4BDIA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
307
structure length
290
Chain Sequence
MSVYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 290
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bdiA01
2HAKA 3OMVA 3FI2A 4ACCA 1KE7A 3P7CA 4YJTA 3COMA 3EQHA 4FTAA 4YLKA 5CALA 5E1SA 1IR3A 3OXZA 4ZP5A 2I0VA 2OJIA 4M66A 4OAUC 4M67A 4FR4A 3D0EA 2QHNA 4RX7A 2R3KA 3D2IA 4AGCA 3M1SA 5FGKA 1YDRE 2BVAA 3PVUA 4ZMEA 3RI1A 4AN3A 4AW0A 2OIQA 2X8EA 4G3EA 5FDXA 4OBPA 4XP3A 5TO8A 2HENA 2Y4PA 3ORPA 3HUBA 1CKIA 4KSQA 4BWXA 4FV3A 2WOUA 2PVRA 4DGLC 3QTXA 1NA7A 4NM0A 5HEZA 3RZFA 2GTNA 5HG7A 4EZ5A 4RC4A 3RGFA 3U9NA 4Z3VA 2XKDA 4M8TA 2WAJA 3TXOA 4ZJIA 1YXXA 2QKRA 4AT5A 5FXRA 4CFFA 2ZV7A 4ACGA 4YJQA 3NYVA 4MQ1A 3RMFA 2CJMA 3QWJA 3FZOA 5HIBA 2C69A 4C8BA 2A19B 5EW8A 4APCA 4NW5A 4EORA 3W2CA 3QQUA 4QYHA 2RFEA 3MIYA 3PA4A 4KWPA 4FKIA 4BIDA 1YXUA 5HTBA 2PY3A 1YDSE 4LMNA 4UWCA 1YOLA 3QKLA 1XBCA 3W8LA 1KSWA 3OUNB 3DPKA 2GQSA 2SRCA 3F9NA 3KRWA 2XJ1A 3KXGA 4BB4A 4O7SA 4CG8A 1XH8A 2YZAA 3H9OA 3QRIA 4FI1A 1XH4A 3H0ZA 3KY2A 4FNYA 4NFMA 4V0GA 5FXQA 4EYJA 3VJOA 5ACKA 4HVGA 1SYKA 5EI2A 3HUCA 4DTKA 4ZTMA 1U59A 4NJDA 1IAHA 3U4WA 1SNXA 5GJDA 4BWPA 4FSRA 4PMTA 5A54A 3SXFA 4U6RA 4C3FA 4DBXA 3EYGA 4TYJA 2VTTA 4F1TA 4R8QA 5F95A 5M44A 5GIOE 4YPDA 4U43A 4N70A 4H3PA 3U51A 2PMIA 4M0YA 1UU9A 4ITIA 4YO6A 3F2RA 3MFSA 4DFZE 4BDJA 4C4HA 2C3IB 4IVCA 3AGMA 3G15A 3OROA 5IUIA 4DYMA 3LKMA 4I3ZA 4IHPA 3FLSA 1KE8A 3NWWA 2YM3A 4QPSA 1J7UA 3FSFA 2J7TA 4I5HA 4JG7A 4OTFA 4U81A 3QYZA 3ZO4A 4B99A 5L8LA 1WFCA 4L68A 5EQEA 4C37A 2Y6MA 2CGUA 4D28A 3K5VA 5KMIA 2H9VA 5CT0A 5A3XA 2XRUA 2I40A 3OTUA 4IX5A 3UDBA 4E6AA 3EN9A 2J6MA 3G5DA 4NJ3A 2ITZA 5HX8A 4P2KA 2WTDA 5KKRC 3S3IA 4D4YA 3DU8A 2PWLA 3DLSA 3OWKA 2PZ5A 4JI9A 3W8QA 1RW8A 1OI9A 4QYEA 4MAOA 4MNEB 4O7VA 2CGXA 2YZLA 3DAEA 3ZZWA 3RAHA 2PSQA 3R30A 5IH6A 2QU5A 4WOVA 4O22A 4YTFA 4PDOA 5TT7A 3D2KA 4K18A 5JK3A 4F6UA 5FTQA 3G33A 3NAYA 4MK0A 5M56A 4ZY4A 4JLCA 4UZDA 4Y5QA 3NS9A 1YDTE 3SG8A 2EXMA 4MQ2A 5LVNA 2WMUA 3LFQA 4BC6A 4C02A 4D9TA 3MY0A 3QTUA 2WU6A 2V7OA 3QTQA 4S32A 2P2IA 4E6CA 4A06A 4TXCA 4ZZOA 3RVGA 5I9WA 3FKOA 2GHMA 4RWKA 1Y8GA 4O6EA 4ZSEA 5K4JA 4XOYA 3UIMA 1ZRZA 2DWBA 5E8VA 3HV5A 5C03A 1OL7A 3O50A 3R9OA 1ZOHA 4JT3A 3TIZA 3RHKA 4JQEA 1QPJA 3O7LB 2WTKB 4G3DA 2XRWA 4FA2A 5CU3A 4D4RA 2R3JA 3R7YA 5HTCA 2W99B 4RIWB 3AOXA 3DY7A 4FVRA 1OMWA 4I23A 3SQQA 2C68A 2JBOA 2F7ZE 3PWYA 1ATPE 2VZ6A 4I20A 4OBOA 5L2WA 1OKWA 3FL5A 1WBVA 2VWBA 4OT5A 3ODYX 3SA0A 4PWNA 5FXSA 4BDHA 4GKIA 1W7HA 2WMQA 1FGIA 3BYMA 1ZYCA 2R3HA 2YM4A 3GT8A 4N6YA 4NM7A 4EC8A 1T45A 4H1JA 3NVMB 1Q24A 2A0CX 5AP6A 2J51A 5AV2A 3FI8A 3UNKA 3U8WA 4FTKA 4O82A 3BLQA 4QMYA 2H96A 3E7OA 2HWPA 4H1MA 4D5KA 3ZM9A 3R63A 3OVVA 3AD6A 3C1XA 2HZIA 5IEXA 2JIIA 2QKWB 3EQCA 3FLZA 4B8MA 4CQGA 3MVHA 4ZEGA 4G31A 1W83A 5BVKA 1SM2A 4J97A 4QMLA 1IAJA 3HMPA 3DBQA 4M69A 5IQDA 3CSVA 2F9GA 3LMIA 2R3OA 3M42A 2GQRA 4Z7GA 2XM8A 4IAKA 4MXYA 3KRLA 3VF8A 3LQ3A 2ETKA 4I5CA 3TJDA 1WZYA 5HD7A 1FQ1B 1MQBA 2Y8OA 3AC2A 3BHHA 5C9CA 2R9SA 4FODA 3R8ZA 3CIKA 5K3YA 4O7RA 2HW7A 3UP2A 3F3ZA 4KKHA 1NVQA 2VTOA 4UWBA 4XJ0A 2ZV2A 4AZVA 3LJ1A 5BYZA 5L6WL 2O3PA 4GUBA 1E1XA 2FO0A 4JG8A 4O0XA 4YJPA 3D5XA 3ORZA 2W06A 3QHRA 4H58A 5AV1A 1CDKA 5HQ0A 3U54A 2YIRA 1O6YA 3I0OA 2VUWA 2QHMA 4O91A 3P78A 5CNNA 4YC8A 3CKWA 3PA3A 2ZAZA 2ZM4A 3OWLA 3R8MA 3W2RA 2XMYA 3PPJA 3HRCA 3KEXA 4ERKA 2VTSA 5DHJA 5DVRA 4DFBA 