QZHA 4M0ZA 5BUJA 4IM3A 2RFDA 4UBAA 2XUUA 2Y6OA 3JVRA 4YLKA 3RVGA 3VBQA 4D2RA 3ZU7A 4F9CA 4O83A 4MF1A 4EOPA 4FEXA 4V04A 4YHTA 3FI3A 4OTRA 5DI1A 3ORIA 4EH2A 4EQMA 4FE2A 5ANIA 5IQDA 3UO6A 1WBNA 2BFXA 3I4BA 3BYSA 4JNWA 1J7LA 1WMKA 1FQ1B 2XNPA 3QGYA 4ZLYA 4ACGA 5EDRA 5DN3A 2EUFB 2GHLA 2W7XA 4MYGA 5M55A 4DEIA 2VWUA 4YJTA 2W4JA 4FSYA 5DH3A 4O84A 4FSMA 1YW2A 4FV0A 3P7AA 4NZWB 4IB3A 3FBVA 1BYGA 3BHTA 5CNNA 2O64A 1U59A 4G5JA 4JXFA 1JAMA 5HO7A 2JDOA 4M97A 3FQSA 2VWIA 4JBQA 5LMKA 3EN7A 4X3FA 1URCA 3CCNA 3O96A 1PW2A 4XV2A 3VHKA 3VULA 4TT7A 2QOCA 4DCEA 4O7VA 3I0QA 1R0PA 3OTVA 2C3JA 1DAYA 3SXFA 3EZRA 4E8AA 5K0KA 2ETKA 3QQLA 2C5VA 1YWNA 4WNMA 4LV8A 2EXMA 3V5PA 2OXXA 4DGGA 4FSTA 3UZTA 5IQGA 5LVMA 1UWJA 4NTTA 3N4UA 4FODA 3BEAA 4JAJA 4BDGA 2ACXA 3NCGA 4L3LA 3RBWA 2XNBA 3P9JA 4GVJA 3D0EA 2G2FA 4X2JA 4DC2A 4MWIA 2BTSA 5I9YA 3MPAA 4QO9A 3D4QA 3W10A 1MRUA 2WEIA 3FC2A 4UWBA 4XG8A 4DH7A 2I0VA 4EZ3A 1HOWA 2J50A 4MD7E 4FTLA 3PDTA 2PE0A 4KRDA 4ZZOA 4IHPA 3EQBA 4PY1A 5KMKA 2F2CB 4G9RA 3U6HA 4F64A 4HPUE 3O51A 1G8AA 2QO9A 2PZYA 3QAME 2WU7A 4RT7A 1R39A 3WBLA 2HCKA 3ZEPA 4BRXA 1QCFA 3PXRA 3QKLA 3QBNA 3MPMA 3PE1A 3OEZA 3PA3A 2ETRA 3U55A 5E8VA 5AV3A 5L4QA 4NU1A 4I94A 3QQUA 2VTMA 5AX9A 5CF8A 1NVSA 4XRJA 3UVPA 5HO8A 2ZVAA 4IX6A 4TTHB 5HG5A 5ANJA 3CD3A 2HENA 4YJUA 4TNBA 4D1ZA 4DFXE 4FNZA 4ZZMA 2FGIA 5EFQA 2F2UA 4AZWA 5DG5A 5A4QA 3DZQA 3F3TA 4AWIA 4J1RA 2WQBA 5FTQA 3TL8A 3R8MA 4AGDA 2NPQA 3PY3A 3BLHA 4F9BA 2P33A 2Q0NA 4FTTA 3FMMA 3PJ2A 3R71A 4EYJA 4CMUA 1STCE 5CLPA 4PTGA 3ZC6A 3GXLA 3D2KA 4GIIA 3EQIA 1QPCA 3Q9ZA 4KA3A 1J91A 3PWYA 3NMUF 3F3ZA 2BRGA 3RNIA 3ORKA 2WTWA 4YTIA 4FGBA 4OUCA 1YOLA 3BCEA 3BU6A 4UXLA 4Q5HA 5CEQA 4K9YA 4R3PA 4F9WA 4GYGA 4GUBA 4QTCA 1KE5A 2W06A 3D7TA 3AC5A 3DZOA 3A2CA 5BQ0A 3NUSA 3OC1A 3MFSA 1FOTA 2VWYA 3WIGA 3KB7A 1H1PA 1LR4A 4YZNA 5E90A 2JKOA 4PPCA 1PXJA 3FSKA 3QL8A 2ITUA 1J1BA 3E93A 3IONA 5J95A 4I0TA 4WD5A 5JK3A 1JSVA 4DGMA 3U51A 4LL0A 2WQNA 4AA0A 3DS6A 3DTCA 2QG5A 4XYFA 5GZAA 2R5TA 5DBXA 3AC1A 1H1RA 5K5XA 4I6HA 1JOWB 1B38A 4AZVA 2XH5A 2XA4A 3TTIA 3OW4A 3QYZA 4IX3A 3R1YA 1SNXA 2JLDA 4P5QA 2YACA 3EFJA 4JR7A 3PIZA 1FVTA 3KULA 4WG5A 1CM8A 2I40A 4YJQA 5KBQA 3RAIA 5CF4A 3ATTA 3S4QA 3NVKI 2F49A 1E9HA 5DEWA 5IU2A 3NUPA 5KNJA 4W4YA 1S9IA 4BDJA 3Q3BA 4OR5A 2R2PA 4EYMA 4JDIA 2AC5A 2I6LA 3QD3A 4G6NA 4PX6A 2WEVA 4GG5A 5IQCA 2BFYA 3RPSA 4XOZA 4BYJA 3ZHPC 1WBSA 3SVVA 3COKA 3AT2A 4X21A 2DQ7X 4EOQA 5G1XA 4FV1A 4XG6A 4EZ7A 1SMHA 4KSQA 3PA5A 4LFIA 4XBRA 4H58A 5TT7A 3VS6A 4EHEA 3AD6A 2C6OA 2UUEA 2W9ZB 1R78A 2C6LA 3BI6A 3P86A 3VS2A 3NAXA 3Q4ZA 4QMYA 4FBXA 1V0OA 3M42A 2V7AA 1IR3A 4LYNA 5HBHA 5AV1A 4TNDA 4ACCA 2QONA 1HCLA 2VN9A 3DDPA 2VX1A 4M15A 5K3YA 3L8SA 2X2LA 5I0BA 3BYVA 5I5ZA 1OL1A 1YQJA 2Y4IC 2C47A 4KSPA 4L44A 1DAWA 3VQUA 4EONA 4XV9A 1H0WA 1CSNA 4BN1A 2BIYA 3M2WA 5DIAA 2ZDTA 3HV5A 4IQ6A 4U9AA 2QVSE 4JLCA 5AUWA 3UODA 3ZTXA 2JAMA 3GCUA 3TV7A 1WAKA 3QQGA 3VBTA 3LQ8A 3OCBA 1OUKA 3BHYA 3KMUA 2HELA 5KO1A 3E62A 3QCXA 1OPKA 3U9NA 5GJGA 3BRBA 3L8XA 3CJGA 1GIIA 2VZ6A 3QZFA 3LM5A 4ACDA 4DINA 4CKRA 3P79A 4R78A 2OFVA 5IQAA 5CAOA 2VNYA 3HGKA 4GU6A 4MWHA 4ZSLA 5HTCA 4DE4A 4GG7A 2R4BA 4PMSA 3ORLA 1FGKA 3AMBA 4C3PA 3HMPA 4IX4A 2JKMA 1YWVA 3FYJX 4ZTMA 5F9EA 5FBNC 5BVWA 2XMYA 3EYGA 3TIZA 2HIWA 4W4VA 2PMOX 3R8PA 1BL7A 2ZOQA 4ACHA 2YDIA 3DJ6A 2XNGA 2PMIA 3WILA 4EWQA 2PE1A 3CXWA 2J0LA 4UMRA 1A9UA 4HZRA 3A60A 2HWPA 5EM8A 3GU6A 2BDJA 2G1TA 3LFFA 4FV6A 2Q83A 4NKSA 4BHZA 5KMNA 5HX8A 3ZFMA 4E20A 3C50A 3F61A 4TYHA 1IAJA 4TYGA 2ZV9A 2R64A 4NJDA 4BIEA 2XVDA 3UOHA 1PY5A 2X2KA 4ZTQA 4XX9A 3D94A 4ZSJA 4EOOA 2NO3A 2UVYA 4NL0A 5A4TA 3PVBA 4QMXA 4J53A 3DOGA 4C33A 4L46A 4AOIA 4GRBA 3ELJA 4IDVA 4LOQA 2XIXA 4P2KA 3R63A 3G2FA 2PVNA 3O17A 3E87A 4II5A 4AW5A 3FLQA 3I60A 4E6AA 3ZXTA 3BYOA 3FMLA 4MBLA 4JX7A 3VNTA 4Z16A 5CEKA 5FXRA 4J99A 1OZ1A 2PL0A 3Q5IA 4FG9A 3W18A 3FWQA 3FKOA 2C0IA 4EZ5A 2JIVA 3C1XA 3DKFA 5L6PA 1B6CB 3DPKA 3A8WA 2B4SB 2YLFA 3IKAA 3KN5A 3O2MA 3PUPA 