4BDIA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
307
structure length
290
Chain Sequence
MSVYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 290
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdiA01
4RMZA 3O2MA 1W84A 4FL1A 3L9LA 4ALVA 4D0WA 3SLSA 5AA9A 3TWJA 3PPJA 4KKEA 1U59A 1PMVA 1PXMA 2XIRA 2YCFA 5L2IA 4FKIA 2WELA 2Y4IC 1Q3DA 2XKDA 2H9VA 2X39A 4YMJA 1CMKE 2OF4A 4GYGA 4J97A 4Q5EA 4TWCA 5M07A 5HVJA 2CN8A 3GU6A 3S4QA 3EQIA 3O71A 4FKRA 3FYJX 4QP7A 3QHWA 4CLIA 1TKIA 4QQCA 5IEXA 3BLHA 4NCTA 4A4OA 2J50A 2XZSA 5IZFA 4HOKA 5IDPA 3R04A 4KA3A 2BKZA 3UO4A 4LM5A 5CU3A 2C6IA 1Q41A 5TO8A 2HELA 4EC8A 4U42A 5A4CA 3DFAA 4H39A 4YZCA 5CU0A 4JJRA 4O7ZA 3KREA 1PF8A 3LMHA 3NVMB 1GZKA 2IZSA 3MH3A 4LRJA 4K0YA 3CC6A 3OTUA 1SNXA 4FTJA 3ACKA 4EYMA 4HW7A 2A19B 5DRBA 4BFMA 3RALA 1ZYJA 1UNGA 4QPAA 3FXZA 3KRLA 4AT5A 2YA9A 4CFUA 3UJGA 2WIHA 3IDPA 4L67A 2J0MB 4KINA 2A4LA 4MCVA 4RIWA 4X2JA 1ZOEA 1W8CA 5EM6A 2ITTA 3DKCA 2R64A 4EI4A 3BHVA 3NNWA 3NAYA 4R7HA 5DOSA 2X6DA 3MPAA 5FTGA 3NIEA 3M11A 5ANKA 4MAOA 5L8JA 2BR1A 3QTWA 4FIFA 2PVHA 4FKOA 1PYEA 2JIVA 1WVWA 5AP5A 5HKMA 4X2NA 3TUCA 4O7NA 3K2LA 4ANBA 4UMQA 3TJDA 5IA0A 5HVYA 1GZNA 1OZ1A 4M66A 2YM3A 4AQCA 4C2WA 3SVVA 4Y46A 4KS7A 4EC9A 4EK4A 3SA0A 2VWWA 3FLSA 4FNXA 3LLAA 3Q04A 3HYHA 5HOAA 4EK6A 2XNGA 1CKJA 4OT5A 5FEEA 3I4BA 2G9XA 3ORMA 4QMWA 3IO7A 2FSOX 2ZV8A 3DFCB 4BHNA 3QKLA 1FGIA 4E6CA 1YOJA 4M3QA 3FMMA 3HVCA 4FZDB 4FGBA 4MNFA 4UWYA 5HX8A 2UZOA 2XK4A 1XR1A 1VYWA 1XWSA 3R8MA 3PYYA 3RNYA 1ZMVA 5FLFA 4ZY6A 3CGFA 4R7IA 3GC9A 3RKBA 4K6ZA 2HWPA 4Y5HA 3VF8A 4EEVA 4ARKA 1DI8A 4ANQA 2HAKA 2VO6A 3OW3A 5L4QA 2PVNA 5CZHA 4U97A 3TZ9A 4D28A 3GCQA 2ITUA 5GJGA 5C01A 3W8LA 4YZDA 3ZLWA 4AU8A 4C0TA 1FBNA 1PMNA 5CX9A 5B0XA 5CENA 3QWJA 3FHRA 3VBVA 5HICA 3QBNA 3DKOA 4V0GB 3QQGA 5E91A 4F9YA 2VWYA 3R8UA 3UOKA 3V8TA 5BVWA 3VQHA 1HCKA 1MRYA 3F3VA 1JSVA 4PY1A 1VJYA 3VUDA 2BTSA 3Q4UA 4MHAA 1LEWA 3QCXA 3DKFA 3G51A 4FIJA 4I23A 4WUNA 4KBAA 4C4HA 5ETFA 3OWLA 5KZ0A 3F2RA 4IJ9A 4CFWA 2OF2A 4HZSA 4G3EA 3QD3A 4RVTA 2IZUA 1YWRA 1M7NA 1STCE 3QCQA 4Y83A 3ATTA 5AUVA 4KABA 1WBSA 4FKPA 3R7VA 3GVUA 4FYOA 3JUHA 5KO1A 1QL6A 3I1AA 2QO2A 1WBOA 3FMKA 5FWKK 3UPZA 1LR4A 3A61A 4G17A 5CSWA 4BWPA 4F08A 5B2LA 4AGCA 5JN2A 4FEUA 4MBLA 3FI4A 1IAJA 2RF9A 4KIKA 3CS9A 3JS2A 3LFQA 4I94A 4TXCA 3WIKA 1OI9A 2B1PA 3PA4A 3QA8A 4AUAA 4XS2A 5I9UA 4XYFA 2VTMA 3TV7A 3UOLA 1KWPA 4NUSA 1S9IA 1TQMA 1WFCA 4PTEA 3ZSHA 4CT2A 2PPQA 1QPCA 1APME 4GK4A 4OTFA 4UYAA 2I7QA 2BZJA 4RZWA 5C8MA 2BCJA 5CLPA 2WTIA 1SZMA 2W5BA 4NM5A 3PJ3A 5ANIA 4C8BA 5LWNA 3EQBA 1H01A 3O0GA 5E8WA 2X7GA 4DAWA 5CEPA 4M0YA 3KFAA 3JVSA 2G1TA 2W1IA 3ZO3A 5CAUA 2R3JA 2R3RA 3BU6A 4YLKA 3DQXA 3IONA 3OVVA 3RPYA 1H00A 4F99A 4WNKA 2GQSA 4NZWB 1P4OA 4RJ6A 3N4VA 5CSXA 4L9IA 3D4QA 4JIKA 5FDXA 5FP6A 3TACA 3HP2A 3NUXA 3PSCA 3UE4A 4DFNA 4TTHB 2NP8A 3RJCA 4YC8A 3TIZA 3COIA 5IF1A 3OUKA 3C0IA 3HV3A 4A06A 5KMJA 2UZTA 3P7BA 2WGJA 2V55A 3HP5A 3R71A 3NUAA 3QZGA 2FSMX 2X8IA 2UVXA 2BAKA 4IC8A 4QQTA 5M4FA 2PYWA 4UX9A 5AV4A 4RJ3A 5EK7A 4K9YA 2JFLA 4IWPA 4M69A 4EH3A 3FKOA 3TNWA 3LXLA 4EOLA 4YO4A 4EK8A 1FVRA 3SG9A 3E63A 2GHMA 3OROA 4ZEGA 3R1NA 3BPRA 4AZFA 2EWAA 3FI3A 1YHSA 4U9AA 2OFVA 2QOLA 2CGUA 3D5WA 4WOVA 4H3PA 4PDPA 1DI9A 3VVHA 4FV4A 1MQBA 3PP1A 3HA6A 1OL1A 3QU0A 4AP7A 4ACDA 2W1EA 2FVDA 1V0OA 3BGPA 5IU2A 3QUEA 4QPSA 4O81A 4NIFB 4XG9A 4GK3A 4IAIA 4N70A 3QXOA 4HGEA 5JFSA 3ZS5A 3D0EA 2A0CX 2X0GA 3PXZA 3VQUA 3TCPA 4V01A 3UTOA 4EQMA 3R9HA 5IEYA 5CEKA 3F6XA 4JOAA 1NW1A 1WBWA 4ENYA 3S0OA 4D4RA 3VUTA 2BFYA 5AEPA 4H05A 5IMEA 4A4XA 5HD7A 3CTHA 3SRVA 3ORXA 4PNKA 1JNKA 2H96A 2JKOA 1S9JA 3PJCA 4IADA 5F1ZA 5M55A 4KSPA 4W9XA 4DGLC 2BAQA 4V0GA 2PUIA 2CN5A 1B38A 3I0QA 4JR3A 2W5HA 4EUTA 2NRUA 1ZOHA 2ZMDA 3LLTA 2O0UA 3Q6WA 5A6NA 4U0IA 4BCPA 3UC4A 2Z7LA 3KVWA 2BRMA 2JC6A 1R0PA 2O2UA 3EHAA 3LMGA 3PE2A 1J1CA 3OBJA 4FKQA 4HVIA 2J6MA 2QODA 3Q9WA 4HGLA 5HO7A 3E8NA 5LVOA 4AW5A 5FTOA 2CHLA 3FQSA 1PYXA 3CP9A 4ACCA 5AFVA 1M17A 2OJGA 3D5XA 3PVUA 3WARA 3TM0A 4X2FA 2C0OA 4YC3A 3AC2A 2R3KA 5JFXA 3OW4A 4JDHA 1IR3A 3Q52A 3TI1A 3NW5A 4C58A 4EWQA 3H9RA 5D12A 4ZMFA 1KE9A 2CLQA 3C13A 4FT5A 4H1JA 4CCBA 3DLSA 5M53A 2YITA 4I6HA 2Y0AA 4BKJA 3R73A 2QO9A 5LXMA 2LAVA 4LGGA 3VBXA 4BGHA 3OP5A 2YM6A 5GJFA 4YBJA 4IXPA 2ZB1A 4IVDA 4PUZA 4EOIA 4FV0A 5J5SA 2R3HA 4DGMA 3EQHA 5AR7A 4FIHA 3UMXA 3IW4A 2W05A 4Y85A 2HY81 2G01A 1Q8WA 2VWZA 5B2KA 3R9RA 4DF3A 3U55A 4YNEA 4K11A 3UO6A 3PG1A 4J99A 2WXVA 3L8VA 1FVTA 3UG2A 1NXKA 2PVRA 4XP2A 4FG7A 3UNJA 2C0IA 2C5YA 3GXLA 3KULB 3L9PA 4O1PA 4BIBA 4IM2A 5BNJA 4RIYA 1NY3A 4N6ZA 4F1MA 2WTWA 4Z3VA 3ULIA 2W1HA 3DAEA 3UVQA 3E88A 4YTFA 4FSZA 4NK9A 5HLPA 4XHKB 3SDJA 5D11A 3ZDIA 2HW6A 3DNEA 5J1WA 3ENHA 4O7RA 4L53A 2CGWA 2QVSE 1J3HA 3EL8A 3OF0A 3PWYA 4XJ0A 3TDWA 4LOPA 3OT8A 4O22A 4AWIA 5AX9A 2WMAA 1O6YA 2C4GA 2Z7QA 4EJNA 4N0SA 4RVMA 1ZYCA 4FKJA 3H10A 3WI6A 3KL8A 4IB5A 4PX6A 2XK3A 2JBOA 2F7EE 4Z9LA 5J79A 4XG2A 3R8VA 3V8WA 1XH9A 4P5QA 4DEDA 4PV0A 4FSTA 3TNHA 4FC0A 1LEZA 3DPKA 3F82A 4AZSA 4O7VA 2WMTA 4EWHA 3FSKA 