3AMBA

Protein kinase a sixfold mutant model of aurora b with inhibitor vx-680
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
340
Chain Sequence
AAAAKKGEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIRTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRIQQAVNFPFLVKLEFSFKDNSNLYMVLEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Mutants of protein kinase A that mimic the ATP-binding site of Aurora kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ambA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ambA02
3FHIA 4XMOA 2I40A 3G0FA 3IKAA 4FT3A 2W4KA 4M68A 4NSTA 1OBGA 1FMKA 4ALUA 2YWPA 4FIGA 2X4FA 4RT7A 2BRHA 5AR3A 4Y73A 4BCFA 3FE3A 3QF9A 4XG9A 1YXXA 4QTAA 3WF7A 5L6OA 4Z7GA 5EM6A 3NYVA 2W1HA 4FV0A 3PY3A 5CVFA 3PY1A 2WNTA 3QQUA 4UV0A 2C6TA 2FGIA 4H39A 5LVNA 3DLZA 5EK7A 2Z60A 3S00A 4CG8A 3LCOA 3LQ3A 3BHYA 3GEQA 3QD2B 4C36A 5DBXA 4L3LA 4IAZA 4IAFA 2PVMA 2W5BA 4YJTA 4FR4A 1SNUA 4FOCA 3L8SA 1FVTA 3KMMA 3IK3A 3KC3A 3L1SA 1ZOEA 4NW5A 4BCHA 5CAVA 1JVPP 4BCNA 5DRBA 5ANGA 4JXFA 5DH3A 4FX3A 4WBOA 4UWCA 4OTWA 3DJ6A 3PSBA 4YC6A 5ANEA 4BCPA 5HD7A 2QKWB 3EMGA 1OUKA 4FOBA 4NIFA 5J5TA 3W2QA 2ITNA 5FWKK 3ZEPA 4U41A 2OFVA 3V3VA 1CSNA 3NUUA 1ZOGA 2GFSA 5JGBA 3NZ0A 4BDFA 4EOMA 1OVEA 1FVVA 2PZIA 5IUHA 5JGAA 2X2KA 5IQCA 2FH9A 3E5AA 2WOUA 5E8YA 3ZCLA 3PXZA 5I0BA 1IAJA 3UZRA 2HZNA 2I1MA 2PHKA 3RP9A 1DS5A 2OWBA 3OWJA 3LM0A 4ZK5A 3ZH8A 2PE1A 1H1QA 3JS2A 5GIPE 3U9CA 5EKOA 2XNMA 3P79A 3GC9A 4MXYA 1YWNA 2V55A 4JQ8A 4RJ4A 4Z9LA 2UZOA 3MPAA 4QPAA 3QL8A 4AACA 4ZS0A 4D0XA 4FGRA 3KRRA 5CU3A 4QYHA 3MH2A 2EXEA 4RVLA 4O7VA 3WF6A 4FV2A 5M51A 3UGCA 4RLKA 3F66A 3ZONA 4FVQA 2XKDA 3IW5A 4V0GB 3W8QA 2XJ1A 2V62A 5BVOA 2QG5A 4GKIA 3H9OA 2BRBA 3UIXA 1GIJA 4FNYA 2C6OA 3ZUUA 1H1WA 3EQGA 3CPBA 3OWKA 4Y72A 4HW7A 3C13A 1YXUA 4CV9A 3MA6A 3Q4TA 3R1QA 4H3PA 3DK7A 3ODYX 1CKPA 2R3HA 4BHZA 2O8YA 3LMGA 4F7JA 3L9MA 1BI8A 4KIKA 4IB3A 4B8MA 4PNKA 2VD5A 4L45A 5IH5A 4BC6A 2O65A 3VN9A 4O21A 5L6WL 5D11A 3DBCA 4FTIA 4FT9A 4BKZA 4LGGA 2JD5A 4RVTA 3WE8A 3DDQA 4DEGA 4W9XA 3SVVA 3KXZA 1ZY5A 4DH7A 5LWNA 3GUBA 3U54A 2ITVA 3LE6A 4FV8A 2E9OA 1Q3DA 4QMOA 1PKGA 2B9IA 4KIPA 2RF9A 3QCQA 5CEMA 2G2IA 2X7OA 4OTIA 3ZLYA 3OCTA 5E1EA 4FSUA 1O6YA 1KE7A 5HVJA 2J6MA 2YACA 3U6HA 1EH4A 4V01A 4F6UA 4QYFA 2CLQA 5DMZA 1PMEA 3D4QA 3LCKA 3RHXA 4AXAA 5I9WA 3D5VA 4AU8A 1RJBA 2GCDA 2XJ2A 3TKIA 3JYAA 4IDVA 4XBRA 3UOKA 4BCMA 3VS6A 3DAEA 3DB6A 1BL7A 4PDSA 3MFRA 4KSQA 4R3PA 3ZXZA 4XG6A 4C57A 4EEVA 2XIXA 4DH5A 1OIUA 4KD1A 3N4VA 1YKRA 4PPBA 3PVBA 4BFMA 3FXZA 3DOGA 2J0JA 3KU2A 4DH1A 4QMMA 4EH8A 3MB6A 1YWVA 4FKWA 4UYAA 3HEGA 4AW1A 4HGTA 2Y4PA 4C4HA 1QPCA 3AD6A 3I5NA 2X39A 4B7TA 5JQ8A 3R1SA 3F3WA 1IG1A 5EHOA 2QODA 5IDNA 5CAUA 3SGCA 4DT9A 4CRSA 5IA1A 2NNWB 4O2PA 4XG7A 4JAJA 1A9UA 3I6UA 2RSVA 3E62A 4EH5A 3TT0A 3FMDA 3SLSA 4TYHA 4GU6A 4BI0A 2WQMA 3MFSA 5KMIA 3T9IA 3V5LA 3PSCA 3EZVA 2VUWA 4EH3A 4C4EA 2CN5A 1QPJA 1IA8A 2UVXA 5BMMA 4F6WA 4D1XA 5KE0A 3VBTA 4RVKA 4RWKA 2DWBA 3FL5A 4JDJA 4RFZA 3ZSIA 2GQRA 3SG9A 3COKA 5E8XA 4FEQA 5M09A 2W17A 3GCPA 3FSFA 1H27A 1UV5A 4KBAA 3R8PA 3LM5A 1YWRA 5GIOE 2VU3A 2VWXA 4GRBA 5CNOA 4E5WA 3TNIA 4YZBA 4HVDA 3QUEA 4EL9A 1YW2A 1WBPA 3BGZA 4EOSA 2Q83A 3QTZA 5KX8A 3PXYA 4QQCA 4U45A 4IJ9A 4C0TA 4F9BA 2AYPA 3BLRA 4XV9A 3VBQA 4Z55A 3VUKA 4AN3A 2WGJA 4DFYA 3E8NA 1MP8A 2UZTA 2XNNA 3HUBA 4UMTA 2YAKA 3FYJX 3NCZA 4AZWA 5HE0A 4K1BA 3VW6A 3OWPA 2FYSA 3DAKA 1ZARA 3QCSA 5ANOA 4C4GA 4EQMA 4FL1A 2R3LA 3AC4A 4QD6A 4LOPA 1PRYA 4H1MA 4RX7A 5DWRA 4FEWA 3RINA 4D4VA 2WTDA 4DEBA 2ZM1A 3OOMA 1XH6A 3R01A 3HKOA 2QNJA 4FL3A 5CU4A 4FT5A 4D9TA 5J9ZA 3C4EA 4X3FB 5AUZA 2JIIA 2QO7A 4FKOA 4O6EA 4PQNA 2RGPA 4ZSLA 3ZM9A 3C50A 1BUHA 4IJPA 4QP6A 3LMHA 2C69A 4FV1A 3U6JA 4G3FA 2C6KA 4PMMA 4QMSA 3PIXA 4RQVA 4TNBA 1SVHA 2PUUA 5CQUA 3UZTA 4LRJA 4RZWA 1OKVA 1PW2A 5LVPA 4GUEA 2CHLA 2O2UA 2RG6A 3NX8A 4XRLA 4LUDA 5HG7A 2I0HA 2YWVA 3HZTA 3RK9A 5A4EA 5CU0A 4TWOA 5FM2A 5HI2A 2F7XE 2QOIA 4IVBA 4LFIA 4LI5A 1WVYA 2X9EA 4GFGA 1JPAA 4ACCA 4GIIA 4F9WA 5T6KA 2WMVA 3W2OA 1MQBA 4KKHA 3R9HA 3RVGA 4M69B 3R7VA 4F99A 4AW2A 3FC1X 2OI4X 2VO6A 4R5YA 3T8OA 2UZNA 4EH9A 4N57A 2J5FA 1O6KA 4IADA 2J5EA 2CMWA 1JKTA 4J99A 2Y6OA 3K3JA 4LV5A 5FM3A 3VBVA 5AR2A 3QGWA 2QQ7A 5FRIA 3Q2MA 2C0IA 3AT3A 3PLSA 4LMNA 3CIKA 5DHJA 5IQGA 4LUEA 2HCKA 5M56A 3V8WA 3CEKA 5K5NA 3FLSA 4FYNA 1HCLA 3EQFA 3I1AA 3DGKA 5FXSA 2ITZA 3SXSA 2XYUA 1NY3A 4RIYA 3UQCA 3MPTA 1E1VA 3DKGA 5AUYA 3HX4A 4MQ2A 2YIWA 3OBJA 3F2NA 3FMMA 4ZTQA 4GUBA 3U8WA 4EC9A 4E6AA 2RFEA 3R73A 4YUQA 5EQPA 4N6ZA 3W2SA 5LMKA 3FLZA 3G6GA 3H10A 1CM8A 3O96A 3VF9A 4C34A 4JL9A 2GS2A 3KN5A 3O8PA 4J52A 3V8TA 3SOCA 3NWWA 4KSPA 2V22A 5CWZA 4KUJA 2WMSA 3QZIA 3WARA 4DYMA 1JBPE 3DBFA 3ZRMA 4E3CA 4ASDA 5AV3A 3O8UA 4A9UA 1APME 2YFXA 3ZC5A 5L2IA 3D0EA 3LFAA 4C59A 2WTKB 3QTRA 1UNGA 4G9CA 4XOZA 5CX9A 5FG8A 4A07A 4BDGA 5IA3A 4BY9E 5CXZA 4IX5A 4YP8A 2CJMA 3NVKI 4IB5A 4K2RA 3LQ8A 3OUNB 3MVJA 4W9WA 4I3ZA 3P86A 4Q5HA 2R3RA 2ITQA 4MD9E 4F7SA 3WF9A 3LKMA 5I9XA 4O7RA 4Y83A 3MJ1A 3FY2A 1UU9A 4GIHA 3DK3A 4P7EA 4NEUA 3ZXTA 2QHNA 3DY7A 2VAGA 5A14A 