3I7BA 4JBPA 3LCDA 4IADA 4M66A 3QYWA 4E93A 3SA0A 4EH5A 4BL1A 3OS3A 4H05A 4IZ7A 2PZPA 2H6DA 4ALVA 1O6LA 4HNFA 4EEVA 4ZXTA 3QKMA 1BMKA 3MV5A 3ANRA 3TNWA 3W2SA 1GOLA 3GCSA 4D55A 4O0VA 5J1WA 1RDQE 4QNYA 4RVTA 3VC4A 3L8PA 3Q4TA 5K0XA 5DT0A 2X39A 3NX8A 5CXHA 4XP2A 2R0UA 3LFCA 4GVAA 4GSBA 4JVGA 2PWLA 4Z7HA 5EOBA 2J0JA 3P5KA 3WZDA 3NW6A 4NJ3A 5BMMA 1U5RA 2R3MA 4QMTA 3AT4A 2YERA 4MX9A 5AV0A 5DWRA 4DEBA 4H36A 2BIKB 2C6TA 4UV0A 1H1QA 4USFA 3KMMA 3C5IA 2ZV8A 2ITQA 2OJFE 3BX5A 3EFWA 5C03A 4G17A 1YDSE 3SAYA 5EW9A 3RCJA 1SVGA 3ACJA 3HDNA 4RFZA 2A27A 4MKCA 5CU2A 5E8XA 4EOKA 1WBTA 5ANKA 4D9UA 2QLUA 4RLLA 2R3LA 3NNUA 3GB2A 4UWCA 4XV1A 3ZEWA 4DFUA 4FX3A 4FVQA 4O21A 4UMQA 5L2QA 3COIA 4I4FA 3KXXA 4CMOA 1KUTA 4IAFA 3MA3A 3NW7A 4I6QA 3P7BA 5E8YA 3PPZA 3K5UA 4IE9A 2CCIA 4BY9E 5HESA 4JOAA 3PRIA 4APPA 5BVFA 1QPDA 2A4LA 4ITJA 3POZA 5CSXA 4EL9A 4U81A 2R3PA 3GC7A 2VO6A 4U40A 4HGEA 4MXXA 3CJFA 3O0GA 5DMZA 3TZ9A 4BTFA 4F1TA 3PSBA 5B2KA 3MWUA 3F2AA 3HV6A 5AA9A 4QTDA 2V5QA 4AS0A 5H9BA 5F94A 3CKXA 1BL6A 4LQMA 3MY0A 2JD5A 4FZAB 4H39A 4YJPA 4LMNA 4ITIA 3A8XA 2OLCA 4FYNA 5C8MA 5L2TA 4A9SA 3FMNA 4RZVA 2JBOA 3C7QA 3RKBA 2OIBA 4RIOA 3QUEA 1PMEA 4BTJA 3TKHA 3SKCA 4YNEA 3OROA 4H1JA 2WOUA 4O91A 2YIXA 5CAVA 3R21A 5FDPA 3SXSA 1TVOA 2OKRA 3GQLA 3ZH8A 5EYCA 3FPMA 4FT0A 5IUHA 3LCSA 2BDFA 1MQ4A 4ZIMA 2F7EE 1NVQA 2ITWA 1Y6AA 3ANQA 2G9XA 2EXCX 4CVAA 2Y4IB 3LPBA 3RK9A 3F69A 3MIAA 1EH4A 4S2ZA 5FTGA 4UMUA 5AUUA 5CU6A 4QQTA 5IDNA 4FV9A 4IXPA 4ERWA 5AP1A 2YZAA 4FTUA 1XH4A 4EUUA 3OCSA 2VTIA 4C57A 3QWKA 4TXCA 4ITHA 3ORPA 4O0XA 2WIHA 2BAKA 5AEPA 5EYDA 3G5DA 3EOCA 5IEVA 3NS9A 3ZDUA 2QD9A 2YA9A 3PY1A 5H8BA 4E73A 2QKRA 1ZZ2A 4J7BA 4FIGA 5CEPA 4D4YA 3S3IA 3IECA 5AR2A 3CPCA 5KX8A 2YIRA 2HXLA 3W16A 4I24A 4F1OA 3EMGA 3TM0A 3ZLYA 2UZWE 2WMVA 5AMNA 4D4RA 5JFXA 5BMSA 5HNBA 2UW0A 5HE2A 4FSRA 3MS9A 4ZMFA 3RAKA 3Q04A 3V5TA 3QA0A 5KCVA 3LJ1A 4W9XA 2IG7A 4FEUA 2Z7LA 3ET7A 4DEHA 3UQCA 5FWKK 3OOMA 5IDPA 4K6ZA 4CFXA 3IW6A 2OZAB 3JXWA 2I7QA 4CFNA 5I9VA 4U45A 4UXQA 4V0GB 1FMOE 3HMMA 4LL5A 2GQRA 1F5QA 2JBPA 2R9SA 2XJ0A 2GHGA 1XBAA 3CGOA 5JZJA 1GZ8A 2OIQA 4L7FA 4HZSA 5FXSA 3KRWA 3K3JA 3TUBA 2WMXA 2QKWB 4BDBA 2YWVA 4FOCA 1W7HA 2R3GA 1WCCA 1O6YA 5CANA 4ZAUA 2YEXA 2IZUA 2WB8A 3MA6A 4HNIA 3UQGA 5L2SA 2QOQA 3EQCA 4ZS4A 2W4KA 3LJ0A 4FUYA 3ODZX 4ZTHA 5JRQA 3IDCA 1H25A 4PPAA 4C4FA 1V0BA 4WRSA 3UC4A 4IFGA 3TUCA 3OXTA 2WQEA 1JKKA 3HP2A 2YABA 4GV1A 2YM3A 4XP3A 4YJNA 4FL2A 3LLTA 2ERKA 4G3DA 2UZBA 4MD9E 3SHEA 5GHVA 2ZV2A 2PTKA 2IW8A 4XOYA 2GNGA 1BKXA 4QMLA 1YHWA 2CNUA 4E4XA 3VW8A 5LVPA 3UNZA 2XKEA 4RJ3A 3IOPA 1M14A 4X2FA 4WRGA 4FG7A 5AV4A 4BFMA 4UN0C 4RA4A 4ZTRA 4FV2A 2XF0A 5HHWA 2VNWA 3LMHA 5CNOA 3I7CA 5I3RA 1PMUA 5HTBA 3G9LX 4G6LA 4K18A 4E4NA 1Z5MA 2NRUA 3IO7A 4OTPA 5HVYA 4L9IA 5J5TA 3FXWA 5FLFA 4E5BA 1ATPE 4AFEA 5HNGA 1LEZA 3ZCLA 4USDA 2FA2A 4WO5A 4BBFA 3UQFA 3DBCA 2A0CX 3UPXA 2OZOA 3NNWA 5HD7A 5HVJA 4H1MA 4ZLOA 2ITPA 4ANNA 2HW7A 3JY0A 3CIKA 4MHAA 3QQKA 4AZSA 4DAWA 1JVPP 2QOOA 5E7RA 5CSWA 4PP7A 3V5JA 1A48A 1DI9A 1ZZLA 4Y46A 3R30A 2W96B 3UNJA 4QYYA 5ITAA 4LI5A 2P55A 2W4OA 3NDMA 3NGAA 4IAYA 1YXSA 5J9LA 3KA0A 4O2PA 1H27A 1RJBA 2ITOA 3QHWA 5JGAA 3O8PA 4BI1A 1P5EA 2VV9A 2C3KA 4OAUC 4PMPA 4PV0A 5CEIA 3LW0A 2R3IA 3GOKA 3H10A 3RPYA 2RG5A 3L9NA 2VUWA 4TWOA 3VUHA 2XIRA 1ZOEA 3R9OA 3RAHA 4YSJA 4TWCA 4YP8A 4B8LA 3FI4A 3QD2B 5M4IA 4IX5A 2BVAA 4RX7A 2YZLA 3ZYAA 2OXDA 3ENMA 4F0GA 2ZMCA 1O6KA 4KUJA 4D28A 4QPSA 5I9XA 1H08A 3ZUUA 4PNIA 3PP1A 5BYZA 1O9UA 3EQPA 1UKHA 4KIQA 4RJ6A 2ERZE 4F7LA 3MFTA 4ZTNA 3FLWA 5AIKA 3PIXA 3FLYA 4RWJA 2RF9A 4TY1A 4I0RA 4KABA 5FM3A 2VO7A 4KAOA 5I4NA 1L3RE 2B9HA 2CGXA 3PSCA 4O7TA 2CNVA 4MF0A 3FXZA 2DWBA 1BX6A 3LMGA 1XO2B 2F9GA 2PVJA 2O2UA 4XBUA 5D41A 3QA8A 2BAQA 5HOAA 4ALWA 2OJGA 3F66A 3FUPA 2W1CA 4M12A 4DT9A 2QO2A 4U79A 4IB1A 4M69B 5A6NA 4AU8A 1Y8YA 3IGOA 2IN6A 1WBOA 3AOXA 3S00A 3W33A 4YPSA 4AT3A 4P4CA 3OWJA 4CG9A 3P0MA 5BYLA 1VEBA 2BDWA 5E8SA 2PHKA 5D10A 4I20A 4FV8A 4JG6A 