4KA3A

Structure of map kinase in complex with a docking peptide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
351
structure length
340
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Crystal structure of the p38 alpha MAP kinase in complex with a docking peptide from TAB1
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/protein binding
total genus 102
structure length 340
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ka3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ka3A01
4GYIA 2OSCA 2YCSA 4CTBA 5AP1A 3V5PA 2YCRA 2VWWA 3NLBA 3ALOA 4NU1A 2BROA 3E7VA 4GCJA 1STCE 4QMLA 4M68A 4R3CA 4ITIA 3UGCA 3UC3A 3QBNA 1TQPA 1W0XC 1TQIA 3O8TA 4YC3A 4E5AX 4NTSA 4QMUA 2X2MA 2W1FA 3HP5A 4RZWA 4OTHA 3PP0A 1U5QA 3Q4UA 5ANIA 3TG1A 4FG9A 4CFXA 4FKGA 4JDKA 3UDBA 1PY5A 4CMUA 5IMEA 2X7GA 2C30A 4FNYA 4BI1A 2IW9A 4IAZA 1KE5A 3DQXA 4IAFA 4IC8A 4EK3A 3ZLWA 3AC1A 4BCHA 5HTCA 4FEWA 1P14A 4H58A 5JMSA 1E9HA 5JN2A 3LFEA 3GVUA 4GUEA 4OTFA 5IDPA 2XK9A 4AA4A 2O0UA 3LHJA 5ACKA 5K9IA 4QD6A 4FTNA 3PXFA 3CBLA 4RWLA 1JSUA 1Q41A 4DFNA 2WTVA 4X2FA 3Q4TA 3E8EA 1KOAA 4W4XA 4CLJA 3QTUA 5LVLA 4AACA 2YM8A 2VO6A 2BRHA 2VTSA 4RC2A 5CLPA 4BCFA 1Q3DA 4ZMFA 4D28A 3FHRA 4NM3A 5CNNA 4WSYA 1Q5KA 4YZMA 2WFYA 4QYFA 4FSUA 3UQFA 1RW8A 1ZZLA 3DKGA 3FQHA 4I23A 4ZK5A 1KV1A 4GMYA 3DNEA 3ZUVA 1WBPA 2IZSA 1NA7A 1M2QA 2X39A 5LVNA 2W7XA 3G0EA 3PPKA 2OI4X 4FYNA 4EONA 4G6LA 5J9LA 3F3ZA 3LFAA 3ZZWA 4ZEGA 4EWQA 5D41A 1XR1A 5EKNA 2BMCA 4E6QA 3VHEA 4XYFA 3BU6A 3UIBA 4LRJA 1KE8A 1H08A 1ZYJA 3ZEWA 4O7YA 4O7VA 3QQFA 4DA5A 5CNOA 4CRSA 5HVKA 4JI9A 3V04A 2PMOX 3OXTA 4L68A 4CMOA 4LRKA 3NDMA 2BRNA 4I6HA 4LM5A 4QYEA 5FEQA 4MVFA 4D0WA 4F9CA 5K4JA 2Y4IB 3VN9A 4DG2E 3C50A 2UZLA 2XK6A 3GCQA 3PPJA 3QQKA 3EFKA 2OXDA 3GC9A 3QU0A 4CRLA 1BL7A 1FOTA 4TWOA 2PVRA 3VBWA 3B8RA 5AR2A 3WILA 3I7BA 3DKCA 4YSMA 3IW6A 2QU5A 1DM2A 2H34A 3W2PA 3SQQA 5CAQA 4CYIA 3PZEA 4TPTA 4FGRA 4FEQA 2WTKB 3H9OA 3DV3A 4PTGA 3BE2A 3BEGA 3KMUA 3OY3A 3RCJA 2XEZA 3GOKA 3CKXA 1UNHA 5AJQA 2OH4A 2RGPA 4YHTA 2ETMA 4C4EA 4HVIA 3ZXZA 4UWYA 1VYWA 1CDKA 2BKZA 3V01A 3G9NA 4CFNA 4F7NA 3DOGA 3WIGA 4O86A 2XA4A 3E88A 5LMBA 4K2RA 5HO7A 1KE9A 1PKDA 2Z7SA 3IONA 4KIKB 5FM3A 3E7OA 3OS3A 4QP6A 2CCIA 3QGYA 4HPUE 2JFLA 2WIPA 2RFEA 2WMXA 3SDJA 2W9FB 1Y8YA 5IQHA 3UE4A 3KXXA 4OTPA 4JG8A 3VAPA 2GS2A 4UMTA 5ANJA 3PJ8A 1M52A 4IWOA 4OLIA 4IM2A 5ACBC 4YTHA 4H1MA 2PE2A 4UMRA 1R78A 3E8CA 3CLYA 4D2VA 2VWUA 4Z3VA 3P78A 3RNYA 4PUZA 4ZSEA 1YI4A 2WOUA 2P2IA 4LRMA 3VQUA 1H00A 5HTBA 4FT0A 2CNQA 2C6LA 2XBAA 3QLGA 2R7IA 2VNYA 4XRJA 3D2KA 2ITNA 3LFFA 1OITA 3C13A 4BCOA 4DFZE 4NKSA 5AMNA 1J7IA 4AOJA 1WZYA 3FSKA 3FEGA 3GBZA 4R3RA 2CKEA 2JIVA 4KKHA 4M97A 4XG9A 2EB2A 4DF3A 4O2PA 3MFRA 3DGKA 1VR2A 5FP6A 3UMWA 3BBWA 3SAYA 3UOKA 3WF6A 4AW1A 4LI5A 3AQVA 4B4LA 4U81A 3Q52A 3QKLA 4L7FA 4WSQA 2FSTX 4F7JA 2OU7A 4GS6A 3FC2A 4YNEA 2AC3A 4NM7A 4O7ZA 3RPYA 4EOLA 2IZUA 3W8LA 4ALVA 2W96B 4YURA 2YWVA 3EN9A 4IWPA 4E6AA 5A4TA 5AM7A 3FXZA 1QPDA 4C7TA 4YR8A 5TR6A 2GHLA 2OGVA 3FLYA 4ANLA 2C3LA 4YZ9A 4PPAA 3REPA 5KKRC 3L9MA 1WBSA 4H39A 4J97A 3VW6A 1U54A 3DFAA 2X4FA 2XNGA 4KRDA 2EUFB 2C5VA 4Q5HA 5EDQA 2WEIA 2F57A 4MBLA 5EFQA 2OZAA 2P2HA 4XOYA 3F2RA 4R5YA 4UYNA 4HYIA 4JQ7A 3ZO1A 4RJ3A 3EL7A 4L46A 3W33A 4E4LA 3OWKA 3IW5A 5BMMA 3NYOA 4QMXA 4A4XA 4HYUA 3ZDIA 4A4OA 4A4LA 2SRCA 3TN8A 4EK4A 2A1AB 4DCAA 4FIFA 5AIKA 2CGWA 5JGBA 1UWHA 4KSQA 1RJBA 5T6KA 5AA8A 2YFXA 2GFCA 3AC5A 1O9UA 3P0MA 4U41A 4W9XA 5E8WA 4ZSAA 5I9XA 1JSTA 4QP8A 1ZARA 5D7AA 4L7SA 2W1EA 3ZSIA 1J1CA 4WNOA 3GU6A 2HK5A 4YBJA 3G90X 3EZRA 2E9OA 4I5CA 4L3LA 1YDRE 3FSFA 3HGKA 1P2AA 3ORPA 4XV2A 3VO3A 3HX4A 4RLKA 4IX5A 4RWJA 5CY3A 3EKNA 3VUTA 2P33A 3ORIA 4RRVA 2J0MB 3QUPA 4I41A 1R3CA 4IFCA 3O7LD 3I0OA 1GIIA 2YLEA 3RAKA 3SVVA 5EKOA 5HLPA 2RF9A 4FT7A 4K8AA 4AW2A 2Y6OA 4QMOA 5KZ0A 1OB3A 2RKUA 3H30A 3MV5A 3Q4ZA 2BRBA 5J9YA 2C5OA 4FSNA 4HNIA 5E8XA 3VS2A 4MCVA 4C3PA 3MPAA 4AW0A 3OW3A 4RIWA 5HG8A 2I7QA 3ELJA 2G2FA 4J53A 4AN9A 4ANOA 4AXAA 3PVGA 2J7TA 4FV5A 3R7IA 4FL3A 3TV7A 3VVHA 3W2OA 3IOPA 2BZJA 4FV1A 1OL7A 2EXEA 5ETAA 4IDVA 4O22A 3VS6A 4DG3E 4TWNA 4BTKA 3LFSA 4JBOA 1G3NA 5CSHA 2GHMA 4ITJA 4B0GA 2XIKA 2WKMA 3TI1A 3TNHA 2QOLA 2R3JA 4OUCA 1OL6A 4RIYB 5DN3A 1FVRA 3Q6UA 2ERZE 2HZ0A 2YJSA 4O1PA 4YUQA 2X1NA 2YDJA 4ACDA 3UPZA 5HCYA 4G31A 3G2FA 3HDNA 4FMQA 5E8YA 4BCMA 3D94A 3FMHA 3SXSA 3R8VA 2VWBA 3B8QA 1OUYA 2XB7A 4U7ZA 4X6RA 5F1ZA 2F4JA 1ND4A 3EFLA 4GT5A 4C34A 5L2TA 2W9ZB 1OIYA 4IFGA 4BTFA 3U6JA 3TM0A 3I81A 3I7CA 4MF1A 4TYHB 1KSWA 3AMBA 5CSWA 2GCDA 4BDFA 5I9WA 3BU3A 2PULA 3TV4A 4EI4A 5FXSA 4LMUA 3ZUUA 5IQEA 2PVNA 2BIYA 4XCUA 4AS0A 2R3FA 2REIA 4FV0A 5JZJA 2DWBA 4I20A 3SLSA 2BZIB 5J87A 4U3ZA 4F63A 3GU8A 3QWJA 2QOFA 3DLSA 3R22A 4KS8A 5F95A 4FKPA 3FUPA 2VWYA 2YAAA 3P7CA 4RQVA 5E8TA 4QMQA 3RAHA 2C3KA 1PXPA 3Q9ZA 5AP2A 2ZB1A 1GZOA 5EW9A 1OKYA 3E8NA 1M7NA 2NRUA 1JQHA 4G6OA 5FUTA 4MQ1A 4AZEA 1JAMA 4FIHA 4GKHA 3HMOA 3V6SA 2B1PA 3HUBA 4QMWA 4DEEA 4ZJJA 2H96A 4ZTLA 4F09A 5BUJA 5EQPA 1H27A 2WMAA 3GCUA 3LM5A 4YPDA 1LPUA 2XS0A 3U4UA 5DA3A 4LOOA 2CNUA 3R2YA 2R3GA 