4KA3A

Structure of map kinase in complex with a docking peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
351
structure length
340
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Crystal structure of the p38 alpha MAP kinase in complex with a docking peptide from TAB1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/protein binding
total genus 102
structure length 340
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ka3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ka3A01
3F2RA 3PSBA 4RIOA 2YCRA 1TQPA 4LGHA 4Y73A 3ZLXA 3CTHA 3FMKA 2XK6A 3A7GA 4AZSA 5CU6A 3MFTA 1DAWA 1M7NA 4I5HA 5H9BA 4JBVA 4EJNA 1XWSA 1AQ1A 1Q62A 2HWOA 4YNOA 2VTLA 1WBWA 2JLDA 5L6OA 4O21A 4GKHA 5IQCA 3ZXTA 4F09A 2BILB 2C0OA 3AGLA 5EM5A 4ZY6A 3ZO1A 4AA4A 5IA0A 3VBVA 4NM5A 4CLIA 4I3ZA 3SLSA 1H4LA 4BY9E 4TYIA 1WBNA 5AP7A 3AD4A 4RT7A 1QPDA 3ZO2A 2X2KA 2Z7SA 1UU7A 4JRNA 5HO8A 2RFSA 5CAOA 1WCCA 4Y72A 3MBLA 3KULA 4QYHA 3U4UA 3UIXA 3FI8A 2DYLA 5HGIA 2G2IA 3DJ5A 1OL5A 2AC5A 3L9LA 4E5BA 4N6ZA 3IECA 5ICPA 3LCOA 3ATSA 3ETAA 3RK7A 4ERKA 2R3MA 3KN6A 4HZRA 3OUNB 4IFCA 1YI6A 3NAYA 5C01A 4FZAB 4JBOA 2R0UA 4CGAA 4FTRA 3UTOA 2NP8A 4YUQA 2XNBA 4RLLA 4XBRA 4XJ0A 4E93A 4MTAA 2GMXA 3KRXA 3O23A 3CQUA 4ZTNA 3O8UA 4CG8A 3IW4A 4U3ZA 4DF3A 5A4LA 2Z7QA 3TL8A 3RK9A 4RWKA 3O8PA 4RFMA 4GIHA 2VTMA 3VS3A 4RMZA 5A9UA 2RG5A 4QOXA 3V8SA 3A4PA 3VC4A 5B2MA 2G1TA 2PVJA 2X0GA 3ZO3A 3DBQA 3QTUA 4AFEA 3TKUA 3NW6A 3B2WA 3QF9A 1G3NA 1DI8A 2XNEA 2XIZA 1IAHA 3NX8A 4EYMA 2C3LA 3E62A 3JYAA 3BHUA 2BPMA 2F49A 4U80A 5JFXA 5LMKC 2YERA 1E1VA 3SKCA 1LEZA 2AC3A 3Q5ZA 4FMQA 3KXHA 4K18A 4JX7A 4I1ZA 1WBSA 2B9JA 3FYKX 3QA8A 1PXOA 4AGUA 4YZDA 4OBQA 1ZYCA 3UIUA 2OJJA 3CPCA 2YISA 1NVSA 4D2VA 3A4OX 2X7OA 3ANRA 2EU9A 3BEGA 3R04A 4I6BA 4ITHA 3UO6A 4R6VA 4FZFB 5BYLA 2YDIA 3EQHA 5IH4A 4CFUA 3ITZA 3L8VA 3BWJA 1A06A 3KQ7A 3OHTA 1WBOA 4EH5A 4NM0A 4LV8A 3EWHA 4WOVA 5H8BA 4MX9A 3LM5A 4EK6A 4I0TA 3NDMA 1OL2A 5K0XA 4DEDA 4K0YA 5FLFA 2ZVAA 4KRCA 2OI4X 5I4NA 4FODA 4RQKA 3P7AA 2V7OA 4AG8A 4L53A 2QODA 4K11A 3FV8A 3EOCA 4AW5A 4F0IA 2PVHA 2OW3A 1LUFA 4F99A 3D5UA 2IJMA 4XV9A 4YGAA 3FMJA 3RZBA 4EOMA 5J79A 2E9OA 3QTWA 4Y83A 1JKKA 3L8PA 4Y5HA 4LRKA 4LGGA 5AM6A 3N4UA 3GC7A 3C1XA 2EXEA 3FHRA 2X6EA 4D58A 2BZHB 2GU8A 3NLBA 2VTQA 3NNUA 4FTLA 4GU6A 4PP9A 4XP0A 3RK5A 3FSKA 3BI6A 2VAGA 3WF8A 4C34A 4H39A 4FEQA 2QOIA 4IC8A 3Q4TA 3QZIA 5CX9A 1T46A 2C6DA 5I9UA 4EOQA 5CTPA 5JEBA 3SA0A 3KK9A 2W9ZB 1Q4LA 2J6MA 3A99A 3LJ2A 3EIDA 3MH2A 2CPKE 3P23A 2WMBA 4V04A 1GZOA 2P33A 4EOLA 2C6OA 2O65A 1IAJA 2XIRA 4ZP5A 3AC3A 4FF8A 3GFWA 5JRSA 4AT4A 5E8WA 5BX0A 1OKVA 2VX1A 3PA3A 4PL5A 5BUIA 5J1WA 2BDJA 3CXWA 3TV4A 4ZZOA 2QURA 2JITA 5J1VA 2CGWA 2FO0A 2W1HA 2XM9A 4ANQA 2UZWE 3JY0A 4JX3A 5CU4A 4Y46A 2V0DA 2X39A 3Q96A 4XOZA 4AFJA 2YIWA 3W8LA 1YWVA 2EB3A 4UXLA 4PTGA 5HICA 3O0GA 4L43A 5C27A 3KU2A 5AEPA 2WMAA 2UW9A 3CEKA 4IJ9A 4XRLA 1IEPA 1YWRA 2QOOA 5CXZA 2XCHA 3R28A 4EH9A 1SZMA 3BHHA 4D2RA 1P5EA 2W4KA 3AC4A 3KXMA 3MYGA 4FTCA 5DH3A 4E6AA 3NYOA 3ZOSA 3MN3A 4DHFA 3WF6A 4YP8A 2ZM3A 3EQIA 3EL8A 4BDBA 5LVMA 2XYUA 5CS6A 3S95A 4AOTA 4IX4A 3QCSA 5EDPA 3UP7A 4H05A 3HX4A 5BMSA 2O3PA 4O7WA 4KBKA 3ODZX 3OFMA 4YSJA 2J51A 2PZRA 2VTPA 5DWRA 2J7TA 4YJOA 3MH0A 3KXNA 2QU5A 4U7ZA 3FZOA 4PMTA 2XYNA 4PV0A 5CSVA 4E7WA 1U5RA 3KEXA 4ANLA 3U51A 1ZY5A 2AUHA 4EBVA 2HZ0A 3FHIA 5FP5A 4G3FA 1M52A 4FKPA 2YA9A 4IAAA 5AADA 4PRJA 2XBAA 2XJ2A 4G17A 4IVAA 3PJ3A 5CF8A 4FTTA 1KWPA 2C3JA 1YHWA 2C6EA 3H9RA 3OWPA 1TKIA 5J5TA 5EHYA 4GT4A 5E7RA 4QMOA 5LVNA 3KA0A 5DA3A 4TTHB 3BCEA 3AC8A 4BHZA 2WU7A 3QRIA 4J98A 4Q5EA 5HCZA 5HO7A 1REKA 3Q5IA 3AC1A 2PK9A 1F0QA 4HCVA 5AV3A 1XH5A 1EH4A 1YHSA 1PYEA 3LFAA 3W2PA 4QMNA 4QTBA 3MGYA 3D4QA 4WBOA 5GIPE 4FGBA 1H24A 4IAZA 2DS1A 4X2NA 3D2IA 5HBEA 4DLIA 3RPYA 2X8IA 4FIIA 3QQKA 4BBMA 3KF4A 3LCDA 2JDOA 4FKTA 5AUTA 1A48A 4AQCA 4QQTA 2RGPA 1U4DA 2QVSE 4TY1A 4ACDA 4X3FA 5KBRA 1RDQE 4B99A 1GZKA 3ORLA 5LVPA 3I0QA 3VUIA 4FV7A 4EQCA 4Z16A 4WKQA 1IR3A 4F64A 4F9CA 4M14A 4BB4A 1WBVA 3E8EA 3A8XA 3GU7A 5HKMA 3BGPA 4LG4A 2B53A 1NY3A 3RJCA 3E8DA 4V0GB 3UBDA 1SNXA 4J8MA 3RVGA 4NL0A 4KIKA 4OTPA 3C0HA 4FI1A 4RQVA 4IVDA 4EOPA 2PVKA 5EH0A 2RKUA 3OXTA 3C5UA 3C50A 2G9XA 3BGQA 4D9UA 1PHKA 2I6LA 3LMHA 1JSTA 2ZDTA 5CZHA 1YI4A 5AMNA 4APPA 4AW2A 3BV3A 3QQLA 4C3RA 4UYNA 2GS2A 3DKFA 4GUEA 3COMA 3NUUA 3QGYA 4AF3A 2IN6A 5M53A 4TYHA 4CV8A 4QMUA 3RI1A 3KFAA 3QRKA 4PP7A 5A4EA 2OKRA 2GS7A 3OP5A 1DI9A 4FZDB 3SDJA 1JAMA 4U8ZA 3HV6A 3W16A 3DNDA 4PX6A 4KA3A 3EN9A 2CGVA 1OUYA 4QP1A 4EKKA 4CMTA 5CT7A 2BUJA 4DA5A 5IUHA 5KBQA 4G3EA 4FL1A 4JL9A 4QMVA 5D41A 4YSMA 3U9NA 4KKGA 3MVLA 1GZNA 2YCQA 1SNUA 5BVKA 3ZBFA 2EUFB 1P2AA 2UW4A 3ORPA 2B0QA 3PXYA 4IEBA 2YACA 4D4RA 2I7QA 3R9DA 3L9MA 3W2SA 4BBEA 5AFVA 2EB2A 3G51A 5AP3A 2W5BA 3MJ2A 4FBXA 4R1YA 4BI0A 3NUAA 5FTGA 1NA7A 2H96A 3QWKA 3GC0A 4IM3A 1MUOA 5ANDA 4UN0C 2ITYA 2J9MA 3Q6WA 3Q53A 1J1CA 3FWQA 4PNKA 3PRIA 4F63A 1OKZA 1MQBA 4EI4A 3TZ9A 2C6KA 1MRUA 1GIIA 4J97A 3FLYA 5AR4A 2J0MB 3FXXA 4MNFA 5TR6A 4C37A 4PMPA 4OAUC 2CKEA 1G8SA 4X2FA 2R0IA 3CLYA 5TE0A 4FV9A 4IACA 