4FEWA 4O0TA 4D2TA 4C4IA 5EG3A 4QP1A 3QQFA 4JIKA 3LQ3A 3G9NA 3DT1A 3K54A 4DBNA 1WFCA 4X2GA 2X9EA 3TG1A 4BIBA 2QURA 5C27A 3VUTA 5C01A 4RSSA 3DKGA 3WF9A 3U4WA 1APME 1ZYCA 2ZYBA 4IC8A 4WG3A 4A7CA 3ZOSA 5AP7A 2UVXA 3R83A 3IDBA 2C5OA 4K8AA 3EN4A 4L01A 4BCFA 3BPRA 3CKWA 3FPQA 4U80A 2G15A 4RIWB 4JG8A 4JAIA 3FDNA 3Q53A 5FEEA 5A4CA 4U3YA 4FKJA 3QQJA 3DAKA 4ANBA 2EVAA 2GS6A 3RMFA 4ANMA 2UZLA 3OUNB 5DNRA 2C4GA 5F20A 3NR9A 5J5SA 2XB7A 3FSFA 4KIOA 2JDVA 5DLSA 3KF4A 2IZSA 4GS6A 5M07A 2YLEA 1ZYDA 4PDPA 3CQWA 4HYSA 5LCJA 3HAVA 1Y57A 4IIRA 1FINA 3OP5A 3ORTA 4I6FA 4FGRA 2ZM3A 2WTDA 2OICA 2RL5A 3OT3A 2WHBA 1JKTA 4DA5A 2GNIA 2WO6A 3M1SA 4U0IA 4O6LA 3QHRA 3TACA 3TIYA 5ANGA 4NM0A 2Q0BA 3TDWA 2VGPA 2ZM4A 4WSQA 4O7WA 1PF8A 4KKHA 1ZYLA 3FHRA 3KU2A 5A4LA 4F6UA 1PYXA 4I5PA 1WBVA 3EYHA 3JS2A 2FB8A 5FD2A 3Q2JA 4FTQA 3E3PA 3IS5A 3E92A 3EFKA 3NSZA 4O0SA 4S32A 3Q96A 2IVSA 4RWIA 3TXOA 1KOAA 3HZTA 4IAAA 4KKEA 4L42A 4Z9LA 5HE3A 4CLJA 4YJSA 3FL5A 2WMQA 2GDOA 5JT2A 2BRHA 3MVMA 2JIIA 4FL1A 5EM5A 2GQGA 3PJ8A 4I41A 4QTAA 2ZB0A 2FUMA 3ACKA 3ORNA 3AC8A 5CAQA 4AN3A 3S1HA 5KMOA 4D1XA 5DR9A 4XEYA 2OW3A 3UG1A 2YDKA 3FMHA 5HLWA 1J3HA 4HGTA 5IA2A 5LWMA 3UDBA 1H07A 5ETCA 3RTPA 4B0GA 4BCQA 4DH1A 1UV5A 1XR1A 4IANA 4P7EA 2B55A 4LOOA 2FYSA 2CLXA 5L8LA 1H24A 3GFWA 2OGVA 5FUTA 2GTMA 5HD4A 5E9EA 3JR1A 4DGLC 3THBA 2HZNA 4RIYB 5E91A 4IVCA 3P4KA 1PMVA 4R77A 4RC2A 4B7TA 2BKKA 3REPA 4PPBA 2YM6A 3LHJA 3ROYA 2IW9A 4JDKA 3UMXA 3LIJA 3UYTA 5EHOA 4D9TA 1GZNA 2RFSA 4FSUA 3N9XA 4L00A 5IEYA 4FNYA 3FLSA 5A14A 2PU8A 2W99B 1URWA 5M4UA 5M06A 3FMDA 5AADA 4S30A 1MUOA 3HDMA 4F70A 5A4EA 1GIHA 4YUQA 4Z55A 1QMZA 3C4CA 4GU9A 2O0UA 4UMTA 2ZJWA 5HX6A 4FIHA 4QMUA 5DPVA 4FZ6A 4WNKA 3V04A 3F5UA 3MSSA 4XJ0A 3EQGA 4MNFA 3HV4A 5CT0A 1WBWA 2XYUA 3FV8A 4ZOGA 2C1BA 1ZOHA 2XK6A 5JGDA 3C4EA 4LGDA 3A7GA 4XG2A 4BIDA 3OBGA 1VZOA 3FKLA 3BE9A 5AJQA 3HMNA 4Q5EA 3BU3A 3HVCA 4DH3A 4C58A 2OH4A 4BDCA 3R6XA 4L8MA 3TV4A 3ZXZA 1P4FA 3A99A 3ZLXA 2FSTX 5ACKA 3OXZA 4BGQA 5IA0A 4YTHA 4XG9A 4QMNA 4XP0A 3UC3A 3V6SA 2QNJA 3K2LA 3SQQA 4BWPA 2A1AB 4CTCA 4Y95A 5GINE 3V3VA 4FIJA 3RGFA 4DLIA 2H96A 4K77A 3R7UA 4E6CA 3LXKA 2V0DA 4R5SA 3CC6A 1ERKA 3KEXA 3VJNA 2PVRA 1H4LA 1Q8UA 3ZO4A 3R7OA 1JKLA 4O81A 3MYGA 5AUYA 1XH8A 3BLRA 3HRCA 2WXVA 2PVHA 3R7IA 4EKLA 5I9WA 2OZAA 3R8LA 5J79A 4V0GA 1M2RA 1M17A 5K5NA 3IPHA 2C6KA 5AP0A 1ZY5A 4CSVA 5CY3A 5LWNA 2WU6A 1UNHA 4I92A 1LPUA 3F2NA 1Q3WA 3POOA 4GIHA 4BBMA 3GT8A 4HCVA 3ORZA 4CCBA 3HECA 3DY7A 3KXHA 4NFNA 3KVXA 4CYJA 4EHVA 3IG7A 2R3KA 1TQIA 3DKOA 2GFSA 3NUUA 3GCVA 4BI0A 5CQWA 4DTKA 4HVSA 4A07A 4D5HA 4ZMEA 2PUIA 5HCZA 4BDAA 4R7BA 3QZIA 4C59A 5AUTA 4CFMA 3QKKA 3K3IA 5HBEA 5DT3A 4Y85A 3B2TA 2Z7RA 5GNKA 4EOSA 1UA2A 5JFSA 2WMSA 3TTJA 4GKIA 2WGJA 3R9NA 2WMRA 4FK6A 2O63A 3U87A 1UKIA 5KMJA 1V0PA 2OFUA 1GIJA 3BYMA 4WUNA 4QQJA 3OT8A 2BUJA 3MVHA 4LRKA 2X8IA 1DM2A 4LG4A 5DRBA 5ANEA 3WI6A 1PXPA 4GL9A 4BCGA 4BCIA 3RK5A 1OKYA 4K1BA 5CALA 2Z02A 3FYKX 2EWAA 3E7VA 3PIYA 1WVWA 3T8OA 1SVEA 2HZ0A 3BBTB 4NEUA 3KREA 5IQHA 5IF1A 2YIQA 4X6QC 5AP3A 5T6KA 4JR3A 4IVDA 5A46A 2HY81 3BLQA 1H00A 2VTHA 2WQOA 5D7VA 2PUUA 1XJDA 3NUYA 1JSUA 3KK9A 3GC8A 2W1IA 1CKJA 3SC1A 2Z60A 4PMMA 4NYEA 3BWJA 3PXZA 4JDJA 3NW5A 4K33A 3VQHA 4E4LA 5BX0A 1W82A 4BCNA 2CN8A 4ZSAA 2XBAA 2PMLX 3MH0A 4RVMA 4DG3E 5TO8A 2CSNA 2P3GX 3A4PA 4U8ZA 5J8IA 5JEBA 2O5KA 1GAGA 3Q6UA 3A7HA 4XMOA 3R7YA 2QR7A 4QYEA 5HVKA 3SW7A 3RI1A 2QC6A 2VAGA 2OF2A 2R3FA 4ZLZA 3CY2A 1YKRA 4X2KA 5HE1A 4X0MA 4Z7GA 4O7NA 3AC3A 4JQ8A 4G3CA 2RFNA 4RX5A 3OW3A 4FUXA 4CG8A 4NM3A 2BHEA 2CDZA 1CDKA 3F9NA 3VF8A 4DCAA 3C4FA 2C5NA 4IVBA 3QTQA 2J6MA 3GENA 4G3GA 2R3JA 2F4JA 3KK8A 2VO3A 4I1ZA 2IZRA 1K9AA 1W84A 4IJPA 2VX3A 4J98A 4HGSA 3FLZA 5ETAA 4I21A 3IGGA 3BBWA 2WD1A 4ZJJA 3Q4CA 2CGUA 4IAKA 4L67A 4N4SA 2AYPA 3TJDA 1FGIA 2J0MB 3MDYA 4AZFA 3CSVA 4PF4A 4XS2A 1RW8A 3C4XA 4FMQA 5E1SA 3UP7A 2BKZA 3VUIA 4ZTSA 3EKNA 4U44A 5G6VA 5BVDA 3VS5A 4DHFA 5HU3A 3FZRA 5GZ9A 3CEKA 4AOTA 2XK4A 1H1SA 3GU5A 