5KKRB 3I0QA 3P08A 4CTBA 3GOKA 3LXKA 4FSNA 2WHBA 4O84A 4G2FA 4BTFA 1F5QA 1BKXA 5JMSA 5CZIA 4AOIA 4BZDA 1NT2A 2OLCA 1G3NA 2H96A 3HV4A 5AP3A 2G2HA 2YDKA 3HMPA 2IG7A 3FI3A 4DEEA 2VTQA 4NT4A 5HZNA 1SM2A 2XNPA 3A7IA 3ERKA 5F1ZA 3R9NA 4L3PA 4YZ9A 4BDJA 4NM5A 2BKZA 4UWYA 3WF5A 5D7VA 1GZOA 4W4VA 1LEWA 2I0EA 4LV8A 2GTNA 4EJ7A 4DBXA 4FNXA 2VO0A 1VYZA 4K11A 3NVMB 1IA9A 2WEIA 2JDTA 3GQLA 2LAVA 4FSQA 3EFLA 4BDAA 4QMXA 2EB3A 3DZQA 5FGKA 4QMWA 1ATPE 3II5A 3QYZA 3A8XA 4EBWA 1YQJA 4V05A 4GYGA 2BTRA 4IWQA 4JBVA 3TIZA 2W4JA 1VJYA 4QMTA 2PU8A 4WBBB 5KMMA 5T68A 5H2UA 3RPRA 1KOAA 3LOKA 4L44A 4CZTA 3OD6X 4O7WA 3QTQA 4RMZA 4E4MA 5C9CA 1Y8GA 1J7IA 5HG8A 5A9UA 3OZ6A 3QQHA 1R0PA 2YDJA 2CN8A 2J51A 4IWDA 4C58A 1STCE 4NZWB 1QPEA 3EH9A 4DEHA 2BILB 1Y8YA 1Y6AA 4V0GA 4IQ6A 4U44A 2AC5A 3POZA 3ZDUA 4LRMA 2J2IB 3Q32A 4GSBA 2IZTA 5DR2A 4E5AX 3H9FA 1KUTA 3SX9A 1K9AA 3P5KA 5AR4A 4ANLA 3NCGA 1ZMUA 3PJ3A 4FKLA 4O0VA 2Z7QA 1F0QA 2ZOQA 3AC5A 4WOVA 3TI1A 3NR9A 5CAQA 2UZEA 3F5UA 4QMQA 1KV1A 4L3JA 3G0EA 2YIYA 1BYGA 3AGLA 4E6CA 3EYGA 2C3KA 3GC0A 5DA3A 5I5ZA 2WMWA 3KCKA 4GVAA 3DDPA 3HMIA 4JS8A 5CT7A 3F3UA 3VHEA 4CFUA 2GMXA 4I0RA 2X0GA 2V5QA 3R7UA 2UZUE 2XBJA 2JFLA 3MESA 2VTLA 4IH8A 4WRGA 5A54A 3PA3A 3BYUA 3VF8A 1GZKA 4BDBA 2UV2A 2GNHA 4LM5A 2HENA 3LCTA 2J4ZA 4U8ZA 3PA5A 4DFBA 5CF6A 3BHUA 4G16A 4EK5A 1UA2A 2Q0NA 3TNHA 4D2PA 1URWA 3ORXA 4FKJA 5LVOA 3NLBA 4NJ3A 1Y91A 5HLNA 1VZOA 4MBIA 4LGHA 2W1DA 5DR6A 4ZSJA 2WQOA 3DXNA 5EI6A 2UUEA 3ZMMA 2XA4A 3JUHA 2ZDTA 4RWLA 2B53A 4OTGA 3P23A 3RM7A 2C1BA 2UW7A 5E91A 3MS9A 3ATTA 2WTJA 3KXMA 5IEYA 3BZ3A 4O22A 4GK4A 2XNOA 5EQYA 4Y46A 5JFSA 2XKEA 4JIKA 3WYXA 4R78A 3POOA 2R2PA 2GSFA 2FO0A 2GNJA 2BTSA 2R3KA 4I24A 4BTMA 3AC8A 5A46A 1A48A 3HECA 3DJ7A 2BALA 2XH5A 1ZYDA 2XB7A 2XKCA 1I09A 3R28A 4EK3A 4HCTA 4OTDA 4HNIA 1PXMA 4AT5A 2P0CA 3NPCA 3ZEWA 4AOTA 3A7FA 4EOKA 1W84A 4ANBA 3VS5A 3NYXA 3P7BA 4YZNA 5EYCA 4FTCA 5E8SA 2YM3A 3IDPA 1GZ8A 5H9BA 4A4XA 4CTCA 4X2NA 1UU7A 4ONAA 3NS9A 3GCQA 3QYWA 3F7ZA 5GZ8A 2PMLX 3JVRA 5B0XA 2WELA 4AZVA 3FMHA 1QCFA 2FB8A 2IZRA 3P4KA 4HOKA 3FQEA 5EI2A 5EYMA 5AX3A 4KA3A 3TV6A 1J7LA 5BYLA 5CYIA 2VTTA 3ENHA 3IS5A 4YJQA 4BCGA 3DZOA 4O0TA 5IUGA 2QD9A 2A1AB 5EW9A 4F09A 1QL6A 3ORPA 3UMWA 2HZIA 3KRXA 3FKLA 5F94A 3D5XA 5JFVA 2KULA 5AUTA 4C3FA 3UNZA 1Y6BA 2Z2WA 4MWIA 5FEEA 3HV6A 4RVMA 4DT8A 4OGRA 5JGDA 4I92A 2BR1A 4JDHA 3C5UA 2B9JA 5CI7A 3PE2A 5ACKA 4CLJA 2PPQA 3BBWA 5BQ0A 3MBLA 3LQ5A 4D2WA 3PVGA 1OMWA 1J1BA 3VRYA 2PVFA 2CKEA 5AR7A 5KMLA 4TYEA 4B99A 1P4FA 4Q2AA 5M57A 3ROCA 4U80A 4BR3A 2BHHA 3C4FA 3FMNA 2W5HA 1JAMA 3OW4A 4D4RA 4X3FA 2R7BA 5CU6A 3TACA 5HNIX 4EZ5A 4H05A 3HRBA 4RLLA 3U87A 4DFZE 2JDOA 4JBPA 2GQSA 5AP2A 4L68A 1Q8UA 5JRSA 2OJIA 4AT4A 2QOLA 4O7ZA 4II5A 3WI6A 4F9YA 2HWPA 2PSQA 2ITYA 3WZEA 1GAGA 2JKKA 3QGYA 4YHJA 5AX9A 4C2VA 2X7GA 2PMNX 4RRVA 2O5KA 4ZOGA 3ET7A 2J0IA 2BIKB 1M7QA 2HAKA 4W8DA 4O6LA 1XBBA 2JDSA 3VW8A 4BZNA 4CFWA 2XK9A 5C4KA 1PXKA 3LJ2A 2C6MA 4M69A 4V04A 3KVXA 1JSUA 4I6HA 1P14A 4O0RA 5HNBA 3RZBA 4DFLA 2C1AA 3EL7A 1YRPA 2G15A 5BVEA 2QONA 5HE1A 4LYNA 1YXSA 2YDIA 3BV2A 1H28A 4RWJA 4QQ5A 4MXXA 4J8NA 5EOLA 3NUXA 4D2VA 5TOZA 3CY3A 5I4NA 3BYVA 3SG8A 4FEUA 4MD8E 4HGLA 4ASZA 3GB2A 1V0BA 4RC3A 2C6IA 3QUDA 4EI4A 4FKIA 1V0OA 2HZ4A 2O0UA 4HYIA 3QQJA 4YJPA 2J0LA 5HO8A 5LOHA 2IVVA 2JEDA 3GP0A 2GU8A 2OIBA 1PYEA 4W4YA 4AGDA 4AP7A 5GHVA 4BGGA 1B38A 1H01A 4D1ZA 2GNGA 4YLJA 5J9LA 1VR2A 3D5WA 4X2FA 4IAYA 3UZPA 4RQKA 4BCOA 4K33A 1PXNA 3C9WA 4U7ZA 2YA9A 2PULA 5M4IA 3PXFA 5CEIA 3IW8A 2XRUA 4QT1A 2G1TA 2XRWA 3DS6A 3KCFA 4GL9A 5EG3A 5AUVA 2W1EA 3BI6A 1Q3WA 4NM7A 3ELJA 5HGIA 3AXWA 5CLPA 5HTBA 5J79A 3U4WA 3ORMA 5HESA 2REIA 3MY5A 2VV9A 4J7BA 5AP0A 3EQDA 5ITAA 3G51A 3VULA 2XK4A 4UN0C 4YJSA 2Z02A 4ACDA 3MWUA 2F2CB 1FOTA 4NUSA 4W4WA 5A4LA 1KE6A 2OH4A 4ZY6A 1H26A 4L9IA 3K54A 2W5AA 1Q99A 2XNGA 5HQ0A 4RG0A 3TUDA 4DGMA 2OBJA 4D2TA 5H8BA 4KS8A 2R3QA 4D5KA 4BIDA 1OECA 3DCVA 1WBOA 3MH0A 4I23A 5CI6A 5AIKA 3VUTA 5HBHA 1UWHA 4ACGA 2X8DA 4CFVA 2UZBA 3PVUA 3CTHA 3IQ7A 5C01A 1LUFA 2C68A 2P55A 3A7JA 4ZY4A 4DF3A 3BELA 3MVMA 3HDMA 3IOPA 3UVRA 4A9YA 3LMIA 1FGKA 3F5PA 4O2ZA 2OZAB 3GCUA 3QKMA 4JQ7A 5M06A 3NAXA 3R7YA 4BCQA 4EKLA 4J95A 2F49A 2YCSA 4WNPA 5E1SA 5M08A 3Q6UA 3F3TA 2I0VA 3TV4A 4WG3A 4XV2A 2V7AA 2YJSA 3HMOA 4K18A 5D9HA 5IH4A 5KMOA 3FXXA 1UU8A 4FIHA 4TN6A 3ZSHA 4FE2A 2OXDA 4FMQA 4N4SA 3TL8A 3ANQA 4ACHA 3UOHA 3DPKA 2VWIA 3Q4CA 2XUUA 2ONLA 2W0JA 4MNFA 4F1MA 4DG2E 1PKDA 5HG5A 2WMTA 4DAWA 2VTSA 2WMQA 2ZV2A 5IDPA 1U5QA 4M15A 1LPUA 1W7HA 2Y7JA 4PPCA 4LQMA 4Q5EA 3V04A 4BDDA 3FZTA 3GXLA 2YM6A 3FZPA 3MYGA 3E3BX 4PL5A 4U0IA 5EQEA 3DK6A 2G2FA 1LR4A 4BICA 2XYNA 3MA3A 2UZLA 5HIDA 3V5TA 3ETAA 1S9IA 3HL7A 1MUOA 5AA8A 5C8KA 2YN8A 4FZAB 4UMQA 2HW7A 3HVCA 4EK8A 3KB7A 5IU2A 2R9SA 4AS0A 4F65A 2Y4IC 3UO6A 1YXVA 2OFUA 3QRJA 4YO6A 1Q41A 3LXLA 4L7SA 5I9UA 5KZIA 5ANJA 4BDHA 3DTWA 2YIRA 5CNNA 1BI7A 4FVPA 3R1YA 5DLSA 3PY0A 5HD4A 3RALA 2FUMA 1W8CA 5FTOA 5JZNA 4G6OA 4DFNA 4FIIA 2C3LA 2W06A 2WU6A 2UVYA 4AA4A 3JR1A 2QOCA 5HORA 2J0KA 3JPVA 4LGDA 2WIHA 4MXOA 3QU0A 2JGZA 1OL2A 3V8SA 2YZLA 