5HD4A 5HU3A 5IISA 2IVTA 3GQLA 4OTIA 5D7AA 2QQ7A 4K1BA 3Q9ZA 5AR3A 2Q0BA 3IW7A 4EHEA 3Q2JA 1HOWA 5CAOA 2C6EA 2FB8A 4UMRA 2W1FA 5AR5A 4MQ2A 4TYGA 5HTIA 3DT1A 4D0XA 2J4ZA 4CG8A 3H9OA 5CF5A 2CNUA 5FBOA 2WAJA 3L8XA 3A7FA 3BWJA 1OUYA 3LFBA 2W17A 1U5QA 5CSHA 5CZIA 3GU8A 3RAIA 2GNFA 4ORKA 4HGTA 2XNBA 3HMMA 3FLWA 3WF5A 5DT3A 2CMWA 3DTCA 3F5UA 3NLBA 3AMBA 4NSTA 4YZNA 5A4QA 5LVMA 1YRPA 4FF8A 3U8WA 2XH5A 3R83A 2WPAA 3TNQB 4X3JA 5TOZA 3RVGA 5ANEA 4OBPA 3WZJA 2I0YA 1PKDA 3ZOSA 3BLRA 3CJFA 4YUQA 4I6BA 5CEOA 5FEDA 3CJGA 3VS2A 1E9HA 4FIEA 2WNTA 3E92A 3QKKA 3SC1A 4EK5A 1NT2A 1CTPE 3TG1A 4GT3A 4UXLA 3PUPA 2RFNA 2VTLA 1H27A 4I6FA 2P3GX 5EQEA 4IWQA 1GZ8A 4JXFA 2OICA 1VR2A 2WMWA 4MXOA 3W16A 1L3RE 4WNMA 5CWZA 3K54A 5FXRA 4DG2E 5AP6A 4KUJA 4NTSA 5IDNA 4MEDA 4QMVA 5AUWA 2V7OA 4G9CA 2JIIA 3CE3A 4KB8A 3W8QA 4CTCA 3NIZA 4QTBA 1BI8A 2E9OA 3Q5ZA 2PY3A 1F0QA 4FSRA 5A3XA 5BMSA 3MJ1A 2E9VA 1OL7A 2JDOA 1M14A 2XIKA 3Q53A 3LCDA 2FYSA 5CY3A 3TN8A 4XLVA 3ZFYA 2YM5A 2CNQA 3NWWA 2XKFA 4RQKA 4WA9A 5EYDA 4E20A 1FGKA 5JMSA 2Y8OA 3BKBA 4GSBA 1LPUA 3A7HA 5T68A 2XM8A 4F4PA 1AD5A 4IACA 1YXUA 3R7UA 4JG8A 1PKGA 5EDPA 3OCGA 5DLSA 5DMZA 5K9IA 2Q83A 3DTWA 2YERA 2ZM3A 2YDIA 4WG3A 4W4WA 5DT4A 1L8TA 5I5ZA 1E1VA 4D55A 4L45A 4GVAA 4FA2A 3QFVA 2QOKA 4LOOA 4BTMA 4E6DA 1RDQE 1TQIA 2OIBA 4PPCA 5K4IA 2BZKB 2XIYA 4QTCA 4ZSJA 5JQ5A 3QCYA 2VX1A 4OBQA 3HDNA 1CSNA 3L1SA 1H25A 4MXXA 4WBBB 3DBCA 4RFZA 3UIUA 4GKIA 4G6LA 4ZLZA 2Y4IB 2CSNA 4BCMA 1OM1A 3KCKA 2PVLA 5HBJA 4C3PA 4CG9A 3L8SA 3RZFA 3ZEWA 4D2SA 4QMLA 4S33A 4EH2A 3L8PA 4EONA 2B52A 4GL9A 4LUEA 1W7HA 4BN1A 5FTQA 3GCVA 4F7SA 3BU5A 4FKGA 4MF0A 3WYXA 2NPQA 4WG5A 4BBFA 2B9HA 4QYFA 5KMLA 3UP2A 1U54B 1WVXA 4UALA 5TT7A 4QP3A 3EIDA 2BDJA 2FH9A 3ZDUA 3HEGA 1YXSA 2WTDA 3H9FA 4H36A 4IZ7A 4AG8A 4CRSA 4ZTHA 5AR4A 2XK9A 3D15A 3LCOA 4AOIA 4BWKA 3VO3A 2HZ4A 3MW1A 3FMJA 5AAEA 5C26A 3MTFA 1J7UA 2BVAA 3DXNA 4RRVA 2QD9A 4AA5A 3OWKA 4GIIA 1KE5A 5HGIA 5I3OA 3N9XA 2OBJA 3DBFA 4U6RA 4PMSA 3IDCA 3PXFA 4Z7HA 2KULA 3HAVA 4LV5A 4FV3A 1OBDA 4GJ3A 1REJA 2GS6A 1OMWA 5FBNC 2O63A 2VTJA 4EHZA 2R5TA 5GZ9A 2C6LA 4FVRA 4TWOA 1G8SA 3PPKA 4QP8A 3MYGA 1M2RA 2OW3A 4E5WA 4Z7GA 1F3MC 2GS7A 4L6QA 2BIYA 3QTIA 3OCSA 3PVWA 1KOBA 4EH5A 4HGSA 3EQGA 4ASEA 4ACMA 5L2WA 4UMUA 3VWAA 4B7TA 3D7ZA 3BX5A 4NM7A 4NWMA 5AV3A 5KBRA 2G15A 2VD5A 3E8DA 3M2WA 4IDTA 3MPTA 4U41A 5E4HA 3BZ3A 4A4LA 5KHWA 5CU6A 1QCFA 3E5AA 2WEVA 3QC4A 4ZXTA 3U51A 1XBBA 3KU2A 5DN3A 4AOTA 3QD4A 4JAIA 3GCSA 4FKWA 3MWUA 1OB3A 1KOAA 1URWA 2VGOA 3S3IA 4GKHA 5E7RA 4BL1A 5JGDA 4O91A 1XH8A 3VUHA 1BKXA 2VN9A 4FSNA 2UVYA 1PJKA 2B7AA 5FGKA 5H8EA 4YSJA 1Y8YA 3ZZWA 4DBNA 3IQ7A 4OTHA 2I0HA 1SVEA 3QX2A 5EHYA 5H9BA 3V8SA 2OJJA 4KIPA 4YTCA 5E8UA 4YZMA 2J0LA 4KRCA 4F9CA 2ESMA 3BHUA 1YXXA 4IHPA 1OKWA 3IW8A 1YDTE 3BYVA 2UZDA 4NM0A 3KKVA 4ZZMA 3KXHA 1ZAOA 3CGOA 4L46A 2GTMA 3DK6A 2GHGA 2VTIA 3TL8A 4KNBA 3V5TA 4AGWA 5IQCA 4KWPA 4L8MA 3MTLA 2ZOQA 3QTSA 4O1OA 4RX8A 5AP0A 2JEDA 2QOQA 4IX5A 4YHJA 3T3VA 3HRCA 4QMMA 5ETAA 3FKLA 4OAVB 4EJ7A 3P08A 3AC4A 5AUUA 4DTBA 5IQHA 2YM8A 5GZAA 3ALOA 3I6UA 1R78A 4FSWA 3KA0A 5FG8A 3SXFA 2PMIA 3LW0A 3VS1A 1OPLA 3ZFMA 4JBQA 2X8EA 4MD8E 3DZQA 5I9VA 4A9TA 4XNEA 3FYKX 5IH5A 4HPUE 4CKIA 4E93A 4NFNA 4DEGA 2QNJA 4UZDA 4AZTA 4F9WA 4U45A 4I5HA 1GNGA 3E7VA 2B4SB 4HJOA 4LI5A 3UNKA 3OXTA 2WMQA 4LGDA 4BDGA 4DC2A 5L3AA 3PJ8A 4KKHA 3HUCA 4I3ZA 4JDJA 5AUYA 4IH8A 4GCJA 2OK1A 4J1RA 3MA6A 3RZBA 4OLIA 3R8ZA 3WF7A 2OXYA 3RMFA 2C68A 3MB6A 2WHBA 5EDQA 4ZS0A 4CFFA 2VV9A 4FE2A 3GOKA 3T9TA 2WTVA 3FZOA 5HNBA 5CYIA 1UKIA 4FGRA 3FE3A 4K8AA 3A60A 1Q5KA 4I0SA 3R9DA 4O6EA 4DN5A 2XYNA 2UUEA 4OTDA 3A8WA 3MGYA 4ANLA 2HZ0A 4ZTRA 2J0IA 5K4JA 2QG7A 3R1YA 4YC6A 4S34A 3JPVA 3W2QA 2ZDUA 4XP0A 4DA5A 1U46A 3JYAA 4R8QA 3PRFA 5TF9A 3NW6A 3TV4A 3QYWA 1FINA 2VWIA 3BHHA 5KX8A 1OL5A 3HLLA 3GU7A 4BI0A 1YOLA 4O7SA 4GS6A 4O0VA 2F49A 1H1WA 4J8MA 2R3MA 4O2PA 3ZUUA 3CBLA 4C4EA 4TYHA 4WD5A 3HGKA 5IUGA 5IUHA 3KRJA 2C5NA 2SRCA 4HVSA 4R3RA 2REIA 3LXPA 1R3CA 3FC1X 3LJ2A 3NUUA 4E5AX 4LV8A 2A27A 1DAWA 4FSUA 3PTGA 2A1AB 2QLQA 4M15A 4QP1A 4A07A 5B7VA 3G5DA 4O7TA 2YDJA 2C6TA 3BIZA 1DM2A 3EZVA 3PZHA 4IB3A 4RJ7A 2AC5A 3W33A 4MNEA 3QRIA 3DBQA 2YIXA 3AD6A 5EFQA 3A7JA 1KE8A 2BRGA 2XCHA 4FUXA 3NAXA 4J98A 5CQUA 3LFFA 3EKNA 2EXCX 2VAGA 4PWNA 3NW7A 4GJ2A 2UZLA 1WBNA 2H8HA 4XG4A 5EYMA 3F7WA 4IB0A 4JRVA 3DCVA 5CEIA 5FM3A 3OWPA 4PMMA 3BWFA 3R6XA 4HCUA 3UVRA 1GJOA 5IG1A 5J9ZA 3DAJA 2BHEA 3NUSA 3AGMA 2QR8A 3ZEPA 3E8CA 2ZM4A 4DFYA 2UW7A 2JDSA 3C50A 2YHVA 4RX7A 5LCKA 5E1SA 1OKYA 2WEIA 3N51A 5LJJA 1G3NA 2NRYA 1ERKA 4R5SA 3PA5A 4L3PA 4BRXA 1P4FA 4HVDA 3WIGA 5J1VA 3PXRA 2Y7JA 2X8DA 4CCUA 3CCNA 5JZNA 4D5HA 3H3CA 3KN5A 2I0VA 1E1XA 3F88A 2Q0NA 3P5KA 1XHAA 3GC7A 3ORNA 3A7IA 4AT3A 3TUDA 4GIHA 4R7BA 3D7TB 2ITOA 4FG9A 3WYYA 3FC2A 3MFRA 1KV2A 2JLDA 4O0SA 1JAMA 4FTMA 5HORA 4X3FC 3NPCA 5C8NA 2E9PA 4BVUA 3CSVA 4R78A 1JKKA 4M0ZA 4AX8A 3P78A 4PP7A 4D2VA 3ZYAA 5EOLA 4FV9A 4CQGA 5HBEA 4FTIA 4AF3A 2YFXA 2BPMA 5JRSA 3ZSGA 4D2PA 2I0EA 3O7LB 4UMPA 3VS6A 5H8GA 4MBIA 4UV0A 3ZM4A 4AE6A 