3MIYA 3SRVB 4N70A 3U54A 3KRJA 1UNLA 4FR4A 4R5YA 2J0KA 5EM7A 2O65A 1QPEA 4KS8A 5KMIA 3FJQE 3F7WA 3FMEA 4C35A 3TKUA 1AGWA 4QRCA 5FP5A 1KWPA 1CMKE 2A2AA 3QTWA 1W8CA 4CT2A 4ANSA 3DB8A 2BPMA 3LZBA 3AXWA 4NSTA 4HCUA 2JEDA 4FVPA 4XG4A 1ZAOA 3EL7A 3MPTA 3PLSA 4CRLA 1HCKA 4FV5A 2IZTA 1Y6BA 4CGAA 4EH4A 2W0JA 4M69A 4F7SA 4FKWA 4FTRA 4O2ZA 4W9WA 5DGZA 4BCPA 3VS3A 5HQ0A 3FEGA 3DB6A 3EQFA 4FKGA 4BCMA 2QO7A 4QYFA 2CGVA 2WOTA 4RJ4A 4Y5HA 4NTSA 5EQPA 4UMPA 1RQQA 2OO8X 1OL7A 5J87A 3PJ3A 3G0EA 4HPTE 3LOKA 4AGCA 5IMEA 1H8FA 1ZYSA 3H9FA 3MGYA 3QXOA 3R1SA 3VN9A 2CKEA 4YC8A 1JLUE 2PVYA 3P78A 4C4JA 1U54B 4QP8A 4QMSA 2WELA 2LAVA 4UX9A 1OPLA 5AP5A 5JFWA 3QWJA 4QMOA 5J7HA 2XK7A 3E3BX 3W2QA 1ZMWA 3DBQA 3QD0A 3ULIA 3ZO3A 3OG7A 4PQNA 5IZFA 5ANDA 4EOLA 3MJ1A 4XCUA 4GK3A 5CSPA 4L45A 2VU3A 3QCYA 4U41A 1CTPE 3IQ7A 4C0TA 4L52A 3R73A 4YHJA 4HCTA 4ZK5A 4FICA 4DYMA 4YBKA 4G6OA 3ID6C 4PWNA 2F7XE 5IQFA 4X3JA 5LCKA 1OIQA 3GQIA 4KD1A 5HGIA 4RIWA 2XM8A 1XH6A 4O0UA 3QGWA 4WBOA 3BV2A 5H8GA 3HNGA 4CCUA 5E92A 4CV9A 2ITTA 4KKGA 3DKCA 4D1SA 3HX4A 3Q5ZA 4MH7A 4I0SA 1PKGA 2A19B 2XJ2A 3NUXA 4LUDA 4QPMA 3WZEA 3CQEA 3RALA 5K4IA 5AAFA 2C6MA 3NIEA 4UZDA 2QU5A 2Z7QA 3LLAA 4U6RA 1YWRA 3O7LB 5BUIA 5GJFA 4FSZA 2Y0AA 3NLBA 3EL8A 3A7FA 4OGRA 1JQHA 4N0SA 3W8LA 4N57A 1F0QA 2GPHA 4X7QA 4ZS0A 4EK6A 5CZHA 4E5WA 2XCKA 4KBKA 4R7HA 3MVJA 2AUHA 1W83A 1SZMA 3OTUA 4OBPA 4FT3A 4OTGA 5C8NA 2XRWA 4FZFB 2JKQA 4AN9A 4IWDA 5HNIX 4GYIA 4DN5A 1G8SA 3AC2A 3OWPA 2QOLA 2CN5A 3CTHA 3PYYA 3SG8A 2E9VA 4UB7A 5E8UA 3PVWA 4ZSGA 3GOPA 4ASZA 5L6OA 4HVIA 4EK5A 2X7FA 4FC0A 4OBOA 2YITA 3OVVA 3Q9XA 1KV1A 4TWNA 1P4OA 3H0YA 4F0IA 3L9LA 2UW5A 2Y4PA 2UZUE 4DH8A 3A4OX 5B0XA 4A06A 3ROCA 3KL8A 4EH9A 5LVLA 1U5QA 2QG7A 3DK3A 5CASA 5DHJA 5BVNA 3O71A 1GZOA 3BV3A 1M7QA 5HCYA 3QALE 4KBAA 3PE2A 4P90A 3GU8A 4RG0A 3PLAE 5TR6A 2JFLA 4X6RA 3DK7A 4U5JA 3EN5A 3R00A 1VYWA 3S2PA 2PUNA 3RINA 4DEEA 4AXAA 4S31A 4FTOA 2BZIB 4IEBA 3QQHA 4TN6A 5LMAA 4LGGA 3FMKA 3UIBA 3N51A 4AQCA 3DJ7A 4PL3A 2BCJA 5EI2A 4RQKA 3FI8A 1T46A 3B8QA 3A7IA 3DBFA 4EH3A 2FSLX 5AFVA 2B54A 3MH2A 2E9NA 1JBPE 4FEVA 1OL6A 1YXVA 4RIYA 5GIPE 2YHVA 2C5XA 3TUDA 4JIAA 5EOLA 4ZEGA 5HTIA 1Q97A 4BC6A 2V7OA 2UV2A 4AA4A 4O7ZA 4FNXA 1BUHA 3C51A 3HL7A 4IH8A 5JZNA 2XIZA 4GFMA 4OBQA 4E26A 4ANQA 3G6GA 3PJ1A 4AGUA 3TT0A 3OUKA 5J9YA 3FZ1A 5IA3A 4YSMA 5IH5A 2ZB1A 5FQDC 3LM0A 5C9CA 5C1QB 3ZMMA 2ZV7A 3R01A 2ZMDA 4H3QA 2C6IA 1P14A 2YJSA 3FAAA 1SYKA 3F5GA 3QTRA 4FL3A 4YBJA 3L8VA 4CTBA 3BHVA 3RWQA 3QTZA 2OSCA 3DTWA 5CS6A 3NYNA 4IM2A 4Q9ZA 3TNHA 2HW6A 2SRCA 3B2WA 3PG1A 4RRVA 2CHLA 4O27B 3ZBXA 3F88A 4F4PA 2XNEA 1XKKA 2BRMA 1YHVA 4FOBA 5EH0A 1W0XC 4MXYA 1SM2A 4USEA 4FTMA 4DFYA 4DBXA 4JG7A 2AC3A 3QRJA 5B2MA 1IA9A 1TQMA 1PRYA 2NP8A 2XEYA 4GK2A 2C6EA 4AN2A 4D2PA 3PA4A 4AACA 2G2IA 3LFQA 3I79A 4AW1A 4CD0A 2WTCA 3RZBA 5C4KA 5B2LA 3SGCA 2GNLA 2GFCA 5EKOA 4BDFA 4OTIA 4C4HA 4TZRA 2VWWA 4OTQA 4CZYB 1IAHA 4S34A 2XKDA 4DF3A 1NVRA 3CTJA 4GFGA 4M3QA 5D7AA 4B8MA 3QLFA 3ZZWA 4PDYA 2C68A 2WTJA 2W5HA 1Y8GA 3TJCA 4RQVA 5EI6A 4S33A 4WHZA 4ZP5A 4YJRA 3E88A 5ETFA 2J0IA 2H9VA 4HVGA 4UZHA 5ACBC 3D5UA 1OL5A 5GJDA 2KTYA 4BCHA 2OJIA 5HKMA 1M2QA 1Q8WA 5ICPA 1OM1A 4TRLA 4D2VA 4CKJA 5LVNA 3VUDA 1ZRZA 3ZSHA 5DFPA 3EIDA 1OGUA 4BR3A 3D2IA 2BHHA 1ND4A 4G1WA 2VTJA 4WG4A 3UE4A 4BTMA 4F63A 4BHNA 5JH6A 1UWHA 2R3QA 4C7TA 2RFEA 4QMVA 5I3OA 2OF4A 3VW6A 3QUPA 4I6BA 3DNDA 3VRYA 5FRIA 2IVTA 4D4VA 2XK8A 3GC9A 3DFCB 1I44A 3VIDA 3MN3A 5CX9A 5IKWA 3ULZA 4E3CA 1H26A 3EZVA 4GK4A 4DGOA 3VJOA 2BALA 3LFDA 3PRFA 4FV7A 1BLXA 5M44A 3O7LD 3MFUA 4DTAA 2W1HA 2XCHA 5M53A 3R9RA 1KE9A 5HICA 4NH1A 3MJ2A 3FY0A 5AR4A 3VBWA 1MQBA 2G01A 2ITZA 2CKPA 5ANOA 5IA1A 3E8EA 2XKFA 4DTBA 4F9AA 2WAJA 4ARKA 4QP4A 5T68A 3MFRA 3NEWA 3D9VA 5AM7A 3V8SA 5L6WL 3KKVA 5CQUA 3UVRA 3CD8A 4QP7A 3DLSA 2UW4A 2VTRA 4JBVA 2HYYA 3QX4A 2I0YA 5HE0A 4O7RA 2WTKB 2YAAA 1X8BA 1YHSA 5H2UA 4AA5A 4ASXA 2GQSA 4M84A 2VTNA 4WIHA 4YO4A 4YPDA 2P2HA 3CTQA 5L2WA 3R02A 2RSVA 4GT4A 