3KVXA 4JBOA 4Q2AA 5EM8A 3MA3A 1Z9XA 4OTDA 4EH5A 1PMVA 5EDPA 1OPJA 5LVPA 4O7WA 2ZM3A 3ANQA 5KCVA 1K9AA 3LFEA 2NO3A 4TNBA 3Q5ZA 4CFMA 2ZMCA 3KK8A 4PNIA 3FKNA 2YWPA 2XUUA 4DEBA 4AZFA 4FEWA 1Z5MA 4LV5A 1WVYA 4DT9A 4CZUA 4EONA 2RL5A 3WOWA 4QQJA 4KBCA 3R7VA 4HGSA 3HP5A 3CQEA 4JBQA 4PQNA 5J1WA 5CU0A 2C5YA 5HE3A 4WBOA 1WVWA 2EB2A 2P3GX 2XF0A 4GMYA 4M97A 3ORKA 2CNUA 2IPXA 4EHGA 2P55A 4X3FC 3OY1A 3DKGA 4I5MA 5EQYA 1L8TA 3E5AA 1DAYA 1XJDA 2VWIA 3NUYA 3SDJA 4AAAA 3CE3A 4XS2A 4R7IA 4UV0A 4O7NA 4O83A 3PJ2A 5A4QA 1H1RA 1JSUA 2QR7A 4OTWA 5FLFA 2BZJA 3IS5A 3A7JA 3ZUVA 3OW3A 4WT6A 4AOTA 2C0OA 2X9FA 3R1QA 3TL8A 4ZSAA 2UZVA 4JG6A 1W82A 2PUUA 2XNNA 4RIXB 1GZNA 3IECA 3ZSIA 4C3RA 5JSMA 4CVAA 3CQUA 3EFWA 4HYIA 5HE0A 4G9RA 4EJ7A 4BVUA 2ITNA 3EH9A 4RFMA 4X3FA 3G6GA 3V5JA 5EDQA 3VJNA 4NCTC 5A14A 2LAVA 5IH5A 4JS8A 3PRFA 4UWYA 4EOLA 1H8FA 3WYXA 5CF5A 3Q9ZA 3ZUUA 3Q3BA 2PVNA 2W1IA 3QQHA 3BQCA 4FOCA 4MXOA 4K8AA 4PP9A 2J5EA 4A7CA 3QC9A 5BYYA 3D5WA 3I6UA 5CXZA 1G8AA 1W84A 3ZSHA 3O23A 4O96A 1OBGA 4O86A 2XBJA 5LMKC 5IEYA 4PV0A 3H9FA 2BR1A 3KCFA 2ZDTA 3DZQA 4NCTA 4XMOA 5AR3A 1P14A 4ZK5A 3DAJA 3PP1A 4XH6A 2XBAA 5EHOA 4BL1A 4CYJA 4UMTA 4J98A 2RFSA 2BRMA 4EC9A 3A7IA 4G34A 2HOGA 3PDTA 5IQFA 3R6XA 4AZTA 4LFIA 1JWHA 1PXPA 3KULA 4DAWA 3KN6A 3LCOA 3TJCA 3CS9A 1IA9A 4CRLA 3CGFA 1DI9A 5E8WA 3TZ7A 1WAKA 3PYYA 3DBEA 3OTVA 5K9IA 1RJBA 1Q41A 3QALE 5I9YA 5LMKA 4FT9A 2OH0E 2UZBA 4TKSA 4AA5A 4EOKA 2GHLA 4G3FA 3SG9A 5AR7A 4ACMA 3A99A 5DFPA 5CENA 4ANMA 3CLYA 1YWRA 3MJ1A 1H24A 2C6DA 2R3IA 3F3WA 3ZDUA 4U44A 3BCEA 4ZTNA 3N51A 3NNUA 3BHVA 3KGAA 3QA0A 3QCSA 3GUBA 3HRFA 4TPTA 4L3LA 2R3FA 3DA6A 3O8UA 3ACJA 3KU2A 3V8TA 3PY1A 3ALOA 2QOIA 4A4OA 3PE2A 3PSBA 1QPEA 4L43A 4C61A 4BHNA 4MH7A 2G2HA 3W16A 1QL6A 2HELA 2Y9QA 3GQLA 3IGGA 5KX8A 1UV5A 2FSOX 2O64A 1OZ1A 3DJ7A 2X39A 2OJFE 3TV6A 2X6EA 1S9JA 3V04A 5J9LA 3TDVA 3MFUA 4MF1A 5CI7A 3PXFA 1B38A 2DUVA 4HVDA 2BIYA 2O63A 2ZMDA 5HD4A 3V5WA 3MY1A 4QTBA 1ZOEA 4KIKA 3O17A 4IAFA 5J8IA 4ID7A 4D2SA 1YVJA 4IAYA 4O0SA 4DFXE 1ZZ2A 2OF2A 4F4PA 3MPMA 4RGJA 5HBJA 4FZDB 2FSLX 3D5UA 3DBFA 3GU6A 3QCXA 5AUWA 3ZO3A 4AX8A 4FOBA 4X2KA 5CNOA 3C7QA 3GU8A 2WTJA 3P79A 3HNGA 3QTSA 3QUPA 4FKPA 4IDVA 5M4CA 4ASZA 4FT7A 4BDDA 3JR1A 4E93A 3E3BX 3BBWA 1HCLA 2ZB1A 5IH4A 1CM8A 1JBPE 2G9XA 5CQUA 4GK4A 3VS6A 2CPKE 4EBWA 2UVXA 3HECA 4C36A 2X2MA 4FG8A 5T6KA 4J96A 2QOQA 4EQMA 3S0OA 3NCZA 4PMSA 2QO9A 4HPTE 3BZ3A 3KXXA 2YA9A 1Q62A 4FC0A 3GC8A 4QRCA 1SVGA 1PXKA 3MVMA 5EQPA 2OLCA 5HBEA 2GNIA 1JLUE 1V0PA 3ZBXA 2QC6A 2OK1A 4MD7E 4KB8A 2CGWA 4E20A 1LR4A 3CTHA 3CCNA 2GNHA 4DE4A 5FP5A 2BAKA 5FWKK 5JRSA 4CXAA 1WBWA 4L8MA 3QD3A 2OFUA 3AG9A 2JAVA 3V3VA 3G0EA 5DGZA 3UBDA 5ACBC 3TG1A 4OW8A 2BTRA 5C1QB 3LXPA 4IC8A 4DLIA 1WVXA 3P23A 1RQQA 2RG5A 4GK2A 3VBXA 4XG2A 4OTHA 4D2RA 3PXKA 4J99A 2QONA 1FBNA 5LQFA 5LOHA 4HVSA 4BY9E 3P5KA 3V8WA 1SVEA 3CGOA 3DK3A 4CNHA 2OXDA 4IVBA 1Y6BA 3MH2A 2IG7A 4L45A 4QNYA 3UVRA 2WFYA 3EN7A 4QYGA 2UZLA 5CQWA 5IU2A 2G1TA 4JBPA 2W9FB 3U4UA 4XYFA 4BIBA 3MDYA 3Q5IA 4BBFA 3TM0A 3B8RA 4XUFA 4OR5A 5DR2A 3PIXA 4EHVA 4J7BA 1UNLA 4C4GA 2J0JA 2ERZE 3C51A 2B0QA 2YHVA 3VW8A 2X8DA 3AD4A 5C8NA 3RCDA 4IM0A 3QQJA 2IN6A 2GNGA 3D7ZA 5F9EA 3GP0A 3OT3A 5B2MA 3MVLA 4OUCA 2WMTA 4LMUA 4DN5A 3EHAA 3LVPA 3ROCA 4ITHA 3EQRA 4F7NA 1Q4LA 5BQ0A 4R3PA 4L6QA 4KRDA 4RC2A 2G2IA 4F1OA 2ZV9A 5ANOA 3COKA 2I0YA 3PIZA 2YITA 5L2IA 4B6LA 2UVYA 3L8XA 3PIYA 3NIEA 3NX8A 5CTPA 5IZFA 1K3AA 