4CZTA 4FODA 4KSQA 4YJPA 2WB8A 4QPMA 5CXHA 3ULZA 3E8EA 4GMYA 2FUMA 2JD5A 5CF8A 5BVFA 3B8RA 3BCEA 4ZMEA 2B55A 4FT3A 4NH1A 3DY7A 4DGNA 3ZC5A 2W4OA 5KZIA 3FQEA 4RIOA 3N4TA 3REPA 2XVDA 3FHIA 2BROA 2WMUA 4MWIA 4L42A 1QPDA 3EOCA 4R1YA 3QWKA 4B6LA 1H0VA 1O6LA 4XG8A 3BHYA 3FMHA 4FTQA 3ZO2A 4PRJA 4JX7A 2OFUA 4RT7A 4DFZE 5AV2A 5JSMA 4KKGA 3Q3BA 4PTGA 4YU2A 2HZNA 4M13A 3LQ8A 2VNWA 4NCTC 2C47A 3HMIA 3VHKA 1KUTA 4R3PA 4E7WA 1ZOGA 5ANGA 3FKNA 5CT0A 3SOAA 2VZ6A 3LFNA 3ZUVA 4MK0A 2RFDA 4CV8A 4DT8A 3UNZA 2ETKA 4APPA 2GFCA 4RJ8A 5DR2A 4IAAA 1JQHA 2VGPA 2ITNA 4IB1A 3BV3A 1YVJA 5HCYA 3PXKA 2IG7A 1CDKA 3GUBA 4JLCA 3FLNC 4JBOA 2PVMA 4P4CA 4XX9A 4YJNA 5M08A 3S95A 2WQOA 4FNYA 3C5UA 4NJ3A 5EHLA 2C69A 5K0KA 3CEKA 3NYNA 3TEIA 2FA2A 5KE0A 4O38A 4B8LA 1Z57A 2F7XE 2XEZA 4PDOA 1Q3WA 5J7BA 4FG8A 1NVQA 3D2IA 4IAFA 2UW9A 4AZVA 4FT9A 3ZLYA 2ACXA 4ZS4A 3T3UA 3II5A 3V6SA 5IUIA 1QPJA 4QRCA 4Z55A 3BEGA 4ACHA 3CTJA 1A9UA 3LPBA 2XS0A 2PSQA 3ETAA 2W4KA 3RWPA 3SAYA 5EG3A 4BC6A 3A7GA 2BFXA 3QA0A 2XNMA 4Y8DA 2VO3A 1U4DA 4XOZA 4OTRA 2X2MA 4OTGA 4HVGA 4FKLA 5E8ZA 2W7XA 3MIYA 3QCSA 5AP7A 3HNGA 1H1RA 2JITA 4BIEA 3ZRMA 5JEBA 5DT0A 3EN6A 2FSLX 2O3PA 4BZOA 1AQ1A 4YLLA 3P7AA 2IVVA 2CGVA 3LQ5A 4OBOA 3ZUTA 4ZTQA 1ZARA 3PG3A 2XNOA 2QHNA 3OD6X 2HZIA 4R77A 1SYKA 2PU8A 3IGOA 3QZHA 4O7WA 2J5EA 5D9HA 3HDMA 5AV1A 1SVHA 3WF8A 3ZTXA 2WO6A 4MVFA 3I81A 5HIEA 4FL3A 4XLIA 3R00A 5ACBC 3FMEA 2V62A 4FVQA 3UYSA 4C4FA 5CF4A 1Z5MA 2OG8A 2W4JA 2IW9A 3JR1A 3MESA 3BE2A 3P9JA 4ZP5A 5EOBA 4I0TA 3D14A 3RP9A 3DA6A 4AGUA 4D5KA 3C4XA 5TE0A 4RVKA 4IQ6A 4ZTMA 5KUPA 4BCIA 5GJDA 3OHTA 4O0RA 1IA8A 4ITIA 2PE0A 2XEYA 3KVXA 3Q6UA 1NVRA 3TTJA 5HIBA 2UZUE 3D5UA 3E3PA 4TRLA 5TKDA 3OXIA 3EQRA 5AP1A 4FSQA 3ZXZA 5GIPE 4ZJIA 3SGCA 4PPBA 5J8IA 1IAHA 3R8PA 4XP3A 4WT6A 1M7QA 3ZFXA 4BCKA 5DWRA 2X2KA 3BU3A 5CXZA 3ORTA 5IQDA 3LCTA 5IQIA 2W99B 4JIAA 1ZXEA 3NZ0A 5HI2A 4DE4A 2G2IA 3MY5A 4CRLA 4FKTA 1YKRA 4WHZA 2Y4PA 3VN9A 3OFMA 3DLZA 5DI1A 5LWMA 3L9MA 1SVGA 4MTAA 3POOA 1REKA 5K5NA 5KCVA 3UZTA 4PP9A 4UYNA 4ZTSA 4E4XA 5M51A 3KMUA 4MH7A 4RX9A 5F95A 1H1SA 4AACA 3G6HA 4AN9A 4EZ7A 4P2KA 2PMOX 4PL5A 4H1MA 1OECA 2WMSA 3EJ1A 4TNDA 5DA3A 4G6NA 3F3UA 4KIOA 3V5QA 3R7GA 4U3YA 4BZNA 2YIWA 4FKSA 3MVHA 4F6WA 5AV0A 4IEBA 1SM2A 4XRJA 3KB7A 5AA8A 5HLWA 1H07A 3R01A 4XV1A 3F3ZA 2EB2A 3BGZA 3ZLSA 2X4FA 4DH7A 3MA3A 4QNAA 4AGDA 4IVAA 5GINE 4QYEA 2OIDA 2OH4A 2BALA 2BAJA 2X4ZA 3FMNA 4GUEA 5GIOE 4AW0A 2DUVA 3QTUA 3KF7A 5D10A 4CGAA 5DHJA 1OL6A 2PZPA 2GNGA 2X9EA 3LVPA 1FVVA 4NTTA 3D83A 4YJUA 3CLYA 3FXXA 4JL9A 4O21A 3WE8A 4BYIA 4D1SA 2CCHA 3AQVA 4AE9A 2GTNA 4UWCA 3KK8A 3TV6A 4EOMA 5CEMA 1OPJA 5EYKA 1BUHA 3A2CA 4I21A 2XJ2A 2BHHA 4WNPA 1SNUA 5CVFA 3FPQA 3VBTA 3KCFA 3VW6A 2R3OA 4M67A 2JKKA 3VRYA 2VTQA 2X6EA 3GI3A 2X9FA 3IK3A 4QYHA 4RX5A 2GS2A 3F2AA 3D94A 5FUTA 5DEWA 2CKQA 3AXWA 4CZUA 3MH1A 5KBQA 4YJSA 2IVSA 2YIRA 5F9EA 2CKPA 2RFEA 4C38A 4F09A 2YN8A 3F5GA 2X81A 3AD5A 4FTUA 5M56A 4X7QA 2W1CA 4BCOA 1KE6A 2B54A 4E4LA 5L6PA 2V5QA 5HG9A 2ITQA 2OXDA 3EN9A 4C02A 3O8TA 3SW4A 1NVSA 5HTCA 3MPMA 3I79A 4FEVA 2QOFA 2YCQA 2ZYBA 5FEQA 3E7OA 4F70A 4QQJA 2QU5A 3DAKA 2FGIA 1YHWA 3C4CA 5A9UA 4PNIA 3MBLA 3ODYX 1YDRE 3FAAA 3NYOA 3D5VA 2QR7A 3FZTA 2XNEA 3HV7A 2FSTX 3PVGA 2WOUA 3N4UA 1PXPA 4F63A 3EYGA 3FXWA 4L01A 5E8XA 1PW2A 3P0MA 5A4TA 3GNIB 5D7VA 3OZ6A 4LG4A 1JOWB 4IZAA 4C4JA 2VX3A 5IH6A 2B53A 3ITZA 2XKEA 3HMOA 2XYUA 3KGAA 2BRNA 2J7TA 4YZBA 1TVOA 3MSSA 2OJFE 3QTRA 4C36A 3FWQA 3LCKA 4L3LA 4YLJA 1ZZLA 3ALNA 3K5VA 3QZFA 5K5XA 5M06A 5GNKA 1UA2A 5HG5A 5LMKA 3K3JA 2NNWB 4CLJA 3IOPA 3QLFA 5FXSA 4A9SA 3LKMA 2HXQA 3UPXA 1M2QA 4C4IA 4DEBA 3VBYA 2IZTA 4OGRA 3HV5A 4BTFA 4XRLA 1UU3A 5HCXA 5HO6A 4D9TA 3QL8A 4U5JA 2GU8A 2VWXA 2QURA 4IANA 4JT3A 4OW8A 4W8DA 5CF6A 4RLLA 2IW6A 5AIRA 4FV6A 4C34A 2YEXA 4F7JA 4FTOA 3THBA 2OZAB 4IZYA 4TN6A 4CKJA 4PPAA 3Q4TA 4NIFA 5L6OA 2BRBA 1BX6A 3PE1A 1JKLA 5H8BA 4LGHA 5EI2A 3ORPA 5BVKA 3EQCA 1ZRZA 5EM7A 4AW1A 2CDZA 5I4NA 4DH3A 4DT9A 4QMYA 3EKKA 4UZHA 2ITWA 1MRVA 4RSSA 5F4NA 4MXAA 1JVPP 3R7YA 4JBPA 4ZLYA 4D4YA 2OWBA 3RK9A 1WVYA 5IA3A 3LM0A 1IA9A 3H0YA 2W1DA 2CKOA 3WILA 4NM3A 3DJ7A 3VF9A 5DYJA 4L43A 5CASA 2PL0A 2VX0A 4XCUA 3W2SA 4LMUA 5I9XA 4HYHA 3E3BX 4U3ZA 3WOWA 4FTNA 5KNJA 4AOJA 3W32A 3ZM9A 2IZRA 4YJVA 5I0BA 2PZIA 1XH5A 3W2RA 1PXLA 1PXKA 3F5XA 2RGPA 3ERKA 2PWLA 4IJPA 4IX4A 3V5LA 4ERKA 3OY3A 3QHRA 4HZRA 1M52A 3PJ1A 5BYZA 3RINA 5T3QA 2GNJA 2B0QA 1W83A 2X1NA 3RPVA 2IVUA 4J71A 3PJ2A 3SG8A 2E9UA 2UV2A 3SX9A 1QPEA 2YZLA 5IQFA 4PDYA 3TT0A 4QTDA 4S2ZA 4IX6A 4JX3A 2R3NA 4M7IA 5CNOA 4QMTA 5IA4A 3FBVA 2J0JA 1WMKA 5FP5A 3NCGA 3NUPA 1XO2B 4HYSA 2GQGA 5EH0A 2WMRA 4QP6A 3LAUA 1DS5A 3QQKA 3RBWA 2R3PA 4YHFA 4B4LA 4PDSA 5L8KA 4CSVA 3AD4A 4USDA 2EXMA 4QMUA 3E93A 4ZLOA 1ATPE 4MKCA 2ITZA 5CVHA 4RC4A 3W10A 4NYEA 3KEXA 3NUNA 3R7OA 2UZNA 2VTAA 4CV9A 1OIQA 3NCZA 1PY5A 2R4BA 3CKXA 2W1GA 3H30A 5HIDA 4BDCA 4DFUA 1OIUA 2ERKA 3JVRA 3COMA 3UDBA 4FOCA 4FV5A 4BGGA 1ZYLA 2UW0A 3OOGA 2ZDTA 4ZSGA 1W82A 4GG7A 3FLYA 4BTJA 1B6CB 3RCDA 4JR7A 4L44A 5CQWA 3EMGA 4WSYA 5CU2A 