4HJOA 4AGDA 4NCTA 4ERWA 1GIHA 2E9VA 3LJ2A 4ARKA 4BGGA 3AGLA 3IW8A 3UZTA 3EHAA 3R7VA 3W18A 4EH6A 3OC1A 1S9IA 2HW7A 2ZV2A 3P1AA 4ZSJA 2BFYA 1XBBA 2G2HA 5HCZA 4X3FB 4EOJA 2WMRA 2C3IB 4R3PA 3QCSA 5C4KA 3LFNA 5L6OA 4ASDA 4E93A 3JVRA 2B54A 3CY3A 2HW6A 2WXVA 4FIGA 3OD6X 5L8JA 4FTJA 5DR6A 4ZS0A 3FJQE 3VWAA 3EQFA 3GUBA 2W17A 4ORKA 5M44A 4RJ6A 2QLUA 3D5WA 3NUXA 5A6NA 2VTIA 3PWYA 4OTDA 3DB8A 3OG7A 4NM0A 4EHVA 1Q3WA 4IADA 4A9RA 4N6ZA 3PA5A 1P4OA 2HY81 4IB1A 4XS2A 3S1HA 2PMLX 1APME 2CSNA 2R64A 3HUCA 3E5AA 3KCFA 2VAGA 3SOCA 4AOIA 3LIJA 4LQMA 3ZTXA 3VRZA 4MH7A 5A4LA 5HTIA 3THBA 4O21A 3L9NA 2RFDA 3FPMA 4QQCA 1KE7A 1H24A 3IGOA 3FV8A 1Q24A 3QCYA 4FNXA 2QLQA 4FTIA 4J99A 4M3QA 5H8EA 4O7TA 3BV2A 5CX9A 5FBNC 3ROYA 1GNGA 2J0IA 2GNFA 2QQ7A 3SC1A 2RIOA 4WIHA 3ZLSA 4EH7A 2XIZA 4EL9A 5GINE 4U97A 3HECA 5LVOA 3RZFA 1KWPA 3HAVA 1MQBA 2R3RA 5I5ZA 4D2TA 4IXPA 4WG3A 4BCJA 3CGOA 1E1VA 1YXUA 5DH3A 3MYGA 1V0OA 2HZ4A 4K9YA 1GY3A 5I9UA 3LMHA 4Z7GA 4DAWA 1ZMUA 1H0VA 4JIAA 4MXYA 4QP9A 4BR3A 4O1OA 3FZRA 4F08A 4EH5A 1M17A 5AV4A 4ZTRA 5M4CA 1MRVA 3WZKA 3KF4A 4QMTA 4QNAA 3O8PA 2JC6A 3Q5ZA 3Q2MA 2VX0A 4KABA 3SGCA 2XUUA 4FV6A 4FKQA 2UW7A 4AZFA 4L01A 4PMPA 2BVAA 3DKOA 1KOBA 5E9EA 1CM8A 3SKCA 2BIKB 4XP3A 2W5HA 1OMWA 3Q9WA 4GSBA 5HX6A 3IGGA 3UYSA 3C4XA 3OBGA 3WF8A 1ZOHA 2WMTA 5GJFA 2VO0A 1CSNA 3ZFYA 4H05A 4O0WA 1YHSA 4O82A 3QD0A 5BVWA 5K0XA 3GQLA 1O6YA 3MWUA 2CCHA 4DITA 3DBQA 5IF1A 1ZZ2A 4X2GA 4YU2A 3QZGA 3A2CA 5IA2A 3QYZA 4L44A 5LMKC 4RVLA 2C69A 4EH4A 2ETRA 3PJCA 3AOXA 5DEWA 4M13A 5BYLA 4FIEA 2UZBA 4J96A 4K18A 4KIPA 1SVHA 4G3FA 4QPMA 5AUZA 2JEDA 4JAJA 2R0IA 2VTMA 4GL9A 2DS1A 4IHPA 4E73A 3QRIA 4RVTA 2BUJA 3GGFA 3K5UA 3N9XA 4GU6A 1Q8WA 4D4VA 1QPEA 3QCXA 2R3OA 3JS2A 4IVDA 4KB8A 3K54A 5CXHA 3TZMA 4AOTA 3FY2A 3NMUF 3QTZA 4FKOA 3SXFA 4AFJA 3FL4A 4AWIA 2QC6A 3EZVA 2JBPA 4QTAA 2UW5A 4GRBA 2Q0NA 2OJIA 3TDVA 4PMSA 2WD1A 4G16A 4MF0A 4I0SA 5A54A 4ANMA 4F6SA 2E9UA 3NSZA 5K5NA 3ETAA 5M57A 1RDQE 3BV3A 4EOIA 3AT4A 3D5XA 3QRTA 2PUNA 4BBEA 5KMKA 2W1HA 4K11A 1DAYA 4DBNA 2OO8X 2ZYBA 2XNPA 3FLZA 4IJPA 2QHNA 4BB4A 4ACMA 4BDIA 4BDCA 2XIRA 4HNFA 1NY3A 2G2IA 4TWPA 2GS7A 3O23A 4HGEA 4U43A 4PP9A 4TZRA 4OTWA 2W06A 4ZSLA 4CCUA 3OUKA 1P4FA 1QCFA 1RQQA 1BL6A 2J4ZA 3DK6A 4PX6A 5KE0A 4I1ZA 3VJNA 5DE2A 3WZUA 3W8QA 1Y6BA 2UUEA 3CJFA 3D0EA 3QTSA 3G33A 1Y91A 2RFNA 4Y8DA 5CI7A 2OIQA 5BVDA 4KWPA 3KULB 3CCNA 3W2RA 3VHKA 3DTWA 2IW8A 5M51A 4IAKA 4BDHA 3U9CA 2QU6A 4NYEA 4DTBA 2I0VA 4H3QA 3ATSA 4FV7A 4E8AA 3CEKA 1XBCA 5FD2A 3FI8A 3PVBA 4XLIA 4N57A 1ZYCA 4MNFA 2PVYA 3D5VA 3KGAA 4UMQA 4D1XA 4EOMA 4F1OA 1YWNA 4USDA 3CC6A 3ZRMA 4MWIA 5IQDA 5CI6A 4XP0A 4NFNA 2B52A 3OEZA 2CLXA 3QQLA 3OW4A 4FTUA 5FDXA 2OJFE 4LOQA 1PRYA 3ERKA 4DEHA 1ZOGA 3D5UA 4ZXTA 3VS5A 5L6WL 1JVPP 5FQDC 5CU4A 4KA3A 3KRRA 3R8LA 3TTJA 3PIYA 4LL5A 3MA3A 2C47A 1OIQA 4EH8A 1BI7A 4ZY6A 5M56A 5HVJA 2X2LA 2OLCA 5K0KA 4C3FA 2FUMA 3HMIA 2XK3A 4O7NA 3R8ZA 3E87A 5DI1A 3OP5A 4DT8A 5EYDA 2HWPA 3MTLA 4XHKB 5M4UA 1KE6A 5DGZA 3O96A 3ZM9A 3VC4A 2A19B 2P4IA 4JR7A 1WFCA 2VTQA 2ZM1A 4QT1A 2VTAA 3I5NA 3KXNA 4IZ7A 4E4NA 3IDCA 2VTOA 4AP7A 3G0FA 5EYMA 3H0YA 3UOLA 5D10A 2EWAA 5HG7A 2WMSA 4NZWB 3FXXA 5GZ9A 3A8WA 4CZYB 5DYJA 5LMAA 5IQBA 5HG9A 3I5ZA 2EU9A 4BZNA 3ORTA 3ZMMA 4KD1A 4BC6A 3FMMA 2IN6A 3OVVA 3KMWA 2BILB 5TE0A 3VW8A 4QO9A 2CHLA 2UW4A 3L8VA 4U3YA 2RL5A 5IDNA 3HV4A 3QD3A 4GW8A 5DBXA 4CEGA 2O64A 4YLKA 2B9IA 4RWKA 3PXRA 3UC4A 4FEUA 3H10A 4PDYA 4GT4A 3UNZA 4DG0E 5E4HA 2QR8A 3I79A 4EC9A 1NVQA 4KUJA 3IS5A 2X9FA 5AA9A 2PYWA 2WGJA 3C4ZA 1F5QA 3L8PA 4H36A 4L00A 4S32A 4XRLA 5I9YA 3RNIA 3WZDA 4DGNA 1Z5MA 4YTIA 5JEBA 4EHEA 4FOBA 2ITXA 1MRYA 3LFCA 4DBXA 3KN5A 1WVWA 3RM6A 4BFMA 3SG9A 1GAGA 2O63A 1M14A 4FV8A 4M8TA 4Q2AA 4RSSA 4ZZMA 3D4QA 5L2WA 3FE3A 5HBJA 1UNGA 3KCKA 2VUWA 2XKEA 4FV3A 4I6QA 3S4QA 3UODA 3CQEA 2C0IA 3WI6A 4LGGA 2VN9A 3MY5A 4OT5A 3SRVB 3UP2A 4RX5A 4EZ3A 2XNNA 3ZLYA 3P23A 5AX3A 4O0XA 3CP9A 4J7BA 1M2RA 4W4YA 1JOWB 3UZRA 3HYHA 5EHLA 3SG8A 4ZTMA 2W5AA 5F94A 2Y9QA 2X7FA 1ZYDA 1P5EA 1I09A 4Q9SA 2YM7A 3G9LX 4KNBA 3KRLA 4C36A 4YJSA 3GCSA 5KCVA 1IA8A 2YIYA 2QO9A 2YDIA 4GIIA 3HZTA 4I0RA 4MAOA 4O0RA 3DU8A 4RC3A 4FKSA 3DQWA 5CSPA 3VS4A 2NRYA 5IA1A 5CALA 3TTIA 4F99A 4I3ZA 3EB0A 3PE1A 5EM6A 3ZEPA 2ZOQA 4S34A 5AUWA 2EVAA 1Q61A 3ULZA 3PP1A 4C4JA 1NW1A 4GEOA 5J7BA 4BWXA 5EOBA 4CG8A 4PTCA 1W98A 5HOAA 4CT1A 3R9DA 3UTOA 4IE9A 4ANSA 2YDKA 2R0UA 3EN5A 3QGWA 5FG8A 1Y8GA 4WBOA 3GC0A 5L4QA 2V5QA 4EUTA 3ZU7A 1H25A 4FTCA 2DYLA 3K3JA 3O7LB 2DUVA 4AX8A 1OL2A 3DBEA 2W05A 5CVFA 3RAWA 3VBTA 1CKJA 3Q60A 5AV3A 3FLQA 4EEVA 3P7BA 3WF9A 2BALA 5HLWA 3DDQA 4CVAA 4BRXA 3KRWA 5IQIA 4FTMA 2OZOA 5F4NA 2R9SA 3OWJA 5CZHA 5C8MA 2W1GA 4CFUA 2QD9A 1H1RA 3OT3A 4YJOA 1FMOE 2EB3A 2PE0A 1OPJA 1TKIA 1CTPE 4FL1A 4AN3A 5I0BA 4WNMA 4YP8A 3I4BA 3MIYA 4C4HA 3VULA 5L2SA 2YM6A 2F2UA 2PUIA 4RPVA 2B4SB 3OCTA 3ZUTA 1Y6AA 4HZRA 1REKA 4KIQA 4ZSGA 3BLHA 5B0XA 5HBEA 3QUEA 4APPA 4AT5A 1JLUE 4EZ7A 5CEMA 4ZIMA 3EFWA 2QG7A 4I92A 4ONAA 3TUDA 2R2PA 1IEPA 2R3IA 4E20A 2J0KA 3OROA 3T9IA 3LCKA 3HV3A 3LJ0A 3QXPA 3QA8A 4M69A 3K5VA 5GJDA 3U51A 3GU7A 