5EHYA 5HVKA 5IMXA 1X8BA 2WZJA 3CQWA 2HIWA 3R1NA 5FTGA 2YM7A 2EB2A 4FV4A 3JXWA 3JY9A 3LFDA 4C61A 1GNGA 4FKVA 1B6CB 3LCSA 4RWIA 4DEIA 3UYTA 5JRQA 2QHMA 2BMCA 2C5YA 5IA5A 4FICA 5IQIA 1CMKE 3UVPA 2BCJA 3DBQA 2PUIA 4FTNA 4NCTC 1WMKA 4U6RA 2UW5A 1CDKA 3FMLA 5BPYA 2XKFA 2UW3A 3C4XA 4JQEA 3S2PA 3ZO4A 4EORA 3M42A 5A4QA 4G31A 2PK9A 3A60A 4FTMA 3TKUA 3EQPA 3PWDA 1GZNA 5HX8A 4RA4A 4BTKA 3DFAA 2B9HA 1Q24A 5AP4A 3CXWA 4ANQA 2PZ5A 2ZV9A 3GOPA 4I4FA 2WMBA 1GOLA 2XJ0A 4NU1A 3GU4A 4WSQA 3PJ2A 3TTIA 4AE9A 5DEYA 2FSMX 4O1OA 4USEA 3TEIA 3UMXA 2BDFA 5DT4A 5ETFA 3NUYA 4RJ5A 3BHHA 4BTJA 2ZMCA 5EM5A 2ERKA 3KN6A 4R1YA 5JN2A 1WAKA 4I5HA 5H8EA 2BZIB 5B2KA 3FL4A 3MH1A 5ETIA 3DBDA 3W32A 2OW3A 4QQTA 3BPRA 3AD4A 4JX7A 3P7CA 3ZZWA 2O63A 5FEDA 3ZUVA 4FSZA 3LZBA 1OL1A 1WBTA 2F57A 2P2HA 3O2MA 2QOFA 4TY1A 3TV7A 3BQRA 3HUCA 4JNWA 4B9DA 4EZ3A 4FSMA 5A4CA 5CF8A 3LFBA 1QPDA 4U97A 3U55A 1Q8WA 4QMYA 3PTGA 4J98A 4MWHA 5EM8A 3HV5A 1NVQA 4O7NA 4HVGA 4QP8A 1J91A 1OPLA 3R63A 2W4OA 3E3PA 3P1AA 3AC1A 5HICA 3RBWA 5KUPA 2BROA 4E93A 4CVAA 4ITHA 1OBDA 4B0GA 3A4PA 2W96B 4EH4A 1PXJA 4FBXA 1V1KA 1U54B 4FV3A 4OTPA 3IGGA 5CSHA 5AR8A 4X6QC 4DGGA 4PL4A 4C37A 5CALA 3I7BA 4O83A 3NUPA 1REKA 3KQ7A 4YTIA 3V6RA 5D7AA 1M2RA 1ZAOA 5FTQA 3KXNA 3VNTA 2JDVA 5AUWA 4ALVA 4EUTA 3QHRA 5IQHA 1ZYSA 5KHWA 4J53A 4NW6A 4RBLA 5CXHA 1MQ4A 4PTEA 2VTRA 4ZLOA 5DPVA 3DT1A 3BU5A 5C03A 4CCUA 3OOGA 2OF4A 2OXYA 4IDTA 4RIWA 3EYHA 4I0SA 4NFNA 4UEUA 2BRNA 1J7UA 5LARA 1OIRA 2PWLA 2B52A 2JAMA 5IKWA 3VBYA 5JKGA 4IZYA 2ITWA 4YJNA 4N0SA 3I0OA 3ZHPC 5C4LA 3VAPA 2VN9A 3HRCA 3JVSA 5AV2A 3WZJA 4GU9A 4M84A 1NVSA 2BAQA 5AUXA 3RCDA 4LL0A 4ITJA 4DEAA 3Q2JA 5J7BA 4TTHB 4RPVA 1OUYA 5JFXA 2C4GA 3DXQA 3Q4UA 4O86A 2VX1A 1K2PA 3MDYA 4IZ7A 4K9YA 5J5SA 2OXXA 1GIHA 4DGOA 2VWZA 4L00A 4HYSA 3BWFA 3G9NA 3KFAA 4IBMA 4XLIA 4EONA 4U9AA 2ONLC 4D2RA 2QU5A 4PMTA 4IVDA 3FMKA 4XP2A 5EI8A 3TJCA 3BBTB 5L8KA 4BHNA 1OL7A 5CVGA 2HZ0A 5JT2A 4CYJA 4AA0A 3NIZA 4XUFA 4XYFA 3VJOA 3ZFXA 4IM0A 3A2CA 2WO6A 5FXRA 2YZAA 4A7CA 3F61A 4I5PA 3HRFA 4KS7A 2GDOA 1OPKA 3AGMA 2R0UA 3E63A 4W4XA 3UIBA 4FA2A 2DUVA 2BFXA 2CCIA 3QXOA 4H36A 5ETCA 2IN6A 2W9FB 4MAOA 4RX8A 3M1SA 4GT4A 4CLIA 3PPJA 4O82A 3F9NA 4YLKA 5FD2A 2X7FA 1W82A 4JDKA 4ZJVA 2VGPA 4MQ1A 3CY2A 2OIQA 2ZYBA 3MFUA 2EUFB 1H1RA 2YIQA 3ANRA 4IM2A 4ZY5A 2CKPA 4KRDA 3UP7A 4CMUA 4ASXA 3OFMA 3ZFYA 1QMZA 1OKYA 2NRYA 2VWYA 3CD8A 3LLTA 5HG9A 3W16A 1ZRZA 3UO4A 4YHFA 4C3PA 3ORNA 4YTFA 3OEFX 3BKBA 5HBEA 5E4HA 2HOGA 2CDZA 3UQFA 1P2AA 2QOOA 1TKIA 5ANKA 5L2TA 4ENXA 2J7TA 4ZJIA 2IVTA 4QTDA 3F3ZA 3SRVB 4YC8A 5L3AA 4YGAA 5HLPA 4FTTA 4BIEA 4ERWA 3FPMA 3NUAA 2GHLA 2XIKA 4EOLA 4IX4A 3Q5IA 3EN7A 2ZAZA 1JLUE 3QHWA 2QLQA 5CVHA 3CKXA 4QMVA 4CG9A 4YTCA 4P5QA 4QPSA 3KL8A 3E8DA 4NKAA 4XG4A 3KXHA 4K0YA 5KNJA 3OXIA 2WAJA 3HMMA 4OTRA 4AW0A 5GJFA 4YHTA 2RFSA 2YISA 2PTKA 4GH2A 1H1SA 4M0YA 4MX9A 5BUEA 3COHA 2VTIA 3L9NA 1PMNA 4EWQA 1BLXA 1G5SA 5CSWA 3D7TA 3RI1A 2C5NA 4QO9A 2BDJA 3RKBA 5AV1A 1ND4A 5IZFA 3QZHA 4L01A 3UVQA 4PTCA 5EH0A 1TQPA 3PP0A 1ZYCA 4FVRA 5LJJA 4FKRA 3H0YA 1MRUA 4FG7A 3QD4A 3IOKA 4MBJA 3RK5A 5DT0A 2WMRA 2W99B 4CKRA 5CEKA 3P7AA 2G9XA 3NEWA 4B6LA 1OL6A 3QZGA 3BE9A 3NSZA 2PVYA 3MH3A 3RJCA 2WFYA 1WCCA 3QQGA 3DNEA 4R1VA 4APPA 3Q96A 4BWKA 2IO6A 5HX6A 3UNKA 3REPA 1DAYA 4OTFA 3CR0A 3GFEA 4O0WA 5FBNC 4A9TA 5GZ9A 3QQLA 4J8MA 3R8VA 2XIZA 4EYMA 4OBQA 2CSNA 4FK6A 5IMEA 2PL0A 4Z3VA 3A8WA 4XV3A 2HELA 3IG7A 2PYWA 2HYYA 2IW8A 1LEZA 4KIQA 3EB0A 3QTIA 3IONA 4FTOA 5BYZA 2O64A 3IO7A 4C4FA 1HCKA 1FBNA 4PF4A 4WA9A 2YM8A 3FWQA 1NW1A 3EQRA 2SRCA 3BU6A 5C8NA 1CKIA 3GCVA 4MEDA 1XH7A 3K5UA 2BZHB 2ZJWA 5F95A 2YHVA 4ZAUA 2UW9A 4FNWA 3OMVA 3PIYA 5TO8A 3RCJA 2WTWA 4KKEA 3TIYA 4GCJA 3QKKA 3THBA 4XBUA 3EN9A 2VTPA 1M14A 3A7GA 3VHKA 4R7IA 4DLJA 4IHPA 3ZM4A 2I0YA 2PE2A 5FP6A 5CT0A 3V5PA 5CS6A 5AEPA 3T3UA 1GJOA 3F69A 4EJNA 2VZ6A 1OKWA 4TYIA 5M55A 4CFNA 2WQBA 3SKCA 2VTJA 1VEBA 3VS4A 5AV4A 4JT3A 4ZEGA 3LFSA 2RFNA 3TZMA 5HKMA 1KWPA 3S95A 3DB8A 4BIBA 2ZVAA 2FSOX 2UW0A 4NTTA 4QP7A 4ZTHA 5IQAA 3I60A 3OUKA 3QX2A 4WD5A 4OTQA 5DG5A 4P90A 5BVKA 4I6QA 1AD5A 2Z8CA 2PZYA 4ZXTA 3UIUA 2W7XA 1JKLA 5J95A 4ENYA 2X2LA 3BWJA 2YEXA 3QA8A 3F88A 4ERKA 3W2CA 4BWXA 3E8EA 4BDCA 2WIPA 1YI3A 1Q8ZA 1H0WA 3R9DA 3CD3A 4XLVA 4CYIA 3F2AA 1XQZA 3I5ZA 4MTAA 1ZZ2A 4XHKB 5FQDC 2JKQA 5HBJA 3N9XA 3VIDA 3OTVA 3R7IA 3C0HA 3C4WA 4AZSA 1H24A 3W8LA 4NTSA 4DA5A 2ZM3A 3DJ5A 3DFCB 1M17A 3VS3A 4PUZA 2QLUA 3BQCA 5IEVA 4UALA 2WMUA 1Q62A 5KBRA 2GHGA 3PP1A 3FYKX 4JLCA 2Y9QA 5D12A 5HIEA 4J71A 4BN1A 3PPKA 3QTSA 2W1IA 3SHEA 2E9PA 1Z57A 3Q9YA 3O7LB 1TQMA 4GJ3A 4H3BA 4YBKA 3A62A 2A0CX 2OZOA 3HNGA 4JVGA 3FPQA 2FSTX 2WTCA 1YOLA 4MXZA 2H6DA 3TTJA 2ACXA 1XO2B 3Q60A 4P2KA 3ENMA 2GQGA 3PA4A 4FSTA 2JBOA 4E6DA 5K9IA 3M11A 1R0EA 2OJFE 3Q3BA 4NIFB 2W1CA 3NNUA 5A6NA 5BVDA 1IAHA 1XJDA 3D83A 4IVCA 2HK5A 3TZ8A 3PZHA 4EBVA 2VX3A 3CKWA 3WE4A 5GZAA 4AWIA 1V0PA 4YLLA 4FKSA 5BVWA 4ZMEA 2P3GX 3VO3A 2IW9A 4C7TA 4YPSA 1R1WA 4QMNA 3Q53A 3R8LA 2ESMA 3LIJA 4NM0A 4QTEA 3G2FA 5CEPA 3P9JA 4CFFA 4D0WA 2HY0A 4EOIA 4E4XA 1OPJA 5CQWA 3FMEA 5HIBA 4BRXA 4IZAA 