3RAWA 2XBAA 4WKQA 3KULA 5EM5A 4ZJJA 2XKCA 4D2TA 4OTWA 5B2MA 1FOTA 4YNOA 1YI4A 1KE7A 2NO3A 2UZEA 3EFLA 4X6QC 5EKOA 4EBWA 3TUBA 4HNFA 5HE3A 3HECA 5K0XA 4YZ9A 3LFDA 4NT4A 5BVNA 3F9NA 4CFVA 4RIXB 4A9RA 4HVHA 4DTKA 4XBRA 3I7CA 4Y72A 1JSUA 4BDIA 2YDKA 2C6KA 3QYZA 3FZ1A 3OWJA 4IAYA 4O0UA 2WTCA 4U43A 4FIGA 2C6DA 3QQLA 4GT5A 5EQPA 2VWUA 1UVRA 3PWDA 4QP2A 2QI8A 4BI1A 1AGWA 3DGKA 3WZKA 4F7LA 3QD2B 3BQCA 4GW8A 4TYEA 3GFWA 1XH7A 1K2PA 2P2IA 1UWHA 3K3IA 2RIOA 2PZ5A 3UOHA 4C35A 3C4ZA 3UQFA 3UG1A 3HRFA 3G90X 3PLSA 3LXNA 4BYJA 2OKRA 1B39A 1J7IA 4QMOA 3P7CA 4ASZA 2GCDA 3TZ8A 4A7CA 3I5ZA 4EKKA 5AAGA 5DEYA 5E8SA 4FKUA 4BZDA 4EL9A 3I60A 4IMYA 5BVEA 2R7IA 3AMYA 4FOBA 4PTCA 2VRXA 5D41A 1H08A 4BCNA 1G5SA 2VO7A 1K9AA 2VTSA 3IKAA 4P7EA 2C1BA 3UQGA 3ZH8A 4BCFA 4DLIA 4C57A 2XBJA 4FI1A 4FMQA 4TT7A 3KC3A 5M4CA 4K18A 4RPVA 3KMMA 5E92A 5JQ8A 3QD0A 3QF9A 1KSWA 5JT2A 2QHMA 3B8QA 3QKMA 1GIIA 2G2HA 1UKHA 2OJIA 4O27B 2YJRA 4X3FB 1ND4A 2JKQA 1BL6A 5KMNA 4FUYA 3LJ1A 3BBTB 4ZJVA 5CSVA 5E90A 3F2NA 3KY2A 3Q96A 3LE6A 3M1SA 4S31A 3HAMA 2ZAZA 3COKA 3P86A 5HO8A 3ANQA 4U40A 2O64A 4QTAA 1XH4A 4I20A 3V5WA 3ZBFA 4NJDA 2PE1A 4G3FA 3LIJA 4M97A 3R2YA 5DFPA 4B0GA 2AC3A 4NKAA 4BDFA 4EH7A 5LVNA 3A4PA 4QNYA 2HXLA 4F9AA 2RG5A 3FPMA 4NEUA 3NNUA 4GV1A 3QLGA 3CIKA 3UC3A 3CXWA 4GU9A 3G15A 2ONLA 1OIRA 4BDBA 4U80A 3FEGA 3R63A 4U79A 2HYYA 2F2UA 3EQDA 3GQIA 3P79A 3AC1A 3BV2A 5HCZA 3QGWA 4KBCA 4RZVA 4V05A 5AP3A 4RA4A 1UNLA 2WTKC 2WQMA 5EI6A 2BZHB 2DYLA 3VJOA 5CTPA 4U7ZA 2IN6A 3LXKA 2JKMA 2QO7A 3AT3A 5G6VA 4BDHA 4CFMA 4IVBA 2UZBA 4DG0E 4UEUA 2XRUA 3ZSIA 4CQEA 4EK3A 5BYYA 2UVZA 1JLUE 1OUKA 3SW7A 5LMAA 2XB7A 2XJ1A 1Q4LA 2XA4A 4FK6A 4KS8A 5DPVA 2VNYA 3HL7A 3HX4A 5DIAA 3DS6A 3C9WA 1ZMUA 3QX4A 4G6OA 3QRUA 5D1JA 2QLUA 3RPSA 2VTTA 5BPYA 3UYTA 1YQJA 3DB8A 3VJNA 4EZ3A 2OIQA 2HOGA 5DE2A 4Y5QA 5IA1A 1Q8TA 3TTIA 4FTLA 5CANA 3PSDA 4G3DA 4ONAA 3ZBXA 4ACGA 4I5CA 3W18A 4RIWB 4FICA 3SHEA 3C7QA 4Q9ZA 2P0CA 1YW2A 4U81A 3ROCA 3KXXA 4TPTA 4EKLA 5J5TA 3AG9A 4G5JA 5EHOA 1X8BA 3PXQA 4UXQA 3VRZA 3GGFA 3L9NA 4HNIA 3D2KA 5IQEA 2PZYA 1U54A 4GUBA 4MYGA 2Y6OA 4NKSA 2JFMA 3VUKA 2R0IA 2C5XA 4FEXA 3CQUA 1HCLA 1YDSE 4GK2A 4UY9A 5EDRA 4D9UA 4EOPA 4O0WA 2RG6A 2VTHA 4I6QA 3OTVA 5L8LA 4I5MA 1PMUA 1RE8A 3DV3A 4E6QA 2R2PA 2W9FB 3GT8A 1PRYA 3QRJA 4S30A 3TXOA 3OEZA 2PULA 4EQUA 2VTNA 5LARA 4NFMA 3R22A 4M14A 4A9YA 3IG7A 5GHVA 5L6WL 2UW3A 3U54A 4XUFA 3BEAA 3R7EA 3IOKA 2PVYA 3IPHA 5CI7A 5KKRC 4M12A 1V1KA 1XH6A 3T8OA 3VUGA 3EL7A 5I9WA 1IRKA 4IWOA 4JI9A 4G16A 2V7AA 5I3RA 1OKVA 2WQEA 4YTHA 3U4WA 3V01A 3SV0A 4O86A 2R3FA 4LOQA 1ZYSA 2Y6MA 4ITJA 2WU6A 3BLQA 3R21A 2HY0A 4G5PA 3IGGA 5IQGA 1CKPA 5JZJA 4C3FA 4ITHA 2VTOA 5C9CA 5DR9A 3MFSA 5L2SA 2HK5A 2GSFA 4TY1A 3GCUA 3OBGA 3MV5A 3U9NA 3U9CA 2C3LA 3QXPA 2O65A 3HMNA 5C8KA 3TIYA 4AFEA 3QALE 5C4LA 4XG3A 2JAVA 3OY1A 4I24A 1WBTA 1H4LA 4HPTE 5FRIA 1XJDA 2UW5A 4F1OA 3CD8A 3Q2MA 3ZC6A 4QMSA 5BUEA 4BBMA 4L7FA 3S00A 5AR8A 3W2CA 4B8MA 4MD9E 1YWVA 2WD1A 4HCVA 4YJOA 4E1ZA 2R3QA 3QGYA 3G9LX 3Q60A 4XV9A 2W96B 2YWPA 2ZVAA 3BYMA 3VS0A 5JFWA 5IH4A 3O50A 4MXYA 5AAFA 1MQ4A 2J5FA 4FTAA 5FXQA 4Z16A 4EOJA 3RM7A 4F6UA 4YJQA 5M09A 2ZJWA 3DBEA 1Y8GA 4KIKB 1J91A 2OGVA 3C51A 3T9IA 4FV8A 5HG8A 3QZIA 3B2WA 5ITAA 2C3JA 4USEA 3TZMA 3W55A 1EH4A 4MBJA 3BYUA 3FUPA 4TWPA 3DDQA 2QU6A 2YCSA 3QRTA 4DH1A 3FMLA 3LZBA 5BVDA 3O8UA 4APCA 4W4YA 4OTPA 3RNIA 3KQ7A 1OL2A 3KK9A 1BYGA 2ZV9A 5BMMA 3BELA 3OEFX 3NVKI 3LCSA 2OH0E 4D58A 2PVKA 2R3GA 2R3IA 4I4EA 4U44A 2W1ZA 2PE2A 1OIYA 4C61A 2EB3A 2XK7A 4ZSLA 4CMUA 2PMNX 2O8YA 2PHKA 2VU3A 5DRDA 3A4OX 3F7ZA 4QD6A 2RFSA 3UZRA 4DG3E 1O9UA 4AA0A 3KRRA 4IW0A 4WNOA 2WTJA 4YPSA 4YSMA 4DTAA 4FV7A 2UW4A 3R02A 3UZPA 3O8PA 4EOOA 5BUJA 2YCRA 4J53A 3E62A 4G34A 4GFOA 3DDPA 5A4EA 4E5BA 2JDVA 4N4SA 5CEQA 4BDDA 2Z7RA 3RTPA 4ZTLA 5A46A 1T46A 3M42A 3RAKA 4QTEA 3DQWA 3EYHA 1BLXA 3ZRKA 3NNXA 4WBOA 1ZYDA 3QTQA 5C27A 3ZRLA 3QUPA 3CD3A 4M69B 4WIHA 2ITYA 4FX3A 2V0DA 4DEHA 5HTBA 4DEEA 3R8LA 3MB7A 4O7YA 4O0XA 1TQPA 4FBXA 4FZAB 2PUPA 4EHGA 2ETRA 4RVLA 3FZSA 3JXWA 2JDRA 3DJ6A 5JFVA 4EHVA 1XKKA 2I40A 5HG7A 3H0ZA 4C7TA 3MVLA 2R0UA 3DOGA 4G1WA 4K33A 2ETMA 1URCA 3UMWA 2IO6A 3F5PA 3CQWA 1JKSA 3FLZA 3PXYA 3B2TA 3DK3A 3OMVA 4LRMA 3PA3A 5HE2A 3DKGA 2EVAA 2WQNA 2QOOA 3GP0A 3C0HA 3MS9A 3ORZA 1ZMWA 4DYMA 1A48A 2XNPA 3W1FA 3VUIA 4M84A 4BKYA 4DH5A 4BCQA 2P33A 2GMXA 4BICA 4CTBA 3VAPA 4ANNA 4LMNA 1GY3A 3A99A 4TWNA 5EI8A 4BIDA 5EKNA 2UW6A 4X2GA 4RWKA 5FDPA 4R5YA 3SRVB 3PY0A 3MFTA 4BGQA 4W9WA 3G9NA 1UV5A 5CALA 5HQ0A 5F94A 4UMTA 4UN0C 1Q97A 3V6RA 3WF9A 3HMPA 5IA5A 2YABA 3C4EA 3FL5A 3ANRA 3O7LD 3OXZA 3PDTA 4QYGA 1VEBA 3EB0A 3OC1A 4L00A 5AR2A 3TDVA 3MH2A 3RPOA 3FLQA 1R0EA 1H1QA 3BRBA 3EH9A 3FY0A 3CR0A 4PL3A 4WSQA 2R9SA 3SXRA 4DBXA 5LVLA 3V51A 5EYCA 4XBUA 3LHJA 3VW8A 3DB6A 3R2BA 2WFYA 3HKOA 3R1QA 5ANJA 5JKGA 3KXZA 5ANOA 5G1XA 1Q8ZA 2F7ZE 3VUMA 4C37A 4EH6A 3UO5A 4N57A 1XBCA 5IMXA 1P2AA 2C5VA 2YJSA 4IFGA 3G2FA 3TKUA 4BBEA 1P5EA 4JVGA 2AYPA 3FQHA 3NRMA 4GVJA 1OBGA 3D7TA 4O7LA 3IW5A 4O96A 5ACKA 2B9JA 3FI2A 3FDNA 