1V1KA 2QNJA 4M66A 5IH5A 1ZY4A 5A4QA 4D55A 2C5XA 1XH6A 1IG1A 3R6XA 5BQ0A 1MRUA 3SD0A 2YACA 4RLLA 4HCUA 1HCLA 5EM7A 3UQGA 2QKRA 2ERKA 1URCA 5M4IA 5FP5A 2BKKA 3LCDA 3BYMA 5CASA 4LGHA 5IEXA 4MXZA 3VS0A 5AAGA 2PVFA 3F2AA 1OKWA 3FMKA 4LUDA 4EYMA 4DFUA 4ASZA 5JGAA 2IW6A 1T45A 4FNWA 4MXXA 4IIRA 3W55A 4YJVA 5K3YA 5HU3A 4L67A 2IPXA 3LQ8A 4QRCA 5CEOA 3IDBA 4FEXA 3O2MA 4FE2A 4WT6A 2CMWA 3F9NA 4QNYA 2WMBA 4ZAUA 5KO1A 3F5UA 5DG5A 4OTRA 4PY1A 2VTLA 3QC9A 3KU2A 3DFCB 4NT4A 2R3MA 4YLJA 3HV5A 2WOTA 4B99A 2CKPA 5GIPE 3GOPA 4BI0A 4JXFA 3E3PA 4EOKA 3A4OX 3E63A 2CGUA 2JIUA 1E1XA 4FC0A 3PFQA 3ZFXA 3NW5A 2ONLC 1NXKA 4RA5A 4W4VA 1PMEA 5CZIA 5AR7A 3R7OA 3RK9A 4A9SA 4EHZA 1DI8A 3R21A 4PNIA 2JDRA 4J52A 2BAQA 4X3FA 3R7UA 4F9YA 4FICA 5CSVA 4ZZOA 4MD8E 3AT3A 5IZFA 1IAHA 5KZIA 3BEAA 2J6MA 4II5A 2EXCX 3HVCA 4MHAA 3MFUA 3ZS5A 4EHGA 4RJ5A 1OKZA 2I0HA 4O6EA 2WTIA 3EIDA 3GU4A 2WTJA 3QTWA 1Z57A 5LVPA 2ZDUA 4IAIA 2C6IA 2R3LA 4BCPA 4C2VA 3OHTA 1DI9A 5EI2A 5J8IA 4CTCA 3CS9A 3BYOA 4BL1A 3DY7A 4NIFA 5GHVA 5M07A 2PL0A 4M15A 4OBPA 4GJ3A 3RPOA 2WELA 5CENA 3P79A 2PUPA 3EFJA 3EJ1A 3F5XA 1HOWA 1I44A 2BDJA 3KXHA 2PTKA 3VUHA 5KKRB 1TVOA 4FR4A 4AUAA 5A9UA 2UZNA 4OT6A 3OF0A 4DH8A 3VUGA 2ITTA 3SHEA 3DCVA 1LR4A 1ZAOA 5E1EA 3F3UA 4FNZA 3FZPA 3MN3A 5HCXA 4FSYA 4U5JA 2OJ9A 3COMA 2GNHA 2WNTA 3KK8A 3M42A 2J50A 2E9PA 4GG5A 2CGVA 1H07A 4AA0A 4CD0A 3U6HA 4X0MA 4IQ6A 3KN6A 4GFOA 4MX9A 4IAAA 4O0YA 4RX7A 1PW2A 2C68A 2JGZA 4PDPA 4W8EA 3PSCA 5IA5A 4ENYA 2WEVA 5TOZA 4EOSA 4MD7E 2C6MA 3R2BA 4RJ7A 4X6QC 2WQNA 3RI1A 4FUXA 3UYTA 1ZYLA 3BHHA 3AD5A 3ENMA 3FAAA 3L1SA 3P7AA 3VBXA 3I6UA 5K4IA 4C4FA 1LEWA 2PMIA 4CZUA 3QX4A 3NUNA 4M7IA 5AR5A 4IB5A 4FEVA 2VZ6A 2OF2A 3IOKA 3E92A 4UXQA 5EH0A 3CTHA 4LYNA 2C0OA 1YDSE 2QOKA 4N70A 3NUAA 5I9VA 3AT2A 1U5RA 2J51A 3AC3A 5J1WA 2PVKA 4CXAA 3NZ0A 1OZ1A 3P08A 3UVRA 4EQCA 4O81A 4JG7A 4D2RA 5KBRA 3SA0A 2X8EA 5C27A 2WTKC 2BAJA 5IEVA 4CFFA 4HPTE 3VS3A 2OW3A 5AP5A 4UALA 1V0BA 4QMVA 5DLSA 3ZBFA 3PIZA 4DINA 4F9AA 1OGUA 4BICA 4L9IA 3EQBA 4HVGA 5EM5A 4ENXA 2PU8A 1S9JA 4A7CA 4R5SA 1UA2A 2YM5A 4P7EA 1H4LA 1CKPA 4C57A 1W82A 3DPKA 1Q8TA 3AMYA 2OICA 3BE9A 3GEQA 5D12A 1PMNA 2PZRA 4FG7A 4L53A 2PVJA 4AN2A 4D5KA 3R71A 5BPYA 3FQSA 4BF2A 1B38A 3VRYA 3QHWA 3WZJA 4MEDA 5EDRA 4BKYA 4FTTA 3TXOA 4DYMA 3QZHA 3EH9A 2V0DA 2OKRA 3HV7A 4O38A 1UV5A 5E91A 2X0GA 4HVHA 3R73A 2VO3A 3A99A 2QG5A 5AR3A 3OTVA 4J8NA 4CNHA 5EDPA 3FC1X 2J90A 5CTPA 3U6IA 5FDPA 2PPQA 3GCPA 1PHKA 3NVKI 2O8YA 4X2NA 3V3VA 1YOLA 1OKVA 1WVXA 3I6WA 3IECA 1OI9A 2G15A 3AGMA 2ACXA 3H0ZA 4KINA 4YZCA 4YSJA 3AD6A 5JQ5A 4GK4A 2VTPA 3OTUA 3PTGA 2GNLA 2WMQA 2QOCA 5CANA 3MTFA 2NP8A 4HGSA 2ZMDA 3UO4A 3A8XA 4NWMA 1XKKA 3MB6A 2UVZA 3ZZEA 3RCDA 3BGQA 3IG7A 3UPXA 1YKRA 3KMMA 4M84A 4R78A 5HVYA 1WBOA 3FWQA 2FA2A 3G5DA 3MS9A 4XG6A 2GNIA 2QOIA 3KULA 5ICPA 5DVRA 4Y5HA 4Z9LA 3MVJA 1IRKA 1L8TA 4QMZA 1UU8A 4HYHA 3OT8A 4AFEA 3MGYA 3ODZX 4S30A 5GJGA 4BTMA 3FYJX 4YZNA 1FINA 5HESA 2H6DA 3FKLA 4IX4A 4H3PA 5LXMA 3NPCA 5FBOA 3ATTA 4BZOA 1AQ1A 3FI3A 3QD2B 2UZOA 5IG1A 5LARA 3QRUA 3JXWA 2YM4A 4TYIA 3P86A 5C1QB 3GU5A 3R9RA 4M12A 4FVRA 4GUBA 4F9BA 4CMTA 1EH4A 5ITAA 1WAKA 4DTAA 4P5QA 5HKMA 5KHXA 1PXNA 2OH0E 3RGFA 4BKJA 4XV1A 4YJNA 4RG0A 2FSMX 3U87A 3S95A 3VIDA 3AC8A 4ANQA 4DN5A 1PJKA 2F7ZE 2XJ2A 3DNDA 2W4JA 4RJ8A 5EQYA 2PE1A 2ZVAA 5AP0A 4FUYA 3MVLA 3D7TA 1UU7A 3OZ6A 2PZYA 4X3JA 3W2QA 2GS6A 3UJGA 3HNGA 2JFMA 2XMYA 4P90A 3Q9XA 3ZLXA 3PY3A 4ERKA 1UVRA 5D7VA 4BVUA 5KUPA 4QYHA 2W4OA 4Y72A 3PA4A 4DEIA 3RJCA 2FH9A 3C5IA 5G6VA 1Q4LA 4BHNA 1ZY5A 2J9MA 4EKLA 4EUUA 4IM0A 4CKIA 2JDSA 5CEPA 4G5JA 1ZMVA 1H1WA 1GJOA 5CU2A 2RG5A 3L8SA 2WAJA 4FL2A 5AIRA 5EK7A 3S2PA 4E1ZA 2ETKA 2VGOA 3HRBA 3PSBA 2XIXA 2OXYA 4BDDA 3RPRA 5EQEA 4CCBA 3PJ2A 5JQ8A 4W4WA 4E6CA 3LJ1A 4ACGA 4CSVA 2AYPA 4CG9A 2FSOX 4LV8A 4UEUA 4M0ZA 4CV8A 1Q8UA 4WG4A 4LV5A 4EOOA 3O8UA 3R1YA 4EZ5A 4QP4A 1R1WA 4XJ0A 5EW8A 1OL1A 2VTNA 2XM8A 2HWOA 4FZFB 3BLQA 3DK7A 5EOLA 3TACA 4DH5A 2VGPA 3PDTA 5FGKA 4FK6A 3T3VA 3NNUA 3W10A 3NYVA 3FLSA 4NJ3A 2YIQA 3C7QA 3PJ1A 2PWLA 4ZP5A 3UNKA 4DFBA 4YJQA 3TEIA 4E5BA 5BVEA 1FPUA 3UQCA 3FMNA 2OFUA 3MBLA 2C6TA 3V5QA 3EOCA 1JBPE 4PL4A 4V04A 3CPCA 4BCGA 3C51A 3SRVA 4CV9A 1OUKA 5DOSA 1ZLTA 4YPSA 4IB0A 4O83A 2WU6A 3R30A 4UYAA 2BRGA 5ANOA 4CFVA 3ZRKA 4K6ZA 5BUIA 4Y46A 3VS1A 1JKTA 2ITZA 5HE1A 2UV2A 3WZEA 4L45A 5A46A 4FVQA 4FSRA 3RMFA 2UZDA 3E3BX 3WF7A 5DFPA 3UNJA 2B9FA 2P3GX 2C6KA 3G6GA 4PV0A 4TYJA 5BVKA 4DEBA 1PMVA 4NW6A 4GFMA 2WU7A 4IJ9A 2WTCA 5L8LA 4RX9A 5J1VA 2BAKA 2DQ7X 3GENA 3ORKA 3NCZA 4W8DA 4F0FA 4MNEB 2XYUA 1JPAA 2XKCA 4NTTA 3KF7A 3LM0A 1SVGA 3B2WA 2B9JA 2PZ5A 4GJ2A 1B39A 1YHWA 4QTBA 2CN5A 5TT7A 5EHYA 1VJYA 5AUVA 3N4UA 2R7BA 5HNGA 1H1PA 1VEBA 1YXVA 4UV0A 4F7SA 4JDJA 5CWZA 5T3QA 3MFSA 4OTQA 2RG6A 3OXZA 5IA3A 2O3PA 4IC7A 4NK9A 5DMZA 4DH7A 2HAKA 2G9XA 2XJ1A 3R1QA 4RFZA 1IAJA 2HCKA 2Q0BA 3V8SA 3UO6A 4EH9A 3GC7A 4R1VA 5C9CA 1VZOA 3QWKA 3FBVA 4G3DA 1JKSA 1Q8YA 2WQBA 2ZAZA 4WOVA 4F70A 4PPBA 1GIJA 2XYNA 2ITWA 4CT2A 4EH3A 5AV2A 5JZNA 3UO5A 3C4EA 2JKKA 4C8BA 4DC2A 2QR7A 4ZLZA 4O7RA 3FMJA 3NX8A 3T9TA 4E5WA 