2UVXA 5I3OA 5AV2A 4NWMA 3FXWA 2WKMA 4AE6A 2QOKA 4X2GA 4FOBA 5ACKA 3QBNA 4R8QA 3R83A 4YJUA 4IW0A 3C0GA 3ZBXA 4V01A 4CYJA 5KMJA 3IKAA 4U40A 1OKYA 4PL3A 3TN8A 5IPJA 4O2PA 4YLKA 2JFMA 3RAIA 3FKOA 4IQ6A 4Q2AA 1Q8WA 4EH3A 4C59A 5GZ8A 4JAIA 1ZAOA 2PVNA 3AC2A 4CMOA 4U42A 2VTJA 1OMWA 3ZDIA 3VS2A 3PXKA 3UQFA 3K2LA 2UW8A 3DS6A 2YLEA 3OEFX 3UZPA 3LVPA 2ONLA 3SW4A 5IA4A 2CSNA 1W82A 2ITTA 2UW3A 2UVYA 4FIGA 4JT3A 4FEVA 1BI8A 2HYYA 4H1JA 4D4SA 2I1MA 4MD7E 3PIYA 2PUPA 2O5KA 5IZFA 3MIAA 5CI7A 4ASXA 4BGHA 3HGKA 1SVGA 3PA4A 3F3ZA 4ZSJA 4CYIA 3A7JA 4MXYA 3SV0A 4C35A 5AP5A 3B8RA 3HEGA 3SGCA 4I5PA 3DNEA 3G33A 5AIKA 1KE9A 4G3GA 5DIAA 4RX7A 4ACHA 5HI2A 2ESMA 4EBWA 4DH7A 3LFDA 5AR7A 3VJNA 3FE3A 4BCPA 4YO4A 4ENXA 2WFYA 2WQNA 3VS7A 3UVRA 3TUBA 3CSVA 2JAMA 4GRBA 2X6DA 4X6QC 4FSRA 2OIDA 3ZZEA 3FBVA 3W33A 3DOGA 4PMSA 3MA3A 4X0MA 2IW9A 3KXXA 4G31A 1E1XA 3GCVA 4K8AA 1KUTA 4NH1A 2JDSA 3CTJA 3FPMA 3OTVA 3PXRA 5D1JA 2GNFA 4PWNA 3A8WA 5HNIX 5B0XA 1YOLA 5EOLA 5DI1A 5HLPA 4BRXA 2A4LA 4QTAA 2WD1A 4YHTA 1O6LA 2JC6A 1VYWA 2B55A 3R1QA 5E8YA 3W55A 3ZM9A 2R3IA 4FVRA 4CT1A 2X81A 5AUZA 3MPTA 1Q61A 2CJMA 3RAHA 3KMWA 3C4ZA 3NW7A 1KE8A 2HXQA 3Q32A 5CSXA 4B0GA 3GQIA 5AV4A 5AUUA 3VIDA 3OZ6A 3O2MA 4W4YA 4ITIA 4LOPA 1Y91A 4ONAA 3VWAA 5CF4A 4MF0A 2G2FA 3ZSIA 2BVAA 5BVFA 3V8WA 4O7LA 2R64A 2VX3A 4WBBB 3FLQA 1H8FA 4GV1A 5BPYA 5KMIA 2Q83A 2WTDA 3UZRA 2GDOA 4TWNA 4BTKA 3IW5A 5BVEA 4PQNA 4D5KA 4QMYA 4EK8A 4FUYA 4FIHA 4O0RA 3C4EA 5EQEA 4L6QA 3GUBA 3HUCA 4FNXA 4BDCA 1W84A 4RZVA 4X3JA 1TQIA 5A4CA 5EQYA 2QG5A 2YIYA 5HNGA 4YJRA 1G8AA 3TEIA 3E8CA 3Q4UA 2Q0NA 5AR3A 4HVIA 3FZTA 3R2YA 1ATPE 3RZFA 4FEWA 3C4XA 5I9YA 5D11A 3KF7A 3R8VA 4S32A 3QHWA 3NGAA 4BGGA 5JFWA 3PSCA 1U59A 1YQJA 3ATTA 2JEDA 3PIZA 4F9WA 3KRJA 1NVQA 1U54A 3EQCA 2FB8A 2VO6A 4PDPA 3TNQB 2GQSA 4ENYA 4O7NA 3BKBA 2W05A 4APCA 5L8KA 4LMUA 2UW5A 3R73A 2YDJA 3L9PA 4HGTA 5ANOA 4UMUA 2I0YA 3QTSA 4U44A 1YVJA 4E73A 3GCUA 2R3RA 2YJRA 3PY3A 1TVOA 1B6CB 1X8BA 2VTIA 3D7TA 4HJOA 4ARKA 3P0MA 4L3PA 3VQUA 5CF6A 5EM8A 5DE2A 3QTQA 2CKOA 5ANEA 4U3YA 1OBDA 4J71A 3VVHA 3FC2A 3RWPA 4C4HA 3TV6A 1S9JA 4M15A 4RJ5A 5EG3A 3R7UA 5DPVA 3FLSA 3KULB 2YIXA 1BI7A 4PPCA 2J0JA 4OBPA 3VUMA 3UG1A 1JKSA 5CNNA 3IGGA 5DT0A 4EHGA 3OTUA 4JDJA 2BAQA 2UZNA 4C2WA 3TJDA 1Z57A 5AR2A 4R5SA 3RAWA 4AZVA 3CR0A 1OIRA 4O0VA 5CAQA 4DE4A 2XB7A 3E7OA 2YIRA 4R1VA 2UW6A 4RVLA 4JRVA 4OTWA 5BVOA 4DYMA 4AZEA 5A4QA 4BZNA 1SM2A 4N0SA 3VO3A 4DEHA 2BRNA 4ZAUA 3I5ZA 5IG1A 5K5XA 4B4LA 5HX8A 2YZAA 1B39A 3KC3A 4XOYA 3TNWA 3DKOA 3CKXA 2YHVA 3OUKA 3HL7A 2QLUA 4FTMA 3OW4A 3OWLA 4AAAA 4CTCA 4F1MA 2W5HA 4G16A 3DQXA 4I0RA 2C4GA 2ZYBA 3NCGA 3C4CA 5EW8A 3ALNA 2PE1A 4L46A 4FA2A 2GQGA 2W1CA 2BAKA 3ID6C 4MH7A 1UNLA 4UMPA 2W06A 1FMKA 3HAMA 3UYTA 2OJ9A 3LJ0A 5JK3A 2Z60A 3AMAA 3IO7A 5JN2A 3IGOA 3REPA 3U6HA 3SXRA 3OS3A 1K9AA 4NKSA 4L3JA 3WF9A 4DT8A 5D7VA 1B38A 4RIYA 5CAUA 4I6HA 3D9VA 1OI9A 2O2UA 2O64A 4ASEA 3PDTA 4LRJA 4YNEA 4MAOA 4E20A 3RWQA 1JVPP 3Q2MA 3UOKA 4I41A 4BDJA 2V5QA 3GT8A 2QO2A 1QMZA 4D2PA 2C5NA 2YM8A 2PYWA 2F2UA 2YM7A 4WNPA 4IWDA 2ERKA 4D2WA 4XUFA 2PY3A 3VQHA 4CRLA 5AV1A 1PY5A 4BCJA 4JJRA 5K3YA 3EN7A 1YW2A 4PF4A 2JKQA 3ZM4A 2OLCA 3M11A 2C0IA 3F3WA 2FUMA 3QYWA 3G6HA 4NEUA 4XG3A 5AA9A 4YHFA 4DEEA 3O50A 2HXLA 2PHKA 3H4JA 4M67A 1LPUA 4LMNA 5KKRC 2B52A 2ITUA 3L9NA 4NM7A 4NZWB 5IU2A 5DYJA 4BDAA 1Q99A 3SW7A 2IVUA 5EI2A 3UZTA 4GFMA 2JIIA 3BX5A 4RX8A 3VUTA 4FV6A 2EXMA 3JR1A 4XS2A 4QMZA 5KKRB 3R71A 3OY1A 5DGZA 5I9WA 3S0OA 4QP7A 3VJOA 3PE2A 3GGFA 2OO8X 1ZMVA 4L00A 3UO4A 3SVVA 1M17A 3GFEA 2V55A 3UP2A 2GNJA 4UBAA 4H58A 3HECA 3UOHA 4LRMA 3RM7A 5CU0A 5HORA 1VJYA 5F94A 5IMEA 4EONA 5LQFA 2UZOA 2ZM1A 4MXCA 4TNDA 3TDWA 4DC2A 2PUUA 4D9TA 3I7CA 3Q6UA 2NNWB 3F3VA 2XKEA 1J7UA 3PPKA 5HE2A 2OFUA 4ZS4A 4P4CA 3QXOA 4ASZA 2DUVA 3SC1A 1YHVA 2WMXA 4IVBA 5HE3A 3NUPA 4FTJA 3R9NA 4ANOA 5EYDA 1Y8YA 4FG9A 3Q4ZA 4I22A 2XKDA 2ZM4A 4ZIMA 2VD5A 4ANBA 2O0UA 2R3GA 5IQFA 4C61A 2QOQA 4O0YA 1ZOGA 3K5UA 4QMTA 4IZ7A 5IUIA 5CXHA 4CFWA 4JIAA 3Q04A 1URWA 4WA9A 3KVWA 4G3CA 5A14A 3QYZA 3BU3A 3V04A 2VO0A 2C5YA 3BLQA 3E93A 4EC9A 4YC8A 1CKPA 1H27A 5HTCA 4GKIA 3BZ3A 4BL1A 4A9SA 4FNYA 4FTUA 1MRVA 2BALA 3LPBA 1H1PA 5EM7A 2XBJA 3MIYA 2XCKA 3VS1A 1W83A 5H2UA 4BIEA 3KVXA 5HBJA 4GG5A 2IW6A 4JS8A 3ORXA 4ANSA 5C1QB 3F2NA 3VBQA 4XNEA 3B8QA 3IOKA 2KULA 3P7CA 3PPJA 5L8JA 1SVHA 2VWBA 3ULIA 2C6LA 4ORKA 3EMGA 4L44A 3SHEA 4RC2A 3LLAA 4IC7A 3D14A 3MA6A 2PWLA 4X2KA 1UKIA 5D7AA 4AGWA 4YJSA 2B9FA 2VGOA 3PVWA 5EK7A 2C30A 5CEQA 4O1OA 3RINA 3ZSGA 3FSFA 5L4QA 3HV4A 3H30A 4OBOA 4X3FC 4F7SA 1GY3A 4O91A 3NW5A 1HOWA 5TKDA 4YC6A 1ZMWA 3EQDA 5TF9A 2QOFA 3R8ZA 3V6RA 5L2TA 4CKJA 1UNGA 5AP0A 4HYIA 5FDXA 3DTCA 5FBNC 3HKOA 2X9EA 4GG7A 4X3FB 3C4FA 4CD0A 1YOMA 3OVVA 2A27A 4FT0A 5E8UA 5HVYA 4Z55A 2IVSA 2QO9A 3EFKA 5IF1A 3EHAA 4JQ8A 4GK3A 5D12A 5FDPA 3VS5A 4O0UA 4M84A 3U54A 4MNEA 5HCXA 4BTJA 1P14A 2QHNA 4YR8A 4OGRA 1AGWA 3SOAA 4DH3A 2YAKA 5JKGA 4NW5A 1PXPA 5DBXA 4F9YA 4KIKB 4CZTA 5JQ8A 1O9UA 2OH4A 4M12A 3M42A 2W4OA 4G1WA 3JPVA 3HP2A 3BRBA 3MWUA 3FLWA 3E3PA 4JR3A 3UJGA 2WMQA 1PMNA 2R3LA 