1IR3A 4FG8A 2PMIA 3CQEA 3EFJA 3PXRA 4U3YA 3RPOA 4AN2A 4HVIA 2ZM4A 5DVRA 4OAVB 1BMKA 1JOWB 3UE4A 5IQDA 3IDCA 3RNYA 4AN9A 2C5OA 3K3IA 2CLXA 2PZPA 2P4IA 3QXPA 3U4UA 3OVVA 3ZC6A 5KMKA 5J1WA 2ETKA 3FLYA 5CSPA 3ZBFA 3E8CA 3OT8A 2XIRA 3COIA 3GCSA 3FDNA 4UBAA 1W0XC 2RKUA 3TM0A 4D4SA 1UNHA 4C38A 3G5DA 2QVSE 3SW4A 1F3MC 3LFNA 3QTXA 2JBPA 3ZRLA 2OIDA 5LMKC 4MF0A 5EDQA 1Q97A 3QTWA 3R8UA 3TNWA 3ZOSA 3QTUA 5TT7A 2QKRA 1XR1A 2UZVA 2R64A 3DKOA 4M13A 2FA2A 3NDMA 3CE3A 4AUAA 3QRTA 4KIKB 5KO1A 1FVRA 3ACJA 1XHAA 4TXCA 4UWBA 4AW5A 3D2IA 4PTGA 3BLQA 3RWPA 3SOAA 3CBLA 5LMBA 4FF8A 3CJFA 4M12A 4ACMA 3WOWA 4I94A 1OB3A 1DM2A 2BAKA 4O0UA 4E1ZA 4P5ZA 2VTAA 3QX4A 4HZRA 1PXOA 3R71A 4X2GA 4Y5HA 3FV8A 4E26A 3BYSA 4OBPA 4RJ7A 2QR7A 2BHEA 3ALNA 4FKQA 3GVUA 4XH6A 3R22A 3CCNA 4FZFB 1HOWA 1M2PA 4X3JA 5JFWA 2ZB1A 4FTUA 1ZYLA 4AQCA 1PXIA 5LVLA 4FTKA 5IH6A 2JIVA 4DH3A 5DEWA 4GG5A 4EKKA 3L8VA 4BYJA 3Q9WA 5GJGA 3NIEA 4R5SA 4XX9A 1H0VA 3ZU7A 1OGUA 4I5CA 4IZ5A 5I3OA 5ACBC 3VC4A 3IW7A 4BCKA 3MI9A 4YBJA 3KEXA 5TE0A 3W1FA 5ICPA 3D7ZA 3OWLA 5HEZA 4RJ8A 4DG3E 5J7HA 4FIEA 4YJVA 5F9EA 3FEGA 2OO8X 3OC1A 3O7LD 1MRYA 4Y85A 1Z5MA 2R3MA 2C0OA 3F3VA 4FI1A 3LXNA 4WIHA 3S1HA 3CGOA 3PDTA 4U5JA 3E87A 3MIAA 4KB8A 4DGLC 3CQUA 3VUDA 4JR7A 4PWNA 4TYHB 3AMYA 4AG8A 4UZDA 4AE6A 3QCYA 2OK1A 3VS7A 1VYWA 3UP2A 4DTKA 2QO2A 4U40A 4A4LA 3GBZA 4N70A 3S4QA 1ZOHA 4H3QA 2OICA 3MVHA 4XCUA 4EH7A 3DAJA 3ORZA 3ZRKA 3KRJA 4U79A 4DCEA 3AMAA 3BYOA 3AG9A 2B55A 2ERZE 3BE2A 2B7AA 3FI4A 3HLLA 5E92A 3CGFA 2EXMA 3BLHA 1P5EA 5F20A 4ZMFA 3O0GA 5IA2A 1J3HA 3QRIA 4QP9A 4Q9SA 1KE8A 4YTHA 3KREA 1LP4A 3OROA 4FV5A 2R3IA 4I1ZA 2JLDA 4BF2A 2VWUA 4J1RA 2QCSA 4M67A 4OW8A 3RGFA 2X81A 4F0GA 2BZJA 1Q4LA 3KVWA 4IW0A 4BBFA 2XEZA 2NP8A 5DOSA 2F7EE 3OT3A 3WZDA 5BMSA 4O7YA 3I7CA 3FXWA 5CAPA 2IW6A 3PG1A 4JRNA 5E8ZA 4EK6A 2X6DA 3R9OA 3VUMA 3B8RA 4M97A 5KCVA 2KTYA 3EQHA 4FKTA 3QAME 5AM6A 3FY0A 3RAHA 2R7IA 4ZJJA 3ZUTA 4C8BA 4AA5A 4BYIA 3T3VA 4EOOA 2I7QA 1DAWA 4ZSAA 3NNWA 2C6LA 2XBAA 3R0TA 4GMYA 4IC7A 4WNMA 5E7RA 1DI8A 5JK3A 4G5PA 3UJGA 4Z7HA 4JR3A 2VWWA 2XK8A 4RC4A 3VUHA 3LJ1A 2WEVA 2WXVA 5CTPA 4NJDA 3HDNA 3RZFA 2OG8A 3D14A 3H0ZA 2YERA 3D94A 1WFCA 3R2YA 4R3CA 3RMFA 3FQHA 4EQCA 3GC7A 3LFFA 4G3GA 5AP6A 5CASA 3FMJA 2QOKA 4FT7A 4RFYA 5I9YA 5HOAA 4DGNA 2BVAA 1JNKA 2R3PA 1JWHA 2CNVA 4LG4A 4EOPA 4IX3A 4X7QA 4F6SA 2GS6A 4S32A 3EN4A 3DQXA 4KIOA 4NKSA 3I79A 2Z7RA 4X21A 4YC3A 5D1JA 2J50A 3KRLA 3OTUA 3PIZA 4KAOA 4XEYA 2ZV7A 2VTMA 3WYYA 4B8LA 2IZUA 3MIYA 3QQFA 2NPQA 3DXPA 3TDWA 3ROYA 3OEZA 3ZO3A 4G6NA 2G01A 3FC2A 3Q9ZA 4G3DA 5H8GA 2PUNA 3LHJA 4GT3A 4UMRA 4QQJA 5LCKA 4XNEA 4BKYA 4CD0A 2GFCA 3ORLA 5E8UA 3R8ZA 1OL5A 3DLSA 3GU7A 4DFUA 3P0MA 1XH8A 2WKMA 1YDRE 3BYMA 3O8TA 2EWAA 2C3JA 2EU9A 3AMBA 4QMPA 4ARKA 5FUTA 1BX6A 5EFQA 3HAMA 4EQUA 3ODZX 2CKOA 3R2BA 5K5XA 3CLYA 4IAKA 3ULIA 3PFQA 2UVZA 3RAWA 5K4IA 3EN5A 4S2ZA 3KXXA 4JJRA 4F1OA 3CTQA 3W55A 4AX8A 1PYXA 3MPMA 3ZO2A 2JITA 1YOMA 5L8JA 3JY0A 4RIOA 5FXQA 3N4TA 3BGQA 2XNEA 1ZZLA 4MXAA 4CKIA 4QMUA 5GJDA 2YIXA 3VS0A 5IISA 3SV0A 4AZFA 3KULB 5I9ZA 4KBCA 2PVLA 2UW4A 4O7LA 4BL1A 4Q9ZA 5K0XA 4K8AA 4DE4A 4CT2A 1UWJA 1UKHA 1JSVA 2YCQA 2VTNA 3KRWA 4MD7E 2BZKB 2VTHA 3SQQA 4DINA 3KY2A 4O96A 3BHTA 1P4OA 4EC8A 4YO4A 5HTIA 4KNBA 3K5VA 5EDRA 5IG1A 4CEGA 5L2QA 4L6QA 4XV1A 4O7TA 4DHFA 4O0XA 4EHGA 2B9FA 3C0IA 3SXRA 5AR5A 2QOBA 5FBOA 5CSXA 4ANSA 1UVRA 3AC2A 3E93A 4QTCA 4G3CA 5DRDA 5EOBA 5H3QA 4BCJA 4CRLA 2H34A 3IW6A 3FLQA 3NW7A 5HCZA 3COMA 3EHAA 4X2KA 1PMVA 5E9EA 4ZZOA 5I3RA 5ANIA 1FGIA 1KE9A 1SVGA 2WOTA 4L42A 2XZSA 3NMUF 2JC6A 4X3FC 3C5IA 4FC0A 2BIYA 3UQGA 5JQ5A 5K4JA 2YCFA 4UY9A 2C5XA 4YZMA 3WIKA 3ZYAA 5TR6A 5KBQA 2OF2A 1U46A 5M4UA 3LJ0A 2B1PA 1T46A 3HYHA 3MV5A 3SA0A 1JKKA 2RFDA 4I22A 4LL5A 3OS3A 4PY1A 5IF1A 4FV7A 3NRMA 3O17A 4YJOA 4D4YA 4CV8A 2ETRA 3MY1A 1PF8A 2C3IB 3NAYA 2I6LA 3V51A 3KF7A 4UYNA 2YCRA 4MHAA 4TW9A 3G90X 1H08A 3BEGA 3W33A 3TUBA 1WBWA 3B2WA 5ANDA 3TN8A 3WZUA 2WQEA 3P78A 4R7HA 1L8TA 3RK7A 3C0GA 4FKUA 4QP1A 1URCA 3KK8A 2OH0E 1KE5A 4OT5A 3GT8A 1M2QA 3H30A 2PZRA 3TUCA 5B2LA 3F6XA 3QBNA 3ORTA 4LMUA 3RPSA 4BDEA 4ZTMA 4JIAA 1IEPA 4KRCA 1W98A 4R7BA 4IWOA 4XP3A 4ZP5A 2YITA 3OCGA 3UPXA 1FINA 3F82A 4GT5A 4S34A 4G9RA 1KSWA 4DG0E 2YLEA 3DBEA 4J97A 5AUUA 3H9RA 3DKCA 3DNDA 1XBAA 2HXLA 5CEOA 2BAJA 3RWQA 1JSTA 1RE8A 3I4BA 5KMJA 2WD1A 4YZDA 4CFMA 1IRKA 3V6SA 3LAUA 5AADA 3M2WA 4FSRA 3HA8A 4HYUA 4FZDB 1NVRA 2UW8A 3ZLXA 3D5UA 4TNDA 3BX5A 3EJ1A 4ZLZA 4QOXA 2JKMA 4I41A 4HJOA 4OUCA 3NW6A 4RA5A 4DN5A 2OU7A 4F9AA 3HAVA 5M07A 2CGXA 5M4FA 2PE0A 4I6BA 4R8QA 2WTIA 4BBMA 1Q8TA 1PY5A 3BV3A 3O71A 5HU9A 2WTKC 3LXPA 4G1WA 3UO5A 2O3PA 2OJGA 4GJ2A 4F0IA 2WMAA 1U4DA 4L67A 3MJ2A 4C02A 3PJCA 2ITPA 4RJ3A 4ZZMA 2CKQA 3PG3A 5AAEA 4DH8A 4JX3A 1ZLTA 2WTVA 5CAOA 4MH7A 4MYGA 2V7OA 4AFEA 3WF8A 4PP9A 4KKGA 1S9JA 2R3GA 4CSVA 3BHVA 2Z7LA 5HTCA 3BEAA 4FSWA 4L7FA 4M7IA 5AIRA 2YM4A 3V5WA 3QRKA 4PDPA 4GK2A 3FLWA 3GU8A 4MBLA 2BFYA 1Q5KA 3GU5A 1NA7A 4RJ6A 4D2SA 5KKRC 3QD0A 5DYJA 3TG1A 1REJA 4JBQA 4NK9A 4QMZA 4C62A 3O51A 2PVRA 3SC1A 4PP7A 3ATSA 4EUUA 2PVNA 3FZOA 4DTBA 5F4NA 