2XP2A 4IM3A 4V0GB 1OM1A 3H9RA 3ULIA 4DFLA 1IASA 4BCNA 3FHIA 1YOMA 3U8WA 4ZY5A 1ZOEA 3RKBA 4DCEA 3A7JA 5A6OA 4JX3A 5IPJA 2W4KA 3W16A 3OEFX 3ROCA 3C0IA 4EORA 1NVRA 5IMXA 3DXPA 2XVDA 3BELA 4MBIA 3V6RA 4O7SA 4BZDA 5IUIA 1G5SA 4PQNA 4R8QA 4QMNA 3BHTA 4KAOA 4FT3A 2B0QA 3JY0A 4MXCA 4C0TA 4WBBB 3KXMA 5HLNA 1WBTA 2P55A 4N6YA 4IZ5A 5DR9A 4ACCA 4FKVA 4C38A 5C8NA 5E1SA 5H3QA 2R3QA 2HYYA 1RE8A 2W1ZA 3M1SA 2ITVA 4DEDA 2B7AA 3MSSA 3LW0A 4FIIA 3KXZA 5H8BA 5CAPA 4UZHA 5DHJA 1Y57A 1OBDA 4O7WA 1Q97A 4FSMA 2OBJA 3QX2A 4WRSA 5IUHA 3IPHA 2WHBA 3DAEA 3MIAA 3WF5A 4YJUA 5L2QA 5CAOA 3ZHPC 4RVKA 3F61A 4U0IA 1W84A 4EQUA 3LCOA 4IWQA 4XOZA 2ZV7A 2PVLA 1REJA 3R1NA 1H8FA 2W1IA 3GP0A 4DTKA 4FKRA 4MD9E 2XNOA 5FXQA 2VTRA 3OWLA 4M0YA 4FTQA 1XH9A 3MFTA 1Z9XA 4QP2A 3R9NA 2GQRA 4OBQA 4BWPA 4TW9A 2IVSA 1NT2A 5LWNA 1YXSA 3BGPA 3AC2A 3EN4A 4TY1A 3HLLA 5AR8A 4QTEA 3BKBA 3COHA 5LCKA 4QPSA 4IVBA 3SW4A 1JNKA 2W0JA 4Z55A 1F0QA 4M67A 4O27B 4OR5A 4GKIA 4IX6A 5IISA 3DXQA 2BDWA 3MH3A 4RT7A 5DWRA 3DJ7A 5EI8A 3ODYX 5FXRA 3TNIA 4FODA 5KMMA 4USFA 3LPBA 4FV2A 3C4FA 4JQEA 4XX9A 3KREA 4KIKA 1BX6A 3ET7A 3MI9A 4OBOA 4UMPA 4GV1A 3NRMA 4OTGA 5BYZA 3L9LA 3H4JA 3NS9A 3NYNA 1U4DA 3G6HA 3R8MA 3NIZA 3M2WA 1XQZA 4EQMA 1YI3A 3AD4A 4D2SA 4A9TA 2FO0A 1YQJA 2VX3A 3BCEA 5ANGA 3D2IA 5E8UA 2JDOA 4X21A 3NNVA 4JIKA 2X6EA 4AW5A 2R3PA 4QP3A 2F9GA 4U45A 5E90A 2JAVA 1PYEA 1UNLA 4JT3A 4U40A 1FVTA 4IWDA 1GOLA 3DAKA 3QUDA 4B7TA 3DAJA 4OGRA 2WQOA 2JDTA 4NH1A 5EHOA 4PL5A 1BYGA 4G5PA 4DE4A 3CD3A 5CXZA 3ZO2A 4LMNA 2J0JA 1L3RE 4KRCA 2VWXA 5AR4A 2Q83A 4O0SA 3DBFA 3NAXA 4F1MA 3RPSA 1HCKA 4WD5A 2OJJA 2R4BA 4FZ6A 3BRBA 4L3PA 4WO5A 5HIDA 1SM2A 4AQCA 3TUCA 4RC4A 5L3AA 4RQKA 3D7ZA 2IJMA 4RFYA 4LG4A 5A3XA 2X2KA 4RIXB 1J91A 4FTRA 3ORZA 3OFMA 3OUNB 2YWPA 3DBCA 4S33A 4PF4A 4F7LA 5IH6A 3TZ9A 4XG4A 5HNBA 2I40A 5CEQA 3LZBA 1YDTE 5IUGA 3TZ8A 3KB7A 3BYUA 4AA5A 5M09A 4FBXA 1H1QA 5HHWA 3ZH8A 3FMDA 3Q32A 5CF8A 5M06A 4BIBA 5L2IA 2WMWA 5KHWA 2BTSA 2XBJA 1BUHA 1LUFA 1OPLA 3EKKA 2ZDTA 3C1XA 4BHZA 5CF5A 4B8LA 5J5TA 2XZSA 3F69A 4FSTA 4PPCA 3CQUA 3D9VA 1JKKA 1YVJA 5DRBA 4EKKA 2VU3A 3LCTA 4X7QA 3TKHA 3QZFA 4FKJA 4GT3A 3WBLA 2FVDA 5JFVA 5J7HA 3R63A 4E26A 3UG2A 3LLAA 2GQSA 3O17A 1J1BA 3RZBA 3CQWA 4RX8A 1J7UA 4G3CA 3EQHA 3VF8A 2W5BA 5HEZA 3UZPA 3NAYA 3CJGA 3PUPA 4O6LA 3FZTA 3MPMA 3BHUA 2C3JA 4BDGA 4BCKA 2QOHA 4UXLA 2JIIA 4TYEA 3A7GA 4H3BA 2VNWA 2HXLA 2NO3A 4YC8A 5I3RA 5IA0A 4K0YA 2I0EA 4IDTA 3RTPA 5DEYA 2E9NA 2XRUA 4JDIA 4JBQA 2X81A 4Y73A 4Z7HA 3RVGA 4P4CA 4TXCA 3UVPA 1UU3A 3TIYA 4FTAA 2CKOA 3EQPA 4APCA 1SVEA 2BPMA 3F2NA 3I1AA 5HI2A 2WQEA 5HICA 4PP7A 2ZM4A 2GU8A 3KQ7A 5HZNA 2Y6MA 2VD5A 3ZOSA 4U8ZA 2GDOA 2HOGA 4BGQA 4XP2A 4F4PA 2OXXA 3G51A 1AD5A 3RP9A 3NW7A 3QTIA 3S0OA 5AUXA 3EN7A 4IZAA 4R1YA 5AP4A 4ALUA 4HGTA 3QQHA 4K77A 4NEUA 3VUMA 5CT0A 3RK7A 4MXAA 3DBDA 1WMKA 2PHKA 3V51A 3RK5A 2ITOA 5A14A 4J1RA 4AG8A 3A60A 4AZTA 2UZEA 3A61A 3UIUA 3BU5A 5JRQA 2R5TA 2I1MA 4IX3A 4DGGA 1ZRZA 1MP8A 4G6NA 1QMZA 2XNMA 4E6DA 3LKMA 3Q2JA 2F49A 4FV4A 5G1XA 4FSWA 4ASEA 4LL0A 4NCTC 2GNJA 4RIYA 2BDFA 5JH6A 4FZDB 3VQHA 3R7YA 4UMUA 3FMEA 5HE3A 2JLDA 5ANEA 4TT7A 5DNRA 5DIAA 3ZDUA 4QOXA 2JAMA 3MH1A 4C3RA 3TNPC 2YCQA 5KX8A 4TYHA 3U4WA 5HQ0A 4DH3A 4EC8A 3VS7A 5J79A 4MKCA 4IEBA 1IR3A 4IB3A 5HE0A 3C4WA 3PSDA 2XJ0A 2VWIA 2RSVA 3MJ1A 4IZYA 4RWIA 2VV9A 3PRFA 3HMNA 5HORA 2B53A 1JSVA 5AV1A 3PVUA 4HYSA 2NNWB 3QKKA 4XG8A 4AGWA 2OG8A 3PXQA 1KV2A 3FZSA 2YCFA 5H2UA 5IQFA 3QTQA 3T8OA 4DEGA 1PXKA 5K5XA 3ZO3A 3BBTB 3O71A 5E8VA 4ZTSA 4QP7A 2C1BA 2OF4A 1LEZA 2XCKA 3QRKA 2CDZA 4FF8A 4MWHA 3RAIA 3U9NA 3VJOA 5AFVA 2YITA 3FL5A 3OMVA 1TQMA 4DGMA 4JX7A 3MDYA 3HAMA 3IW4A 5I9ZA 2B55A 4JBPA 4FT9A 1BLXA 1XHAA 2QI8A 4L3JA 4PL3A 1XJDA 3BX5A 3HL7A 3IDPA 3TKIA 2UW6A 3A7FA 4F0GA 3QQUA 3ORMA 3L8XA 5FTOA 3PIXA 3Q5IA 3QYWA 3N4VA 2YISA 5J9ZA 1XWSA 4C58A 4D5HA 2IZRA 3ID6C 5IH4A 5BVOA 5JFSA 3UOJA 3FY0A 2PSQA 4ZTHA 4GVJA 4JBVA 1XO2B 2PVHA 5AP6A 3PYYA 2R3KA 2JITA 5HE2A 2GNGA 4KS7A 4RIOA 2C5NA 5AUTA 5B2MA 1URWA 1PXIA 2WZJA 3KA0A 3NWWA 5CVHA 4MTAA 3C9WA 1BMKA 1FGKA 4QQ5A 3OCSA 2W1DA 4DH1A 5M53A 2OWBA 2YN8A 4WUNA 4QYYA 5CAVA 2A4LA 2IVTA 3TV6A 3BHYA 3W2SA 3RWQA 3SV0A 3CTJA 4JLCA 3C5UA 4UZDA 4FTOA 3DT1A 3DLZA 5HD4A 2V62A 2UZUE 3MH0A 5I3OA 4GK2A 3KKVA 2XIYA 5AV0A 3BQCA 3JY9A 2PK9A 3MW1A 4FOCA 4AZVA 3D15A 3QHRA 3LE6A 5KMJA 4B9DA 3R04A 1V0PA 4I94A 4LUEA 4WKQA 4JDHA 5EYCA 3P5KA 3QAME 5DR2A 3CTQA 2YIWA 3GQIA 3TIZA 4F0IA 3GNIB 5T68A 3ANRA 4I0TA 4EJNA 5DPVA 2XK8A 2HZIA 3BIZA 3PG1A 3QALE 4TN6A 3T3UA 4C59A 4GVAA 4KKGA 2ITUA 1XH5A 5HIEA 3SW7A 5FTGA 3GI3A 1YRPA 4I4FA 4YTCA 3MH2A 3P9JA 4RMZA 4JR3A 1UKHA 3BQRA 1M2PA 4QMPA 1BKXA 2HXQA 2V7OA 5LMKA 4MNEA 4D9TA 4KBKA 4P2KA 5B2KA 2C6OA 5DRDA 1AGWA 2KULA 4YBKA 2GSFA 4E4XA 3MY1A 4FVPA 2A2AA 3DXNA 5IQGA 3K3IA 3QC4A 3QLFA 3IKAA 2PY3A 4L6QA 4TWCA 3JR1A 4C4GA 5F9EA 1R0EA 1CMKE 4EOPA 3ORNA 4YO4A 1FGIA 4ANBA 3CIKA 3QZIA 5TF9A 3POOA 4HCVA 5LOHA 2VTHA 4UBAA 3WARA 2F7XE 3KRJA 3ALNA 2UZVA 5DT3A 1OPKA 2G01A 2WMUA 4G34A 2Y4IC 4EJ7A 2NPQA 3CE3A 4A06A 3KK9A 2QO2A 3PRIA 4G2FA 3QCQA 4BIDA 4ZLOA 