4RWIA 5FD2A 4IBMA 3Q9XA 2DQ7X 1IG1A 3CPCA 3CY2A 4G3GA 3ET7A 4Y95A 2I6LA 4EBVA 4FVPA 4RA5A 5BX0A 3KN6A 2WMBA 2BILB 3GU5A 2RKUA 4RFYA 4FEWA 3E87A 1IEPA 2QKRA 4QMPA 2QC6A 3CPBA 4X6RA 4BR3A 4JRNA 4EH9A 2GDOA 3Q4ZA 5AP2A 3R0TA 2JDTA 4BY9E 4IM0A 2WMXA 3ZO4A 4ZZOA 4ASXA 2FO0A 3EN7A 2PTKA 3HRBA 4DH8A 5JRQA 3O23A 1Q24A 3PY3A 3RK7A 2XRWA 4L3JA 4TYJA 5HU9A 5KHXA 2ZB0A 4DGGA 4EH4A 3GFEA 2Z8CA 4E3CA 4F0GA 5AM7A 5DG5A 4OT6A 2C6MA 4CFXA 4ENXA 4DEIA 4RIYB 3K5UA 1SMHA 4LQMA 3UIBA 2Z60A 4IDVA 2CKEA 2YACA 4R6VA 3UBDA 4YHTA 3S1HA 5EW3A 1ZLTA 2HCKA 2QG5A 3F69A 1K3AA 5AWMA 2W9ZB 4LFIA 3SOCA 2RSVA 2PUUA 4DEAA 3BGQA 3QQUA 1UU8A 4QT1A 2WMVA 2CPKE 4G2FA 4JQ7A 4AA4A 5J9YA 3QTZA 3O96A 1ZY5A 2W0JA 5J87A 4FTTA 4E6AA 5CNNA 4IIRA 3LOKA 4H3BA 3GC0A 3EFJA 4MQ1A 5L2TA 5LOHA 1H1PA 4OUCA 3Q32A 4EYJA 1MP8A 1ZWSA 3NX8A 3MIAA 3AT4A 1LP4A 2F2CB 3PPZA 3ZCLA 1YOMA 4HYUA 1H24A 4KBKA 4FEQA 5E8TA 4DCEA 2B9FA 5KMKA 4XOYA 1Y57A 1KV1A 4MF1A 1YXVA 1BMKA 2BZIB 2IJMA 1H8FA 3BYOA 2B9IA 1JSTA 3POZA 1U5RA 4BCJA 3DJ5A 2XP2A 1Q8YA 4DFBA 4EOKA 2DS1A 1I44A 4FR4A 2XCKA 4I41A 3WZUA 4ALWA 1G8AA 2YLEA 1R1WA 2GHLA 4TL0A 4O84A 4QMXA 4YTIA 5F20A 5CSPA 2O5KA 4RWLA 5FM2A 1YWNA 3ID6C 4F6SA 3NNVA 2BDWA 2VO0A 3OS3A 3SXSA 4E4MA 3NYXA 4JQEA 2HW7A 4RGJA 2OSCA 3G33A 1PXOA 4UWBA 4KIQA 4CT1A 2J51A 3SQQA 4ZAUA 1Q8UA 3QUDA 4YGAA 3VS5A 2C6OA 3ZLXA 3I6WA 1MRUA 1CM8A 5ETCA 4BKZA 5BVOA 2PZRA 4D4SA 2OU7A 2EUFB 3CY3A 4FV1A 4PL4A 5EW8A 3AC8A 1GAGA 4P5ZA 3UP7A 4RC2A 5BUIA 4IX3A 3FJQE 3F61A 4FTRA 2CCIA 4ID7A 4YP8A 3HV4A 3S2PA 1MUOA 1V0BA 2GFSA 3ACJA 3OG7A 4WUAA 4D2WA 3WBLA 3E64A 4C33A 3GU4A 5A54A 3R9NA 3WZEA 5A14A 3MJ2A 3GC8A 2PVJA 4YR8A 4GH2A 5ICPA 4GFMA 2PUNA 3PLAE 2WQBA 3VC4A 4QOXA 3RM6A 4AS0A 5H2UA 2H34A 4WO5A 1OITA 4I22A 4USFA 3R28A 2ZM1A 4CFNA 5HEZA 4BCGA 2OO8X 4I1ZA 1H0WA 5AUZA 3NUYA 4IC7A 4F9BA 3WE4A 4BDJA 2ZV7A 4CYIA 1QMZA 3PSBA 3NYVA 4I0RA 4BF2A 3PIYA 4WRSA 2A2AA 3NMUF 2C3IB 5DGZA 3AGLA 3RHXA 2Y9QA 3ORKA 5DNRA 2YISA 3DNDA 5IQAA 5TR6A 3AT2A 1UU9A 4II5A 4DINA 2JGZA 4E26A 3DBDA 3V5JA 2HWOA 4JDIA 4L7SA 2VWBA 5HLNA 3UOJA 4XH6A 2J90A 2IW8A 4W8EA 5KMMA 4RC3A 1JBPE 3RWQA 4IAKA 4I93A 3ELJA 2EU9A 4BDKA 3F66A 4D4VA 4EOQA 1PXJA 3AC5A 4O6LA 3R9OA 3KMWA 5LCJA 3EFWA 5CAQA 3GBZA 4FIIA 2EXEA 1R39A 3U6JA 5GZ8A 4PMPA 5C4KA 4CVAA 1H28A 3KXMA 4AAAA 2OZOA 4TZRA 3TNIA 3AC3A 3R1SA 3JY9A 2J9MA 1GZOA 3TJCA 2P2HA 2V22A 3P4KA 3WF6A 4EORA 2E9NA 2OLCA 3ZU7A 4RBLA 4I4FA 2WIPA 3G6GA 3ZXTA 3GENA 1BI7A 2WTKB 4XV2A 3C1XA 3SD0A 3V5PA 3NGAA 5CI6A 5FQDC 2XK6A 3LM5A 3R30A 4CMTA 5I9YA 4DCAA 4JG6A 3NDMA 4LRKA 3CTQA 2XNNA 2P55A 3LFAA 4FV2A 3UVPA 2OXXA 2ZMCA 4QMNA 5M4UA 2ZV2A 2GQRA 4JQ8A 4D2RA 3FV8A 3DXQA 4ZSEA 3RGFA 4J8NA 4QO9A 3HZTA 4XEYA 4ERWA 3C4WA 5AUTA 1ZY4A 3NEWA 2VWVA 4MXCA 3A62A 1YI6A 3FZRA 4ZZNA 3MI9A 4Q9SA 4RLKA 2X2LA 3ODZX 3ZO1A 5IQBA 4E73A 4GYIA 3ORLA 3OUNB 4J52A 4FT7A 3VULA 1P14A 1FPUA 2VTPA 4JAJA 2YM7A 2C1AA 4ASDA 2H6DA 2QKWB 2Z2WA 3ZMMA 3IS5A 3GEQA 3QRKA 3VIDA 4E8AA 2R3LA 2BTRA 3IECA 4O83A 5E9EA 5IA2A 3NS9A 5IPJA 3C0GA 1PXNA 2RL5A 4XG6A 2ITPA 2W5AA 2X7FA 1LUFA 4FSYA 4EOSA 3ORIA 4GRBA 3O17A 4TW9A 4FTCA 4NW6A 4ZTNA 4BDAA 4LUDA 2PMLX 3LFCA 2UZVA 3P23A 5AX3A 3BE9A 2C5OA 4H58A 5LVPA 4UB7A 2BDFA 3ATSA 3DZOA 2OI4X 1JWHA 5LMKC 3NR9A 4FSMA 5E1EA 4DGOA 3Q5IA 5A6OA 2WZJA 4G9RA 1Y6AA 4YJRA 3FMDA 4YPDA 3V3VA 4O0TA 4BI2A 1Y91A 3QC9A 2XMYA 4O0YA 3PY1A 4ZSAA 4H3QA 1WBVA 4ZK5A 5A4LA 3IDBA 4IE9A 4ANMA 3F3TA 4HYIA 3TNPC 1WAKA 5CT7A 4D1ZA 4PF4A 3BI6A 4EUUA 2VUWA 2AUHA 4FZ6A 4WG4A 3VS3A 2ERZE 5CU4A 3ENMA 3VS4A 4MD7E 2ITVA 4DFXE 4EQCA 1BL7A 1UNHA 4C2VA 2YAAA 4FNWA 1WCCA 2QOHA 3U6IA 3C4FA 5KKRB 3MFUA 4QQ5A 5HBHA 5IKWA 4FZ7A 4AZEA 4NW5A 5LQFA 5DBXA 1PXIA 3EWHA 3MVJA 4TYIA 5HVKA 3PIZA 3KRWA 3U4UA 3RK5A 2I1MA 4EZ5A 5LMBA 3LFEA 2QONA 2HENA 4LL0A 3JY0A 5ETIA 4YURA 3I0OA 2WKMA 2YM4A 1M2PA 2BUJA 1I09A 1XBAA 3I5NA 4BTKA 4JG7A 1GIHA 5CS6A 3RAHA 4BHZA 3MH0A 5DR6A 3SKCA 1Q62A 1Y6BA 3CKWA 3DK7A 3PIXA 5HNIX 4CZYB 3AOXA 4DLJA 4CKRA 1IASA 3TKIA 1J1BA 4GT4A 3NSZA 2X7OA 3PFQA 4FYNA 2OZAA 5J7HA 2YAKA 4G3CA 5J95A 3VBQA 4I92A 5EQYA 5AUXA 3VNTA 3EZRA 4AZWA 4JDKA 3GCPA 2E2BA 1V0PA 3KXNA 2XIZA 3LMIA 1UWJA 3OCTA 2GNLA 4X0MA 3O51A 3ZHPC 2UZWE 1F5QA 4DFLA 4X21A 3GB2A 3QAME 2GNHA 1Q61A 3KRXA 5HE1A 3IW6A 3LFSA 3H4JA 2BKKA 2CJMA 4K77A 3HA8A 3QQJA 3FY2A 4FNZA 4FT0A 4W4VA 4YO6A 2JAMA 5L2QA 1XQZA 4A9UA 4L68A 3DXPA 1NA7A 1UU7A 4TNBA 3PRIA 4HCTA 4UBAA 4CD0A 4C3RA 2JIUA 4MWHA 5M44A 3U6HA 1DAYA 3Q4CA 4JNWA 4RQVA 3VS7A 3FL4A 3WZDA 4RFMA 3VHEA 2CNVA 4AN2A 4GG5A 5HE0A 5AMNA 3FZPA 4GU6A 2R7BA 4D1XA 2BIKB 4QMQA 4ANOA 1FQ1B 1YXTA 4E4NA 2C0TA 2QOIA 2WOTA 4BCHA 4B99A 3EFKA 5M4IA 3CQEA 4WRGA 1H26A 4L52A 5HESA 5JGAA 1VZOA 2W06A 1T45A 5HHWA 3W2OA 5DVRA 4J95A 4TYHB 3MY1A 3RPRA 2GPHA 4X2KA 1FMKA 3EQFA 5C1QB 4IAZA 2QOCA 5JK3A 4Y73A 3W2PA 3C5IA 4J96A 1OPKA 4RG0A 4XMOA 1Q99A 4LYNA 5E8VA 3UGCA 4AT4A 2J0KA 4GFGA 4O82A 3RI1A 1OGUA 2WU7A 2YWVA 2YIQA 4MNEB 5IEVA 2YIYA 1OKZA 2F4JA 3PZEA 5BYLA 3BYSA 4MXZA 4F64A 3BBWA 3U87A 3I7BA 2CGXA 2LGCA 4FK3A 4M68A 4AN3A 4G31A 4ZIMA 