4DITA 2HY81 4OT6A 1PXLA 2VRXA 4U81A 3TDVA 2UZDA 1KOBA 3HGKA 4ZTRA 3QWJA 3ID6C 1BL6A 1CTPE 4ANOA 4C3RA 5B7VA 3NYNA 4BDIA 3WZKA 4YSJA 5M53A 1OIQA 5EKNA 1WBNA 3E88A 4FTRA 1NXKA 3QALE 1RW8A 4USDA 3RM6A 2X6EA 3R21A 4BDKA 4IAIA 1YHSA 3AT2A 3VQHA 1TVOA 3PJ8A 4PRJA 5FDXA 4TZRA 4FV9A 2XCKA 4IEBA 5EYKA 4HVHA 4I4EA 3N51A 4O0YA 4P4CA 4ZZNA 2VTOA 4C33A 2EVAA 4FZ6A 5BVFA 4RZVA 5BNJA 4UMUA 2GTMA 4YJUA 4AFJA 2QI8A 4FGBA 3AQVA 5IQFA 1GIIA 3VBWA 4WHZA 4E4LA 3ZS5A 4CKJA 2BPMA 3Q6WA 3QFVA 1XH5A 2J9MA 2WB8A 3G33A 4L46A 4HGSA 4PDOA 2PUPA 4AGCA 4XG3A 1B39A 2QC6A 3S0OA 2RIOA 5IUIA 4EHVA 1OI9A 4WSYA 3OHTA 3PLAE 2A2AA 2Y4IB 2BRMA 2A27A 2F2UA 2P33A 4DEDA 4F70A 2X9FA 3U6IA 4LRKA 5BYYA 3PWYA 1WZYA 4JAIA 4QMLA 3KA0A 2X1NA 5E8VA 2CNQA 2AC3A 3CPCA 4FL2A 4CGAA 5HLWA 3R7GA 4CFXA 5DIAA 4NL0A 3OY1A 3KMWA 4I93A 4FG9A 5BVNA 3MFTA 4FZ7A 2IJMA 5DGZA 4WNOA 1YHVA 3FZRA 3PXKA 4KWPA 1XH4A 3HV7A 5FLFA 5A4TA 3R8MA 3ZFMA 3N4UA 4DCAA 4PDYA 4FUYA 1K3AA 4E5BA 3PVWA 4Y95A 4JRVA 2R0IA 2OJ9A 3O50A 4PL3A 4HGEA 2H9VA 2W1FA 1R78A 3C1XA 3LVPA 5LMAA 4IMYA 4EHZA 3AOXA 2RL5A 4FT0A 5AJQA 3EIDA 2IZSA 5M4CA 2FVDA 1M52A 4I6FA 1A06A 3W10A 3QA0A 4IB0A 4OLIA 3NUNA 4ZTLA 3OCSA 4JG7A 2PVHA 5CSVA 2Y6MA 3VBXA 4WT6A 4BGHA 2VWBA 4GEOA 3RTPA 4DBNA 3TWJA 4I5MA 5AP5A 3RAKA 4CMOA 2UW6A 3ORKA 1SNXA 4YNEA 4ZTNA 4AGUA 4QPMA 4WUNA 4FEXA 5AP7A 1FQ1B 1T45A 4L8MA 2PMOX 3I81A 1PJKA 4EH2A 4F64A 3F2RA 1L3RE 4O0SA 4TRLA 4FTAA 3MTLA 2OZAA 4XS2A 1WVXA 1RQQA 5FEQA 2VWVA 2R3OA 2R3JA 3VWAA 4M0ZA 4X0MA 2HW6A 4HZSA 2HXQA 3DQWA 3FZSA 5HU3A 3IW4A 3L8PA 3Q5ZA 2XNBA 4O1PA 4OTHA 4CQEA 2J90A 4D1SA 3ZTXA 2YLFA 2XIYA 5J9YA 3DTCA 4MCVA 2QOQA 1H4LA 4F08A 4Y5QA 1MRVA 3R83A 4IXPA 5CF5A 4JG6A 1FMOE 1ZMWA 4EHEA 3EWHA 2YJRA 2GNFA 5B2MA 4FV6A 3R30A 4XP0A 2GPHA 5C1QB 4GVJA 4FIJA 1PHKA 3OG7A 4PX6A 5IA4A 3NGAA 2VX0A 3TCPA 4BKJA 4D28A 5CANA 1TQIA 1R39A 2CCHA 4MKCA 3ALOA 2QU6A 3OW3A 3PUPA 3MVLA 5EDPA 3V01A 3D2KA 4F0FA 4E4NA 3LCDA 1PXPA 3PXQA 3ULZA 2OSCA 4F7LA 4FYOA 3FI2A 4IFGA 1ZWSA 3KULA 4O38A 5KZ0A 4CT1A 5JEBA 2EXCX 3Q9XA 3MW1A 4X6RA 1SMHA 3HV3A 3Q52A 4F7NA 4E73A 3EZRA 4OBOA 5AA9A 3CJGA 1DI9A 4ORKA 2QR8A 3EL8A 3QLFA 4WUAA 5K3YA 2F9GA 4M66A 4QYYA 4TYJA 3GI3A 4UB7A 3PYYA 4FUXA 1H1PA 2RG5A 3L9LA 2HWOA 3CC6A 4U43A 2XK7A 4WKQA 3UODA 4TL0A 2E9NA 2QG7A 4YURA 4ZIMA 5L4QA 3TZ9A 3A61A 2XM9A 3EQBA 3C7QA 5AM7A 2C6DA 3G15A 3U51A 4DFXE 3ZSGA 1OIYA 4ZTSA 5A3XA 4EK4A 2NRUA 4GFOA 4XG8A 5C26A 3R6XA 2B54A 3UBDA 3SAYA 4D9UA 2ZMDA 4RIXB 3T9TA 1AQ1A 1OM1A 2R3NA 4QP4A 2OKRA 2F7ZE 3GC8A 2XF0A 4IFCA 4TYGA 3UNJA 3K2LA 2VO3A 4HPTE 1YOJA 2XM8A 4PPAA 3UYSA 4A06A 5AV0A 2VNYA 2ITUA 3Q4ZA 4GYIA 3R02A 3D15A 3GQIA 4MNEB 4APCA 1KV2A 4FNZA 4YSMA 1G8AA 3E7VA 3NW5A 3QLGA 3UPZA 1ZYJA 2W1ZA 4H58A 5D41A 4GK3A 4E8AA 3RHKA 1OZ1A 3V5JA 4EH6A 1YI4A 5IEXA 3EKNA 4FSYA 4KABA 4IE9A 3EQIA 4UXLA 3UG1A 3LFCA 4AOJA 5AP1A 3PPZA 4GS6A 5D10A 3ITZA 4GW8A 4I21A 5ETAA 2IPXA 3W2RA 4R3RA 1H8FA 1FPUA 5DR9A 4AGWA 4C35A 3C4CA 2VGOA 5DI1A 3HP2A 1ERKA 3TJDA 1SVEA 4GKHA 3VVHA 3G6HA 2OJJA 3TNPC 3UDBA 4QYEA 1Z9XA 2PY3A 2GHMA 4JOAA 5J87A 3ZDIA 2C5VA 4GV1A 3ORIA 5L2SA 3FI8A 3U9NA 3VRZA 1WBSA 2GS7A 3BGPA 1Y57A 3HA6A 4F1TA 4YNOA 4RGJA 3QRUA 4K6ZA 4EYJA 3SDJA 4N6YA 4R77A 4QRCA 3UOLA 4NFMA 4PMPA 5C8MA 1XWSA 5IPJA 1H07A 4IIRA 1XBCA 4YMJA 2XEYA 4FEVA 4BWPA 1JQHA 5HNGA 4BVUA 3QUPA 3R9RA 3DV3A 3EKKA 3I6WA 4FTLA 4XG2A 3R00A 4A4OA 5CEQA 4ZS4A 3UC3A 3F5XA 1ZY4A 4QP2A 3GENA 4G17A 4NM3A 4EOJA 4FODA 4G6LA 5DT3A 3FKOA 5BUIA 4IM3A 3FQSA 5K0KA 1O6LA 2AUHA 4TWPA 3TZ7A 5IQEA 3RNIA 3BIZA 1U54A 3UG2A 4HCUA 5HCYA 3GNIB 4C2WA 4O27B 2YABA 3CS9A 3E7OA 3PJ1A 5G1XA 3F7WA 5CU2A 4S33A 3EQCA 2R5TA 5EM7A 5HHWA 4BBEA 1E9HA 4JDIA 5AAGA 1UKIA 3W18A 1ZMVA 1JKSA 1YDSE 2UZWE 3C51A 4IAAA 4DLIA 5FP5A 4NH1A 5HE3A 5KHXA 5DNRA 3ZO1A 4NYEA 4CMTA 2H8HA 1R3CA 5LCJA 5AFVA 3H3CA 3AC3A 4MVFA 4RFMA 4F4PA 4HPUE 2ETMA 5LXMA 3LFQA 2CGUA 3UTOA 4C4IA 4AT3A 3UC4A 4YPDA 2Q0BA 4LOQA 4O91A 4FK3A 4UMPA 5JH6A 3MY0A 3E64A 3OP5A 4F9CA 4WO5A 2JDRA 4L53A 5DFPA 4ASEA 3OXTA 5GNKA 4E20A 3AD5A 2GNIA 3A7HA 4HCVA 4FIFA 4CCBA 4CZYB 1WVWA 4PV0A 3IDBA 5CZHA 4MK0A 2X4ZA 5HO6A 4PMSA 3WIGA 1YI6A 3QZFA 5KMNA 2WMXA 2E9VA 5FDPA 2DS1A 4YR8A 2XCHA 3QD3A 1SZMA 2V0DA 3MTFA 4G3EA 4QNAA 3B8QA 2C6EA 5LWMA 2W05A 4KINA 4K77A 4E6QA 2B0QA 5TKDA 3L9PA 2XVDA 4TWNA 3C4ZA 3KF4A 3FHRA 5LQFA 4CXAA 3SW7A 2ITXA 3D9VA 3DU8A 4HNFA 4TT7A 3GFWA 4XOYA 4WRSA 4M8TA 3OF0A 4L52A 4IX6A 3FZ1A 3FUPA 3KKVA 4FTQA 1YVJA 4JBOA 1U59A 2ZB0A 3FAAA 4S31A 3VUGA 2WU7A 2JAVA 5L6PA 4QP3A 4PNIA 4D5HA 3FBVA 3QWKA 4R6VA 5DN3A 5E90A 2IWIA 5EW3A 4FKGA 4ALWA 5HO7A 1OITA 3IPHA 3PRFA 3CP9A 3HP5A 3PSDA 5CENA 4QTBA 2Z7SA 5GINE 4Y8DA 4YZCA 3RAIA 2XMYA 4U3ZA 5E8TA 5CF4A 3VUIA 4ITIA 2E9UA 3TNQB 2PVJA 5AMNA 2BUJA 2PVKA 2XS0A 3VS2A 3WBLA 5I9VA 4EOQA 2DYLA 5EW8A 4RIWB 2XK3A 1SYKA 2J0MB 4MXCA 2X8EA 3ACKA 4RX9A 5HE2A 5C27A 1W83A 3QCXA 4FKPA 1WBVA 4OAUC 2FSLX 2WQNA 2X2MA 4OR5A 3S3IA 3SRVA 4C4JA 4UXQA 2A4LA 2B4SB 3DA6A 2XK6A 4RX5A 4HYHA 5BUJA 3EFWA 1RDQE 3A4OX 1GY3A 4BB4A 4NCTA 4U42A 3R7EA 2ITOA 4IACA 2VNWA 3DKFA 2CNUA 5HVYA 2JKOA 4IWPA 3OY3A 