3RAKA 3OWJA 3KN5A 2WPAA 4RGJA 2F7EE 1T45A 3F5XA 4GH2A 3NWWA 4X21A 4JBQA 4RVMA 4CZUA 4OUCA 5DVRA 4RBLA 3RPVA 5KNJA 3MH1A 4L52A 4IB0A 1ZWSA 4TYHB 3FZPA 3MVHA 2XA4A 3F3UA 1H1SA 5HBHA 5JGDA 1KOAA 1Q41A 4YU2A 1QCFA 3HMPA 4DGOA 4O38A 5FM3A 2H34A 4FK6A 3SRVA 4ZJIA 3ZFYA 3KK8A 4G34A 4FT9A 3UNJA 3BIZA 4GK2A 2X2LA 4HPUE 4CTBA 5J95A 4FKSA 4JDKA 4YJVA 3H9FA 4EZ5A 2FSMX 5KO1A 1JWHA 3LFBA 3OCSA 4U0IA 3TIZA 1M7QA 4H3PA 2HZNA 4RRVA 5FD2A 1YDTE 2Z7RA 3T9TA 4M69A 3WILA 4C4FA 4ZTMA 1ZYLA 4GYIA 2REIA 4ZSAA 4J95A 3U9CA 4OT6A 3GOPA 4QPAA 3NCZA 1OBGA 5IQIA 4JI9A 4FSMA 3ZEPA 5HTIA 3IW8A 3FAAA 2PMNX 4OTRA 5ETCA 4FKRA 2FYSA 3GC8A 3SXSA 2JD5A 3HDMA 4I20A 2NPQA 3MVJA 2ITQA 4A9TA 4WSQA 2YWPA 3OBJA 5CF5A 2GNLA 2HAKA 2ZV9A 3DGKA 3HYHA 3KL8A 3PE1A 1OKWA 4XLVA 2V7AA 1WVYA 4EH6A 3TNPC 3LJ1A 2P2IA 3NUYA 2QCSA 5GJGA 4GS6A 5CQUA 4KSPA 3ZRLA 5CZIA 2FSTX 3H0YA 5JQ5A 4FNWA 4DH5A 4ANNA 2XNPA 4AWIA 3LXPA 3EL7A 1SYKA 3BYUA 3ZU7A 1W98A 5DEWA 4W4WA 2CNVA 3GQLA 5M56A 3ALOA 4TN6A 4KRDA 3AXWA 2Z8CA 3BQCA 3OMVA 5J7BA 3ZLSA 4C02A 2LAVA 4XG6A 5B2LA 5HE0A 3FQHA 3K3JA 3KY2A 2PUIA 4I6QA 4RVKA 5M51A 5EW3A 4F9BA 4USDA 5DOSA 5CI6A 3UNZA 2ONLC 5IDPA 4QPMA 4IZ5A 4AA5A 2IZUA 3MB6A 1YXVA 4BWXA 3TI1A 4WD5A 3BLRA 3DB6A 4C36A 2R3QA 3NIEA 3O71A 2XIXA 5E8TA 3FMMA 1XBAA 5AIRA 3EKNA 1ZZ2A 4R3CA 3TTJA 3E8NA 3BHYA 3WZEA 2GFSA 2ITXA 2X7GA 5DRBA 3WIKA 3LQ5A 4Q9ZA 2GCDA 1MQ4A 4YTHA 2G2HA 3ENMA 3ZSHA 4USFA 2WTKC 3MFRA 4N6YA 1H25A 5AWMA 4LV5A 5LMAA 1S9IA 2VWXA 5EM6A 3FI2A 3KGAA 1YI3A 4GUBA 5CEOA 1ZMUA 4MD9E 4FYNA 4AT5A 1FOTA 4YPSA 5H8GA 4ZEGA 3QQHA 4IVCA 5J8IA 4ALUA 1Z5MA 2WTKB 3PJCA 1GIJA 4NTSA 5C8KA 4BTFA 1OGUA 4IANA 4G5JA 3QC9A 2VWZA 4OR5A 5E8ZA 3DCVA 4NFNA 4NUSA 2UW0A 2OK1A 3FLNC 4O6LA 4WUAA 4O96A 5DLSA 4C0TA 2V62A 4L7SA 2C0TA 4NFMA 2NRUA 3WE8A 3FY0A 3U55A 2GNHA 5AX9A 1UNHA 2GPHA 1XBBA 3OT8A 4JR7A 2QO7A 3IW7A 3MVMA 4FOCA 4O82A 1JQHA 4CSVA 4DTBA 4M68A 4U9AA 3GNIB 2OSCA 4I92A 1Y57A 2O8YA 3DBCA 5CY3A 3POOA 5HD7A 2VTAA 2EVAA 2R4BA 2BRGA 4A06A 3U4WA 2LGCA 4A9RA 3WF5A 5LOHA 1VYZA 2F4JA 4J8NA 1J3HA 4U5JA 3RKBA 4N4SA 2BAJA 3RCDA 4A4XA 3CD3A 3FJQE 4JXFA 4C57A 3PPZA 4W4VA 3KCKA 4I0SA 3QX4A 2WMVA 3LCTA 4S31A 5DN3A 5IA5A 4FSUA 4I94A 4JG8A 1ND4A 3R02A 4WNOA 1ZYDA 3G0EA 3NPCA 5JGAA 2F7XE 2JBPA 1W0XC 2JDRA 5EI6A 3TM0A 1JNKA 2I0EA 3QZGA 4IAFA 4TKSA 4RWJA 4CFFA 3K5VA 4ZLOA 1KV1A 4E6QA 4AN9A 3QCYA 5HG5A 3MTLA 1W7HA 3VULA 3GC9A 2CHLA 4AUAA 1FGKA 2JAVA 3COKA 4O6EA 1YOJA 2W1EA 3MB7A 4FG7A 4YPDA 4GU9A 5AP2A 5M4FA 4WG5A 4NIFA 4FL2A 3U87A 4O7RA 2HW7A 3OWKA 5E8VA 4Z3VA 1CTPE 1Q3WA 4RSSA 2BRHA 4WNMA 4LM5A 5AUYA 1FPUA 3DXQA 1H0VA 1QL6A 2ITVA 3ERKA 3M1SA 4PNIA 1U54B 3VHEA 4B8LA 5ETIA 5TO8A 4CRSA 4DINA 1OPLA 3CQWA 4GEOA 5DR9A 5LJJA 4E26A 2BMCA 2OWBA 2XK4A 3DT1A 3PYYA 1AD5A 3I60A 3F61A 2HENA 5HE1A 4KIOA 3AMYA 3CD8A 2YM5A 4X7QA 1P4FA 1PXJA 4MBLA 4I5CA 5L8LA 3H0ZA 2J0IA 3F3TA 3D7TB 5BVDA 3QRUA 3SG8A 4G3DA 1U46A 4OTHA 3RGFA 3V6SA 5M06A 4HGEA 3MY5A 3DY7A 3ZMMA 2KTYA 3V01A 3LFCA 5HVJA 4FTKA 4C4JA 4DGMA 4JOAA 1XH4A 3LFEA 4MQ2A 3POZA 1KE6A 3OOGA 4IM2A 5ITAA 1Q8ZA 4PTCA 2BHHA 3RBWA 4AP7A 3G15A 3G2FA 3QQJA 1OPJA 2XK9A 5KMLA 5F9EA 3ZONA 4EHZA 4FVQA 1CKJA 2J5FA 4FKOA 4KAOA 1VEBA 5L2QA 2HZ4A 4M13A 5EKNA 3OC1A 2X4ZA 4P5ZA 1OL1A 3OCTA 4Y85A 3TV7A 4ANMA 5DT4A 1XH8A 4Z9LA 2C1BA 4UX9A 4P90A 4XV1A 2VN9A 4TWPA 3PXQA 3ZH8A 2WTIA 3DJ7A 2ZB0A 3D5VA 3L8XA 3FUPA 4IMYA 4EH8A 4DT9A 4S34A 4XH6A 5HD4A 5A6OA 3KKVA 2BZKB 3F5UA 4PPAA 2WOTA 3OBGA 2QOHA 4BCMA 4AW0A 1IA8A 4EH2A 3CPBA 4K9YA 4BKZA 1F3MC 2BRMA 4IAYA 5TT7A 3QTXA 1XKKA 2EWAA 3AMBA 3E92A 1V0BA 1O6YA 3O51A 5ANJA 4FTNA 4QP6A 4PDSA 2FSLX 2R3FA 3A7FA 3CJGA 4CKIA 1LR4A 4O7VA 4U79A 4H3BA 4BZDA 3DV3A 4CFXA 3HRFA 5E1SA 5FEDA 5M4IA 5AUXA 3DZQA 3V8TA 1WVWA 2ZOQA 2PZIA 2QG7A 1SVEA 4TYJA 4OT5A 4BN1A 5FXRA 2WTJA 4QYGA 1Q24A 4ZY5A 3MPMA 3ORIA 4RFYA 4G6OA 5AP4A 4BICA 4RIYB 4ZXTA 2ZDUA 3PZEA 4E4MA 1OPKA 3UQCA 2WHBA 2WIPA 3EN6A 4L67A 5IA1A 2PUNA 2Y6OA 4XV2A 2A1AB 2UZDA 2X7FA 2C3KA 2X8EA 2YM4A 3LLTA 3BYOA 4G9CA 4LUEA 4XEYA 4EOSA 4F6WA 1KV2A 2B1PA 3C7QA 3NNXA 3P5KA 4IADA 4L9IA 2CGXA 4QMQA 2OJGA 4OTQA 4LQMA 4R3RA 2UZBA 2BKKA 2XM8A 3W8QA 5IH6A 3L1SA 5LMKA 3HP5A 4QTDA 3C9WA 2XK7A 5M08A 2PVRA 3TXOA 3ORZA 5HCYA 4DFLA 2PZPA 3PFQA 3WYXA 4EZ7A 2ITWA 4IX3A 4BDHA 5M07A 1QPCA 1YXXA 4NJDA 3VF9A 5DT3A 3CY3A 1WMKA 4GJ2A 4M0ZA 4XG4A 4DITA 1Q8UA 4YJNA 4CQEA 2RFNA 5HZNA 3IDBA 3LOKA 5HNBA 2VUWA 5HU3A 2YEXA 3FC1X 2Y9QA 2QKWB 2XIKA 5FBOA 4W8DA 2IW8A 2JFLA 3KRLA 3MFSA 3Q9ZA 3GB2A 3KRWA 4WRGA 3QD2B 5KZ0A 4F7JA 5LXMA 2RFDA 4F08A 3QC4A 3WE4A 1HCLA 4ZTQA 5EHLA 5BNJA 2UW7A 3QD4A 4RFZA 4XG7A 2IVTA 4FIEA 3IQ7A 2WELA 4ITJA 1P4OA 4KKEA 2WQMA 2XRUA 4XBUA 1DAYA 5AUVA 3NYNA 4G6LA 5EKOA 1OUKA 2UUEA 5L2SA 1NT2A 4BDKA 2XRWA 3EQGA 1ZLTA 2CKPA 4FKLA 4U81A 3FMNA 4WSYA 5ETFA 2PVMA 3ODYX 3LFNA 1XHAA 5IQHA 3A62A 3LXKA 4FKQA 2WQOA 3R7IA 1YXUA 4F70A 5AA8A 2GTMA 3PZHA 4H1MA 3R9HA 4DFYA 4HGSA 3DPKA 3HV7A 4EL9A 4ZMEA 3TWJA 5EYMA 4KUJA 2OF4A 2WEIA 3QCQA 5J5SA 3QUPA 2NO3A 2WU6A 4UXQA 2VU3A 3RCJA 5KMOA 3SX9A 2B54A 3EKKA 3TT0A 3ZZWA 4LGDA 1JKLA 5LVLA 2PMOX 2W0JA 