3LFQA 2Z7QA 5HNIX 3MB7A 3JPVA 1YW2A 3BHVA 2YAKA 4MXOA 2HENA 3AMAA 1OIRA 4V0GA 3BLRA 5ETFA 2UW8A 4PWNA 3O50A 4AZWA 1F3MC 4HVSA 4IH8A 1YHVA 1XH7A 1FQ1B 4GU9A 1ZYSA 4A9YA 3BWFA 3BWJA 3UVQA 5BVNA 3AC4A 2FSLX 3IK3A 4BDJA 4DGLC 3I60A 3OCGA 5EG3A 3MVMA 4AGCA 3C4CA 4D1SA 5AP3A 4AU8A 3PXZA 5IU2A 2GTMA 3TKUA 4LGDA 1QPJA 5F20A 3PLAE 4R7BA 1H01A 4NFMA 5HX8A 2ZV8A 1PXMA 2AC5A 5D11A 4AGUA 4D0XA 1KUTA 1FVVA 3F6XA 5BNJA 2Z7RA 3HEGA 2C1AA 3W2CA 4BI2A 4XEYA 5KMOA 2BZHB 2CNVA 3R8PA 4FG8A 4K33A 3CGFA 3ZC6A 2WQMA 3G15A 1DS5A 3NCGA 3E64A 4J98A 2YM3A 2ZM3A 2C6DA 3CPBA 3KFAA 4RBLA 5EM8A 5JT2A 4R7IA 1H28A 4JG6A 1PF8A 3R28A 4YHFA 3NEWA 2PUUA 4L42A 4NKAA 3HKOA 2B9HA 4FZAB 5CYIA 4C2WA 3Q4CA 3FI2A 4RA4A 4FZ7A 3NIEA 2BHHA 3PY0A 4YO6A 3C0HA 5E7RA 1OVEA 4WRGA 3FLNC 3WOWA 3N4TA 3TJCA 4V01A 3DJ6A 3ZFMA 3F3WA 4BDEA 5I4NA 1YXXA 4WHZA 3UP7A 3TUBA 4TL0A 3BPRA 3OXIA 2IVVA 2VTTA 3KVXA 4O96A 4NM5A 2PVMA 5HO8A 4O0VA 5D1JA 4QPAA 2LAVA 2WMVA 5ANKA 5AWMA 3LCSA 5GNKA 3F5GA 2GMXA 4I6FA 5J95A 2WB8A 4PNKA 3LXLA 3WIKA 5E8ZA 4RFMA 4YLLA 3TJDA 2C5YA 3WYYA 4AT4A 4F64A 2IG7A 3HMMA 4W9WA 3JUHA 5FTQA 4EK8A 4F1TA 3V8WA 2YERA 4AZSA 2H9VA 4Q5EA 2HY0A 4YNOA 4DGOA 4BTJA 2PMNX 4EBVA 4FA2A 5E8SA 2IVUA 4ACHA 2OIBA 3NYXA 3R7EA 2V22A 4C02A 3NW6A 3TNQB 4BDBA 2XK4A 3EL8A 4JAIA 5JK3A 2BRMA 4BCIA 5GZ8A 4FKUA 4JRNA 3F7ZA 4ITHA 4QQTA 2ZMCA 4UX9A 4FKIA 4CQEA 2O5KA 3F3TA 3M11A 2GPHA 3DTCA 5D9HA 1K3AA 3OBJA 1GZKA 4KSPA 4FSQA 3VNTA 4RJ4A 1G8AA 3R00A 4G9RA 3R1SA 3CXWA 1X8BA 2JD5A 4EYJA 2QURA 3ZRLA 3HDMA 2FB8A 2XRWA 4LOPA 4MBJA 3PA3A 3FKOA 3EYHA 3CD8A 4K1BA 3TDWA 1WBWA 1FMKA 4C61A 4BYIA 4CLIA 1UWJA 3W1FA 1ZWSA 3LXNA 2X8DA 4FK3A 4NL0A 4CFWA 2XCHA 4JL9A 3SOAA 4HGLA 2WTDA 3ORLA 2R3HA 3HV6A 4KBCA 5HU9A 5LWMA 3FKNA 2IZTA 3QQGA 4FV9A 4XNEA 3MJ2A 3LQ3A 1A06A 5CF6A 2JKQA 2QOBA 3LFDA 2X7OA 1SYKA 3CY2A 4ZJIA 4TYGA 4ASXA 3AG9A 4Y83A 4FGBA 4BKZA 2ZJWA 4O0UA 3KY2A 4D58A 3QA0A 3LLTA 4EK6A 5BX0A 3DA6A 3QTRA 4EH2A 4G17A 5BMSA 4M69B 4JJRA 2YZLA 3ZM4A 3ZONA 5FEEA 5JRSA 4C62A 4RIXA 4O2ZA 4UWBA 1PXLA 2R3NA 5M08A 4XBRA 4CYJA 4KKEA 4D2WA 4OTIA 3EQIA 4GH2A 1K9AA 3V5WA 1U59A 4L43A 1SNXA 5ANDA 1K2PA 2BFXA 2OIDA 1NVSA 2P0CA 4L8MA 2J2IB 3UIXA 5GIOE 4I22A 4G3GA 2X8IA 3FZ1A 3ZCLA 1OIUA 2VO7A 4F6UA 3MVHA 3NUSA 5CU0A 3ZYAA 4DEAA 5A4CA 3BYVA 3HA8A 4WNKA 2G1TA 2ZB0A 3Q04A 3QFVA 4IAYA 3TZ7A 3NGAA 2JBOA 3PY1A 1B6CB 2Y0AA 3QXOA 4ZLYA 3OOGA 4HCTA 4HOKA 3FLWA 4S31A 4HVDA 2JDVA 1OL5A 4BBMA 3VUKA 5ETIA 5M4FA 2OFVA 4ANNA 4I5PA 5EYKA 4QQJA 4Y85A 2V55A 5AAFA 3SXRA 4AE6A 4F9WA 3EMGA 5AM6A 3U55A 1YWRA 3WYXA 1OECA 4RZVA 1DAWA 5JFWA 2X9EA 1ATPE 4CKJA 2FGIA 4TRLA 2QCSA 3EQRA 1H26A 2YHVA 3ACKA 2A27A 2HELA 3KC3A 1MQ4A 3Q96A 4UWCA 4XH6A 1R0PA 4WG5A 4FKLA 2CKQA 2YIRA 3DS6A 1PXOA 3S3IA 4ZOGA 4FI1A 4IACA 4HW7A 4Q9ZA 2CGXA 4FYOA 4D4SA 3GB2A 5AP7A 5BUEA 3V5LA 2YA9A 1UU9A 2O65A 3TNWA 3LOKA 3R9HA 4EBWA 1CKIA 3PVWA 3UMXA 1W83A 2I0YA 3NUYA 5FRIA 4OAVB 1IA9A 5CQUA 4O7LA 2ITYA 5C8KA 4JVGA 5LQFA 1FBNA 5CAUA 3RM7A 4QMMA 2YEXA 2CPKE 4MK0A 4F65A 4NIFB 4YC6A 3PG3A 4NW5A 4YJTA 5AUYA 4BDKA 4ZJVA 2AUHA 4I93A 3Q53A 3VUDA 2J5EA 3A62A 3TWJA 2X6DA 3HMPA 5AUUA 1GZ8A 5JFXA 3JYAA 2UVYA 5EW3A 4QMYA 5KBQA 5CVGA 3COKA 4FTKA 4YJRA 3E93A 5HIBA 3QF9A 4GIHA 5CS6A 2LGCA 2QO7A 4L52A 4PDSA 1YOJA 3F88A 4J95A 3CKWA 2QKWB 2QOOA 4QP1A 2BR1A 2IO6A 3BI6A 3EQGA 4FT5A 1JKLA 3C0GA 2HZNA 4WNPA 2XM9A 3L9PA 5KNJA 3O51A 5DT0A 3DJ5A 3NUPA 2E2BA 4NUSA 4XUFA 3UIMA 3ANQA 3KVWA 3R01A 4IVAA 4YHJA 4GFGA 4D4YA 5JSMA 2ONLA 4EK5A 2VWVA 3RPVA 4X3FC 4Y5QA 5CEIA 3NNXA 2JKMA 1R39A 3F3VA 3GXLA 2GHGA 1ZMWA 4PTEA 2I6LA 3D14A 5FEDA 4BY9E 4AF3A 1WBNA 3POZA 2XF0A 4X2KA 2O2UA 4KIOA 3B2TA 5KMLA 1PMUA 1WCCA 4JQ8A 3WE8A 4AE9A 4UB7A 4ZZNA 3KEXA 4I6BA 2XEYA 4ZY4A 5CF4A 2PZIA 3ZO4A 1SNUA 1UKIA 3F7WA 3QKMA 4OW8A 4BGHA 4AAAA 2UZWE 3PE2A 3VF9A 5C01A 3UG1A 4YZBA 2XKFA 5IA4A 1ZXEA 2YABA 3RINA 5CQWA 1G8SA 4IVCA 2Z7LA 4R77A 4P5ZA 5DT4A 2VWZA 3F66A 3EYGA 5H8GA 1T46A 1Q62A 3A7HA 2Z2WA 1ERKA 1QL6A 3OOMA 4N0SA 3RHXA 1U54B 1JWHA 3ITZA 5TKDA 4JS8A 4RVMA 3V8TA 4BN1A 3LMIA 3I0QA 4QTCA 2OZAB 5EI6A 2ESMA 2UW9A 4D2PA 3EQCA 1O6KA 4G9CA 3DZOA 3IQ7A 4YGAA 3MESA 1W7HA 4PRJA 3U54A 1WBVA 3ACJA 2GTNA 4A9UA 2VRXA 1BI8A 4O84A 3DB6A 3EQDA 2C6EA 5A4EA 3QD4A 4TNBA 1YWVA 4ZS4A 3R7GA 2J5FA 5CU6A 5AX9A 5AADA 4XV3A 3ZBXA 3HP2A 4C37A 5IEYA 2XKDA 3OY1A 4EOQA 5HGIA 3R0TA 5C26A 3NVMB 1GZNA 1M7QA 5LCJA 3VBVA 3NNWA 4R7HA 3N51A 3FPQA 4GK3A 4DLJA 4KBAA 1OBGA 2QHMA 4D1ZA 4UN0C 3LQ5A 3RWPA 5IQAA 4DFXE 5HG5A 3COIA 3MA6A 4YJPA 4DLIA 1YXTA 1Q8ZA 5B7VA 2A0CX 4G3EA 3FDNA 3GC8A 3Q6WA 4U44A 5CU3A 3TCPA 3IO7A 4ZTQA 5LVMA 2PZPA 5HBHA 3H3CA 1XH4A 4YTFA 4TNDA 4NSTA 5M55A 5AEPA 5HO6A 5CEKA 3QTXA 4RIWB 4MQ2A 4BIEA 2ITPA 4HZSA 2VTJA 3V5JA 4O91A 3F5PA 4BDAA 2Y4PA 4QTDA 2EXMA 4JRVA 2Z60A 2GQGA 1U46A 4FX3A 5HD7A 2CN8A 2WTWA 3DK3A 4LFIA 3TT0A 2RFSA 1H0WA 1QPCA 2YLFA 3DDPA 3TL8A 3GFWA 4WA9A 5B2LA 2F7EE 1SZMA 3O0GA 1VYZA 3QL8A 2XK7A 4BBFA 2VX1A 2WO6A 4MYGA 2W1CA 1J3HA 2Y8OA 3LXPA 3CR0A 2BZKB 4G1WA 4I5HA 4Y95A 1PKGA 4FSZA 2XH5A 4PDOA 3E8DA 3MY0A 3F82A 3PJ3A 1SMHA 2YIXA 3OWPA 3BGZA 3KXGA 