4TWCA 4XJ0A 3ZLSA 4E7WA 3BCEA 3LPBA 1YHWA 4G5JA 3QKLA 4AZTA 2BRGA 3PE1A 4ANMA 4ANNA 4BGQA 4BCIA 5BX0A 2C0TA 4KBKA 4QYGA 4BI1A 3EN6A 5CY3A 4ZSEA 5EHLA 4AZEA 5LVMA 1U5RA 1J1CA 3HMNA 2CGWA 2R4BA 4GFMA 3SD0A 4O7SA 4YU2A 1G8SA 2W1GA 3KK9A 3TKHA 3UIMA 4JG8A 3NUSA 5J1VA 2XP2A 1E1XA 4W8EA 1M7NA 1YDTE 3RPVA 3ZBXA 3H4JA 5EYDA 3OBGA 1Q61A 2ZV8A 1I44A 4AAAA 4EWHA 2IVSA 4YJRA 4DC2A 5L2WA 4O81A 1CKJA 4RC2A 1UNLA 2CGVA 5DE2A 1O9UA 2QOHA 2C30A 3KMUA 4IC8A 1IASA 4UZHA 3VQUA 4WNKA 2BDWA 2A19B 2YM5A 2OGVA 4AF3A 5IA0A 1YXTA 4M3QA 4D55A 4DTAA 2R3FA 4BZOA 3KGAA 2ZDUA 5E8WA 3MSSA 4ID7A 3CTJA 4M14A 5A6OA 4BI2A 5HCXA 3LFEA 4S30A 3WILA 2BKKA 4G34A 4I20A 4B4LA 3QC4A 3LLAA 2LGCA 2YAAA 4CNHA 4USFA 4LOOA 4IANA 3VS1A 3UOJA 1Q8YA 3MB7A 3ZLWA 4QNYA 3SXFA 2P2IA 3MN3A 3EOCA 4FTJA 1H25A 3BU3A 3IECA 3NYOA 4J96A 4A9RA 1AGWA 2ITTA 3Q04A 3GGFA 1H00A 3AT4A 3TXOA 3F5GA 3OXZA 3A99A 4I0TA 2GNLA 5M44A 2CPKE 4UX9A 2VO7A 4EZ7A 3FKNA 4GG7A 4TPTA 2F4JA 3O23A 2Y8OA 1UU3A 5AAFA 2JFMA 4H1JA 1PMUA 2X8IA 4WG4A 4MF1A 5AWMA 5T3QA 5TF9A 3L8XA 5IQBA 3RPYA 3ZZEA 4ZLYA 3MGYA 4IVAA 3FJQE 3B2TA 3QQKA 4WG5A 4CQGA 4RIYB 2W9ZB 3FSKA 4XRJA 5J8IA 2DQ7X 4L43A 3EFKA 3R7OA 4TKSA 2QO9A 3BRBA 4A9SA 3FLNC 3VJNA 4RIXA 2WPAA 2C47A 4RSSA 4X2JA 4CZUA 3G9LX 3E92A 3LW0A 4ZSGA 2E2BA 3NNXA 2NO3A 2QURA 4JI9A 3CSVA 3IGOA 3OCBA 1OKZA 3D7TB 5JSMA 4MNEA 5G6VA 1XH9A 1XKKA 3R04A 1ZXEA 3NNVA 4IB1A 4F63A 4HVSA 2Y0AA 3V5QA 2IVUA 5JZJA 2JIUA 3PRIA 3GU6A 4Z16A 4NWMA 5L8LA 3W2PA 3KXGA 3PZEA 4D58A 3QC9A
chains in the Genus database with same CATH superfamily
3FHIA 4XMOA 2I40A 3G0FA 3IKAA 4FT3A 2W4KA 4M68A 4NSTA 1OBGA 1FMKA 4ALUA 2YWPA 4FIGA 2X4FA 4RT7A 2BRHA 5AR3A 4Y73A 4BCFA 3FE3A 3QF9A 4XG9A 1YXXA 4QTAA 3WF7A 5L6OA 4Z7GA 5EM6A 3NYVA 4DDIA 2W1HA 4FV0A 3PY3A 5CVFA 3PY1A 2WNTA 3QQUA 4UV0A 2C6TA 2FGIA 4H39A 5LVNA 3DLZA 5EK7A 2Z60A 3S00A 4CG8A 3LCOA 3LQ3A 3BHYA 3GEQA 3QD2B 4C36A 5DBXA 4L3LA 4IAZA 4IAFA 2PVMA 2W5BA 4YJTA 4FR4A 1SNUA 4FOCA 3L8SA 1FVTA 3KMMA 3IK3A 3KC3A 3L1SA 1ZOEA 4NW5A 4BCHA 5CAVA 1JVPP 4BCNA 5DRBA 5ANGA 4JXFA 5DH3A 3W0RA 4FX3A 4WBOA 4UWCA 4OTWA 3DJ6A 3PSBA 4YC6A 5ANEA 4BCPA 5HD7A 2QKWB 3EMGA 1OUKA 4FOBA 4NIFA 5J5TA 3W2QA 2ITNA 5FWKK 3ZEPA 4DT9A 4U41A 2OFVA 3V3VA 1CSNA 3NUUA 1ZOGA 2GFSA 5JGBA 3NZ0A 4BDFA 4EOMA 1OVEA 1FVVA 2PZIA 5IUHA 5JGAA 2X2KA 5IQCA 2FH9A 3E5AA 2WOUA 5E8YA 3ZCLA 3PXZA 5I0BA 1IAJA 3UZRA 2HZNA 2I1MA 2PHKA 3RP9A 1DS5A 2OWBA 3OWJA 3LM0A 4ZK5A 3ZH8A 2PE1A 1H1QA 3JS2A 5GIPE 3U9CA 5EKOA 2XNMA 3P79A 3GC9A 4FRFA 4MXYA 1YWNA 2V55A 4JQ8A 4RJ4A 4Z9LA 2UZOA 3MPAA 4QPAA 3QL8A 4AACA 4ZS0A 4D0XA 4FGRA 3KRRA 5CU3A 4QYHA 3MH2A 2EXEA 4RVLA 4O7VA 3WF6A 4FV2A 5M51A 3UGCA 4RLKA 3F66A 3ZONA 4FVQA 2XKDA 3IW5A 4V0GB 3W8QA 2XJ1A 2V62A 5BVOA 2QG5A 4GKIA 3H9OA 2BRBA 3UIXA 1GIJA 4FNYA 2C6OA 3ZUUA 1H1WA 3EQGA 3CPBA 3OWKA 4Y72A 4HW7A 3C13A 1YXUA 4CV9A 3MA6A 3Q4TA 3R1QA 4H3PA 3DK7A 3ODYX 1CKPA 2R3HA 4BHZA 2O8YA 3LMGA 4F7JA 3L9MA 1BI8A 4F78A 4KIKA 4IB3A 4B8MA 4PNKA 4I6LA 2VD5A 4L45A 5IH5A 4BC6A 2O65A 3VN9A 2IEWA 4O21A 5D11A 3DBCA 4FTIA 5L6WL 4FT9A 4BKZA 4LGGA 2JD5A 4RVTA 3WE8A 3DDQA 4DEGA 4W9XA 3SVVA 3KXZA 1ZY5A 4DH7A 5LWNA 3GUBA 3U54A 2ITVA 3LE6A 4FV8A 2E9OA 1Q3DA 4QMOA 1PKGA 2B9IA 4KIPA 2RF9A 3QCQA 5CEMA 2G2IA 2X7OA 4OTIA 3ZLYA 3OCTA 5E1EA 4FSUA 1O6YA 1KE7A 5HVJA 2J6MA 2YACA 3U6HA 1EH4A 4V01A 4F6UA 4QYFA 2CLQA 5DMZA 1PMEA 3D4QA 3LCKA 3RHXA 4AXAA 5I9WA 3D5VA 4AU8A 1RJBA 2GCDA 2XJ2A 3TKIA 3JYAA 4IDVA 4XBRA 3UOKA 4BCMA 3VS6A 3DAEA 3DB6A 1BL7A 4PDSA 3MFRA 4KSQA 4R3PA 3ZXZA 4XG6A 4C57A 4EEVA 2XIXA 4DH5A 1OIUA 4KD1A 3N4VA 1YKRA 4PPBA 3PVBA 4BFMA 3FXZA 3DOGA 2J0JA 3KU2A 4DH1A 4QMMA 4EH8A 3MB6A 1YWVA 4FKWA 4UYAA 3HEGA 4AW1A 4HGTA 2Y4PA 4C4HA 1QPCA 3AD6A 3I5NA 2X39A 4B7TA 5JQ8A 3R1SA 3F3WA 1IG1A 5EHOA 2QODA 5IDNA 5CAUA 3SGCA 4O4FA 4CRSA 5IA1A 2NNWB 4O2PA 4XG7A 4JAJA 1A9UA 3I6UA 2RSVA 3E62A 4EH5A 3TT0A 3FMDA 3SLSA 4TYHA 4GU6A 4BI0A 2WQMA 3MFSA 5KMIA 3PFYA 3T9IA 3V5LA 3PSCA 3EZVA 2VUWA 4EH3A 4C4EA 2CN5A 1QPJA 1IA8A 2XANA 2UVXA 5BMMA 4F6WA 4D1XA 5KE0A 3VBTA 4RVKA 4RWKA 2DWBA 3FL5A 4JDJA 4RFZA 3ZSIA 2GQRA 3SG9A 3COKA 5E8XA 4FEQA 5M09A 2W17A 3GCPA 3FSFA 1H27A 1UV5A 4KBAA 3R8PA 3LM5A 1YWRA 5GIOE 2VU3A 2VWXA 4GRBA 5CNOA 4E5WA 3TNIA 4YZBA 4HVDA 3QUEA 4EL9A 1YW2A 1WBPA 3BGZA 4EOSA 2Q83A 3QTZA 5KX8A 3PXYA 4QQCA 4U45A 4IJ9A 4C0TA 4F9BA 2AYPA 3BLRA 4XV9A 3VBQA 4Z55A 3VUKA 4AN3A 2WGJA 3BLAA 4DFYA 3E8NA 1MP8A 2UZTA 2XNNA 3HUBA 4UMTA 2YAKA 3FYJX 3NCZA 4AZWA 5HE0A 4AXFA 4K1BA 3VW6A 3NFFB 3OWPA 2FYSA 3DAKA 1ZARA 3QCSA 5ANOA 4C4GA 4EQMA 4FL1A 2R3LA 3AC4A 4QD6A 4LOPA 1PRYA 4H1MA 4RX7A 5DWRA 4FEWA 3RINA 4D4VA 2WTDA 4DEBA 2ZM1A 3OOMA 1XH6A 3R01A 3HKOA 2QNJA 4FL3A 5CU4A 4FT5A 4D9TA 5J9ZA 3C4EA 4X3FB 5AUZA 2JIIA 2QO7A 4FKOA 4O6EA 4PQNA 2RGPA 4ZSLA 3ZM9A 3C50A 1BUHA 4IJPA 4QP6A 3LMHA 2C69A 4FV1A 3U6JA 4G3FA 2C6KA 4PMMA 4QMSA 3PIXA 4RQVA 4TNBA 1SVHA 2PUUA 5CQUA 3UZTA 4LRJA 4RZWA 1OKVA 1PW2A 5LVPA 4GUEA 2CHLA 2O2UA 2RG6A 3NX8A 4XRLA 4LUDA 5HG7A 2I0HA 2YWVA 3HZTA 3RK9A 5A4EA 5CU0A 4TWOA 5FM2A 5HI2A 2F7XE 2QOIA 4IVBA 4LFIA 4LI5A 1WVYA 2X9EA 4GFGA 1JPAA 