4YJVA 2CSNA 2ITOA 4F08A 5BUEA 3HP2A 2RG6A 1E9HA 4FZ6A 4F64A 5AA8A 3WE4A 1H27A 2C5XA 4S30A 4N4SA 5AAEA 1A06A 1ZY4A 3UQCA 3S95A 4C2VA 4PDPA 5M4UA 4BWKA 4W9WA 4PTGA 5HO6A 3N9XA 3ENHA 4U40A 1PXIA 5DNRA 3DBCA 3OBJA 4IB3A 3WF7A 5GZ8A 4MXCA 2E2BA 2IZSA 2OZAA 2XP2A 4GS6A 4RLKA 2O8YA 3EQDA 3KRXA 3NNWA 4EWHA 5AP7A 3A61A 3EQPA 4FTNA 4DH3A 2A4LA 2WB8A 1PXLA 3GU4A 1ZXEA 5LMAA 3Q4TA 5J87A 3QZHA 2JGZA 4AW5A 4A9YA 4MEDA 4TYEA 4I0RA 3KXZA 1VYWA 3MH3A 4USEA 3A8XA 5EW3A 1YOMA 4AGDA 5BMSA 3R00A 4V05A 5IQEA 4WSYA 5J5SA 2VTNA 1ZYSA 2W1EA 4WG4A 1PXOA 3QUDA 4IQ6A 3Q96A 3PP0A 2B54A 3OEFX 3UO4A 3PZEA 3QRUA 1WCCA 2HW6A 4KBAA 3RM6A 1NXKA 3FL4A 4CTBA 3F3UA 3MH0A 2G15A 4AFJA 3MSSA 3NR9A 4L3JA 4GJ2A 4PRJA 4EOIA 3C13A 4UMPA 5IG1A 5DOSA 1JVPP 5E92A 2I6LA 4F7LA 3QZFA 4CKJA 4HZSA 2GHGA 4ZJJA 3GCPA 3GU5A 3HV4A 4K77A 5L6PA 2KTYA 1WBNA 4P5QA 2VAGA 3DOGA 3FPMA 3ZRKA 3D9VA 4O0RA 4RJ3A 3U6IA 5DT4A 5AUVA 3ANRA 4ZXTA 4GKHA 3VW6A 3RPVA 3WZJA 2XKFA 4KNBA 5IDNA 2A2AA 3FLQA 3SXSA 3OP5A 3RWPA 1R39A 5AUXA 3ZYAA 1UU7A 4PL4A 1Q8YA 1R0EA 1MRUA 2YABA 3HLLA 3SVVA 4UB7A 1APME 4RLLA 4TTHB 3E87A 3RK9A 2YM8A 5JZJA 3UIXA 3AC1A 2AC5A 5HOAA 5ANEA 4DH5A 5AP4A 3D4QA 3CD8A 4U7ZA 5M09A 4I6BA 5GNKA 3BHYA 3V6RA 3FC1X 2Z7RA 3DDPA 1XH5A 3HMMA 2VTLA 5AWMA 4QP3A 3DNEA 3ZFXA 2BFXA 3C4WA 4QP9A 3UMWA 3LFDA 3WE8A 3ID6C 1FMKA 3IONA 5ICPA 4KUJA 4QMUA 1URCA 5IQGA 3ROYA 4EK4A 2FGIA 4MNEA 5L8JA 4I93A 2I0HA 5BVNA 2YACA 3GENA 2WMAA 5KMJA 4WSQA 2BMCA 4AW2A 3MPTA 3TACA 2W1HA 3MFRA 4FKSA 5B2KA 2VWXA 4JVGA 2R3GA 4O0YA 4RX9A 2WTKC 2ZYBA 5BX0A 3I7BA 2PE1A 2GCDA 3LM5A 3W2QA 2CGVA 4ERWA 1JKSA 4CGAA 3QTWA 3ZCLA 3ZOSA 3NLBA 3TKHA 3I81A 3LHJA 4IX4A 4M12A 4XG4A 4RVMA 4C7TA 4DG3E 2XYNA 4AWIA 4N0SA 4Q5EA 1V0BA 4DGGA 1H00A 2UZDA 3RPRA 5C26A 1YRPA 1OVEA 4BCFA 1VR2A 5IUGA 2X4FA 1RE8A 2H6DA 4GJ3A 5KE0A 4FV0A 3U9CA 3FJQE 3WIKA 3GOPA 4S31A 3O96A 5A9UA 4RIWA 5KNJA 5IMXA 5JFSA 4HNIA 2JAMA 3HAMA 5IQHA 2O5KA 4GH2A 4XRJA 4C62A 4XV9A 2VO6A 4DFLA 4DITA 3I79A 3FMDA 3UNJA 1BI7A 3OS3A 3UO6A 5M53A 4FVPA 4OT6A 5TOZA 4YLJA 3ALNA 5CZIA 4Z9LA 3VUDA 2BIKB 3WIGA 2HY0A 4FIEA 4QMOA 3RALA 4F6WA 3NUUA 4FIGA 2YCQA 5IA3A 3N4TA 4KSPA 3LMGA 4PX6A 3FZPA 3MH1A 3EKKA 3UOLA 2PPQA 1QPDA 3MWUA 4BKJA 4WUNA 1CKPA 2BRHA 2R2PA 3TUCA 5EYDA 2XNPA 3FLWA 3NPCA 5IA2A 4HJOA 5CAOA 3FXZA 5GJFA 4I41A 1OM1A 4UALA 4IH8A 5FEDA 3I4BA 3UO5A 4IBMA 4LRMA 3JY9A 2E9VA 1M7NA 4FUYA 2W1CA 3OT8A 3TZ9A 5AMNA 2Y6OA 4ONAA 4CCBA 3E62A 4DEDA 4EH9A 3K2LA 2C1AA 2CNQA 1YHSA 2WTIA 5FRIA 1Q61A 2XVDA 1TQPA 2UW9A 3C50A 3CJGA 3OHTA 5FD2A 2PUIA 1VZOA 4QQCA 4BI1A 5L2SA 3DXPA 4FVQA 4EQCA 1CKJA 2W1GA 5JFVA 3D7TA 1H0VA 3CQWA 5T3QA 2WQNA 4NTSA 2J90A 4RJ4A 2OU7A 5CWZA 2YEXA 1R3CA 2VTRA 4M68A 5ANGA 1GIHA 2JKMA 2HK5A 2C1BA 1ZYDA 2XIKA 3GFEA 4PDYA 5J7HA 3O51A 5D41A 3PWDA 3LXLA 4AG8A 5E8YA 3W1FA 4XG9A 2V22A 5CAQA 5KMNA 2PUNA 2X0GA 3DCVA 5HICA 4AN2A 2VTHA 4LI5A 3MW1A 3T9TA 3UJGA 4BDAA 3SW7A 4WBBB 3LJ0A 2PVJA 3Q4UA 4GIHA 1ZMVA 4WO5A 5EOLA 3UMXA 4FIIA 4KA3A 4K9YA 1Q99A 2PHKA 3BIZA 4R1VA 3AT4A 3BBTB 4CZYB 4F9WA 3DKCA 3QFVA 4XG3A 4DHFA 3MYGA 2B55A 3GEQA 4J1RA 3FQEA 2XIXA 4H3QA 2JDVA 2J2IB 4QP4A 4FG7A 3ZDIA 3BELA 4CKRA 3ZBFA 5JN2A 4NUSA 4E4XA 1VJYA 2YDIA 3BGZA 4BIEA 1J7IA 1O6LA 1EH4A 4F7JA 2ITPA 2PVLA 4GT5A 4V04A 4WNOA 1KUTA 2BZHB 4YHJA 1J1CA 4FTCA 4DFNA 4O38A 4YJOA 4HGLA 4F09A 1R1WA 5AR5A 2J5FA 3AT2A 5DRBA 4AUAA 2BDJA 1YHVA 4PMMA 2FUMA 4BGQA 4CFVA 4DGNA 2Y0AA 5JMSA 5M4IA 