2WTVA 3KB7A 4MBIA 4XYFA 4IZYA 5JH6A 2XZSA 2VTRA 1H1WA 3QXPA 4AA0A 1PRYA 2VV9A 5L2WA 3U8WA 4CEGA 4ZJJA 3W2OA 5BVNA 3SXFA 4MF1A 3TNHA 3ZRMA 2R3OA 2JGZA 5CQWA 5BMMA 4AN3A 4J96A 3G6GA 4RWLA 4RWIA 3W32A 4L8MA 3ZLYA 4USEA 3ZRKA 4AXAA 4HCUA 2VWVA 4DBNA 2Y4IC 1DS5A 2ITPA 3I0OA 3GU8A 2IVVA 4GVAA 3VBTA 3P7BA 4W4XA 2WIHA 4L01A 3FMHA 4AZWA 3UNKA 4RIXA 3DFAA 3PG1A 2J90A 4HCTA 4HZSA 5E1EA 2CN8A 4QNYA 4AE9A 5L2IA 3FQEA 3OEZA 4I93A 2Y4IB 4DFNA 2PTKA 2YCFA 3CP9A 4BDFA 2IWIA 2PPQA 3TDVA 1H26A 4WT6A 2XKFA 2P3GX 3RHKA 3R2BA 5JFSA 5ANKA 4BCKA 4DFZE 2JBOA 1V0PA 3BBTB 3VRYA 4BDDA 2PZ5A 2VTTA 4IAKA 3HV5A 3BBWA 4YBJA 4FSZA 3RNIA 1URCA 3QTRA 3OROA 4E3CA 4XRJA 1YXTA 2WQEA 4D1XA 3EQFA 3QFVA 3ZHPC 4O1PA 4BIBA 3EZRA 5FTOA 3S1HA 4FEUA 3R21A 3PJ2A 4FL3A 2QNJA 5M55A 3E88A 3TZMA 4MNEB 5I5ZA 4F6UA 5KZIA 4IE9A 5K4IA 3R0TA 5CSPA 5I9ZA 3EFJA 1CSNA 3E63A 2XP2A 2FA2A 5T68A 4FV4A 4L3LA 2BRBA 3HZTA 1PMVA 2BTSA 3ZO4A 5KX8A 4RJ8A 1O6KA 4S30A 4FKJA 4DTAA 3RPRA 3S2PA 3BYSA 3WI6A 4BI1A 1BKXA 2HZIA 2X2MA 5AAFA 1XR1A 3R01A 4UMQA 4AGDA 3Q9XA 4BCFA 3NVKI 4B8MA 4DGGA 4KKHA 5D10A 1WZYA 4YURA 3FQSA 4I4FA 1PMEA 3AD5A 3TJCA 2FGIA 4L45A 1PW2A 4IX5A 4EEVA 4DFXE 1UU9A 2BFXA 3ORKA 4ZSLA 3BV2A 1YXSA 2G01A 3VUDA 4RX9A 4O7SA 4JQ7A 3A2CA 4QMSA 5FP6A 4DG0E 2PE2A 1PJKA 3SRVB 2XEYA 3HUBA 4IHPA 5DG5A 4QYYA 4C3FA 3I79A 4GYGA 2XNGA 3GU6A 2RF9A 3QZFA 3II5A 4YZMA 5C8MA 5J9YA 2CN5A 4XG9A 2CKQA 4ALWA 1FVVA 2F57A 3ORNA 2WNTA 1PKDA 2OJIA 4CCUA 4Y8DA 1OITA 3NNWA 1L8TA 3NYVA 4TYGA 3G9NA 3GP0A 4U43A 2GQRA 2Q0BA 2H8HA 2A2AA 4M69B 5E92A 1BMKA 3UIMA 3FZRA 4YTCA 2ETMA 4RZWA 3VBYA 3NNVA 5FQDC 5HG8A 2EXCX 2WQBA 3FL5A 5GZ9A 4FG8A 1K3AA 1R39A 3DLSA 4U97A 3IDCA 3HLLA 2C1AA 4NJ3A 4BTMA 4UWYA 4MCVA 4AT3A 1H1QA 4E1ZA 5HVKA 4BKJA 4ACGA 2I0VA 2YIQA 3NEWA 1CKIA 3QKMA 4GFOA 3ZXZA 5CYIA 2UVZA 3EQPA 2RG6A 3F7WA 4LOQA 4JNWA 2JIVA 1F5QA 2ITNA 5ANGA 4C8BA 1HCKA 5CT0A 3QA0A 4O0TA 3F5GA 1M2RA 2C5XA 3SQQA 3WZKA 3N4TA 4GL9A 4RJ7A 3VF8A 4C7TA 3TKHA 1U5QA 2PL0A 5IH5A 5IEYA 1A9UA 1H01A 1KE5A 5CU2A 3UOJA 4A4LA 3R7EA 2Z2WA 2YZLA 3LCSA 3EFLA 4XX9A 2RFEA 3VW6A 1GAGA 4YTIA 4KS8A 5E91A 3WARA 3VHKA 3WOWA 2Y0AA 3JXWA 5CNOA 5KMNA 4TNBA 3R1NA 4N57A 2F2CB 2VNYA 4C4IA 1OECA 3I81A 4FICA 4WRSA 5HO6A 3VBWA 1CMKE 1WAKA 3PIXA 5EDQA 2QQ7A 4P5QA 3TG1A 3V5QA 4AZTA 4DN5A 4HYHA 3GCPA 5CAPA 1G5SA 2H6DA 3DAJA 2BR1A 4IFGA 4JVGA 4QYEA 3JY9A 5LVOA 1BL7A 3NMUF 5GHVA 5HLNA 4BYIA 1OM1A 2QU6A 4K1BA 1JBPE 2ETKA 5D9HA 2XNNA 4JG6A 3MFUA 3WYYA 3E64A 2VWYA 3AT3A 1I44A 1ERKA 2R7BA 3R63A 4MYGA 2B9HA 4GCJA 4UWBA 2I0HA 4NM3A 5E8XA 2SRCA 5M09A 3ZUUA 4DFBA 3ET7A 3LXNA 3MY0A 4C4EA 2X8DA 4F0FA 3QAME 3E7VA 1R0EA 3GXLA 5FWKK 3R8MA 2W1FA 5I0BA 3A60A 2OXDA 1STCE 4G5PA 5LARA 2R3PA 3ZDUA 1Y6BA 3EZVA 1R1WA 4PPBA 3BHTA 5IUGA 4WIHA 3BEAA 5TOZA 1M2QA 3JUHA 3PSDA 4JDHA 5KHXA 4DFUA 4DCAA 1RW8A 5I9VA 3LAUA 4M0YA 2BZJA 2GSFA 4U6RA 1OL6A 5IDNA 2XKCA 4R5YA 4O7TA 4J1RA 2DQ7X 4IX6A 4TWCA 5A3XA 1BX6A 1UU3A 4LL5A 1J7IA 5HIDA 3D5XA 4H36A 4MXOA 3V5LA 4RG0A 4FTAA 2X4FA 1Q8TA 4YBKA 5G1XA 4O83A 4FYOA 1KOBA 4OTDA 1ZXEA 3VBXA 4FIJA 4ZSEA 5EOBA 5FM2A 4B7TA 2J2IB 3R00A 2Y6MA 3GOKA 4D1ZA 3EQRA 3SD0A 2ZV8A 4EYJA 5CVGA 3UODA 3WZUA 3BHVA 2E9VA 2NRYA 2RIOA 4IB5A 3PG3A 1NXKA 5CEMA 4NCTA 3IDPA 4IWQA 3H9OA 3LIJA 4QQJA 5HU9A 3KRRA 3TKIA 5J7HA 5C26A 2R3JA 3AC5A 4GK4A 4FTQA 4AZFA 2OZAA 4S33A 1APME 3DU8A 2C3IB 3ZC5A 4D0WA 3N9XA 2JIUA 1L3RE 2GHMA 3DBFA 3R8PA 3TTIA 4EOJA 2W5AA 4ACMA 3KXZA 4I23A 4NIFB 5F4NA 5L6PA 3D83A 3KCFA 4QMMA 5FEQA 2VO7A 3P78A 2IG7A 4TL0A 3MESA 2R2PA 1PXLA 4I4EA 4ZOGA 1MRYA 4A07A 4HVSA 5FEEA 2QD9A 3V5JA 3DJ6A 4M8TA 2C47A 1FMOE 3CCNA 2ITOA 4FKUA 4JAJA 4EH7A 2YAAA 3QQGA 4JBPA 5CENA 5EDRA 2Z02A 4BCIA 3UQGA 4EOKA 3OOMA 3I1AA 3T3VA 4I21A 4RIWA 3TNIA 3D2KA 3ZLWA 2ITZA 2XVDA 5BUJA 4MD8E 1OIQA 3ENHA 3FZSA 1UVRA 3PLSA 4RPVA 4CT2A 4KS7A 1GNGA 2VTNA 4O22A 2C5OA 5CLPA 1IA9A 1R3CA 4AS0A 1CM8A 3U6JA 2GS6A 3D5WA 3P9JA 3RPOA 3ZFXA 2JDVA 4ZTRA 4NU1A 3PLAE 3UO5A 2CCHA 2WXVA 3LFSA 4DLJA 4F65A 3BU6A 3V51A 3CQEA 3BE2A 2PSQA 3LQ3A 4D5HA 2WEVA 3TZ7A 5LMBA 3MI9A 2BCJA 1LP4A 3PJ1A 2B9IA 5ACBC 4FZ7A 3BPRA 3VUHA 4J52A 5F1ZA 4AU8A 4O86A 3UIBA 2C6MA 2VWUA 3V5TA 3IONA 5KMMA 5CEIA 4E4LA 2VO3A 3O8TA 3VS4A 5AM7A 3G90X 3LXLA 4KBCA 1BUHA 1KSWA 3ZCLA 1Y8GA 4FNZA 3PXFA 2BHEA 3DAKA 4II5A 5J9LA 2W96B 2HY81 2OICA 3PTGA 2E9NA 5AJQA 5BUEA 3QQFA 4FT3A 4RLKA 2GNGA 4P7EA 4YJTA 5EW9A 3CC6A 3L8SA 3MDYA 3RNYA 3WZJA 3FKNA 2IPXA 3GCQA 5DEYA 2BIYA 1Q3DA 4QP9A 4FSTA 5A54A 3QKLA 4O84A 3F7ZA 3I7BA 4IZAA 1Q8YA 4CZYB 2W1GA 2FH9A 2W99B 5FRIA 5C4KA 4TWOA 1UWHA 4MKCA 3PJ8A 4F6SA 3AT2A 2BZIB 2R3HA 3OT3A 5JFVA 2GNIA 3WZDA 5CWZA 1UA2A 5T6KA 4K6ZA 2OIBA 2WMUA 3DZOA 4KABA 4ALVA 2UZEA 4E5WA 4CLJA 4AN2A 4BDGA 4M7IA 3CKWA 3PVBA 3LE6A 3TZ8A 3RP9A 3W2QA 4FX3A 4QMWA 4EZ3A 1IRKA 1BLXA 2FSOX 4FV1A 4DEBA 1Q97A 3DXPA 2WMWA 4YZCA 4YC3A 2YDKA 5C03A 4YO6A 1PF8A 5B7VA 2QOCA 3FY2A 2R9SA 4ZMFA 3ZYAA 2QLQA 4BF2A 3U6IA 1ZRZA 3JS2A 3WBLA 4J53A 2JKOA 2F7ZE 4OTGA 3N4VA 2OBJA 4FKIA 3UE4A 3F69A 3HMIA 1H28A 4PDYA 3R1SA 4BCHA 1Y6AA 1OIYA 3KMUA 4JIKA 4FSQA 3VW8A 4ZTSA 3FDNA 5C4LA 