4ACCA 4GIIA 4F9WA 5T6KA 2WMVA 3W2OA 1MQBA 4KKHA 3R9HA 3RVGA 4M69B 3R7VA 4F99A 4AW2A 3FC1X 2OI4X 2VO6A 4R5YA 3T8OA 2UZNA 4EH9A 4N57A 2J5FA 1O6KA 4IADA 2J5EA 2CMWA 1JKTA 4J99A 2Y6OA 3K3JA 4LV5A 5FM3A 3VBVA 5AR2A 3QGWA 2QQ7A 5FRIA 3Q2MA 2C0IA 3AT3A 3PLSA 4LMNA 3CIKA 5DHJA 5IQGA 4LUEA 2HCKA 5M56A 3V8WA 3CEKA 5K5NA 3FLSA 4FYNA 1HCLA 3EQFA 3I1AA 3DGKA 5FXSA 2ITZA 3SXSA 2XYUA 1NY3A 4RIYA 3UQCA 3MPTA 1E1VA 3DKGA 5AUYA 3HX4A 4MQ2A 2YIWA 3ML1A 3OBJA 3F2NA 3FMMA 4ZTQA 4GUBA 3U8WA 4EC9A 4E6AA 2RFEA 3R73A 4YUQA 5EQPA 4N6ZA 3W2SA 5LMKA 3FLZA 3G6GA 3H10A 1CM8A 3O96A 3VF9A 4C34A 4JL9A 2GS2A 3KN5A 3O8PA 4J52A 3V8TA 3SOCA 3NWWA 4KSPA 2V22A 5CWZA 4KUJA 2WMSA 3QZIA 3WARA 4DYMA 1JBPE 3DBFA 3ZRMA 4E3CA 4ASDA 5AV3A 3O8UA 4A9UA 1APME 2YFXA 3ZC5A 5L2IA 3D0EA 3LFAA 4C59A 2WTKB 3QTRA 1UNGA 4G9CA 4XOZA 5CX9A 5FG8A 4A07A 4BDGA 5IA3A 4BY9E 5CXZA 4IX5A 4YP8A 2CJMA 3NVKI 4IB5A 4K2RA 3LQ8A 3OUNB 3MVJA 4W9WA 4I3ZA 2NYAA 3P86A 4Q5HA 2R3RA 2ITQA 4MD9E 4F7SA 3WF9A 3LKMA 5I9XA 4O7RA 3BL9A 4Y83A 3MJ1A 3FY2A 1UU9A 4GIHA 3DK3A 4P7EA 4NEUA 3ZXTA 2QHNA 3DY7A 2VAGA 5A14A 5KKRB 3I0QA 3P08A 4CTBA 3GOKA 3LXKA 4FSNA 2WHBA 4O84A 4G2FA 4BTFA 1F5QA 1BKXA 5JMSA 5CZIA 4AOIA 4BZDA 1NT2A 2OLCA 1G3NA 2H96A 3HV4A 5AP3A 2G2HA 2YDKA 3HMPA 2IG7A 3FI3A 4DEEA 2VTQA 4NT4A 5HZNA 1SM2A 2XNPA 3A7IA 3ERKA 5F1ZA 3R9NA 4L3PA 4YZ9A 4BDJA 4NM5A 2BKZA 4UWYA 3WF5A 5D7VA 1GZOA 4W4VA 1LEWA 2I0EA 4LV8A 2GTNA 4EJ7A 4DBXA 4FNXA 2VO0A 1VYZA 4K11A 3NVMB 1IA9A 2WEIA 2JDTA 3GQLA 2LAVA 4FSQA 3EFLA 4BDAA 4QMXA 2EB3A 3DZQA 5FGKA 4QMWA 1ATPE 3II5A 3QYZA 3A8XA 4EBWA 1YQJA 4V05A 4GYGA 2BTRA 4IWQA 4JBVA 3TIZA 4BJJB 2W4JA 1VJYA 4QMTA 2PU8A 4WBBB 5KMMA 5T68A 5H2UA 3RPRA 1KOAA 3LOKA 4L44A 4CZTA 3OD6X 4O7WA 3QTQA 4RMZA 4E4MA 5C9CA 1Y8GA 1J7IA 5HG8A 5A9UA 3OZ6A 3QQHA 1R0PA 2YDJA 2CN8A 2J51A 4IWDA 4C58A 1STCE 4NZWB 1QPEA 3EH9A 4DEHA 2BILB 1Y8YA 1Y6AA 4V0GA 4IQ6A 4U44A 2AC5A 3POZA 3ZDUA 4LRMA 2J2IB 3Q32A 4GSBA 2IZTA 5DR2A 4E5AX 3H9FA 1KUTA 3SX9A 1K9AA 3P5KA 5AR4A 4ANLA 3NCGA 1ZMUA 3PJ3A 4FKLA 4O0VA 2Z7QA 1F0QA 2ZOQA 3AC5A 4WOVA 3TI1A 3NR9A 5CAQA 2UZEA 3F5UA 4QMQA 1KV1A 4L3JA 3G0EA 2YIYA 1BYGA 3AGLA 4MUQA 4E6CA 3EYGA 2A98A 2C3KA 3GC0A 5DA3A 5I5ZA 2WMWA 3KCKA 4GVAA 3DDPA 3HMIA 4JS8A 5CT7A 3F3UA 3VHEA 4CFUA 2GMXA 4I0RA 2X0GA 2V5QA 3R7UA 2UZUE 2XBJA 2JFLA 3MESA 2VTLA 4IH8A 4WRGA 5A54A 3PA3A 3BYUA 3VF8A 1GZKA 4BDBA 2UV2A 2GNHA 4LM5A 2HENA 3LCTA 2J4ZA 4U8ZA 3PA5A 4DFBA 5CF6A 3BHUA 4G16A 4EK5A 1UA2A 2Q0NA 3TNHA 4D2PA 1URWA 3ORXA 4FKJA 5LVOA 3NLBA 4NJ3A 1Y91A 5HLNA 1VZOA 4MBIA 4LGHA 2W1DA 5DR6A 4ZSJA 2WQOA 3DXNA 5EI6A 2UUEA 3ZMMA 2XA4A 3JUHA 2ZDTA 4RWLA 2B53A 4OTGA 3P23A 3RM7A 2C1BA 2AQXA 2UW7A 5E91A 3MS9A 3ATTA 2WTJA 3KXMA 5IEYA 3BZ3A 4O22A 4GK4A 2XNOA 5EQYA 4Y46A 5JFSA 2XKEA 4JIKA 4O4EA 3WYXA 4R78A 3POOA 2R2PA 2GSFA 2FO0A 2GNJA 2BTSA 2R3KA 4I24A 4BTMA 3AC8A 5A46A 1A48A 3HECA 4FJVA 3DJ7A 2BALA 2XH5A 1ZYDA 2XB7A 2XKCA 1I09A 3R28A 4EK3A 4HCTA 4OTDA 4HNIA 1PXMA 4AT5A 2P0CA 3NPCA 3ZEWA 4AOTA 3A7FA 4EOKA 1W84A 4ANBA 3VS5A 3NYXA 3P7BA 4YZNA 5EYCA 4FTCA 5E8SA 2YM3A 3IDPA 1GZ8A 5H9BA 4A4XA 4CTCA 4X2NA 1UU7A 4ONAA 3NS9A 3GCQA 3QYWA 3F7ZA 5GZ8A 2PMLX 3BL7A 3JVRA 5B0XA 2WELA 4AZVA 3FMHA 1QCFA 2FB8A 2IZRA 3P4KA 4HOKA 3FQEA 5EI2A 5EYMA 5AX3A 4KA3A 3TV6A 1J7LA 1OGYA 5CYIA 2VTTA 3ENHA 3IS5A 4YJQA 4BCGA 3DZOA 4O0TA 5IUGA 2QD9A 2A1AB 5EW9A 4F09A 1QL6A 3ORPA 3UMWA 2HZIA 3KRXA 3FKLA 5F94A 3D5XA 5JFVA 2KULA 5AUTA 4C3FA 3UNZA 1Y6BA 2Z2WA 4MWIA 5FEEA 3HV6A 4RVMA 4DT8A 4OGRA 5JGDA 4I92A 2BR1A 4JDHA 3C5UA 2B9JA 5CI7A 3PE2A 5ACKA 4CLJA 2PPQA 3BBWA 5BQ0A 1TFFA 3MBLA 3LQ5A 4D2WA 3PVGA 1OMWA 1J1BA 3VRYA 2PVFA 2CKEA 5AR7A 5KMLA 4TYEA 4B99A 1P4FA 4Q2AA 5M57A 3ROCA 4U80A 4BR3A 2BHHA 3C4FA 3FMNA 2W5HA 1JAMA 3OW4A 4D4RA 4X3FA 2R7BA 5CU6A 3TACA 5HNIX 4EZ5A 4H05A 3HRBA 4RLLA 3U87A 4DFZE 2JDOA 4JBPA 2GQSA 5AP2A 4L68A 1Q8UA 5JRSA 2OJIA 4AT4A 2QOLA 4O7ZA 4II5A 3WI6A 4F9YA 2HWPA 2PSQA 2ITYA 3WZEA 1GAGA 2JKKA 3QGYA 4YHJA 5AX9A 4C2VA 2X7GA 2PMNX 4RRVA 2O5KA 4ZOGA 3ET7A 2J0IA 2BIKB 1M7QA 2HAKA 4W8DA 4O6LA 1XBBA 2JDSA 3VW8A 4BZNA 4CFWA 2XK9A 5C4KA 1PXKA 3LJ2A 2C6MA 4M69A 4V04A 3KVXA 1JSUA 4I6HA 1P14A 4O0RA 5HNBA 3RZBA 4DFLA 2C1AA 3EL7A 1YRPA 2G15A 5BVEA 2QONA 5HE1A 4LYNA 1YXSA 2YDIA 3BV2A 1H28A 4RWJA 4QQ5A 4MXXA 4J8NA 5EOLA 3NUXA 4D2VA 5TOZA 3CY3A 5I4NA 3BYVA 3SG8A 4FEUA 4MD8E 4HGLA 4ASZA 3GB2A 1V0BA 4RC3A 2C6IA 3QUDA 4EI4A 4FKIA 1V0OA 2HZ4A 2O0UA 4HYIA 3QQJA 4YJPA 2J0LA 5HO8A 5LOHA 2IVVA 2JEDA 3GP0A 2GU8A 2OIBA 1PYEA 4W4YA 4AGDA 4AP7A 5GHVA 4BGGA 1B38A 1H01A 4D1ZA 2GNGA 4YLJA 5J9LA 1VR2A 3D5WA 4X2FA 4IAYA 3UZPA 4RQKA 4BCOA 4K33A 1PXNA 3C9WA 4U7ZA 2YA9A 2PULA 5M4IA 3PXFA 5CEIA 3IW8A 2XRUA 4QT1A 2G1TA 2XRWA 3DS6A 3KCFA 4GL9A 5EG3A 5AUVA 2W1EA 3BI6A 1Q3WA 4NM7A 3ELJA 5HGIA 3AXWA 5CLPA 5HTBA 5J79A 3U4WA 3ORMA 5HESA 2REIA 3MY5A 2VV9A 4J7BA 5AP0A 3EQDA 4O4DA 5ITAA 3G51A 3VULA 2XK4A 4UN0C 4YJSA 2Z02A 4ACDA 3MWUA 2F2CB 1FOTA 4NUSA 4W4WA 5A4LA 1KE6A 2OH4A 4ZY6A 1H26A 4L9IA 3K54A 2W5AA 1Q99A 2XNGA 5HQ0A 4RG0A 3TUDA 4DGMA 2OBJA 4D2TA 5H8BA 4KS8A 2R3QA 4D5KA 4BIDA 1OECA 3DCVA 