4LV8A 3I60A 4IM2A 1PYXA 4L7FA 5CI6A 3UP7A 3VN9A 2XEZA 5C4LA 5GINE 5IPJA 3V8SA 1U4DA 4MBIA 5M51A 2WEIA 4WNPA 4CZTA 3L8SA 3SGCA 4EH4A 4YPSA 2QG7A 3VRYA 2R0UA 4CT2A 3VBTA 1URWA 4QTDA 4KBKA 2UZTA 4EK5A 3IG7A 4KRCA 1UNGA 3EQIA 3VUTA 3QHWA 4R78A 4TT7A 4W4XA 3A62A 3OCGA 4U9AA 4KKEA 3WF8A 2CNVA 2VTQA 2YIXA 4JDJA 4Z55A 5I9XA 2VX1A 3PSDA 3AC5A 1Q3WA 2IZUA 2XK6A 3LFFA 2W9ZB 2Z7SA 4AA0A 3QTIA 2CKEA 4QMWA 4ZAUA 2VTAA 1HOWA 5CU4A 5I3OA 3DK7A 3NYNA 4WG5A 4Q5HA 1UKIA 3ORMA 2NPQA 5EHLA 4A9SA 3A60A 3GVUA 3TNHA 1E1VA 4O2ZA 3DV3A 4FSWA 2F2CB 2W5AA 2Z02A 4DA5A 4P7EA 2WNTA 4FSTA 5F20A 5DRDA 5AV4A 3WZUA 1Q8TA 4HCTA 4E7WA 4RWJA 2BAQA 3L9PA 2ITUA 2FA2A 3COIA 3KF7A 4GFOA 4MBJA 4X2GA 2W5HA 4ZLZA 3QD0A 3DS6A 4KIQA 4YNEA 2VTJA 3LFSA 5H2UA 1U5RA 1BYGA 1H07A 2O0UA 2GFSA 3HX4A 1BKXA 3PJCA 3RHXA 4MXZA 4ENYA 4FT3A 3LQ5A 1BUHA 4QP6A 3OG7A 3P86A 2XNEA 1J1BA 3FAAA 2JIVA 3ORLA 3VS7A 3Q04A 1CTPE 3MS9A 3PXZA 4RJ5A 4D2VA 2PYWA 3VS1A 4BCPA 2OO8X 4CMOA 1S9IA 4UN0C 5K0XA 2C6EA 4EBVA 4EHEA 5AADA 2C6OA 3ZRMA 2VTIA 5BMMA 2C5OA 2XCHA 4FKUA 2VV9A 1H4LA 2OW3A 4E8AA 4LYNA 4NYEA 2HXLA 3LFNA 1FPUA 3HMNA 3FXXA 4YHTA 4CFUA 1R0PA 2UW7A 4XX9A 3EQBA 3E8CA 2OJGA 3V5QA 2HYYA 4BKZA 2BRBA 4L3PA 4HOKA 3FZSA 2C0IA 3F82A 4G6LA 2F49A 2VTMA 4DGOA 5IQIA 2QOLA 2ERKA 2RKUA 1LUFA 3R9NA 4M7IA 4Y85A 5BPYA 3PVBA 3FSKA 5HG9A 4G6OA 3JPVA 3O2MA 4FTMA 4EK6A 3HDMA 1OIYA 4GRBA 3LFAA 4LL5A 4OAVB 4IVAA 5FQDC 2UVZA 1UU8A 4QPAA 4QTCA 4EH6A 3QX4A 4XEYA 4QMTA 3VAPA 5HX6A 2ITTA 4CTCA 4JBVA 2VX3A 4ZS0A 3PLSA 4U79A 4FT0A 4HZRA 4DTAA 3L9LA 5K0KA 2W1ZA 4NZWB 4GT3A 4BRXA 4QMNA 4YTHA 2IW9A 3TKUA 3GC9A 1H25A 4FG9A 3CC6A 4EH7A 2WXVA 3QX2A 1I09A 2ITXA 4X7QA 5JGDA 4AGWA 3KRJA 1F5QA 1ERKA 3RAKA 3O7LD 4ZIMA 4MYGA 4BDIA 4TL0A 3QQFA 5J9ZA 1T46A 2GPHA 5EYKA 3C5IA 3T9IA 4YUQA 3BV2A 4PPBA 4TY1A 2G01A 3E92A 4JXFA 4IWDA 3ORNA 5FM3A 4ZLOA 3D94A 4FKRA 3U6HA 3DXNA 2XK4A 2WZJA 4F9YA 5DA3A 1SVHA 2PL0A 1PXNA 1H01A 2XB7A 5HG5A 3TT0A 4O0TA 3VUKA 3RCJA 3ENMA 1OKYA 4FKTA 5ETFA 4UXLA 4IADA 2CN8A 4TYIA 5HLPA 3R01A 3OWPA 3MB6A 1MQ4A 2JEDA 3FBVA 3KN5A 4S34A 4BZDA 3TN8A 4HW7A 3RAWA 5A4CA 3R22A 4DEGA 3PXQA 1YI3A 3PY0A 3CEKA 4FSYA 4LRJA 4Y5HA 4UMUA 3OXTA 4U3ZA 3PJ8A 5C8KA 4ORKA 1OPLA 4J71A 2XJ2A 5EYMA 1O9UA 2P33A 1OKZA 1PHKA 2A27A 4FZFB 3IGOA 3DB8A 1QPCA 4C4JA 2WIPA 5T68A 3F88A 5HKMA 3CP9A 5AM6A 5I0BA 4YSMA 4GT4A 5HO8A 5HLWA 1AD5A 3LFCA 3JYAA 4DH7A 3SW4A 3EL7A 4YZCA 4WUAA 3BRBA 4M15A 2O65A 3R7UA 4FV1A 4AE6A 3NDMA 3POOA 3GCSA 4HGEA 2PMLX 4LL0A 4X21A 1TVOA 3KREA 3BLRA 5HE2A 5A46A 5AR2A 3GC7A 3HGKA 4D1SA 3P08A 2ZVAA 3A7FA 1UVRA 2NNWB 1O6KA 1V0OA 2RF9A 2C6MA 4MD8E 4FK6A 2XIRA 1OPKA 4BZNA 3PA5A 3LJ2A 4JNWA 1SMHA 2PZYA 3FHRA 3LCSA 4CFXA 4DT8A 4CRSA 4I6HA 4WIHA 3QXPA 4Y83A 2BHHA 3MJ2A 3KVWA 3AGLA 4KAOA 4EOQA 4CV9A 3O8TA 2XNMA 5EW9A 2R3QA 3UG2A 1OUYA 4FKOA 4G5JA 5GHVA 2CN5A 4E4LA 2WHBA 4X2FA 3TDWA 1Y8YA 4G9CA 3DGKA 2GQGA 2BROA 3OZ6A 3R9HA 3F6XA 4EUTA 2OXXA 3TZ8A 3WF6A 1F3MC 3IDBA 2JITA 1Q8ZA 4OLIA 5HORA 2J0LA 1BMKA 2DS1A 3MY5A 1GY3A 2BDWA 4GVJA 4GV1A 3TNWA 5CVHA 3VBWA 2Z7QA 2B1PA 4M13A 3UZTA 5LXMA 4FTOA 4IB1A 3Q6UA 4YP8A 3R8VA 4QT1A 2GMXA 3HKOA 4U45A 1REJA 2IVSA 4EHZA 5KMMA 3MA6A 3UZRA 4JDHA 4NKSA 4C0TA 3EFKA 4IZ7A 2X7FA 2WIHA 3B2WA 3C4EA 3H9RA 2I0EA 4IAAA 4GFMA 4FTQA 3IW6A 1Q5KA 4BYIA 3OW4A 4C4FA 4RA5A 3NW6A 5JQ5A 4H39A 4YZDA 3W10A 3HV7A 3TEIA 2JDTA 3F5UA 4J8NA 4O27B 1PKGA 4YZMA 2DQ7X 2J50A 3QLGA 4XCUA 3G9LX 4FKVA 