1Q99A 4U42A 2OK1A 3FI4A 4I24A 3II5A 3QQJA 5C03A 2OJGA 5IKWA 3D83A 4N4SA 4NJDA 4M14A 2UVXA 5JKGA 3ZC5A 3W32A 3KL8A 4JOAA 4S2ZA 1YI6A 4BCQA 4PMTA 4F6WA 5LJJA 3FMLA 4B8MA 3EWHA 5J5SA 2JKOA 4CKRA 2YJRA 2YZAA 1H1SA 3JVSA 5IQCA 3S00A 2KTYA 4IBMA 4GYGA 3A7IA 4X2JA 4JNWA 2FYSA 4I5MA 2GFSA 5AAEA 4FKWA 5JGDA 3D7TB 4CQGA 5FM2A 2V7AA 3UOHA 3H9FA 5TO8A 3R8UA 2BTRA 3Q3BA 4ID7A 4V05A 3BZ3A 3ORXA 5H9BA 3RBWA 2QVSE 3NR9A 4B6LA 4USEA 3MPTA 4DT9A 2ZV9A 4C4IA 3ZSHA 3FQEA 1A48A 1XBAA 2Y7JA 3ENHA 3LFBA 4E3CA 4Z16A 1A9UA 2BHEA 2W99B 4TKSA 3AXWA 2Z8CA 3RHKA 2J0LA 4XMOA 2XNBA 1J7LA 3K2LA 5L6PA 4H1JA 5BVFA 1LP4A 4TTHB 4U6RA 4FTLA 4U9AA 3PXYA 3GCVA 3HRCA 3Q9YA 3P4KA 4C35A 3EN6A 5FWKK 3GT8A 3QRJA 3VBYA 3VUIA 4D4RA 2QODA 4ZMEA 2X4ZA 2C0TA 4U80A 3IW7A 3R02A 4IW0A 4XBUA 3ZSGA 4CGAA 4DHFA 3DZQA 2WPAA 2CLQA 4BYJA 1XH8A 4RGJA 3V5TA 2QONA 2WIHA 3BYSA 2BCJA 4E4MA 3VBQA 4YMJA 1WVYA 3FZOA 5ETCA 5C4LA 4QYGA 4ALWA 1MUOA 3DKFA 3PWDA 3PZHA 4I21A 3R9OA 4AT3A 4BWKA 4CFMA 4XV9A 4GG7A 2HIWA 2ITQA 2F2CB 4J71A 2UZTA 3OCBA 5E92A 4EWHA 5CT7A 4C33A 4YZDA 4DFYA 2C4GA 5KMIA 2IWIA 3LVPA 3SX9A 2CJMA 4A07A 1O6LA 3LXKA 5GZAA 4WUAA 2UW0A 2Z02A 4QMSA 5KMNA 2UW3A 4E7WA 3LAUA 3PPZA 4I4EA 1PYXA 5BYYA 4IANA 4OAUC 4UY9A 4XG7A 3RALA 3R83A 4O0TA 3CSVA 4XG3A 3KRXA 3WE4A 3NUUA 3HA6A 5CSXA 3ZXTA 4CZTA 5L8KA 3PLSA 1W8CA 2H8HA 2XNEA 3HRFA 4FKTA 4XG2A 3FYKX 3FXWA 4XLVA 4ZTNA 3UBDA 3LMGA 4PMMA 3E62A 4J8MA 4IMYA 3PXKA 2QOQA 4R6VA 4FIJA 3GFEA 4D9UA 1PXJA 4U79A 3A4PA 5FLFA
chains in the Genus database with same CATH superfamily
4GYIA 2OSCA 2YCSA 4CTBA 5AP1A 3V5PA 2YCRA 2VWWA 3NLBA 3ALOA 4NU1A 2BROA 3E7VA 4GCJA 1STCE 4QMLA 4M68A 4R3CA 4ITIA 3UGCA 3UC3A 4QEBA 3QBNA 1TQPA 1W0XC 1TQIA 3O8TA 4YC3A 4E5AX 4NTSA 4QMUA 2X2MA 2W1FA 3HP5A 4RZWA 4OTHA 3PP0A 1U5QA 3Q4UA 5ANIA 3TG1A 4FG9A 4CFXA 4FKGA 4JDKA 3UDBA 3P5JC 1PY5A 4CMUA 5IMEA 2X7GA 2C30A 4AAYA 3W0NA 4O4DA 4FNYA 4BI1A 2IW9A 4IAZA 1KE5A 3DQXA 4IAFA 4IC8A 4EK3A 3ZLWA 3AC1A 4BCHA 5HTCA 4FEWA 1P14A 3W0QA 4H58A 5JMSA 1E9HA 5JN2A 3LFEA 3GVUA 4GUEA 4OTFA 5IDPA 2XK9A 4AA4A 2O0UA 3LHJA 5ACKA 5K9IA 4QD6A 4FTNA 3PXFA 3CBLA 4RWLA 1JSUA 1Q41A 4DFNA 2WTVA 4X2FA 3Q4TA 3E8EA 1KOAA 4W4XA 4CLJA 3QTUA 5LVLA 4AACA 2YM8A 2VO6A 2BRHA 2VTSA 4RC2A 5CLPA 4BCFA 1Q3DA 4ZMFA 4D28A 3FHRA 4NM3A 5CNNA 2XANA 3W0PA 4WSYA 1Q5KA 4YZMA 2WFYA 4QYFA 4FSUA 3UQFA 1RW8A 1ZZLA 3DKGA 3FQHA 4I23A 4ZK5A 1KV1A 4GMYA 3DNEA 3ZUVA 1WBPA 2IZSA 1NA7A 1M2QA 2X39A 5LVNA 2W7XA 3G0EA 3PPKA 2OI4X 4FYNA 4EONA 4G6LA 5J9LA 3F3ZA 3LFAA 3ZZWA 4ZEGA 4EWQA 5D41A 1XR1A 5EKNA 2BMCA 4E6QA 3VHEA 4XYFA 3BU6A 3UIBA 4LRJA 1KE8A 1H08A 1ZYJA 3ZEWA 3AKLA 4O7YA 4O7VA 3QQFA 4DA5A 5CNOA 4CRSA 5HVKA 4JI9A 3V04A 2PMOX 3OXTA 4L68A 4CMOA 4LRKA 3NDMA 2BRNA 4I6HA 4LM5A 4QYEA 5FEQA 4MVFA 4D0WA 4F9CA 5K4JA 2Y4IB 3VN9A 4DG2E 3C50A 2UZLA 2XK6A 3GCQA 3PPJA 3QQKA 3EFKA 2OXDA 3GC9A 3QU0A 4CRLA 1BL7A 1FOTA 4TWOA 2PVRA 3VBWA 3B8RA 5AR2A 3WILA 3I7BA 3DKCA 4YSMA 3IW6A 2QU5A 1DM2A 2H34A 3W2PA 3SQQA 5CAQA 4CYIA 3W0RA 3PZEA 4TPTA 4FGRA 4FEQA 2WTKB 3H9OA 3DV3A 4PTGA 3BE2A 3BEGA 3KMUA 3OY3A 3RCJA 2XEZA 3GOKA 3CKXA 1UNHA 3TYKA 4DHIB 5AJQA 2OH4A 2RGPA 4YHTA 2ETMA 4C4EA 4HVIA 3ZXZA 4UWYA 1VYWA 1CDKA 2BKZA 3V01A 3G9NA 4CFNA 4F7NA 3DOGA 3WIGA 4O86A 2XA4A 3E88A 5LMBA 4K2RA 5HO7A 1KE9A 1PKDA 2Z7SA 3IONA 4KIKB 5FM3A 3E7OA 3OS3A 4QP6A 2CCIA 3QGYA 4HPUE 2JFLA 2WIPA 2RFEA 2WMXA 3SDJA 2W9FB 1Y8YA 5IQHA 3UE4A 3KXXA 4OTPA 4JG8A 3VAPA 2GS2A 4UMTA 5ANJA 3PJ8A 1M52A 4IWOA 4OLIA 4IM2A 5ACBC 4YTHA 4H1MA 2PE2A 4UMRA 1R78A 3E8CA 3CLYA 4D2VA 2VWUA 4Z3VA 3P78A 3RNYA 4PUZA 4ZSEA 1YI4A 2WOUA 2P2IA 4LRMA 3VQUA 1H00A 5HTBA 4FT0A 2CNQA 2C6LA 2XBAA 3QLGA 2R7IA 2VNYA 4XRJA 3D2KA 2ITNA 3LFFA 1OITA 3C13A 4BCOA 4DFZE 4NKSA 5AMNA 1J7IA 4AOJA 1WZYA 3FSKA 3FEGA 3GBZA 4R3RA 2CKEA 2JIVA 4KKHA 4M97A 4XG9A 2EB2A 4DF3A 4O2PA 3MFRA 3DGKA 1VR2A 5FP6A 3UMWA 3BBWA 3SAYA 3UOKA 3WF6A 4AW1A 4LI5A 3AQVA 4B4LA 4U81A 3Q52A 3QKLA 4L7FA 4WSQA 2FSTX 4F7JA 2OU7A 4GS6A 3FC2A 4YNEA 2AC3A 4NM7A 4O7ZA 3RPYA 4EOLA 2IZUA 3W8LA 4ALVA 2W96B 4YURA 2YWVA 3EN9A 4IWPA 4E6AA 5A4TA 5AM7A 3FXZA 1QPDA 4C7TA 4YR8A 2XALA 5TR6A 2GHLA 2OGVA 3FLYA 4ANLA 2C3LA 4YZ9A 4PPAA 3REPA 5KKRC 3L9MA 1WBSA 4H39A 4J97A 3VW6A 1U54A 3DFAA 2X4FA 2XNGA 4KRDA 2EUFB 2C5VA 4Q5HA 5EDQA 2WEIA 2F57A 4MBLA 5EFQA 2OZAA 2P2HA 4XOYA 3F2RA 4R5YA 4UYNA 4HYIA 4JQ7A 3ZO1A 4RJ3A 3EL7A 4L46A 3W33A 4E4LA 3OWKA 1ST4A 3IW5A 5BMMA 3NYOA 4QMXA 4A4XA 4HYUA 3ZDIA 4A4OA 4A4LA 2SRCA 3TN8A 4EK4A 2A1AB 4DCAA 4FIFA 5AIKA 2CGWA 5JGBA 1UWHA 4KSQA 1RJBA 5T6KA 5AA8A 2YFXA 2GFCA 3AC5A 1O9UA 3P0MA 4U41A 4W9XA 5E8WA 4ZSAA 5I9XA 1JSTA 4QP8A 1ZARA 5D7AA 4L7SA 2W1EA 3ZSIA 1J1CA 4WNOA 3GU6A 2HK5A 4YBJA 3G90X 3EZRA 2E9OA 4I5CA 4L3LA 1YDRE 3FSFA 3HGKA 1P2AA 3ORPA 4XV2A 3VO3A 3HX4A 4RLKA 4IX5A 4RWJA 5CY3A 3EKNA 3VUTA 2P33A 3ORIA 4RRVA 2J0MB 3QUPA 4I41A 1R3CA 4IFCA 3O7LD 3I0OA 1GIIA 2YLEA 3RAKA 3SVVA 5EKOA 5HLPA 2RF9A 4FT7A 4K8AA 4AW2A 2Y6OA 4QMOA 5KZ0A 1OB3A 2RKUA 3H30A 3MV5A 3Q4ZA 2BRBA 5J9YA 2C5OA 4FSNA 4HNIA 5E8XA 3VS2A 4MCVA 4C3PA 3MPAA 4AW0A 3OW3A 4RIWA 5HG8A 2I7QA 3ELJA 2G2FA 