3FLNC 1MP8A 4Y73A 3KXNA 1JWHA 2ZM1A 4FT5A 2LGCA 4RBLA 3RPRA 3WE8A 2VTLA 5E8ZA 2YM8A 2W1DA 4WSYA 3PSDA 3C9WA 5DR2A 4OW8A 2J90A 2X81A 3TWJA 4W8DA 3ORXA 5EHLA 1I09A 3AG9A 2FO0A 2DUVA 4LOPA 3RHXA 3OWKA 4IB0A 4RMZA 4DEAA 4RVLA 2R3RA 4XRLA 4GJ3A 2W1ZA 1AD5A 3HV7A 4M7IA 5C4LA 4XV3A 5FEDA 2GS7A 4HYHA 3RWPA 2WPAA 1WBPA 3VS1A 3GU7A 3M11A 3QRIA 4IM0A 3PXYA 4RIXB 3SV0A 4BYIA 4Q2AA 1ZWSA 4QQCA 5TKDA 2XNMA 2UZNA 3P08A 1VJYA 5CYIA 3GUBA 3TEIA 1PHKA 3D5VA 2H8HA 4YC6A 5F95A 3SRVA 4BDIA 5HZNA 4J96A 1OL2A 1K2PA 4PUZA 4FIEA 2WTVA 3EQHA 3GBZA 3CBLA 2CPKE 5AR3A 3L1SA 5DR6A 4C34A 4O7YA 3JUHA 4LUEA 4XG7A 5CTPA 2C5YA 5CVHA 4EH6A 4O7LA 2QOFA 2UZDA 4YZBA 4M0YA 4O0WA 1PXOA 4U43A 5CI7A 4RWLA 4NIFB 5D11A 1YDTE 3HUCA 4FKVA 5EK7A 3ZZEA 3KY2A 2HOGA 3PJCA 4BDEA 3GFEA 1AQ1A 4EKKA 4C38A 4I4EA 2XIKA 2JITA 4QNAA 2E9UA 3U4UA 3WF6A 3BHHA 3LCTA 4B9DA 3G15A 1UVRA 5KZIA 2XK3A 1Q61A 2X8EA 4FZ7A 1E1XA 5K9IA 3TZ7A 3BGZA 5JGBA 1OKVA 1PXLA 3KF7A 5HCXA 3DFAA 4BKJA 5IMXA 3HA8A 4M68A 4XLVA 4FKUA 3UYSA 3MY1A 2VX0A 4U42A 1YXTA 4UALA 2B1PA 3D83A 3WARA 2C0TA 4O96A 5KKRB 2IVUA 3UZRA 2J9MA 5AR7A 4TYJA 3LFSA 3OHTA 3ZBFA 4QP2A 3COHA 5BVKA 2ITYA 3LE6A 3P7CA 3S95A 3TN8A 1NA7A 3LJ2A 1Y91A 2C6DA 3WE4A 5HLPA 3F2RA 4GW8A 4NM7A 4I23A 4YTCA 3DBDA 4QMMA 4EOIA 1K3AA 2VWVA 3PXQA 4FKIA 4DFZE 1NW1A 4CKIA 4RJ7A 3R28A 3F5PA 1OMWA 2UW7A 3QRUA 1PXIA 3R7GA 3GNIB 1QL6A 2JIUA 1OECA 4FSNA 5LJJA 4HOKA 3F3WA 3UG2A 2QI8A 2ITXA 3I1AA 3ZM4A 3LFNA 3D15A 3RPVA 2QU6A 2PK9A 4RFMA 4MNEB 4A4OA 2VRXA 3ZLWA 4IWPA 4A4LA 4A9YA 2Y6MA 4FZDB 3TKIA 4AW0A 2OU7A 2VD5A 4DGNA 3Q9YA 5CSVA 3DGKA 4F08A 3ATSA 1XBCA 4AFJA 2QOBA 5AP2A 3ZO1A 5A6OA 2W1FA 5A3XA 1FMKA 3DLZA 3ERKA 3EQRA 4RLKA 4G3EA 3PPKA 2IW6A 5HIBA 5TE0A 3WF8A 3E8NA 5CZIA 3HMIA 3QF9A 3QFVA 3RCDA 5L3AA 4H3BA 2PZ5A 2VWZA 4FKRA 3SW4A 4MXCA 3V5WA 3AD4A 4DEGA 4O86A 1G5SA 3OWLA 2B52A 4QP3A 4CMTA 5IQEA 4EC9A 2HXQA 2VTPA 2YM4A 2J5EA 3AGMA 2R3NA 3I6UA 4GFOA 5D12A 3VS0A 5K4JA 3QZGA 3V8TA 3N4VA 4J97A 4EK8A 3FQHA 4KIPA 3O8TA 4CV8A 3II5A 3VUGA 3RK7A 3IW5A 5CU4A 4RC4A 2W1GA 3UMWA 5BPYA 4C4GA 1NXKA 4C2WA 3ORMA 3BHUA 2PVMA 2C3IB 2BRNA 3DQWA 4QQ5A 2HY0A 3BELA 4GJ2A
chains in the Genus database with same CATH superfamily
4BF2A 5DOSA 4UWYA 3ZRLA 4BKZA 3EJ1A 5IA4A 3F5XA 3WF5A 2X6DA 3H30A 4ZZNA 4IAIA 3WIKA 3ZM9A 2OI4X 2W17A 2WMBA 4FTNA 4TYIA 5HLNA 3IOKA 2XZSA 4C8BA 5KMMA 4DHJA 2V55A 2IJMA 1H28A 4ZJIA 3D5WA 1U4DA 4GKHA 3ML1A 3RPOA 5HU9A 2FH9A 2Y9QA 5CU0A 3OFMA 1GJOA 4BKYA 2CCHA 3LAUA 4PP9A 1BI7A 3VS4A 2EB3A 1KV2A 3DA6A 3VF9A 4IC7A 2R0IA 4G5PA 3R9HA 4RJ5A 3PXKA 5DA3A 4D0WA 1LP4A 3BEGA 3LFEA 2E9PA 3UOLA 4ANOA 4ASEA 4FK3A 5CF6A 3GI3A 4FSWA 4FKLA 5EW8A 5AV2A 3R7VA 4F7JA 2OJJA 5AP6A 1E1VA 1XH7A 4IZYA 1IG1A 5FGKA 4ENXA 1XQZA 5LOHA 1DI8A 4L3PA 3UDSA 2B9FA 5HIDA 3LCKA 2W5AA 4HW7A 5AAEA 3PZHA 4BCKA 4D5KA 3P1AA 1ZYJA 2PVKA 3QUDA 5KMLA 2XNNA 2PMNX 4QP6A 4F09A 1JPAA 3NYXA 2RG6A 4M14A 2B9JA 3IW8A 1ZXEA 3OY3A 1DS5A 3Q60A 3HEGA 4JQ7A 4KINA 4NK9A 1IA8A 5E8TA 4BCJA 2GNFA 2X1NA 4YZCA 3UTOA 4YO6A 1VYZA 4MEDA 3PVUA 5KUPA 2Z2WA 4F7NA 4QD6A 4OTWA 1XWSA 2P0CA 3A61A 5EDPA 1ZMVA 3SDJA 5CAPA 2E9OA 3NZ0A 3FZTA 3K5VA 4GUEA 4I5HA 4E5AX 4PTCA 5M51A 3MTFA 2E2BA 3CS9A 2QOHA 3VBVA 4BI2A 2AQXA 4BTKA 3HLLA 4RA5A 4IVAA 5F1ZA 3MH1A 2GNHA 3BQCA 3VRZA 4FV3A 3CQUA 1ZLTA 5CU3A 4OLIA 3UOJA 2R3HA 4WA9A 5DE2A 4I3ZA 2ITNA 4UY9A 5AUVA 2HWOA 5GIOE 4TL0A 5M08A 3SD0A 4ACMA 3MI9A 2XRUA 3PFQA 3R9DA 3WZKA 5AA8A 3FC1X 3EH9A 4YZ9A 3PP0A 4O82A 1KE8A 4YHFA 1OB3A 1XHAA 1NY3A 2V22A 4PMTA 4DLJA 4F0FA 2BMCA 4WT6A 1OBDA 3UDZA 2GS2A 1KE7A 4ENYA 5AWMA 4AX8A 3DXPA 2Y7JA 3LVPA 1YOJA 4I22A 4CFWA 5HG7A 2QOKA 5FEQA 4WOVA 4YC3A 4F1MA 2W1EA 4TPTA 3VBYA 3OY1A 4LRMA 4AGWA 4CFVA 3LXLA 3AT3A 5FP6A 4R1VA 5BVOA 4U3ZA 3FQEA 4DFLA 1REKA 3HA6A 1IASA 4O0RA 2JGZA 4IMYA 4C3FA 3P5JC 4BVUA 5A54A 3UDTA 2JDSA 2X4ZA 3CE3A 5FDXA 1M2PA 3V51A 4F99A 5HI2A 4XNEA 4Y8DA 4NFMA 3F82A 3Q6WA 2UW8A 4NM5A 2WIPA 3EB0A 1REJA 2Z7SA 4EOMA 5F4NA 5BVEA 4FKQA 