1PYXA 3HA6A 5AUWA 5IEVA 4F0GA 5IMXA 4MK0A 3THBA 5H8EA 5L6WL 2WGJA 3VS6A 5LCJA 4PY1A 4AOJA 5FXSA 4KIPA 4IDTA 4PTEA 5CVFA 1FVRA 1I09A 5EYCA 3COIA 4A9YA 4FZ6A 1E9HA 4F4PA 1ZOHA 2J4ZA 4R7BA 2XJ0A 4PMMA 4FR4A 4WO5A 5KE0A 3WIGA 4QRCA 2IO6A 4KIQA 3C0IA 2XNOA 4GFGA 4HVGA 2GHGA 5GINE 1SMHA 2HWPA 3OD6X 4W9WA 3UOLA 5M4CA 3QKKA 4HYUA 5CEKA 1BYGA 3GEQA 2QKRA 1OL7A 1R0PA 4D28A 4DEIA 2J50A 4TZRA 2ZAZA 1UKHA 3DQWA 5HHWA 4YHJA 2OG8A 3R22A 3HAVA 1J7LA 3BYVA 2H9VA 4LUDA 3QRTA 2GFCA 5BVWA 3O7LB 2ZJWA 4PDOA 4AACA 1YDRE 4UMTA 2UV2A 3A7HA 3CGOA 4GW8A 4C33A 4B9DA 2YCSA 2WMSA 5CEPA 1JOWB 4IWPA 3ULZA 3IG7A 3OCBA 4LYNA 4CG9A 4CMUA 4EORA 5C9CA 4IB3A 4AW1A 3LKMA 3FPQA 3HVCA 3UPXA 4QMPA 2DWBA 3EB0A 2BKZA 1ZYSA 1J1BA 3F88A 3MY1A 2BFYA 4FT5A 4EOIA 1Q5KA 4BHNA 4G9RA 3E3BX 1ZZLA 4UB7A 3MPAA 3OG7A 3OXZA 4R7IA 4UEUA 2FVDA 2W7XA 4D1SA 4UALA 3UPZA 1PXIA 3CJFA 3O17A 5JGBA 3OY3A 3QRJA 4JLCA 4UYAA 3T8OA 4ASDA 4ERWA 5CVHA 3A7IA 3QLGA 4MEDA 3Q9YA 4A9UA 1J91A 2C69A 1H07A 3QL8A 2WOUA 2RL5A 4QMXA 4TT7A 3HRBA 5FGKA 4C62A 2PMIA 3DDQA 4Z7HA 3D94A 4BCNA 4P2KA 5AR8A 2E2BA 2OF2A 5DMZA 3ORTA 3P08A 2CGUA 4O7YA 3QHRA 3PXZA 1WFCA 3RMFA 4NK9A 4A4OA 3D15A 4RJ4A 1PXKA 4FIFA 5E4HA 5KHWA 1XBCA 4D4VA 1JSVA 4W9XA 2CLXA 4D0XA 2O63A 4RIXB 4L68A 1GOLA 3F2AA 4GMYA 2XIYA 4BDEA 2ZMCA 5FG8A 2W1IA 4BGQA 5CANA 4I5MA 4MBJA 5F95A 1H0WA 2VWIA 3UVQA 2CCIA 4GIIA 4YLLA 3SAYA 3DDPA 1H1RA 3PY1A 4U41A 5K4JA 3NR9A 3DBDA 1GZ8A 4FV2A 5GIOE 3T9IA 3QCXA 4XLIA 3FXZA 2Y7JA 1WBPA 4EOOA 5BQ0A 1GJOA 2P55A 2PU8A 5CAVA 3ROCA 5E90A 3UMWA 2ERZE 3MV5A 5IQEA 2VTOA 3EYHA 1WBTA 2XK8A 4YTFA 5IA2A 5EHOA 2C6IA 2HW6A 4CQGA 4DAWA 5J87A 4UY9A 5LWNA 4S2ZA 2QR7A 3BU5A 3COHA 4EKLA 3EN5A 4RJ3A 4ACCA 4BCQA 1ZOEA 3DK6A 3W2RA 3G9LX 2W1DA 3FI3A 5KUPA 2VZ6A 5T3QA 4EUUA 5IQGA 3C5IA 3F66A 2B7AA 3BELA 3JVSA 3O7LD 2YITA 3QWJA 3UC4A 4AGCA 5I3RA 3F82A 2J0LA 5HX6A 3ZTXA 5LWMA 3KREA 2P4IA 3VRZA 4DTKA 4XP2A 2UZLA 4HVHA 5JZJA 4EWHA 2QR8A 4MXZA 4QPSA 4NKAA 3BWFA 4QYFA 3MW1A 4HGLA 2VGPA 4BWKA 4F9AA 3SG9A 2BDFA 5ETAA 3HMOA 3ZUVA 4Q5HA 3NZ0A 1ZARA 2GTNA 3H10A 2VX0A 3LQ8A 4FK3A 1RQQA 3HMMA 3QQUA 2IZSA 1H00A 5C8NA 3Q60A 3VNTA 3W2CA 2AYPA 3ELJA 4M66A 4F7LA 4IDVA 4L42A 4KBAA 3DXNA 3LMGA 5HLWA 2PE0A 4JQEA 3FYJX 4PUZA 3LZBA 2HK5A 4D4YA 4XP3A 4QQCA 2YABA 3I6WA 4NT4A 4BDIA 2X1NA 3S00A 1ZY4A 4YJPA 3H3CA 4AOIA 3DK3A 3LM0A 3R8LA 4F1OA 4UV0A 5AAEA 2OZOA 4FV3A 2VTSA 3IPHA 2I40A 4IH8A 4R7HA 4YJQA 3EJ1A 2WTCA 3MTFA 5BYZA 3M2WA 2J0KA 4IBMA 1QPJA 4M97A 4MXAA 4HNFA 3PY0A 1YKRA 3CTQA 3Q9WA 3CS9A 3BLHA 5CALA 4E8AA 1REJA 2UZVA 4DEAA 4Y5QA 5EYKA 4DEGA 2BDWA 2OH0E 4QP3A 3OF0A 4F1TA 3PVUA 2A19B 4ZK5A 3IK3A 4O7ZA 1YWNA 3NIZA 4A7CA 2W4JA 3W18A 3K3IA 3KXGA 5BYYA 3BQRA 4IAIA 1FQ1B 4N70A 3SOCA 3EH9A 4D2SA 3DFCB 2YM3A 4LL0A 1R78A 4DH1A 1UWJA 5EFQA 4BR3A 2W1ZA 3AGMA 3Q52A 4EC8A 3PWDA 3ZS5A 4CFNA 4NSTA 5CSHA 4C4GA 1H08A 2YFXA 4HPTE 4MWHA 2X9FA 1JSUA 2WO6A 3CY2A 4EWQA 3I5NA 3QGWA 4FSNA 5KCVA 3AOXA 2R5TA 3PP0A 5AX3A 3VN9A 4NYEA 4EHVA 1VR2A 2XUUA 3DKGA 3NS9A 4EJ7A 4G2FA 4IJPA 4CXAA 5DFPA 4D2TA 1M2PA 3F5PA 5JMSA 4TXCA 3E87A 4E4NA 4DBXA 4H3QA 4WNKA 4MWIA 3Q3BA 1IG1A 1YRPA 4KNBA 1FVTA 4WG4A 4RA4A 3W10A 4O27B 3NSZA 5H3QA 2RSVA 3OXIA 3R1YA 4HVDA 4WUNA 3QD3A 3LMIA 2WTWA 3EYGA 2CMWA 4CFVA 3NRMA 4E6CA 3F9NA 5ANIA 3C51A 3ACKA 3TIYA 5HG7A 4DCEA 4EK4A 3VAPA 1OB3A 1FGIA 2ACXA 2CLQA 1GIHA 2WMTA 4O81A 2PVFA 4BCGA 5HESA 3FEGA 4TRLA 2V22A 4BVUA 4FV5A 5AAGA 2P0CA 1TQMA 3DK7A 3DA6A 4IIRA 4O0XA 3B2TA 3R9OA 5AR5A 3WF7A 2HOGA 3OW3A 5E8SA 2QI8A 3TACA 3R9RA 4MHAA 3LW0A 4XG8A 3BGZA 4ZTLA 3R7YA 3ZUTA 3N51A 3UC3A 4PL4A 3NVMB 4QP4A 5CU3A 4IM0A 3E5AA 3V5PA 4MQ1A 4QT1A 4ID7A 3RALA 3UYSA 2YN8A 2HY0A 4DGLC 4CNHA 5FXQA 3PVGA 4Z7GA 4OTFA 4OLIA 1OVEA 3I4BA 3LFFA 4GVJA 3QLFA 1XO2B 4QNAA 4LI5A 3ANQA 3QTIA 3CBLA 4OTIA 2PMLX 2VNWA 1BL6A 5L3AA 3QUEA 3PRFA 4RX5A 3EN4A 3FKLA 3S3IA 5DR6A 4OAVB 4QQ5A 1PXMA 5IISA 4BBFA 1W8CA 3FZ1A 4FTIA 1WVXA 4V0GA 4NTTA 2Y8OA 3AG9A 2W9FB 4LOOA 1NW1A 4EQMA 4CKRA 4EK5A 3PP1A 4JDIA 3ACJA 4QTCA 4BIDA 4R78A 4FUXA 5FTQA 1FBNA 1JLUE 3DBEA 2XS0A 1UV5A 1V1KA 2QONA 4MXXA 2XNMA 3MS9A 3AQVA 4ZS0A 3C4WA 4RVTA 3EQBA 3DAEA 4KD1A 5CASA 4JG7A 4R77A 3CIKA 4ZY4A 4FGRA 3Q4CA 3NUSA 3NYXA 4K77A 3F6XA 3ROYA 2XMYA 2QOBA 4NCTC 2PULA 5B2KA 4FT7A 2ZV2A 3VUKA 2OU7A 3GBZA 4HOKA 2WAJA 1XJDA 3CGFA 3RM6A 4GSBA 4FV8A 3GVUA 3UMXA 3JVRA 4KWPA 2ZV7A 3LHJA 5E9EA 1KE7A 3FLZA 3IOPA 3MH3A 4FKGA 2PVYA 4V05A 5I9XA 4IB1A 3NUXA 4O0WA 1PMUA 2HELA 4X6RA 5GZAA 2ZB1A 2XF0A 1VZOA 2OZAB 3QUDA 1OZ1A 4QP8A 3R7OA 3MJ1A 4DG2E 2XJ1A 4HNIA 4EK3A 5A6NA 3CE3A 4QO9A 3MSSA 4KSQA 5KMKA 3FMDA 4Y95A 4XG2A 2VTHA 2XK3A 3RHXA 2CNQA 4QP2A 3BE9A 4ZLZA 4DH8A 4FV0A 4NW6A 1JKTA 4E5AX 3PWYA 4EHEA 5CSWA 3P79A 5FUTA 3K54A 4BZOA 1PKGA 3C13A 3D0EA 3RTPA 2YM6A 4C38A 4OW8A 3P86A 5IEXA 5M44A 4HYSA 4U45A 3TUDA 4RIWB 4RJ6A 4K33A 2IZTA 3GU5A 4QMLA 2VRXA 3AT4A 3ZC6A 3TUCA 4FKWA 3FL4A 3QD0A 3A61A 3PUPA 2R7IA 4ZZMA 5LCKA 2QOLA 3G5DA 4FTOA 1XH6A 4WHZA 2HIWA 4TYEA 3T3UA 5HQ0A 5EQPA 4YZNA 2IZRA 3LFQA 4BYJA 3HMNA 2HCKA 4J7BA 3QALE 4L7FA 4FC0A 1XH9A 3UG2A 4F7NA 4BI2A 5A4TA 