4FUXA 4GG5A 3CKXA 3R8PA 5CAVA 4BI2A 3HEGA 3HVCA 5IQCA 3TIYA 3QYWA 1U54B 2OSCA 4QQTA 5CSHA 3TNQB 4CV8A 3Q32A 4YBKA 3OCSA 3FPQA 5IISA 2ITVA 3FZ1A 4UBAA 3R7IA 4AU8A 4NK9A 3RM7A 3UGCA 3MGYA 3ATTA 1IRKA 4U80A 4WNKA 3PJ3A 4AT3A 1M2PA 4QP2A 3NZ0A 5DN3A 4IMYA 5EKNA 3PTGA 2CHLA 2ESMA 2QG5A 5KZ0A 4GEOA 5CLPA 2C30A 4XV1A 5AP2A 1OITA 1LEZA 3SX9A 3IOKA 5BVWA 4BBEA 2CKOA 4QP7A 4HCVA 5DWRA 4HVIA 3DKFA 3TNIA 3CY3A 4BTKA 3PY3A 4O1PA 4DG0E 4HYSA 4PL3A 4QP8A 3F69A 3BE9A 3QUEA 3R83A 4RZVA 5K4IA 2Z2WA 4HNFA 4IEBA 5GJGA 5EM5A 2GTMA 5AR4A 4USFA 1ZLTA 4WRGA 5JRQA 4I5PA 3PXRA 1M2RA 3Q52A 4JJRA 4JIKA 3PRIA 5HU9A 3BKBA 3UTOA 3DBDA 4ANOA 4AT4A 5EFQA 3WI6A 2HWOA 4F7SA 4ZTHA 3M11A 2YAKA 4TNDA 3MV5A 2BRNA 2R64A 3Q4CA 2HXQA 5CEMA 2ONLC 4NIFA 3ULIA 4JOAA 5I9VA 3QCYA 3RP9A 1YI4A 4RQKA 4YJSA 3DFAA 2QOOA 3SV0A 1NVRA 4BCOA 5KO1A 4ZMFA 3BI6A 3FE3A 1A48A 4NW6A 3RTPA 4DGMA 4YZ9A 4TN6A 3IQ7A 1ZOGA 3EWHA 4RX5A 2YM6A 4E26A 2BZKB 4YHFA 3FMKA 3AC3A 3AMYA 4DH1A 2IW6A 4NKAA 3QKMA 4IX3A 2QU6A 4ZSJA 1YW2A 4C35A 2XK8A 4K0YA 1GJOA 4PTCA 3D5VA 2VD5A 4ENXA 2CLXA 3F61A 4QMXA 1PW2A 2JIUA 4NM3A 5FTGA 5H3QA 2ONLA 5GZ9A 1B6CB 2C6TA 5DI1A 5JQ8A 4ANQA 4K2RA 3AQVA 4MWHA 4EKKA 4RMZA 4C4EA 2HZNA 4ANSA 4IE9A 2OFVA 4D4VA 2YFXA 3GFWA 3OBGA 3EOCA 5AR8A 3UC4A 4EUUA 2C6KA 4W8DA 1KV2A 3QKKA 4UEUA 3QC4A 4OTQA 4XV3A 5M07A 3ZRLA 4EJNA 1V1KA 5HNBA 1BI8A 4BCJA 3QD2B 1XQZA 5H8EA 3P1AA 4DEIA 4AACA 2PZIA 4DG2E 5FM2A 2ZJWA 4BTJA 3HDNA 1K2PA 4E3CA 2EUFB 3HL7A 4ZSGA 5FG8A 3GCQA 5DMZA 3GB2A 4L52A 3RPOA 3ZFMA 2UW4A 1KOBA 3NUXA 3NW5A 4JQ7A 1HCKA 1QCFA 4BDBA 3HV6A 1DS5A 4GG7A 4Y8DA 5CEKA 1MUOA 1G3NA 3HMOA 3QD4A 5ANIA 1PYEA 1ZZLA 4YBJA 3VC4A 2BUJA 4RJ8A 3QRKA 2PMNX 2VO0A 2Q0BA 4U5JA 4DC2A 4FX3A 3EFJA 3C5UA 3PSCA 5A6OA 5DH3A 3KXHA 1PXJA 5C01A 5AAFA 4BZOA 5ETIA 5J1VA 5CF6A 1H0WA 3BPRA 5EDRA 4IXPA 5JKGA 4U3YA 3PJ1A 2H34A 3E63A 5EM6A 3R2YA 4TWNA 3ZXTA 5DBXA 4CSVA 3DB6A 3F66A 4CCUA 5FDPA 4RIYB 5B0XA 3FY2A 4E4MA 4QMPA 3DDQA 3BHTA 4QTEA 3E64A 2YM7A 4CMTA 4FICA 4M84A 3LZBA 4PMPA 4RC3A 2GNFA 4FK3A 3G6HA 3V6SA 3CPCA 3SHEA 4DBNA 3QZGA 3ULZA 1YXSA 4RQVA 4AOJA 4JAIA 4OTPA 4IJPA 5IA1A 5DT3A 3NUNA 3CTJA 2ZDUA 3P4KA 4X2JA 5DE2A 1KE6A 4ASEA 5LVMA 1OL2A 1ZYLA 1SNUA 1OIUA 2XH5A 2Y4IB 4G1WA 4ANNA 2CMWA 2XKCA 5HNIX 3BEGA 3CJFA 4XG7A 3RZBA 3QXOA 4RPVA 5CEOA 5BNJA 5JGBA 3LW0A 4JRVA 4FKLA 3VUHA 1PMUA 3I7CA 3UQGA 4FGBA 3QAME 3EZRA 5IKWA 4IB5A 3MN3A 3ZS5A 5JFWA 3TUDA 1H1PA 2VO3A 3VWAA 3LCKA 3GCUA 4CT1A 3O71A 4YNOA 4QYFA 5AV0A 3ZM4A 5C27A 5FBOA 3C0IA 3NSZA 2WPAA 4K33A 4F65A 3IDCA 2WMXA 3BHUA 4WG3A 3EZVA 2X1NA 4GU9A 4BHZA 4AGUA 4R5SA 4D55A 5ANKA 4DFUA 5IEVA 2IVVA 3KMUA 3KA0A 3ORIA 1BL7A 2WU7A 3MBLA 3E3PA 4YC3A 4DEEA 4QMSA 5H9BA 2AYPA 2GS2A 2DYLA 4IFCA 4O21A 4E5BA 4WKQA 4O1OA 4FKQA 3QCQA 4IZAA 3FUPA 3QQLA 2JFMA 3REPA 4LRKA 2GDOA 2XNGA 5DIAA 2XJ0A 3QL8A 4FL3A 1U5QA 4JDIA 4DF3A 4FSMA 3BGPA 4W4YA 5L4QA 4O7ZA 3IK3A 5M4FA 4IX6A 4FSZA 5EK7A 3FXWA 2RGPA 1PMNA 3WF5A 4M3QA 2NP8A 3UPXA 2WMWA 3BU5A 1PKDA 3RPSA 4R7BA 2WMVA 1OL1A 5TE0A 5K5XA 2UUEA 1YOJA 3QTRA 4RJ6A 4KKGA 1AQ1A 1ZWSA 2YISA 4FNXA 1WBTA 3RINA 4EL9A 5HHWA 3GGFA 5B7VA 2XM9A 3Q2JA 3QTZA 2G2FA 3BQRA 2YDKA 2ZB0A 3R0TA 3EN4A 3HA8A 3OC1A 3QQGA 4RWLA 4UXQA 5LWNA 1M14A 3CPBA 3ZLXA 1JSTA 5IDPA 4EOSA 5IA5A 3TWJA 2PULA 3RK5A 3TKIA 4D5HA 2BILB 4IW0A 5I5ZA 1BL6A 3PZHA 5JFXA 4QPMA 2GNJA 2OJ9A 1FVTA 1UA2A 2UZEA 4ZOGA 3KB7A 4G2FA 4MTAA 5H8BA 3P0MA 2Z60A 2W7XA 2NRYA 