4BDEA 1A06A 4NU1A 4FTKA 5AADA 4Q5HA 3EN5A 2IWIA 4CYJA 4N6YA 4DITA 4F0IA 3BHTA 3MVMA 1WBPA 1JPAA 4FZFB 1J7LA 5CAVA 4TKSA 4B9DA 3ROYA 4DHFA 5I9ZA 4FKVA 3AMAA 2DWBA 2XF0A 3RCJA 3GOPA 4C59A 3A8XA 4ZY4A 1CKIA 5H3QA 1VYZA 4PMTA 5AIKA 5M57A 3EN4A 4MX9A 4QP4A 1YI3A 2XUUA 1Z9XA 3FI8A 5DH3A 4IM3A 3PVBA 3D9VA 5K3YA 4CEGA 2F9GA 3F3WA 4P90A 3G0FA 1ZZ2A 4ANSA 4RIXA 2XIXA 5T6KA 3RHKA 5C03A 1OVEA 3FSFA 4M8TA 2JBPA 3LJ0A 3QQFA 1PMEA 1W0XC 3R7IA 4K2RA 3VBWA 4ZOGA 4ALUA 4F1TA 5KMIA 5AP4A 2BMCA 2Z7SA 3UQCA 3DU8A 1PHKA 3QQHA 5EM8A 3MN3A 3UIMA 4OR5A 4PQNA 2UW8A 1GIJA 4GEOA 3UIXA 4AXAA 4F7NA 4BB4A 5HX6A 4RJ5A 4I5PA 4IFCA 4OAUC 3OOMA 5BQ0A 5HZNA 4R1VA 1GOLA 3Q9YA 5EW9A 3MDYA 4YJTA 5CAPA 4JS8A 3BQRA 4CXAA 4FL2A 2C3KA 1RW8A 2OJ9A 3TZ7A 4QMZA 2Z02A 4QYYA 4AW2A 1JKTA 3HUBA 4IVCA 4NL0A 3ZONA 4RWJA 3PP0A 3COHA 2HIWA 3TKHA 4AFJA 4Q2AA 1RJBA 3V04A 1W98A 1YHVA 3ZZEA 4J7BA 2QOBA 5JH6A 2CLXA 2ONLC 5KMOA 4IZ5A 2J2IB 4CNHA 5HNGA 2P4IA 4V04A 4F65A 2F57A 2YZAA 3OT3A 2YLFA 3G0EA 3HV6A 4IWDA 3EQPA 2KTYA 1RQQA 5AM6A 5E8YA 4C62A 3OCBA 3P1AA 4EH8A 4OTQA 4S32A 5ANDA 3LQ3A 5JGBA 3KF4A 1FMOE 4XV3A 3KXGA 5J9LA 2PK9A 4X3FA 4ZY5A 4KRDA 2XK8A 2XM9A 4LL5A 1WZYA 4CMOA 2XJ0A 2QCSA 3MY0A 4RJ4A 4F0FA 2BRHA 2ITXA 4KAOA 2C30A 4QP9A 4C4GA 4R3CA 4BWXA 4JBVA 3QTXA 2PVFA 1O6KA 4W4XA 5AJQA 2G2FA 4O2ZA 4XG7A 4YBKA 2VTRA 2IPXA 4KD1A 3UODA 5CVGA 2GNIA 4U8ZA
chains in the Genus database with same CATH superfamily
4RMZA 3O2MA 1W84A 4FL1A 3L9LA 4ALVA 4D0WA 3SLSA 5AA9A 3TWJA 3PPJA 4KKEA 1U59A 1PMVA 1PXMA 2XIRA 2YCFA 5L2IA 4FKIA 2WELA 2Y4IC 1Q3DA 2XKDA 3TYKA 2H9VA 2X39A 4YMJA 1CMKE 2OF4A 4GYGA 4J97A 4Q5EA 4TWCA 5M07A 5HVJA 4LV7A 2CN8A 3GU6A 3S4QA 3EQIA 3O71A 4FKRA 3FYJX 4QP7A 3QHWA 4CLIA 1TKIA 4QQCA 5IEXA 3BLHA 4NCTA 4A4OA 2J50A 2XZSA 5IZFA 4HOKA 5IDPA 3R04A 4KA3A 2BKZA 2AQXA 3UO4A 4LM5A 5CU3A 2C6IA 1Q41A 5TO8A 2HELA 4EC8A 4U42A 5A4CA 3DFAA 4H39A 4YZCA 5CU0A 4JJRA 4O7ZA 3KREA 1PF8A 3LMHA 3NVMB 1GZKA 2IZSA 3MH3A 4LRJA 4K0YA 3CC6A 3OTUA 1SNXA 4FTJA 3ACKA 4EYMA 4HW7A 2A19B 5DRBA 4BFMA 3RALA 1ZYJA 1UNGA 4QPAA 3FXZA 3KRLA 4AT5A 2YA9A 4CFUA 3UJGA 2WIHA 3IDPA 4L67A 2J0MB 4KINA 2A4LA 4MCVA 4RIWA 4X2JA 1ZOEA 1W8CA 5EM6A 2ITTA 3DKCA 2R64A 4EI4A 3BHVA 3NNWA 3NAYA 4R7HA 5DOSA 2X6DA 3MPAA 5FTGA 3NIEA 3M11A 5ANKA 4MAOA 5L8JA 2BR1A 3QTWA 4FIFA 2PVHA 4FKOA 1PYEA 2JIVA 1WVWA 5AP5A 5HKMA 4X2NA 3TUCA 4O7NA 3K2LA 4ANBA 4UMQA 3TJDA 5IA0A 5HVYA 1GZNA 1OZ1A 4M66A 2YM3A 4AQCA 4C2WA 3SVVA 4Y46A 4KS7A 4EC9A 4EK4A 3SA0A 2VWWA 3FLSA 4FNXA 3LLAA 3Q04A 3HYHA 5HOAA 4EK6A 2XNGA 1CKJA 4OT5A 5FEEA 3I4BA 2G9XA 3ORMA 4QMWA 3IO7A 2FSOX 2ZV8A 3DFCB 4BHNA 3QKLA 1FGIA 4E6CA 1YOJA 4M3QA 3FMMA 3HVCA 4FZDB 4FGBA 4MNFA 4UWYA 5HX8A 2UZOA 2XK4A 1XR1A 1VYWA 1XWSA 3R8MA 3PYYA 3RNYA 1ZMVA 5FLFA 4ZY6A 3CGFA 4R7IA 3GC9A 3RKBA 4K6ZA 2HWPA 4Y5HA 3VF8A 3TMOA 4EEVA 4ARKA 1DI8A 4ANQA 2HAKA 2VO6A 3OW3A 5L4QA 2PVNA 5CZHA 4U97A 3TZ9A 4D28A 3GCQA 2ITUA 5GJGA 5C01A 3W8LA 4YZDA 3ZLWA 4AU8A 4C0TA 1FBNA 1PMNA 5CX9A 5B0XA 5CENA 3QWJA 3FHRA 3VBVA 5HICA 3QBNA 3DKOA 4V0GB 3QQGA 5E91A 4F9YA 2VWYA 3R8UA 3UOKA 3V8TA 5BVWA 3VQHA 1HCKA 1MRYA 3F3VA 1JSVA 4PY1A 1VJYA 3VUDA 2BTSA 3Q4UA 4MHAA 1LEWA 3QCXA 3DKFA 3G51A 4FIJA 4I23A 4WUNA 4KBAA 4C4HA 5ETFA 3OWLA 5KZ0A 3F2RA 4IJ9A 4CFWA 2OF2A 4HZSA 4G3EA 3QD3A 4RVTA 2IZUA 1YWRA 1M7NA 1STCE 3QCQA 4Y83A 3ATTA 5AUVA 4KABA 4AXFA 1WBSA 4FKPA 3R7VA 3GVUA 4FYOA 3JUHA 5KO1A 1QL6A 3I1AA 2QO2A 1WBOA 3FMKA 5FWKK 3UPZA 1LR4A 3A61A 4G17A 5CSWA 4BWPA 4F08A 5B2LA 4AGCA 5JN2A 4FEUA 4MBLA 3FI4A 1IAJA 2RF9A 4KIKA 3CS9A 3JS2A 3LFQA 4FRFA 4I94A 4TXCA 3WIKA 1OI9A 2B1PA 3PA4A 3QA8A 4AUAA 4XS2A 5I9UA 4XYFA 2VTMA 3TV7A 3UOLA 1KWPA 4NUSA 1S9IA 1TQMA 1WFCA 4PTEA 3ZSHA 4CT2A 1TFFA 2PPQA 1QPCA 1APME 4GK4A 4OTFA 4UYAA 2I7QA 2BZJA 4RZWA 5C8MA 2BCJA 5CLPA 2WTIA 1SZMA 2W5BA 4NM5A 3PJ3A 5ANIA 4C8BA 4AXEA 5LWNA 3EQBA 1H01A 3O0GA 5E8WA 2X7GA 4DAWA 5CEPA 4M0YA 3KFAA 3JVSA 2G1TA 2W1IA 3ZO3A 5CAUA 2R3JA 2R3RA 3BU6A 4YLKA 3DQXA 3IONA 3OVVA 3RPYA 1H00A 4F99A 4WNKA 2GQSA 4NZWB 1P4OA 4RJ6A 3N4VA 5CSXA 4L9IA 3D4QA 4JIKA 5FDXA 5FP6A 3TACA 3HP2A 3NUXA 3PSCA 3UE4A 4DFNA 4TTHB 2NP8A 3RJCA 4YC8A 3TIZA 3COIA 5IF1A 3OUKA 3C0IA 3HV3A 4A06A 5KMJA 2UZTA 3P7BA 2WGJA 2V55A 3HP5A 3R71A 3NUAA 3QZGA 2FSMX 2X8IA 2UVXA 2BAKA 4IC8A 4QQTA 5M4FA 2PYWA 4UX9A 5AV4A 4RJ3A 5EK7A 4K9YA 2JFLA 4IWPA 4M69A 4EH3A 3FKOA 3TNWA 3LXLA 4EOLA 4YO4A 4EK8A 1FVRA 3SG9A 3E63A 2GHMA 3OROA 4ZEGA 3R1NA 3BPRA 4AZFA 2EWAA 3FI3A 1YHSA 4U9AA 2OFVA 2QOLA 2CGUA 3D5WA 4WOVA 4H3PA 4PDPA 1DI9A 3VVHA 4FV4A 1MQBA 3PP1A 3HA6A 1OL1A 3QU0A 4AP7A 4ACDA 2W1EA 2FVDA 1V0OA 3BGPA 5IU2A 3QUEA 4QPSA 4O81A 4NIFB 4XG9A 4GK3A 4IAIA 4N70A 3QXOA 4HGEA 5JFSA 3ZS5A 3D0EA 2A0CX 2X0GA 3PXZA 3VQUA 3TCPA 4V01A 3UTOA 4EQMA 3R9HA 5IEYA 5CEKA 3F6XA 4JOAA 1NW1A 1WBWA 4ENYA 3S0OA 4D4RA 3VUTA 2BFYA 5AEPA 4H05A 5IMEA 4A4XA 5HD7A 3CTHA 3SRVA 3ORXA 4PNKA 1JNKA 2H96A 2JKOA 1S9JA 3PJCA 4IADA 5F1ZA 5M55A 4KSPA 4W9XA 4DGLC 2BAQA 4V0GA 2PUIA 2CN5A 1B38A 3I0QA 4JR3A 2W5HA 4EUTA 2NRUA 1ZOHA 2ZMDA 3LLTA 2O0UA 3Q6WA 