4RA5A 4UWCA 4BKYA 2UZUE 5JRQA 1IASA 3R30A 1XQZA 5HIEA 4MVFA 5A46A 3UDBA 2OGVA 4UZDA 4DGNA 4XMOA 3R8UA 2C6TA 2QC6A 2OJFE 2BTRA 3V3VA 5K9IA 5M4UA 2CNUA 3ZFMA 5HIBA 3I6UA 5AP1A 4TW9A 3FI4A 3FMLA 4XCUA 3VS0A 2GHLA 4BWPA 5JT2A 5F20A 2XH5A 4EH4A 3QU0A 2E9PA 3P4KA 4YLJA 4WG3A 2ZMDA 5J9ZA 3KMMA 3VUGA 1NVRA 2C68A 4YZBA 4BCOA 2VWWA 3R7VA 4AX8A 2JDTA 4CCBA 2UZTA 3HDNA 4K2RA 2B4SB 5IKWA 4BC6A 4LFIA 2WB8A 4CV9A 3D7ZA 5IQAA 2C5VA 4CVAA 4C3PA 4BFMA 4TPTA 4ZLYA 4FVPA 1V0OA 5K5NA 1MP8A 4G6NA 3UVPA 5M57A 4YMJA 5DRDA 2R3NA 2P2HA 5IQDA 2JKMA 4R3PA 3PA5A 2W17A 2OIQA 2PVLA 5HEZA 2OXYA 4I6FA 2PZYA 1XH7A 5DHJA 2CDZA 3QTZA 3R6XA 5IA3A 2ETRA 2WMRA 2Z7LA 5G6VA 5HOAA 5DNRA 3GU4A 3IS5A 4FSWA 4FEXA 3Q2JA 1PXNA 4KINA 1LEWA 3DB8A 4X2JA 2A0CX 4E6DA 3ORMA 4ZJVA 5AP6A 3OCGA 3GENA 5AV0A 4ZSGA 3QZHA 4DG3E 4I24A 3P1AA 4D55A 4HW7A 2OFVA 2YJSA 5GNKA 4EUTA 4QTEA 5GJDA 3NUNA 1JPAA 4Q9SA 3FMEA 2JKKA 3QX2A 4RC4A 1K2PA 3UGCA 4GT3A 4ZTHA 3EFWA 3TCPA 4M3QA 2G15A 2J5EA 3R7GA 4GJ3A 4KB8A 3W1FA 2QHMA 3HRCA 2YLFA 2R3KA 4XHKB 1FINA 3G0FA 2OXXA 1RE8A 2WZJA 1RJBA 2BIKB 3HV3A 3ZEWA 2Y4PA 4FKVA 1DM2A 3NAXA 2XEZA 4ZZNA 4YZ9A 4UMRA 3LCKA 1M14A 1QPEA 1ZYJA 3IW6A 4W8EA 4C58A 2YWVA 4O0SA 4C2VA 3V5WA 3DLZA 1Z9XA 4FE2A 2BROA 4O2ZA 3AD6A 4RC3A 4UZHA 3BYMA 3DTWA 1CDKA 1YDSE 2E9UA 4CFMA 5K0KA 3GI3A 3HNGA 1UU8A 5DR2A 2F9GA 5GJFA 4J99A 3HA8A 1OIUA 3RPSA 3DKCA 5HTBA 4FSYA 5IQBA 5HG9A 5EI8A 4XV3A 4QD6A 4IXPA 5JSMA 4B6LA 4E4XA 4EQUA 5JZNA 3GCSA 4GT5A 3S4QA 3O96A 4IWOA
chains in the Genus database with same CATH superfamily
3F2RA 3PSBA 4RIOA 2YCRA 1TQPA 4LGHA 4Y73A 3ZLXA 3CTHA 3FMKA 2XK6A 3A7GA 4AZSA 5CU6A 3MFTA 1DAWA 1M7NA 4I5HA 5H9BA 4JBVA 4EJNA 1XWSA 1AQ1A 1Q62A 2HWOA 4YNOA 2VTLA 1WBWA 2JLDA 5L6OA 4O21A 4GKHA 5IQCA 3ZXTA 4F09A 2BILB 2C0OA 3AGLA 5EM5A 4ZY6A 3ZO1A 4AA4A 5IA0A 3VBVA 4NM5A 4CLIA 4I3ZA 3SLSA 1H4LA 4BY9E 4TYIA 1WBNA 5AP7A 3AD4A 4RT7A 1QPDA 3ZO2A 2X2KA 2Z7SA 1UU7A 4JRNA 5HO8A 2RFSA 5CAOA 1WCCA 4Y72A 3MBLA 3KULA 4QYHA 3U4UA 3UIXA 3FI8A 2DYLA 5HGIA 2G2IA 3DJ5A 1OL5A 2AC5A 3L9LA 4E5BA 4N6ZA 3IECA 5ICPA 3LCOA 3ATSA 3ETAA 3RK7A 4ERKA 2R3MA 3KN6A 4HZRA 3OUNB 4IFCA 1YI6A 3NAYA 5C01A 4FZAB 4JBOA 2R0UA 4CGAA 4FTRA 3UTOA 2NP8A 4YUQA 2XNBA 4RLLA 4XBRA 4XJ0A 4E93A 4MTAA 2GMXA 3KRXA 3O23A 3CQUA 4ZTNA 3O8UA 4CG8A 3IW4A 4U3ZA 4DF3A 5A4LA 2Z7QA 3TL8A 3RK9A 4RWKA 3O8PA 4RFMA 4GIHA 2VTMA 3VS3A 4RMZA 5A9UA 2RG5A 4QOXA 3V8SA 3A4PA 3VC4A 5B2MA 2G1TA 2PVJA 2X0GA 3ZO3A 3DBQA 3QTUA 4AFEA 3TKUA 3NW6A 3B2WA 3QF9A 1G3NA 1DI8A 2XNEA 2XIZA 1IAHA 3NX8A 4EYMA 2C3LA 3E62A 3JYAA 3BHUA 2BPMA 2F49A 4U80A 3W0PA 5JFXA 5LMKC 2YERA 1E1VA 3SKCA 1LEZA 2AC3A 3Q5ZA 4FMQA 3KXHA 4K18A 4JX7A 4I1ZA 1WBSA 2B9JA 3FYKX 3QA8A 1PXOA 4AGUA 4YZDA 4OBQA 1ZYCA 3UIUA 2OJJA 3CPCA 2YISA 1NVSA 4D2VA 3A4OX 2X7OA 3ANRA 2EU9A 3BEGA 3R04A 4I6BA 4ITHA 3UO6A 4R6VA 4FZFB 5BYLA 2YDIA 3EQHA 5IH4A 4CFUA 3ITZA 3L8VA 3BWJA 1A06A 3KQ7A 3OHTA 1WBOA 3UDSA 4EH5A 4NM0A 4LV8A 3EWHA 4WOVA 5H8BA 4MX9A 3LM5A 4EK6A 4I0TA 3NDMA 1OL2A 5K0XA 4DEDA 4K0YA 5FLFA 2ZVAA 4KRCA 2OI4X 5I4NA 4FODA 4RQKA 3P7AA 2V7OA 4AG8A 4L53A 2QODA 4K11A 3FV8A 3EOCA 4AW5A 4F0IA 2PVHA 2OW3A 1LUFA 4F99A 3D5UA 2IJMA 4XV9A 4YGAA 3FMJA 3RZBA 4EOMA 5J79A 2E9OA 3QTWA 4Y83A 1JKKA 3L8PA 4DHZA 4Y5HA 4LRKA 4LGGA 4FJVA 5AM6A 3N4UA 3GC7A 3C1XA 2EXEA 3FHRA 2X6EA 4D58A 2BZHB 2GU8A 3NLBA 2VTQA 3NNUA 4FTLA 4GU6A 4PP9A 4XP0A 3RK5A 3FSKA 3BI6A 2VAGA 3WF8A 4C34A 4H39A 4FEQA 2QOIA 4IC8A 3Q4TA 3QZIA 5CX9A 1T46A 2C6DA 5I9UA 4EOQA 5CTPA 5JEBA 3SA0A 3KK9A 2W9ZB 1Q4LA 2J6MA 3A99A 3LJ2A 3EIDA 3MH2A 2CPKE 3P23A 2WMBA 4V04A 1GZOA 2P33A 4EOLA 2C6OA 2O65A 1IAJA 2XIRA 4ZP5A 3AC3A 4FF8A 3GFWA 5JRSA 4AT4A 5E8WA 5BX0A 1OKVA 2VX1A 3PA3A 4PL5A 5BUIA 5J1WA 2BDJA 3CXWA 3TV4A 4ZZOA 2QURA 2JITA 5J1VA 2CGWA 2FO0A 2W1HA 2XM9A 4ANQA 2UZWE 3JY0A 4JX3A 5CU4A 4Y46A 2V0DA 2X39A 3Q96A 4XOZA 4AFJA 2YIWA 3W8LA 1YWVA 2EB3A 4UXLA 4PTGA 5HICA 3O0GA 4L43A 5C27A 3KU2A 5AEPA 2WMAA 2UW9A 3CEKA 4IJ9A 4XRLA 1IEPA 1YWRA 2QOOA 4O4FA 5CXZA 2XCHA 3R28A 4EH9A 1SZMA 3BHHA 4D2RA 1P5EA 2W4KA 3AC4A 3KXMA 3MYGA 4FTCA 5DH3A 4E6AA 3NYOA 3ZOSA 3MN3A 4DHFA 3WF6A 4YP8A 2ZM3A 3EQIA 3EL8A 4BDBA 5LVMA 2XYUA 5CS6A 3S95A 4AOTA 4IX4A 3QCSA 5EDPA 3UP7A 4H05A 3HX4A 5BMSA 2O3PA 4O7WA 4KBKA 3ODZX 3OFMA 4YSJA 2J51A 2PZRA 2VTPA 5DWRA 2J7TA 4YJOA 3MH0A 3KXNA 2QU5A 4U7ZA 3FZOA 4PMTA 2XYNA 4PV0A 5CSVA 4E7WA 1U5RA 3KEXA 4ANLA 3U51A 1ZY5A 2AUHA 4EBVA 2HZ0A 3W0OA 3FHIA 5FP5A 4G3FA 2XALA 3VONA 1M52A 4FKPA 2YA9A 4IAAA 5AADA 4PRJA 2XBAA 2XJ2A 4G17A 4IVAA 3PJ3A 5CF8A 4FTTA 1KWPA 2C3JA 1YHWA 2C6EA 3H9RA 3OWPA 1TKIA 5J5TA 5EHYA 4GT4A 5E7RA 4QMOA 5LVNA 3KA0A 5DA3A 4TTHB 3BCEA 3AC8A 4BHZA 2WU7A 3QRIA 4J98A 4Q5EA 5HCZA 5HO7A 1REKA 3Q5IA 3AC1A 2PK9A 1F0QA 4HCVA 5AV3A 1XH5A 1EH4A 1YHSA 1PYEA 3LFAA 3W2PA 4QMNA 4QTBA 3MGYA 3D4QA 4WBOA 5GIPE 4FGBA 1H24A 4IAZA 2DS1A 4X2NA 3D2IA 5HBEA 4DLIA 3RPYA 2X8IA 4FIIA 3QQKA 4BBMA 3KF4A 3LCDA 2JDOA 4FKTA 5AUTA 1A48A 4LDTA 4AQCA 4QQTA 2RGPA 1U4DA 2QVSE 4TY1A 4ACDA 4X3FA 5KBRA 1RDQE 4B99A 1GZKA 3ORLA 5LVPA 3I0QA 3VUIA 4FV7A 4EQCA 4Z16A 4WKQA 1IR3A 4F64A 4F9CA 