4IAIA 2VWZA 3EQGA 4II5A 5AJQA 2X2KA 5BUJA 3DJ6A 3S4QA 2WD1A 3DTWA 4MBLA 1DM2A 4IIRA 5EG3A 2XA4A 4AOIA 5GIPE 2KULA 1XKKA 5KMLA 2QO2A 1WMKA 3AT3A 3ODZX 4F9CA 2YCFA 4R1YA 1TQIA 4D2PA 5IMEA 4ALUA 2V62A 4YJNA 4C58A 4YZNA 4ACHA 3QQKA 4ITJA 2UW6A 4BCGA 3AXWA 3FZTA 3PUPA 4NM5A 4LUDA 2B9FA 4F6SA 4PP7A 5LWMA 4IB0A 4X6QC 3NYXA 1YWVA 2RSVA 4J95A 5EI8A 3BEAA 2VRXA 3JUHA 2C3KA 2J0KA 3BYVA 5CZHA 3VBVA 3E7VA 4I6FA 2F7EE 2XCKA 4Y73A 4BF2A 3TV4A 1Q97A 5AV3A 2I1MA 2ITYA 4XNEA 3CY2A 2EWAA 3PE1A 3V5TA 4R77A 5D1JA 4ALVA 3LIJA 3G90X 4UYAA 4HGTA 1YI6A 3UG1A 5I4NA 3R73A 4LGHA 2I7QA 2QOKA 4R7HA 2XNOA 3POZA 3T3VA 3UIUA 4S2ZA 5LJJA 4YSJA 5KZIA 4UZHA 3HAVA 3RBWA 5LVOA 3VBYA 4I4EA 3C4FA 3OUKA 4MF0A 1XH6A 3R9DA 3ZSGA 4CLIA 2EU9A 2PVFA 3H3CA 4EOPA 1IEPA 2HZ0A 2R3RA 2JDSA 2YJSA 2HCKA 3OFMA 4NH1A 2QQ7A 4NSTA 3ATSA 2QVSE 3QF9A 3SRVB 4NU1A 3E93A 3M2WA 2B52A 1UWJA 2GNLA 4AQCA 1H1QA 3FHIA 4EWQA 3KMMA 3EIDA 4I24A 4TYHB 1Q8WA 5HCYA 4LG4A 2FYSA 1R78A 3HYHA 3WILA 4PPAA 3IOPA 3SKCA 4C59A 2WMSA 1XH7A 3PXYA 4FTUA 4P5ZA 4TRLA 2QOHA 1GOLA 5M55A 3KMWA 4LM5A 2OZAB 3VIDA 3GBZA 2WTCA 2X8IA 3OOGA 4U97A 2PVMA 3FYJX 4XP2A 2C6IA 5D11A 3SOAA 3THBA 3C4XA 3UYSA 3HMIA 4AP7A 2F7XE 3FQSA 2QOCA 3LFBA 4OBQA 4RZWA 1XH9A 4C38A 1YHWA 2JD5A 4BCHA 1XBAA 4D9UA 2YCRA 4RWIA 3PG1A 2WTVA 5E8TA 2JFLA 5IQAA 4IZ5A 2Q0NA 3IW8A 4FF8A 4CFWA 1H08A 2UZNA 3ZMMA 1XHAA 5CSPA 5AFVA 4L67A 1X8BA 3FC2A 3ZEPA 2XK7A 5D9HA 1IASA 5EYCA 4FIHA 3RNYA 1J7LA 2A1AB 4GL9A 4IC7A 1RDQE 2XK9A 3D15A 2WKMA 4U41A 3F2AA 3G2FA 2WOTA 3H0YA 1ZARA 3NMUF 1KE5A 3F5XA 3ORTA 1FOTA 4IJ9A 3R71A 3V5PA 1PXMA 2GU8A 3EFLA 2VO7A 4FV8A 4FZ7A 4ZTQA 5FP6A 4RVKA 3AC8A 5L3AA 3V01A 3FDNA 5AIRA 3O0GA 3GNIB 4XV2A 5CX9A 4EK3A 3SLSA 3VS5A 2PU8A 4ZTSA 2VWVA 3NCGA 4RIXA 3FEGA 4XOZA 3GU7A 5AX3A 2OICA 3P9JA 3QBNA 3RAIA 3RPYA 4BN1A 2W05A 3KFAA 4FEQA 4AZSA 3A2CA 3ITZA 5BVDA 3QA8A 1QMZA 2R3NA 3KXMA 4QOXA 5H8GA 5CASA 2BCJA 4D1XA 3JVSA 4RX8A 4IACA 2X2LA 4FTTA 3BWJA 2GSFA 2VWUA 2LGCA 5CEQA 1OIRA 4FEUA 2XIYA 4QMVA 3PG3A 2C6LA 1OGUA 3OD6X 4RVTA 4BFMA 4FV7A 4I4FA 4EZ7A 5TKDA 4RJ7A 4KIOA 1I44A 4F70A 4ZTLA 4BCIA 4FV5A 2UW0A 3Q60A 4PTEA 4CFNA 2GS6A 3LM0A 2UW5A 4RFZA 5ANJA 5E91A 3R2BA 4MKCA 3F5GA 1CSNA 2IVUA 3ELJA 3JS2A 3R02A 4O6LA 5KHWA 5HVYA 4RRVA 3D14A 4HYUA 2ACXA 1UKHA 1ZAOA 3C9WA 3LXKA 1UWHA 2BHEA 3ETAA 4BDCA 5A6NA 2FVDA 1GZOA 2ZM1A 2J4ZA 3VS4A 4M0ZA 5C4KA 3K3JA 4JIAA 2XKEA 4FTIA 3W32A 1FMOE 3S1HA 3SOCA 3VHEA 3FYKX 1P5EA 3LCDA 3LPBA 4WRSA 4GFGA 4P4CA 4XLVA 4RSSA 1MRVA 2RIOA 3TV7A 3P7AA 3MPAA 4AZEA 3L8PA 4TWPA 3FY0A 4ACDA 3KXNA 5F94A 3UIBA 1WBSA 3DFCB 2EVAA 5CS6A 5JH6A 4Q9SA 3WF9A 5E8SA 5M57A 2UZWE 5DLSA 4YTIA 5HZNA 3OWJA 2H8HA 3SXRA 2OIDA 3B8QA 1H28A 3VULA 4GW8A 4BGHA 3RWQA 4K6ZA 3AC4A 4AW1A 4UX9A 4FYNA 3ZC5A 4UMQA 3NAXA 3FZRA 1A9UA 2BDFA 2R4BA 3R7OA 3UVPA 5EI6A 5FTOA 4KD1A 4LGDA 3FMMA 3V5LA 5CVGA 2UV2A 3DLZA 1P4FA 4FYOA 4GUEA 4QP1A 4X2NA 5AUYA 2P0CA 4YR8A 4LQMA 5KUPA 3VBQA 2C5NA 4WNMA 1P2AA 3NGAA 2OZOA 5D10A 2OIBA 3OEZA 2YAAA 3R04A 3NRMA 3R7GA 3L9MA 2IWIA 3NNXA 1U54A 3MIAA 4L7SA 2X7GA 3DZOA 4DEAA 2CCIA 4ZZMA 5AIKA 5E9EA 2R7BA 3GI3A 4QNAA 4C3PA 3ZXZA 2JDOA 4YGAA 4CLJA 1MP8A 4HPUE 2CKPA 4H05A 4C33A 5EKOA 4EQUA 2BZIB 3L9NA 3Q9YA 2JKKA 3I0QA 4B0GA 4EOJA 5HU3A 4FT5A 3W55A 5DR9A 5I9UA 2B9HA 3FLYA 5ANDA 1JOWB 3COHA 4JX7A 5ETAA 5HIEA 4G3CA 4R3CA 4TW9A 4ZJVA 2YIYA 3BLHA 3VQUA 2WQMA 4G16A 3W33A 3TTJA 3FWQA 4AF3A 3TTIA 4F0IA 5CF4A 5AA9A 