4J53A 4AN9A 4ANOA 4AXAA 3PVGA 2J7TA 4FV5A 3R7IA 4FL3A 3TV7A 3VVHA 3W2OA 3IOPA 2BZJA 4FV1A 1OL7A 2EXEA 5ETAA 4IDVA 4O22A 3VS6A 4DG3E 4TWNA 4BTKA 3LFSA 4JBOA 1G3NA 5CSHA 2GHMA 4ITJA 4B0GA 2XIKA 2WKMA 3TI1A 3TNHA 2QOLA 2R3JA 4OUCA 1OL6A 3AKJA 4RIYB 5DN3A 1FVRA 3Q6UA 2ERZE 2HZ0A 2YJSA 4O1PA 4YUQA 2X1NA 2YDJA 4ACDA 3UPZA 5HCYA 4G31A 3G2FA 3HDNA 4FMQA 5E8YA 4BCMA 3D94A 3FMHA 3SXSA 3R8VA 2VWBA 3B8QA 1OUYA 2XB7A 4U7ZA 4X6RA 5F1ZA 2F4JA 1ND4A 2X0QA 3EFLA 4GT5A 4C34A 2W9ZB 5L2TA 1OIYA 4IFGA 4BTFA 3U6JA 3TM0A 3I81A 3I7CA 4MF1A 4TYHB 1KSWA 3AMBA 5CSWA 2GCDA 4BDFA 5I9WA 3BU3A 2PULA 3TV4A 4EI4A 5FXSA 4LMUA 3ZUUA 5IQEA 2PVNA 2BIYA 4XCUA 4AS0A 2R3FA 2REIA 4FV0A 5JZJA 2DWBA 4I20A 3SLSA 2BZIB 5J87A 4U3ZA 4F63A 3GU8A 3QWJA 2QOFA 3DLSA 3R22A 4KS8A 5F95A 4FKPA 3FUPA 2VWYA 2YAAA 3P7CA 4RQVA 5E8TA 4QMQA 3RAHA 2C3KA 1PXPA 3Q9ZA 5AP2A 2ZB1A 1GZOA 5EW9A 1OKYA 3E8NA 1M7NA 2NRUA 1JQHA 4G6OA 5FUTA 4MQ1A 4AZEA 1JAMA 4FIHA 4GKHA 3HMOA 3V6SA 2B1PA 3HUBA 4QMWA 4DEEA 4ZJJA 2H96A 4ZTLA 4F09A 5BUJA 5EQPA 1H27A 2WMAA 3GCUA 3LM5A 1W2CA 4YPDA 1LPUA 2XS0A 3U4UA 5DA3A 4LOOA 2CNUA 3R2YA 2R3GA 4HJOA 4AGDA 4NCTA 4ERWA 1GIHA 2E9VA 3LJ2A 4ARKA 4BGGA 3AGLA 3IW8A 3UZTA 3EHAA 3R7VA 3W18A 4EH6A 3OC1A 1S9IA 2HW7A 2ZV2A 3P1AA 4ZSJA 2BFYA 1XBBA 2G2HA 5HCZA 4X3FB 4EOJA 2WMRA 2C3IB 4R3PA 3QCSA 5C4KA 3LFNA 5L6OA 4ASDA 4E93A 3JVRA 2B54A 2HW6A 3CY3A 2WXVA 4FIGA 3OD6X 5L8JA 4FTJA 5DR6A 4ZS0A 3FJQE 3VWAA 3EQFA 3GUBA 2W17A 4ORKA 5M44A 4RJ6A 2QLUA 3D5WA 3NUXA 5A6NA 2VTIA 3PWYA 4OTDA 3DB8A 3OG7A 4NM0A 4EHVA 1Q3WA 4IADA 4A9RA 4N6ZA 3PA5A 1P4OA 2HY81 4IB1A 4XS2A 1W2FA 3S1HA 2PMLX 1APME 2CSNA 2R64A 3HUCA 3E5AA 3KCFA 2VAGA 3SOCA 4AOIA 3LIJA 4LQMA 3ZTXA 3VRZA 4MH7A 5A4LA 5HTIA 4O4BB 4O21A 3L9NA 2RFDA 3THBA 3FPMA 4QQCA 1KE7A 1H24A 3IGOA 3FV8A 1Q24A 3QCYA 4FNXA 2QLQA 4FTIA 4J99A 4M3QA 5H8EA 4O7TA 3BV2A 5CX9A 5FBNC 3ROYA 1GNGA 2J0IA 2GNFA 2QQ7A 3SC1A 2RIOA 4WIHA 3ZLSA 4EH7A 2XIZA 4EL9A 5GINE 4U97A 3HECA 5LVOA 3RZFA 1KWPA 3HAVA 1MQBA 2R3RA 5I5ZA 4D2TA 4IXPA 4WG3A 4BCJA 3CGOA 1E1VA 1YXUA 5DH3A 3MYGA 1V0OA 2HZ4A 4K9YA 1GY3A 5I9UA 3LMHA 4Z7GA 4DAWA 1ZMUA 1H0VA 4JIAA 4MXYA 4QP9A 4BR3A 4O1OA 3FZRA 4F08A 4EH5A 1M17A 5AV4A 4ZTRA 5M4CA 1MRVA 3WZKA 3KF4A 4QMTA 4QNAA 3O8PA 2JC6A 3Q5ZA 3Q2MA 2VX0A 4KABA 3SGCA 2XUUA 4FV6A 4FKQA 2UW7A 4AZFA 4L01A 4PMPA 2BVAA 3DKOA 1KOBA 5E9EA 1CM8A 3SKCA 2BIKB 4XP3A 2W5HA 1OMWA 3Q9WA 4GSBA 5HX6A 3IGGA 3UYSA 3C4XA 3OBGA 3WF8A 1ZOHA 2WMTA 5GJFA 2VO0A 1CSNA 3ZFYA 4H05A 4O0WA 1YHSA 4O82A 3QD0A 5BVWA 5K0XA 3GQLA 1O6YA 3MWUA 2CCHA 4DITA 3DBQA 5IF1A 1ZZ2A 4X2GA 4YU2A 3QZGA 3A2CA 5IA2A 3QYZA 4L44A 5LMKC 4RVLA 2C69A 4EH4A 2ETRA 3PJCA 3AOXA 5DEWA 4M13A 5BYLA 4FIEA 2UZBA 4J96A 4K18A 4KIPA 1SVHA 4G3FA 4QPMA 5AUZA 2JEDA 1TFFA 2A98A 4JAJA 2R0IA 2VTMA 4GL9A 2DS1A 4IHPA 4E73A 3QRIA 4RVTA 2BUJA 3GGFA 3K5UA 3N9XA 4GU6A 1Q8WA 4D4VA 1QPEA 3QCXA 2R3OA 3JS2A 4IVDA 4KB8A 3K54A 5CXHA 3TZMA 4AOTA 3FY2A 3NMUF 3QTZA 4FKOA 3SXFA 4AFJA 3FL4A 4AWIA 2QC6A 3EZVA 2JBPA 4QTAA 2UW5A 4GRBA 2Q0NA 2OJIA 3TDVA 4PMSA 2WD1A 4G16A 4MF0A 4I0SA 5A54A 4ANMA 4F6SA 2E9UA 3NSZA 5K5NA 3ETAA 5M57A 1RDQE 3BV3A 4EOIA 3AT4A 3D5XA 3QRTA 2PUNA 4BBEA 5KMKA 2W1HA 4K11A 1DAYA 4DBNA 2OO8X 2ZYBA 2XNPA 3FLZA 4IJPA 2QHNA 4BB4A 4ACMA 4BDIA 4BDCA 2XIRA 4HNFA 1NY3A 2G2IA 4TWPA 2GS7A 3O23A 4HGEA 4U43A 4PP9A 4TZRA 4OTWA 2W06A 4ZSLA 4CCUA 3OUKA 1P4FA 1QCFA 1RQQA 1BL6A 2J4ZA 3DK6A 4PX6A 5KE0A 4I1ZA 3VJNA 5DE2A 3WZUA 3W8QA 1Y6BA 2UUEA 3CJFA 3D0EA 3QTSA 3G33A 1Y91A 2RFNA 4Y8DA 5CI7A 2OIQA 5BVDA 4KWPA 3KULB 3CCNA 3W2RA 3VHKA 3DTWA 2IW8A 5M51A 4IAKA 4BDHA 3U9CA 2QU6A 4NYEA 4DTBA 2I0VA 4H3QA 3ATSA 4FV7A 4E8AA 3CEKA 1XBCA 5FD2A 3FI8A 3PVBA 4XLIA 4N57A 1ZYCA 4MNFA 2PVYA 3D5VA 3KGAA 4UMQA 4D1XA 4EOMA 4F1OA 1YWNA 4USDA 3CC6A 3ZRMA 4MWIA 5IQDA 5CI6A 4XP0A 4NFNA 2B52A 3OEZA 2CLXA 3QQLA 3OW4A 4FTUA 5FDXA 3O5AA 2OJFE 4LOQA 1PRYA 3ERKA 4DEHA 1ZOGA 3D5UA 4ZXTA 3VS5A 5L6WL 1JVPP 5FQDC 5CU4A 4KA3A 3KRRA 3R8LA 3TTJA 3PIYA 4LL5A 3MA3A 2C47A 1OIQA 4EH8A 1BI7A 4ZY6A 5M56A 5HVJA 2X2LA 2OLCA 5K0KA 4C3FA 2FUMA 3HMIA 2XK3A 4O7NA 3R8ZA 3E87A 5DI1A 3OP5A 4DT8A 5EYDA 2HWPA 3MTLA 4XHKB 5M4UA 1KE6A 5DGZA 3O96A 3ZM9A 3VC4A 2A19B 2P4IA 4JR7A 1WFCA 2VTQA 2ZM1A 4QT1A 2VTAA 3I5NA 3KXNA 4IZ7A 4E4NA 3IDCA 2VTOA 4AP7A 3G0FA 5EYMA 3H0YA 3UOLA 5D10A 2EWAA 5HG7A 2WMSA 4NZWB 3FXXA 5GZ9A 3A8WA 4CZYB 5DYJA 5LMAA 2XAMA 5IQBA 5HG9A 3I5ZA 2EU9A 4BZNA 3ORTA 3ZMMA 4KD1A 4BC6A 3FMMA 2IN6A 3OVVA 3KMWA 2BILB 5TE0A 3VW8A 4QO9A 2CHLA 2UW4A 3L8VA 4U3YA 2RL5A 5IDNA 3HV4A 3QD3A 4GW8A 5DBXA 4CEGA 2O64A 4YLKA 2B9IA 4RWKA 3PXRA 3UC4A 4FEUA 3H10A 4PDYA 4GT4A 3UNZA 4DG0E 5E4HA 2QR8A 3I79A 4EC9A 1NVQA 4KUJA 3IS5A 2X9FA 5AA9A 2PYWA 2WGJA 3C4ZA 1F5QA 5BV3A 3L8PA 4H36A 4L00A 4S32A 4XRLA 5I9YA 3RNIA 3WZDA 4DGNA 1Z5MA 4YTIA 5JEBA 4EHEA 4FOBA 2ITXA 1MRYA 3LFCA 4DBXA 3KN5A 1WVWA 3RM6A 4BFMA 3SG9A 1GAGA 2O63A 1M14A 4FV8A 4M8TA 4Q2AA 4RSSA 4ZZMA 3D4QA 5L2WA 3FE3A 5HBJA 1UNGA 3KCKA 2VUWA 2XKEA 4FV3A 4I6QA 3S4QA 3UODA 3CQEA 2C0IA 3WI6A 4AXEA 4LGGA 2VN9A 3MY5A 4OT5A 3SRVB 3UP2A 4RX5A 4EZ3A 2XNNA 3ZLYA 3P23A 