3BQRA 4EQCA 3ZUTA 2JDTA 2XS0A 5I9UA 2QR8A 3AMAA 4E1ZA 2DYLA 4MBIA 5DT4A 4FTKA 5HBJA 3F3VA 5DEYA 3CLYA 3U6JA 2J4ZA 3NAYA 2NYAA 2BILB 2WFYA 1M7NA 3LFBA 4Y5QA 4ZY5A 3OZ6A 4RGJA 3NNXA 3NWWA 4IDTA 4JRNA 2VTTA 1WVXA 5IH4A 5LMKC 4ANLA 4JJRA 2V62A 5CVGA 4X3FC 1OIUA 1OIRA 5CVFA 3T3UA 2GSFA 2YFXA 2PVFA 2WNTA 4IACA 4G3FA 4F9YA 4OAVB 4FT7A 3Q4UA 3BL7A 5EYMA 2XJ1A 5H3QA 1OKWA 3E8DA 3G6HA 4JDHA 3QTUA 1UU7A 4NKAA 3TZMA 3LXNA 3ZFYA 3D7ZA 4C61A 4AG8A 2QQ7A 3Q32A 4GH2A 2B0QA 2CMWA 4MCVA 3KRRA 3LCOA 2ETMA 5TF9A 2R7BA 5HEZA 5HIEA 3UPZA 5IQBA 2J2IB 1V1KA 4UEUA 4RVKA 3VVHA 1BI8A 2PULA 2OWBA 4JS8A 5E8WA 3P23A 3KXGA 5CXZA 4YGAA 4E7WA 2ESMA 5CT7A 3MTLA 3FI2A 4APCA 4O4DA 1XH9A 4QMZA 1WZYA 2RIOA 3KRXA 4C2VA 3TYKA 4AOJA 2WZJA 4MD8E 3GCQA 2CNQA 2OIDA 4PDOA 3BGQA 3QX2A 1Q41A 3QCSA 4PDSA 3R8VA 4BZNA 2HZIA 1Q8ZA 3N4TA 1Z9XA 2OJ9A 3OF0A 3F3UA 3DXQA 4DHZA 3AMYA 4CT1A 3HMOA 4CRSA 3W0PA 3O50A 4Z3VA 4L43A 3AGLA 4MAOA 4OTHA 4AT4A 2CKOA 2PYWA 3V01A 3ZUVA 4EHZA 2PSQA 4YU2A 2O8YA 4NW6A 3ENHA 4IFCA 3R0TA 3CY3A 4HGLA 4QYGA 4QT1A 3QRKA 2CLQA 1M52A 5LXMA 2EXEA 3QCQA 5IUIA 5M57A 3KC3A 4RIXA 5EYKA 3SLSA 4A4XA 3V5QA 3GCPA 4MK0A 3I6WA 1YXXA 4BGGA 5L8KA 3RM7A 4FYOA 4N6YA 4XUFA 4ID7A 4IW0A 4YURA 2IVVA 2ZFYA 3A7JA 2YCQA 3KCFA 4ASDA 4BDKA 2XK9A 3DQXA 3ETAA 1G3NA 2BZKB 2XEZA 3C4ZA 4X2NA 3GEQA 4HYIA 2X4FA 2XNOA 1ZARA 5ETIA 5JFVA 4GT3A 1TFFA 3CGFA 4ZTLA 4R7IA 3OXIA 1W2FA 4W4WA 3R1NA 2YDJA 2YCFA 4NIFA 2VTQA 3G33A 1PXNA 4GT5A 3W2PA 3RZFA 2ONLA 1OI9A 4YTFA 1R0EA 2X8DA 5FXQA 5AX3A 1CKIA 2WMWA 5BUEA 2XP2A 3FMJA 4MXZA 4QPAA 5EHYA 2BZJA 3QXPA 5DVRA 2J51A 4MQ2A 3UVQA 2WTIA 1PKDA 3NIZA 4IZAA 4Q9SA 3PPJA 5C8KA 4I5MA 1W2DA 3DK6A 3NCZA 3DJ5A 3GVUA 4GCJA 4ZY6A 5T3QA 1XBBA 4ONAA 3RJCA 1UU8A 3PVGA 4AW2A 5JKGA 1SVHA 3BWFA 1JNKA 4TW9A 3VUKA 5JRSA 1XH5A 3NYVA 4KIKB 4OT6A 3VBXA 5IUGA 5DYJA 4V05A 3KXZA 3EN9A 4NCTA 4J95A 2PVLA 4QMPA 5IISA 4EWHA 1OBGA 5CF5A 2BZHB 3R22A 4R6VA 3T9IA 3TV6A 1ZMUA 2YIWA 1H0VA 1YRPA 2PUPA 4E6DA 4L68A 5AM6A 3PG3A 2R3OA 3PTGA 1UNGA 2H34A 4M13A 3OEFX 3QTSA 3ALOA 1GNGA 2UZTA 4RX9A 3TNQB 5IH6A 3H3CA 4LRJA 1W98A 3W2RA 3C0GA 2J5FA 3ZONA 1J7UA 2JKKA 4EJ7A 3QD4A 1YOMA 4MXAA 4KRCA 2C69A 2QCSA 2XM9A 3QLGA 4O6EA 5D9HA 2PZRA 3A62A 2X0GA 2X7GA 2VO0A 4MNEA 2ZAZA 4JBOA 3E7OA 3FXXA 4EC8A 5CWZA 4PL4A 3W0OA 4AP7A 3LKMA 3IW7A 3NNVA 5IPJA 1TKIA 1T45A 4LV7A 5M4FA 4EK3A 4WNOA 3GGFA 4IBMA 2W5BA 4A9UA 4J8MA 3UP2A 3KCKA 4LM5A 2WMTA 2WTKC 1J7IA 3C4WA 3MB7A 1J1CA 3I5ZA 4GEOA 1CKPA 4FNWA 3UNKA 2YISA 3H9OA 3LQ5A 4F6WA 5AIRA 2X7OA 4FKSA 2X9FA 4IWOA 4KNBA 4M67A 4EQUA 3GP0A 3W1FA 5EI8A 4PL5A 1A06A 3TNIA 4EI4A 4F65A 4BZDA 2B9IA 3R04A 4XG3A 2BAJA 4MQ1A 4G31A 4K0YA 3JVSA 3W8QA 5M4CA 5I9ZA 4KWPA 2C30A 2GMXA 2RKUA 4X3FB 5E1EA 5HG8A 4FKTA 3UIXA 1OIYA 4PNKA 3W2CA 2J7TA 5EW3A 3AQVA 3R8ZA 3O8UA 3SOCA 4ZY4A 4R3CA 3DAJA 3AD5A 2C3LA 4D2SA 2X0PA 4IJ9A 4O22A 4WKQA 2KULA 3VHEA 4CEGA 3RM6A 2VTSA 4CQEA 5LMBA 2CGWA 1PYEA 3VWAA 2R7IA 2G2HA 3JPVA 3OCTA 2YAKA 3BIZA 1ZY4A 5KHXA 3E5AA 4D2WA 4CFUA 5M09A 1Q5KA 3IK3A 3QTXA 5JQ5A 3T9TA 4C37A 5JMSA 3O23A 5EDQA 3B8RA 4FIIA 4JX3A 1TQPA 2JDRA 3BYUA 2EU9A 4YZMA 3FZSA 4BDHA 4ERKA 4FIFA 5CI6A 1GY3A 3NRMA 4LGHA 4UYAA 3SX9A 4EBVA 3V8WA 3LMIA 3VS7A 2GCDA 3D5XA 3F6XA 3H4JA 3H9RA 3PXFA 4FRFA 4N6ZA 4G9CA 4BWKA 2GNJA 4O38A 3IW4A 4HVHA 4QDVA 3T3VA 2OK1A 4ORKA 3MVLA 2ITVA 3AC4A 2NRYA 1PJKA 3MY5A 3WZJA 5JQ8A 3NVMB 3C0IA 2ONLC 3FZPA 4KS7A 3MH3A 4O0YA 4EK4A 4O7SA 4BICA 1IEPA 5KBRA 5LQFA 4EOJA 1PXKA 3WYXA 3FE3A 5CENA 2PPQA 4BBEA 5TOZA 1KSWA 3EWHA 4R1YA 1FVRA 4DFNA 3ITZA 4EHGA 3FL4A 1YVJA 4G2FA 4KB8A 2HZ4A 3OMVA 3UO4A 3ZRKA 2XIYA 3G90X 1FVVA 3ZS5A 3D14A 3V5LA 3UIUA 2Z8CA 5KKRC 3HYHA 4J52A 3KN6A 2YJRA 3NYOA 1WVYA 2BRBA 4NCTC 3C0HA 5LARA 3BE2A 4CYIA 3ZDIA 3PY0A 3QC9A 5CEMA 4CQGA 2PY3A 3OBJA 3QC4A 2C1AA 4DFBA 4EORA 2XBJA 4FKOA 4J8NA 2VWXA 4FSQA 4HYUA 4W4XA 4RC3A 5D1JA 4NWMA 3EKKA 3IDPA 3NUNA 5JSMA 2W9FB 2QLQA 3ZRMA 3F7ZA 3JY9A 3L9PA 3UOKA 5AAGA 3D7TB 2I0HA 3KXMA 3UO5A 5CEOA 2CJMA 