5DT0A 4I21A 2R3PA 1KOAA 1OL6A 4GYIA 4W8EA 3R8UA 4BGGA 4HCUA 3EJ1A 4NT4A 4CMUA 4O7YA 4YJRA 3V51A 4F0FA 4BTMA 2E9NA 3W2OA 2V55A 3UC3A 4KINA 2C3JA 4XHKB 4RBLA 2GFCA 3IO7A 5AP0A 4D4SA 4BR3A 1NVSA 3D7TB 3G0FA 3WARA 2J9MA 2YLEA 3GC0A 2AC3A 2JDRA 2W96B 2X6DA 4OTIA 2R3MA 3L1SA 1Y57A 3CBLA 4MD9E 1F0QA 2BALA 3HV3A 3UYTA 3UPZA 3U55A 4GYGA 2CDZA 2XZSA 4L46A 5GZAA 5HCZA 4P90A 3UNZA 2XIZA 4QMZA 4V0GB 3C4CA 2C0TA 3QLFA 5A4TA 4FL2A 2PE0A 4CYIA 5JGAA 1JNKA 5CAPA 4FL1A 2YWVA 4I1ZA 4J52A 2QURA 3PPZA 3Q9WA 5D7VA 2V5QA 2YIWA 4R6VA 4CKIA 5FEQA 3KC3A 2BKZA 4U42A 2C47A 3UE4A 4XLIA 4YMJA 4FBXA 4IANA 4KS7A 4I94A 3E8EA 5IQBA 2VU3A 5ITAA 5KBRA 1JKLA 2QO7A 2WELA 2WQEA 2YCSA 3WZKA 4B7TA 5CY3A 4XG6A 1UNHA 3DKOA 5CU2A 4O2PA 5E8UA 3VVHA 3HA6A 1VYZA 2F2UA 3I1AA 2JLDA 5E8ZA 3EYHA 2XYUA 4IWQA 3F7WA 3E8DA 3VS0A 4OTGA 1YKRA 5LMBA 2WGJA 2YIQA 3CTQA 3OCBA 4TZRA 2QI8A 3UVQA 2VWYA 4A4XA 1OIQA 4W9XA 1JAMA 2B9IA 4FTLA 4WA9A 3SC1A 5KHXA 3E8NA 4EZ3A 2B7AA 1YXVA 3FI3A 3DNDA 3C0GA 2W17A 2JC6A 4N57A 2CKQA 3EN5A 5JZNA 5J5TA 1ZMUA 1FINA 2CLQA 3BU3A 1H1WA 3C4ZA 3QZIA 3LMHA 1IA8A 1SZMA 3LCTA 4MVFA 3I5ZA 4FV6A 4AFEA 2WMBA 4V01A 2R0IA 1PJKA 4ZSLA 3UZPA 3R1SA 4YLLA 4IM3A 4L42A 3SD0A 5LCJA 4JAJA 4QYYA 1UU3A 4FV9A 2P2HA 4JDKA 5CSWA 3U6JA 4APPA 2VWWA 2XNBA 3Q2MA 2OXYA 1Q8UA 1M2QA 5CXHA 4BCKA 5CEPA 3DT1A 5E7RA 5HO7A 2B53A 1LPUA 4IZYA 3FMEA 4L01A 4OGRA 4Z7HA 3PLAE 1PF8A 3G51A 5AP1A 3EL8A 4NL0A 3W2PA 3R8LA 5CT7A 3F3VA 1CMKE 4FIJA 4DFYA 4Y72A 5CF8A 2EB3A 5CSXA 1Q3DA 5DR6A 3QWKA 4TWCA 4DINA 2GS7A 2OJJA 5KKRB 5J7BA 4I0SA 3JVRA 4FTRA 1ZY5A 4LOQA 4O0WA 4CQEA 2PK9A 3H30A 4YO4A 4CG9A 4BDKA 3T8OA 3OOMA 5AX9A 4XBRA 4RIYA 2Y4IC 3NVKI 2V7AA 2UW3A 4DEHA 3AMAA 3MB7A 4NTTA 2R5TA 1M7QA 2FB8A 4LOPA 4XP0A 2PUPA 2QLQA 3R7EA 3R21A 2QNJA 2JKOA 4QO9A 4BDFA 1KWPA 1YXTA 4IAZA 5EM7A 4E6DA 3HZTA 2YERA 5KBQA 3A7HA 3KK9A 4Y95A 5KMKA 5HBHA 3U87A 4EEVA 4QTAA 3IDPA 4FE2A 4KIPA 1NY3A 3BGQA 5EH0A 3BYSA 2OBJA 3FV8A 3KF4A 3MVJA 4ZS4A 4MNFA 2VN9A 4I92A 1XO2B 3IW4A 3NW7A 2BRGA 4IFGA 3W2SA 2BTSA 2REIA 3F2NA 5G6VA 3GOKA 2PMOX 4PF4A 2IZRA 5D12A 2HIWA 1OBDA 5A4LA 5L8KA 4PDSA 3ET7A 5AUZA 4DLJA 3BYOA 3FMLA 4ZTRA 5BVOA 1GIIA 4AS0A 4MHAA 3II5A 5CEIA 2B9JA 2ETRA 1TQMA 4KABA 5IA0A 3LLAA 5EOBA 2OWBA 2C3LA 2JBPA 1GZ8A 3LAUA 4FTJA 4F99A 4PL5A 3UQFA 4AXAA 2WO6A 3MI9A 1PY5A 3PVWA 4GVAA 4BTFA 1MRYA 2Y7JA 4X6RA 2PTKA 4RFYA 5HGIA 3VS3A 5IUHA 3OF0A 5AAGA 3B2TA 1BX6A 2FSMX 3EQFA 2WEVA 2W1FA 1NT2A 4B4LA 4M69B 3UODA 5HI2A 3KRRA 3A4PA 2X7OA 4FSNA 3LXNA 3RK7A 3S2PA 4BCQA 4YU2A 2IJMA 3NNVA 1Y91A 3FI4A 1H1SA 2UW8A 1OKVA 4EOOA 4IVDA 4O0VA 4R3RA 4I22A 4O7LA 1J91A 5FBNC 4FEVA 3TI1A 4I6QA 3VUMA 3ZC6A 3ZEWA 4D0XA 2WMRA 3KCKA 3Q6WA 4IWPA 4J53A 5E90A 1G8SA 4F0GA 4PNKA 4QMMA 2IZTA 2ETMA 4G5PA 2EXEA 5EHYA 4MXAA 4FMQA 5L2QA 3ZHPC 1TKIA 4FV4A 3A8WA 4U0IA 3W18A 4ZY5A 5AUUA 5LCKA 4ASDA 2W1DA 4BYJA 5I9ZA 5DPVA 1PMEA 1Z57A 1GNGA 3F5PA 5C8MA 2IW8A 3GQIA 1OL5A 5HVJA 2YM5A 3P7BA 5DEYA 4AN9A 4C4IA 4G6NA 3CR0A 3NYOA 3R1NA 5TR6A 4FEXA 4WD5A 3AD5A 3FQHA 4E4NA 3VNTA 4A9RA 1FVVA 4HYHA 1XBBA 4FKGA 4O7TA 2P4IA 4XRLA 3VO3A 2OH4A 2W4OA 3KL8A 4R5YA 1PRYA 4PUZA 4RG0A 4ASXA 4GU6A 3T3UA 4D2WA 4IWOA 2BKKA 4BCMA 4C2WA 3TZMA 4B8LA 5E1EA 2UZOA 3ACKA 2YLFA 2XK3A 3K54A 3QGWA 3WZEA 1AGWA 2FSTX 3VF9A 5AEPA 3F3TA 2QR8A 1BLXA 2F4JA 2QLUA 3I6WA 2HY81 3A4OX 4FNWA 4RA4A 2VTPA 3OCTA 3N4VA 5G1XA 2E9UA 4QQ5A 4ZLYA 3K3IA 4QD6A 3R28A 3VUIA 1NW1A 2QD9A 1KV1A 5LARA 