4M14A 4BB4A 1WBVA 3E8EA 3A8XA 3GU7A 5HKMA 3BGPA 4LG4A 2B53A 1NY3A 3RJCA 3E8DA 4V0GB 3UBDA 1SNXA 4J8MA 3RVGA 4NL0A 4KIKA 4QDVA 4OTPA 3C0HA 4FI1A 4RQVA 4IVDA 4EOPA 2PVKA 5EH0A 2RKUA 3OXTA 3C5UA 3C50A 2G9XA 3BGQA 4D9UA 1PHKA 2I6LA 3LMHA 1JSTA 2ZDTA 5CZHA 1YI4A 5AMNA 4APPA 4AW2A 3BV3A 3QQLA 4C3RA 4UYNA 2GS2A 3DKFA 4GUEA 3COMA 3NUUA 3QGYA 4AF3A 2IN6A 5M53A 4TYHA 4CV8A 4QMUA 3RI1A 3KFAA 3QRKA 4PP7A 5A4EA 2OKRA 2GS7A 3OP5A 1DI9A 4FZDB 3SDJA 1JAMA 4U8ZA 3HV6A 3W16A 3DNDA 4PX6A 4KA3A 3EN9A 2CGVA 1OUYA 4QP1A 4EKKA 4CMTA 5CT7A 2BUJA 4DA5A 5IUHA 4O4EA 5KBQA 4G3EA 4FL1A 4JL9A 4QMVA 5D41A 4YSMA 3U9NA 4KKGA 3MVLA 1GZNA 2YCQA 1SNUA 5BVKA 3ZBFA 2EUFB 1P2AA 2UW4A 3ORPA 2B0QA 3PXYA 4IEBA 2YACA 4D4RA 2I7QA 3R9DA 3L9MA 3W2SA 4BBEA 5AFVA 2EB2A 3G51A 5AP3A 2W5BA 3MJ2A 4FBXA 4R1YA 4BI0A 3NUAA 5FTGA 1NA7A 2H96A 3QWKA 3GC0A 4IM3A 1MUOA 5ANDA 4UN0C 2ITYA 2J9MA 3Q6WA 3Q53A 1J1CA 3FWQA 4PNKA 3PRIA 4F63A 1OKZA 1MQBA 4EI4A 3TZ9A 2C6KA 1MRUA 1GIIA 4J97A 3FLYA 5AR4A 2J0MB 3FXXA 4MNFA 5TR6A 4C37A 4PMPA 4OAUC 2CKEA 1G8SA 4X2FA 2R0IA 3CLYA 5TE0A 4FV9A 4IACA 2UVXA 5I3OA 5AV2A 4NWMA 3FXWA 2WKMA 4AE6A 2QOKA 4X2GA 4FOBA 5ACKA 3QBNA 4R8QA 3R83A 4YJUA 4IW0A 3C0GA 3ZBXA 4V01A 4CYJA 5KMJA 3IKAA 4U40A 1OKYA 4PL3A 3TN8A 5IPJA 4O2PA 4YLKA 2JFMA 4I6LA 3RAIA 3FKOA 4IQ6A 4Q2AA 1Q8WA 4EH3A 4C59A 5GZ8A 4JAIA 1ZAOA 2PVNA 3AC2A 4CMOA 4U42A 2VTJA 1OMWA 3ZDIA 3VS2A 3PXKA 3UQFA 3K2LA 2UW8A 3DS6A 2YLEA 3OEFX 3UZPA 3LVPA 2ONLA 3SW4A 5IA4A 2CSNA 1W82A 2ITTA 2UW3A 2UVYA 4FIGA 4JT3A 4FEVA 1BI8A 2HYYA 4H1JA 4D4SA 2I1MA 4MD7E 3PIYA 2PUPA 2O5KA 5IZFA 3MIAA 5CI7A 4ASXA 4BGHA 3HGKA 1SVGA 3PA4A 3F3ZA 4ZSJA 4CYIA 3A7JA 4MXYA 3SV0A 4C35A 5AP5A 3B8RA 3HEGA 3SGCA 4I5PA 3DNEA 3G33A 5AIKA 1KE9A 4G3GA 5DIAA 4RX7A 4ACHA 5HI2A 2ESMA 4EBWA 4DH7A 3LFDA 5AR7A 3VJNA 3FE3A 4BCPA 4YO4A 4ENXA 2WFYA 2WQNA 3VS7A 3UVRA 3TUBA 3CSVA 2JAMA 4QEBA 4GRBA 2X6DA 4X6QC 4FSRA 2OIDA 3ZZEA 3FBVA 3W33A 3DOGA 4PMSA 3MA3A 4X0MA 2IW9A 3KXXA 4G31A 1E1XA 3GCVA 4K8AA 1KUTA 4NH1A 2JDSA 3CTJA 3FPMA 3OTVA 3PXRA 5D1JA 2GNFA 4PWNA 3A8WA 5HNIX 5B0XA 1YOLA 5EOLA 5DI1A 5HLPA 4BRXA 2A4LA 4QTAA 2WD1A 4YHTA 1O6LA 2JC6A 1VYWA 2B55A 3R1QA 5E8YA 3W55A 3ZM9A 2R3IA 4FVRA 4CT1A 2X81A 5AUZA 3MPTA 1Q61A 2CJMA 3RAHA 3KMWA 3C4ZA 3NW7A 1KE8A 2HXQA 3Q32A 5CSXA 4B0GA 3GQIA 3W0NA 5AV4A 5AUUA 3VIDA 3OZ6A 3O2MA 4W4YA 4ITIA 4LOPA 1Y91A 4ONAA 3VWAA 5CF4A 4MF0A 2G2FA 3ZSIA 2BVAA 5BVFA 3V8WA 4O7LA 2R64A 2VX3A 4WBBB 3FLQA 1H8FA 4GV1A 5BPYA 5KMIA 2Q83A 2WTDA 3UZRA 2GDOA 4TWNA 4BTKA 3IW5A 5BVEA 4PQNA 4D5KA 4QMYA 4EK8A 4AXFA 4FUYA 4FIHA 4O0RA 3C4EA 5EQEA 4L6QA 3GUBA 3HUCA 4FNXA 4BDCA 1W84A 4RZVA 4X3JA 1TQIA 5A4CA 5EQYA 2QG5A 2YIYA 5HNGA 4YJRA 1G8AA 3TEIA 3E8CA 3Q4UA 2Q0NA 5AR3A 4HVIA 3FZTA 3R2YA 1ATPE 3RZFA 4FEWA 3C4XA 5I9YA 5D11A 3KF7A 3R8VA 4S32A 3QHWA 3NGAA 4BGGA 5JFWA 3PSCA 1U59A 1YQJA 3ATTA 2JEDA 3PIZA 4F9WA 3KRJA 1NVQA 1U54A 3EQCA 2FB8A 2VO6A 4PDPA 3TNQB 2GQSA 4ENYA 4O7NA 3BKBA 2W05A 4APCA 5L8KA 4LMUA 2UW5A 3R73A 2YDJA 3L9PA 4HGTA 5ANOA 4UMUA 2I0YA 3QTSA 1W2FA 4U44A 1YVJA 4E73A 3GCUA 2R3RA 2YJRA 3PY3A 1TVOA 1B6CB 1X8BA 2VTIA 3D7TA 4HJOA 4ARKA 3P0MA 4L3PA 3VQUA 1G8KA 5CF6A 5EM8A 5DE2A 3QTQA 2CKOA 5ANEA 4U3YA 1OBDA 4J71A 3VVHA 3FC2A 3RWPA 4C4HA 3TV6A 1S9JA 4M15A 4RJ5A 5EG3A 3R7UA 5DPVA 3FLSA 3KULB 2YIXA 1BI7A 4PPCA 2J0JA 4OBPA 3VUMA 3UG1A 1JKSA 5CNNA 3IGGA 5DT0A 1ST0A 4EHGA 3OTUA 4JDJA 2BAQA 2UZNA 4C2WA 3TJDA 1Z57A 5AR2A 4R5SA 3RAWA 4AZVA 3CR0A 1OIRA 4O0VA 5CAQA 4DE4A 2XB7A 3E7OA 2YIRA 4R1VA 2UW6A 4RVLA 4JRVA 4OTWA 5BVOA 4DYMA 4AZEA 5A4QA 4BZNA 1SM2A 4N0SA 3VO3A 4DEHA 2BRNA 4ZAUA 3I5ZA 5IG1A 5K5XA 4B4LA 5HX8A 2YZAA 1B39A 3KC3A 4XOYA 3TNWA 3DKOA 3CKXA 2YHVA 3OUKA 3HL7A 2QLUA 4FTMA 3OW4A 3OWLA 4AAAA 4CTCA 4F1MA 2W5HA 4G16A 3DQXA 4I0RA 2C4GA 2ZYBA 3NCGA 3C4CA 5EW8A 3ALNA 2PE1A 4L46A 4FA2A 2GQGA 2W1CA 2BAKA 3ID6C 4MH7A 1UNLA 4UMPA 2W06A 1FMKA 3HAMA 3UYTA 2OJ9A 3LJ0A 5JK3A 2Z60A 3AMAA 3IO7A 5JN2A 3IGOA 3REPA 3U6HA 3SXRA 3OS3A 1K9AA 4NKSA 4L3JA 3WF9A 4DT8A 5D7VA 1B38A 4RIYA 5CAUA 4I6HA 3D9VA 1OI9A 2O2UA 2O64A 4ASEA 3PDTA 4LRJA 3W0MA 4YNEA 4MAOA 4E20A 3RWQA 1JVPP 3Q2MA 3UOKA 4I41A 4BDJA 2V5QA 3GT8A 2QO2A 1QMZA 4D2PA 2C5NA 2YM8A 2PYWA 2F2UA 2YM7A 4WNPA 4IWDA 2ERKA 4D2WA 4XUFA 2PY3A 3VQHA 4CRLA 5AV1A 1PY5A 4BCJA 4JJRA 5K3YA 3EN7A 1YW2A 4PF4A 2JKQA 3ZM4A 2OLCA 3M11A 2C0IA 3F3WA 2FUMA 3QYWA 3G6HA 4NEUA 4XG3A 5AA9A 4YHFA 4DEEA 3O50A 2HXLA 2PHKA 3H4JA 4M67A 1LPUA 4LMNA 5KKRC 2B52A 2ITUA 3L9NA 4NM7A 4NZWB 5IU2A 5DYJA 4BDAA 1Q99A 3SW7A 2IVUA 5EI2A 3UZTA 4GFMA 2JIIA 3BX5A 4RX8A 3VUTA 4FV6A 2EXMA 3JR1A 4XS2A 4QMZA 5KKRB 3R71A 3OY1A 5DGZA 5I9WA 3S0OA 4QP7A 3VJOA 3PE2A 3GGFA 2OO8X 1ZMVA 4L00A 3UO4A 3SVVA 1M17A 3GFEA 2V55A 3UP2A 2GNJA 4UBAA 4H58A 3HECA 3UOHA 4LRMA 3RM7A 5CU0A 5HORA 1VJYA 5F94A 5IMEA 4EONA 5LQFA 2UZOA 2ZM1A 4MXCA 4TNDA 3TDWA 4DC2A 2PUUA 4D9TA 3I7CA 3Q6UA 2NNWB 3F3VA 2XKEA 1J7UA 3PPKA 5HE2A 2OFUA 4AXDA 4ZS4A 4P4CA 3QXOA 4ASZA 2DUVA 3SC1A 1YHVA 2WMXA 4IVBA 5HE3A 3NUPA 4FTJA 3R9NA 4ANOA 5EYDA 1Y8YA 4FG9A 3Q4ZA 4I22A 2XKDA 2ZM4A 4ZIMA 2VD5A 4ANBA 2O0UA 2R3GA 