5A6NA 4U0IA 4BCPA 3UC4A 2Z7LA 3KVWA 2BRMA 2JC6A 1R0PA 2O2UA 3EHAA 3LMGA 3PE2A 1J1CA 3OBJA 4FKQA 4HVIA 2J6MA 2QODA 3Q9WA 4HGLA 5HO7A 3E8NA 5LVOA 4AW5A 5FTOA 2CHLA 3FQSA 3PFYA 1PYXA 3CP9A 4ACCA 5AFVA 1M17A 2OJGA 3D5XA 3PVUA 3WARA 3TM0A 4X2FA 2C0OA 4YC3A 3AC2A 2R3KA 5JFXA 3OW4A 4JDHA 1IR3A 3Q52A 3P5JC 3TI1A 3NW5A 4C58A 4EWQA 3H9RA 5D12A 4ZMFA 1KE9A 2CLQA 3C13A 4FT5A 4H1JA 4CCBA 3DLSA 5M53A 2YITA 4I6HA 2Y0AA 4BKJA 3R73A 2QO9A 5LXMA 2LAVA 4LGGA 3VBXA 4BGHA 3OP5A 2YM6A 5GJFA 4YBJA 4IXPA 2ZB1A 4IVDA 4PUZA 4EOIA 4FV0A 5J5SA 2R3HA 4DGMA 4QDVA 3EQHA 5AR7A 4FIHA 3UMXA 3IW4A 2W05A 4Y85A 2HY81 2G01A 1Q8WA 2VWZA 5B2KA 3R9RA 4DF3A 3U55A 4YNEA 4K11A 3UO6A 3PG1A 4J99A 2WXVA 3L8VA 1FVTA 3UG2A 1NXKA 2PVRA 4XP2A 4FG7A 3UNJA 4O4CA 2C0IA 2C5YA 3GXLA 3KULB 3L9PA 4O1PA 4BIBA 4IM2A 5BNJA 4RIYA 1NY3A 4AXCA 4N6ZA 4F1MA 3W0PA 2WTWA 4Z3VA 3ULIA 2W1HA 3DAEA 3UVQA 3E88A 4YTFA 4FSZA 4NK9A 5HLPA 4I6LA 4XHKB 3SDJA 5D11A 3ZDIA 2HW6A 3DNEA 5J1WA 3ENHA 4O7RA 4MUQA 4L53A 2CGWA 2QVSE 1J3HA 3EL8A 3OF0A 3PWYA 4XJ0A 3TDWA 4LOPA 3OT8A 4O22A 4AWIA 5AX9A 2WMAA 1O6YA 2C4GA 2Z7QA 4EJNA 4N0SA 4RVMA 1ZYCA 4FKJA 3H10A 3WI6A 3KL8A 4IB5A 4PX6A 2XK3A 2JBOA 2F7EE 4Z9LA 5J79A 4XG2A 3R8VA 3V8WA 1XH9A 4P5QA 4DEDA 4PV0A 4FSTA 3TNHA 1W2DA 4FC0A 1LEZA 3DPKA 3F82A 4AZSA 4O7VA 2WMTA 4EWHA 3FSKA 5HD4A 5HU3A 5IISA 2IVTA 3GQLA 4OTIA 5D7AA 2QQ7A 4K1BA 3Q9ZA 5AR3A 2Q0BA 3IW7A 4EHEA 2XALA 3Q2JA 1HOWA 5CAOA 2C6EA 2FB8A 4UMRA 2W1FA 5AR5A 4MQ2A 4TYGA 5HTIA 3DT1A 4D0XA 4QEBA 2J4ZA 4CG8A 3H9OA 5CF5A 2CNUA 5FBOA 2WAJA 3L8XA 3A7FA 3BWJA 1OUYA 1TZDA 3LFBA 2W17A 1U5QA 5CSHA 5CZIA 5BV3A 3GU8A 3RAIA 2GNFA 4ORKA 4HGTA 2XNBA 3HMMA 3FLWA 3WF5A 5DT3A 2CMWA 3DTCA 3F5UA 3NLBA 3AMBA 4NSTA 4YZNA 5A4QA 5LVMA 1YRPA 4FF8A 3U8WA 2XH5A 3R83A 2WPAA 3TNQB 4X3JA 5TOZA 3RVGA 5ANEA 4OBPA 3WZJA 2I0YA 1PKDA 3ZOSA 3BLRA 3CJFA 4YUQA 4I6BA 5CEOA 5FEDA 3CJGA 3VS2A 1E9HA 4FIEA 2WNTA 3E92A 3QKKA 3SC1A 4EK5A 1NT2A 1CTPE 3TG1A 4GT3A 4UXLA 3PUPA 2RFNA 2VTLA 1H27A 4I6FA 2P3GX 5EQEA 4IWQA 1GZ8A 4JXFA 2OICA 1VR2A 2WMWA 4MXOA 3W16A 1L3RE 4WNMA 5CWZA 3K54A 5FXRA 4DG2E 4JMQA 5AP6A 4KUJA 4NTSA 5IDNA 4MEDA 4QMVA 5AUWA 2V7OA 4G9CA 2JIIA 3CE3A 4KB8A 3W8QA 4CTCA 3NIZA 4QTBA 1BI8A 2E9OA 3Q5ZA 2PY3A 1F0QA 4FSRA 5A3XA 5BMSA 3MJ1A 2E9VA 2X0OA 1OL7A 2JDOA 1M14A 2XIKA 3Q53A 3LCDA 2FYSA 5CY3A 3TN8A 4XLVA 3ZFYA 2YM5A 2CNQA 3NWWA 2XKFA 4RQKA 4WA9A 5EYDA 4E20A 1FGKA 5JMSA 2Y8OA 3BKBA 4GSBA 1LPUA 3A7HA 5T68A 2XM8A 2AEGA 4F4PA 1AD5A 4IACA 1YXUA 3R7UA 4JG8A 1PKGA 5EDPA 3OCGA 5DLSA 5DMZA 5K9IA 2Q83A 3DTWA 2YERA 2ZM3A 2YDIA 4WG3A 4W4WA 5DT4A 1L8TA 5I5ZA 1E1VA 4D55A 4L45A 4GVAA 4FA2A 3QFVA 2QOKA 4LOOA 4BTMA 4E6DA 1RDQE 1TQIA 2OIBA 4PPCA 5K4IA 2BZKB 2XIYA 4QTCA 4ZSJA 5JQ5A 3QCYA 3ML1A 2X0QA 2VX1A 4OBQA 3HDNA 1CSNA 3L1SA 1H25A 4MXXA 4WBBB 3DBCA 4RFZA 3UIUA 4GKIA 4G6LA 4ZLZA 2Y4IB 2CSNA 4BCMA 1OM1A 3KCKA 2PVLA 5HBJA 4C3PA 4CG9A 3L8SA 3RZFA 3ZEWA 4D2SA 4QMLA 4S33A 4EH2A 3L8PA 4EONA 2B52A 4GL9A 4LUEA 1W7HA 4BN1A 5FTQA 3GCVA 4F7SA 3BU5A 4FKGA 4MF0A 3WYXA 2NPQA 4WG5A 4BBFA 2B9HA 4QYFA 5KMLA 3UP2A 1U54B 1WVXA 4UALA 5TT7A 4QP3A 3EIDA 2BDJA 2FH9A 3ZDUA 3HEGA 1YXSA 2WTDA 3H9FA 4H36A 4IZ7A 4AAYA 4AG8A 4CRSA 4ZTHA 5AR4A 2XK9A 3D15A 3LCOA 4AOIA 4BWKA 3VO3A 2HZ4A 3MW1A 3FMJA 5AAEA 5C26A 3O5AA 3MTFA 1J7UA 2BVAA 3DXNA 4RRVA 2QD9A 4AA5A 3OWKA 4GIIA 1KE5A 5HGIA 5I3OA 3N9XA 2OBJA 3DBFA 4U6RA 4PMSA 3IDCA 3PXFA 4Z7HA 2KULA 3HAVA 4LV5A 4FV3A 1OBDA 4GJ3A 1REJA 2GS6A 1OMWA 5FBNC 2O63A 2VTJA 4EHZA 3KIOC 2R5TA 5GZ9A 2C6LA 4FVRA 4TWOA 1G8SA 3PPKA 4QP8A 3MYGA 1M2RA 2OW3A 4E5WA 4Z7GA 1F3MC 2GS7A 4L6QA 2BIYA 3QTIA 3OCSA 3PVWA 1KOBA 4EH5A 4HGSA 3EQGA 4ASEA 4ACMA 5L2WA 4UMUA 3VWAA 4B7TA 3D7ZA 3BX5A 4NM7A 4NWMA 4O4FA 5AV3A 5KBRA 2G15A 2VD5A 3E8DA 3M2WA 4IDTA 3MPTA 4U41A 5E4HA 3BZ3A 4A4LA 5KHWA 5CU6A 1QCFA 3E5AA 2WEVA 3QC4A 4ZXTA 3U51A 1XBBA 3KU2A 5DN3A 4AOTA 3QD4A 4JAIA 3GCSA 4FKWA 3MWUA 1OB3A 1KOAA 1URWA 2VGOA 3S3IA 4GKHA 5E7RA 4BL1A 5JGDA 4O91A 1XH8A 3VUHA 1BKXA 2VN9A 4FSNA 2UVYA 1PJKA 2B7AA 5FGKA 5H8EA 4YSJA 1Y8YA 3ZZWA 4DBNA 3IQ7A 4OTHA 2I0HA 1SVEA 3QX2A 5EHYA 5H9BA 3V8SA 2OJJA 4KIPA 4YTCA 5E8UA 4YZMA 3NFGB 2J0LA 4KRCA 4F9CA 2ESMA 3BHUA 1YXXA 4IHPA 1OKWA 3IW8A 1YDTE 3BYVA 2UZDA 4NM0A 3KKVA 4ZZMA 4QDEA 3KXHA 1ZAOA 3CGOA 4L46A 2GTMA 3DK6A 2GHGA 2VTIA 3TL8A 4KNBA 3V5TA 4AGWA 5IQCA 4KWPA 4L8MA 3MTLA 2ZOQA 3QTSA 4O1OA 4RX8A 5AP0A 2JEDA 2QOQA 4IX5A 4YHJA 3T3VA 3HRCA 4QMMA 5ETAA 3FKLA 4OAVB 4EJ7A 3P08A 3AC4A 5AUUA 4DTBA 5IQHA 2YM8A 5GZAA 3ALOA 3I6UA 1R78A 4FSWA 3KA0A 5FG8A 3SXFA 3W0SA 2PMIA 3LW0A 3VS1A 1OPLA 3ZFMA 4JBQA 3UDZA 2X8EA 4MD8E 3DZQA 5I9VA 4A9TA 4XNEA 3FYKX 5IH5A 4HPUE 4CKIA 4E93A 4NFNA 4DEGA 2QNJA 4UZDA 4AZTA 4F9WA 3W0OA 4U45A 4I5HA 2XAOA 1GNGA 3E7VA 2B4SB 4HJOA 4LI5A 3UNKA 3OXTA 2WMQA 4LGDA 4BDGA 4DC2A 5L3AA 3PJ8A 4KKHA 3HUCA 4I3ZA 4JDJA 5AUYA 4IH8A 4GCJA 2OK1A 4J1RA 3MA6A 3RZBA 4OLIA 3R8ZA 3WF7A 2OXYA 3RMFA 2C68A 3MB6A 2WHBA 5EDQA 4ZS0A 4CFFA 2VV9A 4FE2A 3GOKA 3T9TA 2WTVA 3FZOA 5HNBA 5CYIA 4F78A 1UKIA 4FGRA 3FE3A 4K8AA 3A60A 1Q5KA 4I0SA 3R9DA 