1WBOA 3MH0A 4I23A 5CI6A 5AIKA 3VUTA 2XAOA 3UDSA 5HBHA 1UWHA 4ACGA 2X8DA 4CFVA 2UZBA 3PVUA 3CTHA 3IQ7A 5C01A 1LUFA 2C68A 2P55A 3A7JA 4ZY4A 4DF3A 3BELA 3MVMA 3HDMA 3IOPA 3UVRA 4A9YA 3LMIA 1FGKA 4AXEA 3F5PA 4O2ZA 2OZAB 3GCUA 3QKMA 4JQ7A 5M06A 3NAXA 3R7YA 3AKJA 4BCQA 4EKLA 4J95A 2F49A 2YCSA 4WNPA 5E1SA 5M08A 3Q6UA 3F3TA 2I0VA 3TV4A 4WG3A 4XV2A 2V7AA 2YJSA 3HMOA 4K18A 5D9HA 5IH4A 5KMOA 3FXXA 1UU8A 4FIHA 4TN6A 3ZSHA 4FE2A 2OXDA 4FMQA 4N4SA 3TL8A 3ANQA 4ACHA 3UOHA 3DPKA 2VWIA 3Q4CA 2XUUA 2ONLA 2W0JA 4MNFA 4F1MA 4DG2E 1PKDA 5HG5A 2WMTA 4DAWA 2VTSA 2WMQA 2ZV2A 5IDPA 1U5QA 4M15A 1LPUA 1W7HA 2Y7JA 4PPCA 4LQMA 4Q5EA 3V04A 4BDDA 3FZTA 3GXLA 2YM6A 3FZPA 3MYGA 3E3BX 4PL5A 4U0IA 5EQEA 3DK6A 2G2FA 1LR4A 4BICA 2XYNA 3MA3A 2UZLA 5HIDA 3V5TA 3ETAA 1S9IA 3HL7A 1MUOA 5AA8A 5C8KA 2YN8A 4FZAB 4UMQA 2HW7A 3HVCA 4EK8A 3KB7A 5IU2A 2R9SA 4AS0A 4F65A 2Y4IC 3UO6A 1YXVA 2OFUA 3QRJA 4YO6A 1Q41A 3LXLA 4L7SA 5I9UA 5KZIA 5ANJA 4BDHA 3DTWA 2YIRA 5CNNA 1BI7A 4FVPA 3R1YA 5DLSA 3PY0A 5HD4A 3RALA 2FUMA 1W8CA 5FTOA 5JZNA 4G6OA 4DFNA 4FIIA 2C3LA 2W06A 2WU6A 2UVYA 4AA4A 3JR1A 2QOCA 5HORA 2J0KA 3JPVA 4LGDA 2WIHA 4MXOA 3QU0A 2JGZA 1OL2A 3V8SA 2YZLA 5EHYA 5HVKA 5IMXA 1X8BA 2WZJA 3CQWA 2HIWA 3R1NA 5FTGA 2YM7A 2EB2A 4FV4A 3JXWA 3JY9A 3LFDA 4C61A 1GNGA 4FKVA 1B6CB 3LCSA 4RWIA 4DEIA 3UYTA 5JRQA 2QHMA 2BMCA 2C5YA 5IA5A 4FICA 5IQIA 1CMKE 3UVPA 2BCJA 3DBQA 2PUIA 4FTNA 4NCTC 1WMKA 4U6RA 2UW5A 1CDKA 3FMLA 5BPYA 2XKFA 2UW3A 3C4XA 4JQEA 3S2PA 3ZO4A 4EORA 3M42A 5A4QA 4G31A 2PK9A 3A60A 4FTMA 3TKUA 3EQPA 3PWDA 1GZNA 5HX8A 4RA4A 4BTKA 3DFAA 2B9HA 1Q24A 5AP4A 3CXWA 4ANQA 2PZ5A 2ZV9A 3GOPA 4I4FA 2WMBA 1GOLA 2XJ0A 4NU1A 3GU4A 4WSQA 3PJ2A 3TTIA 4AE9A 5DEYA 2FSMX 4O1OA 4USEA 3TEIA 3UMXA 2BDFA 5DT4A 5ETFA 3NUYA 4RJ5A 3BHHA 4BTJA 3KIOC 2ZMCA 5EM5A 2ERKA 3KN6A 4R1YA 5JN2A 1WAKA 4I5HA 5H8EA 2BZIB 5B2KA 3FL4A 3MH1A 5ETIA 3DBDA 3W32A 2OW3A 4QQTA 3BPRA 3AD4A 4JX7A 3P7CA 3ZZWA 2O63A 5FEDA 3ZUVA 4FSZA 3LZBA 1OL1A 1WBTA 2F57A 2P2HA 3O2MA 2QOFA 4TY1A 3TV7A 3BQRA 3HUCA 4JNWA 4B9DA 4EZ3A 4FSMA 5A4CA 5CF8A 3LFBA 1QPDA 4U97A 3U55A 1Q8WA 4QMYA 3PTGA 4J98A 4MWHA 5EM8A 3HV5A 1NVQA 4O7NA 4HVGA 4QP8A 1J91A 1OPLA 3R63A 2W4OA 3E3PA 3P1AA 3AC1A 5HICA 3RBWA 5KUPA 2BROA 4E93A 4CVAA 4ITHA 1OBDA 4B0GA 3A4PA 2W96B 4EH4A 1PXJA 4FBXA 1V1KA 1U54B 4FV3A 4OTPA 3IGGA 5CSHA 5AR8A 4X6QC 4DGGA 4PL4A 4C37A 5CALA 3I7BA 4O83A 3NUPA 1REKA 3KQ7A 4YTIA 3V6RA 5D7AA 1M2RA 1ZAOA 1G8KA 5FTQA 3KXNA 3VNTA 2JDVA 5AUWA 4ALVA 3W0NA 4EUTA 3QHRA 5IQHA 1ZYSA 5KHWA 4J53A 4NW6A 4RBLA 5CXHA 1MQ4A 4PTEA 2VTRA 4ZLOA 5DPVA 3DT1A 3BU5A 5C03A 1XMMA 4CCUA 2ZFYA 3OOGA 2OF4A 2OXYA 4IDTA 4RIWA 3EYHA 4I0SA 4NFNA 4UEUA 2BRNA 1J7UA 5LARA 1OIRA 2PWLA 2B52A 2JAMA 5IKWA 3VBYA 5JKGA 4IZYA 2ITWA 4YJNA 4N0SA 3I0OA 3ZHPC 5C4LA 3VAPA 2VN9A 3HRCA 3JVSA 5AV2A 3WZJA 4GU9A 4M84A 1NVSA 2BAQA 5AUXA 3RCDA 4LL0A 4ITJA 4DEAA 3Q2JA 5J7BA 4TTHB 4RPVA 1OUYA 5JFXA 2C4GA 3DXQA 3Q4UA 4O86A 2VX1A 1K2PA 3MDYA 4IZ7A 4K9YA 5J5SA 2OXXA 1GIHA 4DGOA 2XAMA 2VWZA 4L00A 4HYSA 3BWFA 4LV7A 3G9NA 3KFAA 4IBMA 4XLIA 4EONA 3W0SA 4U9AA 2ONLC 4D2RA 2QU5A 4PMTA 4IVDA 3FMKA 4XP2A 5EI8A 3TJCA 3BBTB 5L8KA 4BHNA 1OL7A 5CVGA 2HZ0A 5JT2A 4CYJA 4AA0A 3NIZA 4XUFA 4XYFA 3VJOA 3ZFXA 4IM0A 3A2CA 2WO6A 5FXRA 2YZAA 4A7CA 3F61A 4I5PA 3HRFA 4KS7A 2GDOA 1OPKA 3AGMA 2R0UA 3E63A 4W4XA 3UIBA 4FA2A 2DUVA 2BFXA 2CCIA 3QXOA 4H36A 5ETCA 2IN6A 2W9FB 4MAOA 4RX8A 3M1SA 4GT4A 4CLIA 3PPJA 4O82A 3F9NA 4YLKA 5FD2A 2X7FA 1W82A 4JDKA 4ZJVA 2VGPA 4MQ1A 3CY2A 2OIQA 2ZYBA 3MFUA 2EUFB 1H1RA 2YIQA 3ANRA 4IM2A 4ZY5A 2CKPA 4KRDA 4DHJA 3UP7A 4CMUA 4ASXA 3OFMA 3ZFYA 1QMZA 1OKYA 2NRYA 2VWYA 3CD8A 3LLTA 5HG9A 3W16A 1ZRZA 3UO4A 4YHFA 4C3PA 3ORNA 4YTFA 3OEFX 3BKBA 5HBEA 5E4HA 2HOGA 2CDZA 3UQFA 1P2AA 2QOOA 1TKIA 5ANKA 5L2TA 4ENXA 2J7TA 4ZJIA 3P5JC 2IVTA 4QTDA 3F3ZA 3SRVB 4YC8A 5L3AA 4YGAA 5HLPA 4FTTA 4BIEA 4ERWA 3FPMA 3NUAA 2GHLA 2XIKA 4EOLA 4IX4A 3Q5IA 3EN7A 2ZAZA 1JLUE 3QHWA 2QLQA 5CVHA 3CKXA 4QMVA 4CG9A 4YTCA 4P5QA 4QPSA 3KL8A 3E8DA 4NKAA 4XG4A 3KXHA 4K0YA 5KNJA 3OXIA 2WAJA 3HMMA 4OTRA 1ST4A 4AW0A 5GJFA 4YHTA 2RFSA 2YISA 2PTKA 4GH2A 1H1SA 4M0YA 4MX9A 1VLRA 5BUEA 3COHA 2VTIA 3L9NA 1PMNA 3W0MA 4EWQA 1BLXA 1G5SA 5CSWA 3D7TA 3RI1A 2C5NA 4QO9A 2BDJA 3RKBA 5AV1A 1ND4A 5IZFA 3QZHA 4L01A 3UVQA 4PTCA 5EH0A 1TQPA 3PP0A 1ZYCA 4FVRA 5LJJA 4FKRA 3H0YA 1MRUA 4FG7A 3QD4A 3IOKA 4MBJA 3RK5A 5DT0A 2WMRA 2W99B 4CKRA 5CEKA 5BYLA 3P7AA 2G9XA 3NEWA 4B6LA 1OL6A 3QZGA 3BE9A 3NSZA 2PVYA 3MH3A 3RJCA 2WFYA 1WCCA 3QQGA 3DNEA 4R1VA 4APPA 3Q96A 4BWKA 2IO6A 5HX6A 3UNKA 3REPA 1DAYA 4OTFA 3CR0A 3GFEA 4O0WA 5FBNC 4A9TA 5GZ9A 3QQLA 4J8MA 3R8VA 2XIZA 4EYMA 4OBQA 2CSNA 4FK6A 5IMEA 2PL0A 4Z3VA 3A8WA 4XV3A 2HELA 3IG7A 2PYWA 2HYYA 2IW8A 1LEZA 4KIQA 3EB0A 3QTIA 3IONA 4FTOA 5BYZA 2O64A 3IO7A 4C4FA 1HCKA 1FBNA 4PF4A 4WA9A 2YM8A 3FWQA 1NW1A 3EQRA 2SRCA 3BU6A 5C8NA 1CKIA 3GCVA 4MEDA 1XH7A 3K5UA 2BZHB 2ZJWA 5F95A 2YHVA 4ZAUA 2UW9A 4FNWA 3OMVA 3PIYA 5TO8A 3RCJA 2WTWA 4KKEA 3TIYA 4GCJA 3QKKA 3THBA 4XBUA 3EN9A 2VTPA 1M14A 3A7GA 3VHKA 4R7IA 4DLJA 4IHPA 3ZM4A 2I0YA 2PE2A 5FP6A 5CT0A 3V5PA 5CS6A