4WUAA 3RAWA 1LEWA 3DNEA 3WZUA 3UZPA 4OT5A 3UBDA 1Z57A 4YLLA 5FBOA 3S0OA 3KGAA 3NUAA 5AUXA 4C36A 3RHKA 1VR2A 2YWPA 4QTBA 3R8UA 2I0EA 4U7ZA 4Y83A 1Q8TA 3G0FA 3ALNA 4JQEA 4RZWA 3I81A 2X6EA 5IQIA 4DT8A 3E8CA 4DITA 5EQYA 1Q24A 4R3RA 4AZTA 4QOXA 4EBWA 3EFLA 3WF7A 4B4LA 3PZEA 4DH5A 2REIA 3KULB 1Q62A 4CXAA 3VAPA 4FVRA 2BR1A 3Q2MA 4I5CA 2AEGA 2UZOA 4I93A 3W0NA 3TDVA 3DBEA 2IO6A 4RFYA 5AP4A 3PUFC 5DRDA 1Q3DA 3QU0A 4A9TA 4JI9A 3E64A 3HKOA 4QYHA 1R1WA 4E6QA 3R1QA 5AR5A 4EUTA 4DDGA 1YI4A 4FTIA 2UW9A 4P5ZA 4RWKA 4W8EA 4YJOA 1H01A 2DS1A 1YDRE 3UJGA 2IWIA 3DAEA 1YXUA 4KBCA 4TYEA 1L8TA 2BROA 4YNOA 4BB4A 5EM6A 1OKZA 4BDDA 4NT4A 1P2AA 2B53A 4CFFA 1NT2A 5C26A 3VUMA 4L3JA 5FM2A 5KHWA 3R2YA 2WMUA 3TI1A 3U6IA 5KZ0A 4PTEA 3W0RA 1ZOGA 2C0OA 5FTOA 2VTOA 3SXRA 1IRKA 4FEQA 2JAVA 2QHMA 1GZKA 3W2OA 1OUYA 3LXPA 4MBJA 4FT9A 4U97A 3BGPA 2HAKA 5IEXA 5E4HA 4D4SA 2O3PA 2UW3A 3DV3A 4L53A 3KRLA 1UU9A 3CP9A 1FBNA 4BWXA 3WOWA 4YJVA 4CNHA 2PZIA 1Q99A 4WBBB 4IB5A 4FI1A 2OG8A 3OD6X 4M8TA 4FV4A 3KVWA 4FTJA 4J71A 2WMAA 2QHNA 1YI6A 4RJ8A 4QTEA 3HRFA 4JL9A 4IZ5A 5J1VA 4CZUA 1OPJA 5IG1A 4B6LA 2FVDA 3CR0A 3R2BA 3ZO2A 4DG0E 3HAMA 4D58A 4F6SA 4O1OA 4RX8A 3C5UA 2F57A 3C13A 2YN8A 2OXYA 4FKPA 4AAAA 2GHMA 3DDQA 3U9CA 4WNPA 1FPUA 3DCVA 3BU5A 4JT3A 5BNJA 3MESA 3U8WA 2EB2A 2JC6A 2YM7A 3ZLSA 4YR8A 1R3CA 1H1WA 3OOGA 4LV5A 2PE2A 4FF8A 4A9RA 5AR8A 5HORA 4XLIA 2NNWB 2UZVA 4CZTA 4OTDA 3TZ8A 4AZEA 3KQ7A 2XKCA 3MB6A 4G34A 5FG8A 5AUZA 4MTAA 5A9UA 4MXOA 3VO3A 2FSMX 4TWPA 4AE6A 4BZOA 4PRJA 5CAUA 3BZ3A 3SG9A 2IPXA 5B7VA 1U46A 2FSOX 4XH6A 3SOAA 2QODA 4TYHB 2VWBA 4FG8A 1RE8A 4XHKB 4EJNA 2XYNA 4FA2A 1MRYA 3DU8A 2F7ZE 3ZSIA 5J7BA 1SNUA 1JKSA 5L2IA 1OITA 4ZJVA 3HP5A 3UIMA 4C3RA 4EH8A 3HUBA 3GC0A 2GTNA 3QRTA 4UYNA 4C02A 2VTAA 4NUSA 4G16A 5KE0A 4FTAA 3Q52A 4V01A 4EH7A 5J9ZA 5IA5A 5H8EA 3NPCA 2OBJA 3HV3A 4DG2E 2HK5A 3JYAA 4LMUA 5LVOA 2P2IA 3DXNA 2YM5A 4K11A 4ALUA 2VGOA 3UGCA 3G51A 3V6RA 4Y72A 1U54A 4NW5A 4DEDA 2WKMA 4JRVA 5GZ8A 4D0XA 4HJOA 1S9JA 2X2MA 3KFAA 4O1PA 2RGPA 2WQMA 4BCOA 3H0ZA 3E63A 5CSHA 3W55A 5JN2A 4QMQA 5M56A 4AT5A 4QP9A 3QTIA 4B99A 3ZSGA 3FHIA 3L9MA 2YCRA 3HRBA 2YCSA 5EKNA 1PMNA 1Q4LA 4L7SA 5EQEA 2GU8A 1QPJA 3EQDA 1YI3A 2OH0E 4AUAA 4MVFA 4R8QA 4CLIA 5BYYA 4IWQA 1MRVA 1B39A 4KIKA 2QOIA 4BGHA 4L6QA 3EHAA 3FY2A 3ZC5A 4YMJA 3FKNA 1KE6A 3Q9WA 4OTFA 1Q8YA 1LUFA 3CPBA 1F3MC 4C62A 2UZEA 5L8JA 3LFAA 3TCPA 4AF3A 2I1MA 4H3PA 4ZSEA 3W32A 2UW6A 3OCGA 4C4EA 5HG9A 3FZOA 3BKBA 3PWDA 4FTCA 5HO6A 2W05A 4GMYA 3ZFXA 2UVZA 2BTRA 2CKQA 2JFMA 1PXMA 1KOBA 2B7AA 4TKSA 4YLJA 3RP9A 4E4MA 4AE9A 3I5NA 3ODYX 4YZDA 3R7EA 2ZDUA 2P4IA 3MW1A 3I0OA 2Y8OA 3RNYA 3WYYA 3EN6A 4QMWA 3TNPC 1JSTA 2YIYA 3MBLA 1OVEA 4RPVA 1UU3A 3COMA 3KMWA 4K2RA 4HVDA 3GU4A 4IAZA 3QZHA 4M0ZA 5BUJA 4IM3A 2RFDA 4UBAA 2XUUA 2Y6OA 3JVRA 4YLKA 3RVGA 3VBQA 4D2RA 3ZU7A 4F9CA 4O83A 4MF1A 4EOPA 4FEXA 4V04A 4YHTA 3FI3A 4OTRA 5DI1A 3ORIA 4EH2A 4EQMA 4FE2A 5ANIA 5IQDA 3UO6A 1WBNA 2BFXA 3I4BA 3BYSA 4JNWA 1J7LA 1WMKA 1FQ1B 2XNPA 3QGYA 4ZLYA 4ACGA 5EDRA 5DN3A 2EUFB 2GHLA 2W7XA 4MYGA 5M55A 4DEIA 2VWUA 4YJTA 2W4JA 4FSYA 5DH3A 4O84A 4FSMA 1YW2A 4FV0A 3P7AA 4NZWB 3AKLA 4IB3A 3FBVA 1BYGA 3BHTA 5CNNA 2O64A 1U59A 4G5JA 4JXFA 1JAMA 5HO7A 2JDOA 4M97A 3FQSA 2VWIA 4JBQA 5LMKA 3EN7A 4X3FA 1URCA 3CCNA 3O96A 1PW2A 4XV2A 3VHKA 3VULA 4TT7A 2QOCA 4DCEA 4O7VA 3I0QA 1R0PA 3OTVA 2C3JA 1DAYA 3SXFA 3EZRA 4E8AA 5K0KA 2ETKA 3QQLA 2C5VA 1YWNA 4WNMA 4LV8A 2EXMA 3V5PA 2OXXA 4DGGA 4FSTA 3UZTA 5IQGA 5LVMA 1UWJA 4NTTA 3N4UA 4FODA 3BEAA 4JAJA 4BDGA 2ACXA 3NCGA 4L3LA 3RBWA 2XNBA 3P9JA 4GVJA 3D0EA 2G2FA 4X2JA 4DC2A 4MWIA 2BTSA 5I9YA 1G8JA 3MPAA 4QO9A 3D4QA 3W10A 1MRUA 2WEIA 3FC2A 4UWBA 4XG8A 4DH7A 2I0VA 4EZ3A 1HOWA 2J50A 4MD7E 4FTLA 3PDTA 2PE0A 4KRDA 4ZZOA 4IHPA 3EQBA 4PY1A 5KMKA 2F2CB 4G9RA 3U6HA 4F64A 4HPUE 3O51A 1G8AA 2QO9A 2PZYA 3QAME 2WU7A 4RT7A 1R39A 3WBLA 2HCKA 3ZEPA 4BRXA 1QCFA 3PXRA 3QKLA 3QBNA 3MPMA 3PE1A 3OEZA 3PA3A 2ETRA 3U55A 5E8VA 5AV3A 5L4QA 4NU1A 