4O6EA 4DN5A 2XYNA 2UUEA 4OTDA 3A8WA 3MGYA 4ANLA 2HZ0A 4ZTRA 2J0IA 3W0RA 5K4JA 2QG7A 3R1YA 4YC6A 4S34A 3JPVA 3W2QA 2ZDUA 4XP0A 4DA5A 1U46A 3JYAA 4R8QA 3PRFA 5TF9A 3NW6A 3TV4A 3QYWA 1FINA 2VWIA 3BHHA 5KX8A 1OL5A 3HLLA 3GU7A 4BI0A 1YOLA 4O7SA 4GS6A 4O0VA 2F49A 1H1WA 4J8MA 2R3MA 4O2PA 3ZUUA 3CBLA 4C4EA 4TYHA 4WD5A 3HGKA 5IUGA 5IUHA 3KRJA 2C5NA 2SRCA 4HVSA 4R3RA 2REIA 3LXPA 1R3CA 3FC1X 3LJ2A 3NUUA 4E5AX 4LV8A 2A27A 1DAWA 4FSUA 3PTGA 2A1AB 2QLQA 4M15A 4QP1A 4A07A 5B7VA 3G5DA 4O7TA 2YDJA 2C6TA 3BIZA 1DM2A 3EZVA 3PZHA 4IB3A 4RJ7A 2AC5A 3W33A 4MNEA 3QRIA 3DBQA 2YIXA 3AD6A 5EFQA 3A7JA 1KE8A 2BRGA 2XCHA 4FUXA 3NAXA 4J98A 5CQUA 3LFFA 3EKNA 2EXCX 2VAGA 4PWNA 3NW7A 4GJ2A 2UZLA 1WBNA 2H8HA 4XG4A 5EYMA 3F7WA 4IB0A 4JRVA 3DCVA 5CEIA 5FM3A 3OWPA 4PMMA 3BWFA 3R6XA 4HCUA 3UVRA 1GJOA 5IG1A 5J9ZA 3DAJA 2BHEA 3NUSA 3AGMA 2QR8A 3ZEPA 3E8CA 2ZM4A 4DFYA 2UW7A 2JDSA 3C50A 2YHVA 4RX7A 5LCKA 5E1SA 1OKYA 2WEIA 3N51A 5LJJA 1G3NA 2NRYA 1ERKA 4R5SA 3PA5A 4L3PA 4BRXA 1P4FA 4HVDA 3WIGA 5J1VA 3PXRA 2Y7JA 2X8DA 4CCUA 3CCNA 5JZNA 4D5HA 3H3CA 3KN5A 2I0VA 1E1XA 3F88A 2Q0NA 3P5KA 1XHAA 3GC7A 3ORNA 3A7IA 4AT3A 3TUDA 4GIHA 4R7BA 3D7TB 2ITOA 4FG9A 3WYYA 3FC2A 3MFRA 1KV2A 2JLDA 4O0SA 1JAMA 4FTMA 5HORA 4X3FC 3NPCA 5C8NA 2E9PA 4BVUA 4DDGA 3CSVA 4R78A 1JKKA 4M0ZA 4AX8A 3P78A 4PP7A 4D2VA 3ZYAA 5EOLA 4FV9A 4CQGA 5HBEA 4FTIA 4AF3A 2YFXA 2BPMA 5JRSA 3ZSGA 4D2PA 2I0EA 3O7LB 4UMPA 3VS6A 5H8GA 4MBIA 4UV0A 3ZM4A 4AE6A 4CZTA 4FODA 4KSQA 4YJPA 2WB8A 4QPMA 5CXHA 3ULZA 2NYAA 3E8EA 4GMYA 2FUMA 2JD5A 5CF8A 5BVFA 3B8RA 3BCEA 3BLAA 4ZMEA 3AKJA 2B55A 4FT3A 4NH1A 3DY7A 4DGNA 3ZC5A 2W4OA 5KZIA 3FQEA 4RIOA 3N4TA 3REPA 2XVDA 3FHIA 2BROA 2WMUA 4MWIA 4L42A 1QPDA 3EOCA 4R1YA 3QWKA 4B6LA 1H0VA 1O6LA 4XG8A 3BHYA 3FMHA 4FTQA 3ZO2A 4PRJA 4JX7A 2OFUA 4RT7A 4DFZE 5AV2A 5JSMA 4KKGA 3Q3BA 4PTGA 4YU2A 2HZNA 4M13A 3LQ8A 2VNWA 4NCTC 2C47A 3HMIA 3VHKA 1KUTA 4R3PA 4E7WA 1ZOGA 5ANGA 3FKNA 5CT0A 3SOAA 2VZ6A 3LFNA 3ZUVA 4MK0A 2RFDA 4CV8A 4DT8A 3UNZA 2ETKA 4APPA 2GFCA 4RJ8A 5DR2A 4IAAA 1JQHA 2VGPA 2ITNA 4IB1A 3BV3A 1YVJA 5HCYA 3PXKA 2IG7A 1CDKA 3GUBA 4JLCA 3FLNC 4JBOA 2A98A 2PVMA 4P4CA 4XX9A 4YJNA 5M08A 3S95A 2WQOA 4FNYA 3C5UA 4NJ3A 3PUFC 5EHLA 2C69A 5K0KA 3CEKA 3NYNA 3TEIA 2FA2A 5KE0A 4O38A 4B8LA 1Z57A 2F7XE 2XEZA 4PDOA 1Q3WA 5J7BA 4FG8A 1NVQA 3D2IA 4IAFA 2UW9A 4AZVA 4FT9A 3ZLYA 2ACXA 4ZS4A 3T3UA 3II5A 3V6SA 5IUIA 1QPJA 4QRCA 4Z55A 3BEGA 4ACHA 3CTJA 1A9UA 3LPBA 2XS0A 2PSQA 3ETAA 2W4KA 3RWPA 3SAYA 5EG3A 4BC6A 3A7GA 2BFXA 3QA0A 2XNMA 4Y8DA 2VO3A 1U4DA 4XOZA 4OTRA 2X2MA 4OTGA 4HVGA 4FKLA 5E8ZA 2W7XA 3MIYA 3QCSA 5AP7A 3HNGA 1H1RA 2JITA 4BIEA 3ZRMA 5JEBA 5DT0A 3EN6A 2FSLX 2O3PA 4BZOA 1AQ1A 4YLLA 3P7AA 2IVVA 2CGVA 3LQ5A 4OBOA 2X0PA 4ZTQA 3ZUTA 1ZARA 3PG3A 2XNOA 2QHNA 3OD6X 2HZIA 4R77A 1SYKA 2PU8A 3IGOA 3QZHA 4O7WA 2J5EA 5D9HA 3HDMA 5AV1A 1SVHA 3WF8A 3ZTXA 2WO6A 4MVFA 3I81A 4LDTA 5HIEA 4FL3A 4XLIA 3R00A 5ACBC 3FMEA 2V62A 4FVQA 3UYSA 4C4FA 5CF4A 1Z5MA 2OG8A 2W4JA 2IW9A 3JR1A 3MESA 3BE2A 3P9JA 4ZP5A 5EOBA 4I0TA 3D14A 3RP9A 3DA6A 4AGUA 4D5KA 3C4XA 5TE0A 4RVKA 4IQ6A 4ZTMA 5KUPA 4BCIA 5GJDA 3OHTA 4O0RA 1IA8A 4ITIA 2PE0A 2XEYA 3KVXA 3Q6UA 1NVRA 3TTJA 5HIBA 2UZUE 3D5UA 3E3PA 4TRLA 5TKDA 3OXIA 3EQRA 5AP1A 4FSQA 3ZXZA 5GIPE 4ZJIA 3SGCA 4PPBA 5J8IA 1IAHA 3R8PA 4XP3A 4WT6A 1M7QA 3ZFXA 4BCKA 5DWRA 2X2KA 3BU3A 5CXZA 3ORTA 5IQDA 3LCTA 5IQIA 2W99B 4JIAA 1ZXEA 3NZ0A 5HI2A 4DE4A 2G2IA 3MY5A 4CRLA 4FKTA 1YKRA 4WHZA 2Y4PA 3VN9A 3OFMA 3DLZA 5DI1A 5LWMA 3L9MA 1SVGA 4MTAA 3POOA 1REKA 5K5NA 5KCVA 3UZTA 4PP9A 4UYNA 4ZTSA 4E4XA 5M51A 3KMUA 4MH7A 4RX9A 5F95A 1H1SA 4AACA 3G6HA 4AN9A 4EZ7A 4P2KA 2PMOX 4PL5A 4H1MA 1OECA 2WMSA 3EJ1A 4TNDA 5DA3A 4G6NA 3F3UA 4KIOA 3V5QA 3R7GA 4U3YA 4BZNA 2YIWA 4FKSA 3MVHA 4F6WA 5AV0A 4IEBA 1SM2A 4XRJA 3KB7A 5AA8A 5HLWA 1H07A 3R01A 4XV1A 3F3ZA 2EB2A 3BGZA 3ZLSA 2X4FA 4DH7A 3MA3A 4QNAA 4AGDA 4IVAA 5GINE 4QYEA 2OIDA 2OH4A 2BALA 2BAJA 2X4ZA 3FMNA 4GUEA 5GIOE 4AW0A 2DUVA 3QTUA 3KF7A 5D10A 4CGAA 5DHJA 1OL6A 2PZPA 2GNGA 2X9EA 3LVPA 1FVVA 4NTTA 3D83A 4YJUA 3CLYA 3FXXA 4JL9A 4O21A 3WE8A 4BYIA 4D1SA 2CCHA 3AQVA 4AE9A 2GTNA 4UWCA 3KK8A 3TV6A 4EOMA 5CEMA 1OPJA 5EYKA 1BUHA 3A2CA 4I21A 2XJ2A 2BHHA 4WNPA 1SNUA 5CVFA 3FPQA 3VBTA 3KCFA 3VW6A 2R3OA 4M67A 2JKKA 3VRYA 2VTQA 2X6EA 3GI3A 2X9FA 3IK3A 4QYHA 4RX5A 2GS2A 3F2AA 3D94A 5FUTA 5DEWA 2CKQA 3AXWA 4CZUA 3MH1A 5KBQA 4YJSA 2IVSA 2YIRA 5F9EA 2CKPA 2RFEA 4C38A 4F09A 2YN8A 3F5GA 2X81A 1G8JA 3AD5A 4FTUA 5M56A 4X7QA 2W1CA 4BCOA 1KE6A 2B54A 4E4LA 5L6PA 2V5QA 5HG9A 2ITQA 2OXDA 3EN9A 4C02A 3O8TA 3SW4A 1NVSA 5HTCA 3MPMA 3I79A 4FEVA 2QOFA 2YCQA 2ZYBA 5FEQA 3E7OA 4F70A 4QQJA 2QU5A 3DAKA 2FGIA 1YHWA 3C4CA 5A9UA 4PNIA 3MBLA 3ODYX 1YDRE 3FAAA 3NYOA 3D5VA 2QR7A 3FZTA 2XNEA 3HV7A 2FSTX 3PVGA 2WOUA 3N4UA 1PXPA 4F63A 3EYGA 3FXWA 4L01A 5E8XA 1PW2A 3P0MA 5A4TA 3GNIB 5D7VA 4BJJB 3OZ6A 4LG4A 1JOWB 4IZAA 4C4JA 2VX3A 5IH6A 2B53A 3ITZA 2XKEA 3HMOA 2XYUA 3KGAA 2BRNA 2J7TA 4YZBA 1TVOA 3MSSA 2OJFE 3QTRA 4C36A 3FWQA 3LCKA 4L3LA 4YLJA 1ZZLA 3ALNA 3K5VA 3QZFA 5K5XA 5M06A 5GNKA