5IQFA 4C61A 2QOQA 4O0YA 1ZOGA 3K5UA 4QMTA 4IZ7A 5IUIA 5CXHA 4CFWA 4JIAA 3Q04A 1URWA 4WA9A 3KVWA 4G3CA 5A14A 3QYZA 3BU3A 3V04A 2VO0A 3PUFC 2C5YA 3BLQA 3E93A 4EC9A 4YC8A 1CKPA 1H27A 5HTCA 4GKIA 3BZ3A 4BL1A 3KIOC 4A9SA 4FNYA 4FTUA 1MRVA 2BALA 3LPBA 1H1PA 5EM7A 4DDGA 2XBJA 3MIYA 2XCKA 3VS1A 1W83A 5H2UA 4BIEA 3KVXA 5HBJA 4GG5A 2IW6A 4JS8A 3ORXA 4ANSA 5C1QB 3F2NA 3VBQA 4XNEA 3B8QA 3IOKA 2KULA 3P7CA 3PPJA 5L8JA 1SVHA 2VWBA 3ULIA 2C6LA 4ORKA 3EMGA 4L44A 3SHEA 4RC2A 3LLAA 4IC7A 3D14A 3MA6A 2PWLA 4X2KA 1UKIA 5D7AA 4AGWA 4YJSA 2B9FA 2VGOA 4FRFA 3PVWA 5EK7A 2C30A 5CEQA 4O1OA 3RINA 3ZSGA 3FSFA 5L4QA 3HV4A 3H30A 4OBOA 4X3FC 4F7SA 1GY3A 4O91A 4F78A 3NW5A 1HOWA 5TKDA 4YC6A 1ZMWA 3EQDA 5TF9A 2QOFA 3R8ZA 3V6RA 5L2TA 4CKJA 1UNGA 5AP0A 4HYIA 5FDXA 3DTCA 5FBNC 3HKOA 2X9EA 4GG7A 4X3FB 3C4FA 4CD0A 1YOMA 3OVVA 2A27A 4FT0A 5E8UA 5HVYA 4Z55A 2IVSA 2QO9A 3EFKA 5IF1A 3EHAA 4JQ8A 4GK3A 5D12A 5FDPA 3VS5A 4O0UA 4M84A 3U54A 4MNEA 5HCXA 4BTJA 1P14A 2QHNA 4YR8A 4OGRA 1AGWA 3SOAA 4DH3A 2YAKA 5JKGA 4NW5A 1PXPA 5DBXA 4F9YA 4KIKB 4CZTA 5JQ8A 1O9UA 2OH4A 4M12A 3M42A 2W4OA 4G1WA 3JPVA 3HP2A 3BRBA 3MWUA 3FLWA 3E3PA 4JR3A 3UJGA 2WMQA 1PMNA 2R3LA 3RAKA 3OWJA 3KN5A 2WPAA 4RGJA 2F7EE 1T45A 3F5XA 4GH2A 3NWWA 4X21A 3UDTA 4JBQA 4RVMA 4CZUA 4OUCA 5DVRA 4RBLA 3RPVA 5KNJA 3MH1A 4L52A 4IB0A 1ZWSA 4TYHB 3FZPA 3MVHA 2XA4A 3F3UA 1H1SA 5HBHA 5JGDA 1KOAA 1Q41A 4YU2A 1QCFA 3HMPA 4DGOA 4O38A 5FM3A 2H34A 4FK6A 3SRVA 4ZJIA 3ZFYA 3KK8A 4G34A 4FT9A 3UNJA 3BIZA 4GK2A 2X2LA 3ML1A 4HPUE 4CTBA 5J95A 4FKSA 4JDKA 4YJVA 3H9FA 4EZ5A 2FSMX 5KO1A 1JWHA 3LFBA 3OCSA 4U0IA 3TIZA 1ST4A 1M7QA 4H3PA 2HZNA 4RRVA 5FD2A 1YDTE 2Z7RA 3T9TA 4M69A 3WILA 4C4FA 4ZTMA 1ZYLA 4GYIA 2REIA 4ZSAA 4J95A 3U9CA 4OT6A 3GOPA 4QPAA 3NCZA 1OBGA 5IQIA 4JI9A 4FSMA 3ZEPA 5HTIA 3IW8A 3FAAA 2PMNX 4OTRA 5ETCA 4FKRA 2FYSA 3GC8A 3SXSA 2JD5A 3HDMA 4I20A 2NPQA 3MVJA 2ITQA 4A9TA 4WSQA 2YWPA 3OBJA 5CF5A 2GNLA 2HAKA 2ZV9A 3DGKA 3HYHA 3KL8A 3PE1A 1OKWA 4XLVA 2V7AA 1WVYA 4EH6A 3TNPC 3LJ1A 2P2IA 3NUYA 2QCSA 5GJGA 4GS6A 5CQUA 4KSPA 3ZRLA 5CZIA 2FSTX 3H0YA 5JQ5A 4FNWA 4DH5A 4ANNA 2XNPA 4AWIA 3LXPA 3EL7A 1SYKA 3BYUA 3ZU7A 1W98A 5DEWA 4W4WA 2CNVA 3GQLA 5M56A 3ALOA 4TN6A 4KRDA 3AXWA 2Z8CA 3BQCA 3OMVA 5J7BA 3ZLSA 4C02A 2LAVA 4XG6A 5B2LA 5HE0A 3FQHA 3K3JA 3KY2A 2PUIA 4I6QA 4RVKA 5M51A 5EW3A 4F9BA 4USDA 5DOSA 5CI6A 3UNZA 2ONLC 5IDPA 4QPMA 4IZ5A 4LV7A 4AA5A 2IZUA 3MB6A 1YXVA 4BWXA 3TI1A 4WD5A 3BLRA 3DB6A 4C36A 2R3QA 3NIEA 3O71A 2XIXA 5E8TA 3FMMA 1XBAA 5AIRA 3EKNA 1ZZ2A 4R3CA 3TTJA 3E8NA 3BHYA 3WZEA 2GFSA 2ITXA 2X7GA 5DRBA 3WIKA 3LQ5A 4Q9ZA 2GCDA 1MQ4A 4YTHA 2G2HA 3ENMA 3ZSHA 4USFA 2WTKC 3MFRA 4N6YA 1H25A 5AWMA 4LV5A 5LMAA 1S9IA 2VWXA 5EM6A 3FI2A 3KGAA 1YI3A 4GUBA 3W0RA 5CEOA 1ZMUA 4MD9E 4FYNA 4AT5A 1FOTA 4YPSA 5H8GA 4ZEGA 3QQHA 4IVCA 5J8IA 4ALUA 1Z5MA 2WTKB 3PJCA 1GIJA 4NTSA 5C8KA 4BTFA 1OGUA 4IANA 4G5JA 3QC9A 2XAOA 2VWZA 4OR5A 5E8ZA 3DCVA 4NFNA 4NUSA 2UW0A 2OK1A 3FLNC 4O6LA 4WUAA 4O96A 5DLSA 4C0TA 2V62A 4L7SA 2C0TA 4NFMA 2NRUA 3WE8A 1W2DA 3FY0A 3U55A 2GNHA 1TFFA 5AX9A 1UNHA 2GPHA 1XBBA 3OT8A 4JR7A 2QO7A 3IW7A 3MVMA 4FOCA 4O82A 1JQHA 4CSVA 4DTBA 4M68A 4U9AA 3GNIB 2OSCA 4I92A 1Y57A 2O8YA 3DBCA 5CY3A 3POOA 5HD7A 2VTAA 2EVAA 2R4BA 2BRGA 4A06A 3U4WA 2LGCA 4A9RA 3WF5A 4QDEA 5LOHA 1VYZA 2F4JA 4J8NA 1J3HA 4U5JA 3RKBA 4N4SA 2BAJA 3RCDA 4A4XA 3CD3A 3FJQE 4JXFA 4C57A 3PPZA 4W4VA 3KCKA 4I0SA 3QX4A 2WMVA 3LCTA 4S31A 5DN3A 5IA5A 4FSUA 4I94A 4JG8A 1ND4A 3R02A 4WNOA 1ZYDA 3G0EA 3NPCA 5JGAA 2F7XE 2JBPA 1W0XC 2JDRA 5EI6A 3TM0A 1JNKA 2I0EA 3BL7A 3QZGA 4IAFA 4TKSA 4RWJA 4CFFA 3K5VA 4ZLOA 1KV1A 4E6QA 4AN9A 3QCYA 5HG5A 3MTLA 1W7HA 3VULA 3GC9A 2CHLA 4AUAA 1FGKA 2JAVA 3COKA 4O6EA 1YOJA 2W1EA 3MB7A 4FG7A 4YPDA 4GU9A 5AP2A 5M4FA 4WG5A 4NIFA 4FL2A 3U87A 4O7RA 2HW7A 3OWKA 5E8VA 4Z3VA 1CTPE 1Q3WA 4RSSA 2BRHA 4WNMA 4LM5A 5AUYA 1FPUA 3DXQA 1H0VA 1QL6A 2ITVA 3ERKA 3M1SA 4PNIA 1U54B 3VHEA 4B8LA 5ETIA 5TO8A 4CRSA 4DINA 1OPLA 3CQWA 4GEOA 5DR9A 5LJJA 4E26A 2BMCA 2OWBA 2XK4A 3DT1A 3PYYA 1AD5A 3I60A 3F61A 2HENA 5HE1A 4KIOA 3AMYA 3CD8A 2YM5A 4X7QA 1P4FA 1PXJA 4MBLA 4I5CA 5L8LA 3H0ZA 2J0IA 3F3TA 3D7TB 5BVDA 3QRUA 3SG8A 4G3DA 1U46A 4OTHA 3RGFA 3V6SA 5M06A 4HGEA 3MY5A 3DY7A 3ZMMA 2KTYA 3V01A 3LFCA 5HVJA 4FTKA 4C4JA 4DGMA 4JOAA 1XH4A 3LFEA 4MQ2A 3POZA 1KE6A 3OOGA 4IM2A 5ITAA 1Q8ZA 4PTCA 2BHHA 3RBWA 4AP7A 3G15A 3G2FA 3QQJA 1OPJA 2XK9A 5KMLA 5F9EA 3ZONA 4EHZA 4FVQA 1CKJA 2J5FA 4FKOA 4KAOA 1VEBA 5L2QA 2HZ4A 4M13A 5EKNA 3OC1A 2X4ZA 4P5ZA 1OL1A 3OCTA 4Y85A 3TV7A 4ANMA 5DT4A 1XH8A 4Z9LA 2C1BA 4UX9A 4P90A 4XV1A 2VN9A 4TWPA 3PXQA 3ZH8A 2WTIA 1TZDA 3DJ7A 2ZB0A 3D5VA 3L8XA 3FUPA 4IMYA 4EH8A 4DT9A 4S34A 4XH6A 5HD4A 5A6OA 3KKVA 2BZKB 3F5UA 4PPAA 2WOTA 3OBGA 2QOHA 4BCMA 4AW0A 1IA8A 4EH2A 3CPBA 4K9YA 4BKZA 1F3MC 2BRMA 4IAYA 5TT7A 3QTXA 1XKKA 2EWAA 3AMBA 3E92A 1V0BA 1O6YA 3O51A 5ANJA 4FTNA 4QP6A 4PDSA 2FSLX 2R3FA 3A7FA 3CJGA 4CKIA 1LR4A 4O7VA 4U79A 4H3BA 4BZDA 3DV3A 4CFXA 3HRFA 5E1SA 5FEDA 5M4IA 5AUXA 3DZQA 3V8TA 1WVWA 2ZOQA 2PZIA 2QG7A 1SVEA 4TYJA 4OT5A 4BN1A 5FXRA 2WTJA 4QYGA 1Q24A 4ZY5A 3MPMA 3ORIA