5AX3A 4O0XA 3CP9A 4J7BA 1M2RA 4W4YA 1JOWB 3UZRA 3HYHA 5EHLA 3SG8A 4ZTMA 2W5AA 5F94A 2Y9QA 2X7FA 1ZYDA 1P5EA 1I09A 4Q9SA 2YM7A 3G9LX 4KNBA 3KRLA 4C36A 4YJSA 3GCSA 5KCVA 1IA8A 2YIYA 2QO9A 2YDIA 4GIIA 3HZTA 4I0RA 4MAOA 4O0RA 3DU8A 4RC3A 4FKSA 3DQWA 5CSPA 3VS4A 2NRYA 5IA1A 5CALA 3TTIA 4F99A 4I3ZA 3EB0A 3PE1A 5EM6A 3ZEPA 2ZOQA 4S34A 5AUWA 2EVAA 1Q61A 3ULZA 3PP1A 4C4JA 1NW1A 4GEOA 5J7BA 4BWXA 5EOBA 4CG8A 4PTCA 1W98A 5HOAA 4CT1A 3R9DA 3UTOA 4IE9A 4ANSA 2YDKA 2R0UA 3EN5A 3QGWA 5FG8A 1Y8GA 4WBOA 3GC0A 5L4QA 2V5QA 4EUTA 3ZU7A 1H25A 4FTCA 2DYLA 3K3JA 3O7LB 2DUVA 4AX8A 1OL2A 3DBEA 2W05A 5CVFA 3RAWA 3VBTA 1CKJA 3Q60A 5AV3A 3FLQA 4EEVA 3P7BA 3WF9A 2BALA 5HLWA 3DDQA 4CVAA 1XMLA 4BRXA 3KRWA 5IQIA 4FTMA 2OZOA 5F4NA 2R9SA 3OWJA 5CZHA 5C8MA 2W1GA 4CFUA 2QD9A 1H1RA 3OT3A 4YJOA 1FMOE 2EB3A 2PE0A 1OPJA 1TKIA 1CTPE 4FL1A 4AN3A 5I0BA 4WNMA 4YP8A 3I4BA 3MIYA 4C4HA 3VULA 5L2SA 2YM6A 2F2UA 2PUIA 4RPVA 2B4SB 3OCTA 3ZUTA 1Y6AA 4HZRA 1REKA 4KIQA 4ZSGA 3BLHA 5B0XA 5HBEA 3QUEA 4APPA 4AT5A 1JLUE 4EZ7A 5CEMA 4ZIMA 3EFWA 2QG7A 4I92A 4ONAA 3TUDA 2R2PA 1IEPA 2R3IA 4E20A 2J0KA 3OROA 3T9IA 3LCKA 3HV3A 3LJ0A 3QXPA 3QA8A 4M69A 3K5VA 5GJDA 3U51A 3GU7A 1V1KA 2QNJA 4M66A 5IH5A 1ZY4A 5A4QA 4D55A 2C5XA 1XH6A 1IG1A 3R6XA 5BQ0A 1MRUA 3SD0A 2YACA 4RLLA 4HCUA 1HCLA 5EM7A 3UQGA 2QKRA 2ERKA 1URCA 5M4IA 5FP5A 2BKKA 3LCDA 3BYMA 5CASA 4LGHA 5IEXA 4MXZA 3VS0A 3W0SA 5AAGA 1OGYA 2PVFA 3F2AA 1OKWA 3FMKA 4LUDA 4EYMA 4DFUA 4ASZA 5JGAA 2IW6A 1T45A 4FNWA 4MXXA 4IIRA 3W55A 4YJVA 5K3YA 5HU3A 4L67A 2IPXA 3LQ8A 4QRCA 5CEOA 3IDBA 4FEXA 3O2MA 4FE2A 4WT6A 2CMWA 3F9NA 4QNYA 2WMBA 4ZAUA 3PFYA 5KO1A 3F5UA 5DG5A 4OTRA 4PY1A 2VTLA 3QC9A 2ZFYA 3KU2A 3DFCB 4NT4A 2R3MA 4YLJA 3HV5A 2WOTA 4B99A 2CKPA 5GIPE 3GOPA 4BI0A 4JXFA 3E3PA 4EOKA 3A4OX 3E63A 2CGUA 2JIUA 1E1XA 4FC0A 3PFQA 3ZFXA 3NW5A 2ONLC 1NXKA 4RA5A 4W4VA 1PMEA 5CZIA 5AR7A 3R7OA 3RK9A 4A9SA 4EHZA 1DI8A 4DHJA 3R21A 4PNIA 2JDRA 4J52A 2BAQA 4X3FA 3R7UA 4F9YA 4FICA 5CSVA 4ZZOA 4MD8E 3AT3A 5IZFA 1IAHA 5KZIA 3BEAA 2J6MA 4II5A 2EXCX 3HVCA 4MHAA 3MFUA 3ZS5A 4EHGA 4RJ5A 1OKZA 2I0HA 4O6EA 2WTIA 3EIDA 3GU4A 2WTJA 3QTWA 1Z57A 3BL9A 5LVPA 2ZDUA 4IAIA 2C6IA 2AQXA 2R3LA 4BCPA 4C2VA 3OHTA 1DI9A 5EI2A 5J8IA 4CTCA 3CS9A 3BYOA 4BL1A 3DY7A 4NIFA 5GHVA 5M07A 2PL0A 4M15A 4OBPA 4GJ3A 3RPOA 2WELA 5CENA 3P79A 2PUPA 3EFJA 3EJ1A 3F5XA 1HOWA 1I44A 2BDJA 3KXHA 2PTKA 3VUHA 5KKRB 1TVOA 4FR4A 4AUAA 5A9UA 2UZNA 4OT6A 3OF0A 4DH8A 3VUGA 2ITTA 3SHEA 3DCVA 1LR4A 3NFFB 1ZAOA 5E1EA 3F3UA 4FNZA 3FZPA 3MN3A 5HCXA 4FSYA 4U5JA 2OJ9A 3COMA 2GNHA 2WNTA 3KK8A 3M42A 2J50A 2E9PA 4GG5A 2CGVA 1H07A 4AA0A 4CD0A 3U6HA 4X0MA 4IQ6A 3KN6A 4GFOA 4MX9A 4IAAA 4O0YA 4RX7A 1PW2A 2C68A 2JGZA 4PDPA 4W8EA 3PSCA 5IA5A 4ENYA 2WEVA 5TOZA 4EOSA 4MD7E 2C6MA 3R2BA 4RJ7A 4X6QC 2WQNA 3RI1A 4FUXA 3UYTA 1ZYLA 3BHHA 3AD5A 3ENMA 3FAAA 3L1SA 3P7AA 3VBXA 3I6UA 5K4IA 4C4FA 1LEWA 2PMIA 4CZUA 3QX4A 3NUNA 4M7IA 5AR5A 4IB5A 4FEVA 2VZ6A 2OF2A 3IOKA 3E92A 4UXQA 5EH0A 3CTHA 4LYNA 2C0OA 1YDSE 2QOKA 4N70A 3NUAA 5I9VA 3AT2A 1U5RA 2J51A 3AC3A 5J1WA 2PVKA 4CXAA 3NZ0A 1OZ1A 3P08A 3UVRA 4EQCA 4O81A 4JG7A 4D2RA 5KBRA 3SA0A 2X8EA 5C27A 2WTKC 2BAJA 5IEVA 4CFFA 4HPTE 3VS3A 2OW3A 5AP5A 4UALA 1V0BA 4QMVA 5DLSA 3ZBFA 3PIZA 4DINA 4F9AA 1OGUA 4BICA 4L9IA 3EQBA 4HVGA 5EM5A 4ENXA 2PU8A 1S9JA 4A7CA 4R5SA 1UA2A 2YM5A 4P7EA 1H4LA 1CKPA 4C57A 1W82A 3DPKA 1Q8TA 3AMYA 2OICA 3BE9A 3GEQA 5D12A 1PMNA 2PZRA 4FG7A 4L53A 2PVJA 4AN2A 4D5KA 3R71A 5BPYA 3FQSA 4BF2A 1B38A 3VRYA 3QHWA 3WZJA 4MEDA 5EDRA 4BKYA 4FTTA 3TXOA 4DYMA 3QZHA 3EH9A 2V0DA 2OKRA 3HV7A 4O38A 1UV5A 5E91A 2X0GA 4HVHA 3R73A 2VO3A 3A99A 2QG5A 5AR3A 3OTVA 4J8NA 4CNHA 5EDPA 3FC1X 2J90A 5CTPA 3U6IA 5FDPA 2PPQA 3GCPA 1PHKA 3NVKI 2O8YA 4X2NA 3V3VA 1YOLA 1OKVA 1TZDA 1WVXA 3I6WA 3IECA 1OI9A 2G15A 3AGMA 2ACXA 3H0ZA 4KINA 4YZCA 4YSJA 3AD6A 5JQ5A 4GK4A 2VTPA 3OTUA 3PTGA 2GNLA 2WMQA 2QOCA 5CANA 3MTFA 2NP8A 4HGSA 2ZMDA 3UO4A 3A8XA 4NWMA 1XKKA 3MB6A 2UVZA 3ZZEA 3RCDA 3BGQA 3IG7A 3UPXA 1YKRA 3KMMA 4M84A 4R78A 5HVYA 1WBOA 3FWQA 2FA2A 3G5DA 3MS9A 4XG6A 2GNIA 2QOIA 3KULA 5ICPA 5DVRA 4Y5HA 4Z9LA 3MVJA 4I6LA 1IRKA 1L8TA 4QMZA 1UU8A 4HYHA 3OT8A 4AFEA 3MGYA 3ODZX 4S30A 5GJGA 4BTMA 3FYJX 4YZNA 1FINA 5HESA 2H6DA 3FKLA 4IX4A 4H3PA 5LXMA 3NPCA 5FBOA 3ATTA 4BZOA 1AQ1A 3FI3A 3QD2B 2UZOA 5IG1A 5LARA 3QRUA 3JXWA 2YM4A 4TYIA 3P86A 5C1QB 3GU5A 3R9RA 4M12A 4FVRA 4GUBA 4F9BA 4CMTA 1EH4A 5ITAA 1WAKA 4DTAA 4P5QA 5HKMA 5KHXA 1PXNA 2OH0E 3RGFA 4BKJA 4XV1A 4YJNA 4RG0A 2FSMX 3U87A 3S95A 3VIDA 3AC8A 4ANQA 4DN5A 1PJKA 2F7ZE 2XJ2A 3DNDA 2W4JA 4RJ8A 5EQYA 2PE1A 2ZVAA 5AP0A 4FUYA 3MVLA 3D7TA 1UU7A 3OZ6A 2PZYA 4X3JA 3W2QA 2GS6A 3UJGA 3HNGA 2JFMA 2XMYA 4P90A 3Q9XA 3ZLXA 3PY3A 4ERKA 1UVRA 5D7VA 4BVUA 5KUPA 4QYHA 2W4OA 4Y72A 3PA4A 4DEIA 3RJCA 2FH9A 3C5IA 5G6VA 1Q4LA 4BHNA 1ZY5A 2J9MA 4EKLA 4EUUA 4IM0A 4CKIA 2JDSA 5CEPA 3UDTA 4G5JA 1ZMVA 1H1WA 1GJOA 5CU2A 2RG5A 3L8SA 2WAJA 4FL2A 5AIRA 5EK7A 3S2PA 4E1ZA 2ETKA 2VGOA 3HRBA 3PSBA 2XIXA 2OXYA 4BDDA 3RPRA 5EQEA 4CCBA 3PJ2A 5JQ8A 4W4WA 4E6CA 3LJ1A 4ACGA 4CSVA 2AYPA 4CG9A 2FSOX 4LV8A 4UEUA 4M0ZA 4CV8A <