4I94A 3QQUA 2VTMA 5AX9A 5CF8A 1NVSA 4XRJA 3UVPA 5HO8A 2ZVAA 4IX6A 4TTHB 5HG5A 5ANJA 3CD3A 2HENA 4YJUA 4TNBA 4D1ZA 4DFXE 4FNZA 4ZZMA 2FGIA 5EFQA 2F2UA 4AZWA 5DG5A 5A4QA 3DZQA 3F3TA 4AWIA 4J1RA 2WQBA 5FTQA 3TL8A 3R8MA 4AGDA 2NPQA 3PY3A 3BLHA 4F9BA 2P33A 2Q0NA 4FTTA 3FMMA 3PJ2A 3R71A 4EYJA 4CMUA 1STCE 5CLPA 4PTGA 3ZC6A 3GXLA 3D2KA 4GIIA 3EQIA 1QPCA 3Q9ZA 4KA3A 1J91A 3PWYA 3NMUF 4AXDA 3F3ZA 2BRGA 3RNIA 3ORKA 2WTWA 4YTIA 4FGBA 4OUCA 1YOLA 3BCEA 3BU6A 4UXLA 4Q5HA 5CEQA 4K9YA 4R3PA 4F9WA 4GYGA 4GUBA 4QTCA 1KE5A 2W06A 3D7TA 3AC5A 3DZOA 3A2CA 5BQ0A 3NUSA 3OC1A 3MFSA 1FOTA 2VWYA 3WIGA 3KB7A 1H1PA 1LR4A 4YZNA 5E90A 2JKOA 4PPCA 1PXJA 3FSKA 3QL8A 2ITUA 1J1BA 3E93A 3IONA 5J95A 4I0TA 4WD5A 5JK3A 1JSVA 4DGMA 3U51A 4LL0A 2WQNA 4AA0A 3DS6A 3DTCA 2QG5A 4XYFA 5GZAA 2R5TA 5DBXA 3AC1A 1H1RA 5K5XA 4I6HA 1JOWB 1B38A 4AZVA 2XH5A 2XA4A 3TTIA 3OW4A 3QYZA 4IX3A 3R1YA 1SNXA 2JLDA 4P5QA 2YACA 3EFJA 4JR7A 3PIZA 1FVTA 3KULA 4WG5A 1CM8A 2I40A 4YJQA 5KBQA 3RAIA 5CF4A 3ATTA 3S4QA 3NVKI 2F49A 1E9HA 5DEWA 5IU2A 3NUPA 5KNJA 4W4YA 1S9IA 4BDJA 3Q3BA 4OR5A 2R2PA 4EYMA 4JDIA 2AC5A 2I6LA 3QD3A 4G6NA 4PX6A 2WEVA 4GG5A 5IQCA 2BFYA 3RPSA 4XOZA 4BYJA 3ZHPC 1WBSA 3SVVA 3COKA 3AT2A 4X21A 2DQ7X 4EOQA 5G1XA 4FV1A 4XG6A 4EZ7A 1SMHA 4KSQA 3PA5A 4LFIA 4XBRA 4H58A 5TT7A 3VS6A 4EHEA 3AD6A 2C6OA 2UUEA 2W9ZB 1R78A 2C6LA 3BI6A 3P86A 3VS2A 3NAXA 3Q4ZA 4QMYA 4FBXA 1V0OA 3M42A 2V7AA 1IR3A 4LYNA 5HBHA 5AV1A 4TNDA 4ACCA 2QONA 4DDIA 1HCLA 2VN9A 3DDPA 2VX1A 4M15A 5K3YA 3L8SA 2X2LA 5I0BA 3BYVA 5I5ZA 1OL1A 1YQJA 2Y4IC 2C47A 4KSPA 4L44A 1DAWA 3VQUA 4EONA 1XMMA 4XV9A 1H0WA 1CSNA 4BN1A 2BIYA 3M2WA 5DIAA 2ZDTA 3HV5A 4IQ6A 4U9AA 2QVSE 4JLCA 5AUWA 3UODA 3ZTXA 2JAMA 3GCUA 3TV7A 1WAKA 3QQGA 3VBTA 3LQ8A 3OCBA 1OUKA 3BHYA 3KMUA 2HELA 5KO1A 3E62A 3QCXA 1OPKA 3U9NA 3TMOA 5GJGA 3BRBA 3L8XA 3CJGA 1GIIA 2VZ6A 3QZFA 3LM5A 4ACDA 4DINA 4CKRA 3P79A 4R78A 2OFVA 5IQAA 5CAOA 2VNYA 3HGKA 4GU6A 4MWHA 4ZSLA 5HTCA 4DE4A 4GG7A 2R4BA 4PMSA 3ORLA 1FGKA 3AMBA 4C3PA 3HMPA 4IX4A 2JKMA 4O4CA 1YWVA 3FYJX 4ZTMA 5F9EA 5FBNC 5BVWA 2XMYA 3EYGA 3TIZA 2HIWA 4W4VA 2PMOX 3R8PA 1BL7A 2ZOQA 4ACHA 2YDIA 3VONA 3DJ6A 2XNGA 2PMIA 3WILA 4EWQA 2PE1A 4LDTA 3CXWA 2J0LA 4UMRA 1A9UA 4HZRA 3A60A 2HWPA 5EM8A 3GU6A 2BDJA 2G1TA 3LFFA 4FV6A 2Q83A 2A98A 4NKSA 4BHZA 5KMNA 5HX8A 3ZFMA 4E20A 3C50A 3F61A 4TYHA 1IAJA 4TYGA 2ZV9A 2R64A 4NJDA 4BIEA 2XVDA 3UOHA 1PY5A 2X2KA 4ZTQA 4XX9A 3D94A 4ZSJA 4EOOA 2NO3A 2UVYA 4NL0A 5A4TA 3PVBA 4QMXA 4J53A 3DOGA 4C33A 4L46A 4AOIA 4GRBA 3ELJA 4IDVA 4LOQA 2XIXA 4P2KA 3R63A 3G2FA 2PVNA 3O17A 3E87A 4II5A 4AW5A 3FLQA 3I60A 4E6AA 3ZXTA 3BYOA 3FMLA 4MBLA 4JX7A 3VNTA 4Z16A 5CEKA 5FXRA 4J99A 1OZ1A 2PL0A 3Q5IA 4FG9A 3W18A 3BLAA 3FWQA 3KIOC 3FKOA 2C0IA 4EZ5A 2JIVA 3C1XA 3DKFA 5L6PA 1B6CB 3DPKA 3A8WA 2B4SB 2YLFA 3IKAA 3KN5A 3O2MA 3PUPA 3I7BA 4JBPA 3LCDA 4IADA 4M66A 3QYWA 4E93A 3SA0A 4EH5A 4BL1A 3OS3A 4H05A 4AXFA 4IZ7A 2PZPA 2H6DA 4ALVA 1O6LA 4HNFA 4EEVA 4ZXTA 3QKMA 1BMKA 3MV5A 3ANRA 3TNWA 3W2SA 1GOLA 3GCSA 4D55A 4O0VA 5J1WA 1RDQE 4QNYA 4RVTA 3VC4A 3L8PA 3Q4TA 5K0XA 5DT0A 2X39A 3NX8A 5CXHA 4XP2A 2R0UA 3LFCA 4GVAA 4GSBA 4FJVA 4JVGA 2PWLA 4Z7HA 5EOBA 2J0JA 3P5KA 3WZDA 3NW6A 4NJ3A 5BMMA 1U5RA 2R3MA 4QMTA 3AT4A 2YERA 4MX9A 5AV0A 5DWRA 4DEBA 4H36A 2BIKB 2C6TA 4UV0A 1H1QA 4USFA 3KMMA 3C5IA 2ZV8A 2ITQA 2OJFE 3BX5A 3EFWA 3NFGB 5C03A 4G17A 1YDSE 3SAYA 5EW9A 3RCJA 1SVGA 3ACJA 3HDNA 4RFZA 2A27A 4MKCA 5CU2A 5E8XA 4EOKA 1WBTA 5ANKA 4D9UA 2QLUA 4RLLA 2R3LA 3NNUA 3GB2A 4UWCA 4XV1A 3ZEWA 4DFUA 4FX3A 4FVQA 4O21A 4UMQA 5L2QA 3COIA 4I4FA 3KXXA 4CMOA 1KUTA 3AKJA 4IAFA 3MA3A 3NW7A 4I6QA 3P7BA 5E8YA 3PPZA 3K5UA 4IE9A 2CCIA 4BY9E 5HESA 4JOAA 3PRIA 4APPA 5BVFA 1QPDA 2A4LA 4ITJA 3POZA 5CSXA 4EL9A 4U81A 2R3PA 3GC7A 2VO6A 4U40A 4HGEA 4MXXA 3CJFA 3O0GA 5DMZA 3TZ9A 4BTFA 4F1TA 3PSBA 5B2KA 3MWUA 3F2AA 3HV6A 5AA9A 4QTDA 2V5QA 4AS0A 5H9BA 5F94A 3CKXA 1BL6A 4LQMA 3MY0A 2JD5A 4FZAB 4H39A 4YJPA 4LMNA 4ITIA 3A8XA 2OLCA 4FYNA 5C8MA 5L2TA