3BYUA 3ZUTA 3WYYA 4H3BA 1W8CA 1Y6AA 1FGKA 2PVHA 1WBOA 2ITQA 4FIFA 2IVTA 3F7ZA 4FNZA 3DQXA 4F9BA 1JKTA 3K5UA 2RFDA 4F9AA 4NFNA 1OECA 4U8ZA 2B4SB 3Q53A 5E4HA 1STCE 1WBPA 1W0XC 3DXQA 4O84A 4DTBA 4JR7A 4X3FB 4LUEA 5M08A 4G3GA 4E5WA 2W0JA 3G9NA 3WZDA 3ZO2A 4FSQA 3FMHA 4ZZNA 4UYNA 1DAWA 1JKKA 1OUKA 3FMNA 2PZRA 4PY1A 3S00A 5L6OA 4KS8A 3AMBA 3JXWA 5J9YA 4E73A 2ZOQA 2ITWA 2OI4X 4D2TA 1U46A 4BDGA 4Q9ZA 5IF1A 2CCHA 5BYLA 2YDJA 5DYJA 3ZONA 2OG8A 1B39A 1GAGA 4A9TA 3ZTXA 3IPHA 1ZMWA 2WQBA 5HE1A 3PPKA 4A4LA 3VHKA 2C4GA 5AP3A 5K5NA 5B2LA 5E8XA 4FSUA 3SAYA 4O0UA 4BDEA 5HLNA 3BWFA 4RVLA 1XR1A 3OXIA 3SRVA 3Q9XA 4EK8A 2QCSA 3FKLA 3FMJA 4IDTA 1YQJA 3VRZA 4TWOA 2O2UA 2QOFA 3KULB 4MCVA 4TYHA 5CAUA 1JPAA 3NIZA 2PZPA 3EN6A 3UOJA 3MTLA 3QGYA 3I5NA 4NWMA 4EH3A 3L8VA 4JL9A 5HVKA 5HCXA 1IG1A 1J3HA 2R3LA 4AE9A 2XS0A 3ZH8A 4E6QA 4ZY6A 2Z8CA 2W4JA 2BFYA 3GXLA 4EI4A 4QMQA 3NEWA 4ANLA 5HIDA 4N6ZA 2WQOA 1KE9A 4FZAB 2FH9A 5CYIA 4A07A 5F1ZA 4DCEA 1OB3A 2VNYA 2QOBA 5ETCA 2J0IA 5J95A 4AZWA 3LQ8A 3N4UA 3KKVA 4GCJA 2W4KA 4K1BA 3BU6A 5CVFA 3LLTA 3TUBA 3MFTA 3JY0A 2E9OA 2PE2A 4XG8A 3A7GA 5J79A 4WHZA 2X81A 2OGVA 4L44A 3C0HA 3QRTA 3EMGA 1G5SA 3PVGA 3EB0A 3BV3A 3VS2A 2NRUA 2QODA 3FLNC 5JT2A 4AA4A 5F4NA 4UMRA 4D1ZA 4OTRA 3WBLA 4W4WA 2EXCX 3TCPA 5AM7A 2OF4A 5LVLA 3NUAA 4A9UA 4KIKB 1W98A 4MX9A 4PPCA 3UOKA 1P4OA 4BKYA 2UZUE 4ALWA 3QRJA 3ZLSA 3DQWA 1REKA 4BICA 3ZZEA 4RIOA 3RNIA 2YN8A 3CXWA 5JEBA 3DK6A 4XBUA 2R7IA 5CSVA 4E5AX 5AP5A 2ZV8A 5FEEA 2XEYA 3EKNA 4C34A 5AUTA 3ZU7A 3O8PA 4JR3A 3VUGA 1H26A 2WTWA 5BUIA 3CD3A 5DG5A 3BE2A 3RKBA 1FVRA 5HESA 4F1MA 4GK3A 4O81A 4YC6A 5CU6A 5BVFA 4L00A 4F63A 2OKRA 2X4ZA 4NEUA 3ERKA 4USDA 4EYMA 5CANA 4YTCA 1ND4A 4Y46A 1M17A 2C5VA 4HVHA 3PFQA 4DH8A 4UY9A 3LE6A 1GZKA 1YWNA 5KMOA 3H10A 4ARKA 2BAJA 4BCNA 3E88A 1JQHA 4TYGA 4X3JA 4B9DA 5L2TA 3ORXA 3UOHA 4YURA 3NUPA 2VX0A 4FKJA 4CEGA 4D0WA 4X0MA 2VNWA 4GIIA 2Q83A 4H36A 3TNPC 4K11A 5HG8A 5FUTA 3Q4ZA 1LP4A 4FGRA 2YJRA 4YZBA 4CD0A 2HZ4A 4D58A 4NIFB 3DAKA 4J8MA 4GSBA 3IW7A 4L53A 3ZFYA 4EKLA 3QU0A 5BVEA 3DJ5A 3MTFA 4FKWA 4L9IA 4BI0A 3D83A 3RJCA 3BX5A 3ZO1A 5A4EA 2RFNA 4MXXA 1JSVA 3OY3A 1VEBA 4JRNA 5HTIA 4JQ8A 2W5BA 4MWIA 3IW5A 5DEWA 4BBMA 2BPMA 2VGPA 5M06A 2X9EA 3NUSA 4I0TA 4EH2A 4M14A 2E9PA 3ZLWA 4JX3A 4LGGA 3R1YA 2Z7LA 4G17A 1L3RE 5HNGA 3GCVA 1M52A 5I3RA 4C57A 2JKQA 2F57A 3IKAA 3LOKA 4Z16A 3HRBA 4S33A 2IO6A 2AUHA 1GIJA 2J0MB 3ZLYA 3R9RA 4LOOA 1LEWA 4ANBA 4FV2A 3H4JA 1XWSA 5TF9A 4E1ZA 1ZYJA 3VQHA 4DCAA 4EH8A 5D7AA 5IA4A 4EOMA 3MESA 4W4VA 3KQ7A 1DI8A 2V0DA 4YJUA 2PVYA 2VGOA 4RT7A 2PVKA 3DTCA
chains in the Genus database with same CATH superfamily
2HAKA 3OMVA 3FI2A 4ACCA 1KE7A 3P7CA 2XAOA 4YJTA 3COMA 3EQHA 4FTAA 4YLKA 5CALA 5E1SA 1IR3A 3OXZA 4ZP5A 2I0VA 2OJIA 4M66A 4OAUC 4M67A 4FR4A 3D0EA 2QHNA 4RX7A 2R3KA 3D2IA 4AGCA 3M1SA 5FGKA 1YDRE 2BVAA 3PVUA 4ZMEA 3RI1A 4AN3A 4AW0A 2OIQA 2X8EA 4G3EA 5FDXA 1W2FA 4OBPA 4XP3A 5TO8A 2HENA 4O4BB 2Y4PA 3ORPA 3HUBA 1CKIA 4KSQA 4BWXA 4FV3A 2WOUA 2PVRA 4DGLC 3QTXA 1NA7A 4NM0A 5HEZA 3RZFA 2GTNA 5HG7A 4EZ5A 4DDIA 4RC4A 3RGFA 3U9NA 4Z3VA 2XKDA 4M8TA 2WAJA 3TXOA 4ZJIA 1YXXA 2QKRA 4AT5A 5FXRA 4CFFA 2ZV7A 4ACGA 4YJQA 3NYVA 4MQ1A 3RMFA 2CJMA 3QWJA 3FZOA 5HIBA 2C69A 4C8BA 2A19B 5EW8A 4APCA 4NW5A 4EORA 3P5JC 3W2CA 3QQUA 4QYHA 2RFEA 3MIYA 3PA4A 4KWPA 4FKIA 4BIDA 1YXUA 5HTBA 2PY3A 1YDSE 4LMNA 4UWCA 1YOLA 3QKLA 1XBCA 3W8LA 1KSWA 3OUNB 3DPKA 2GQSA 2SRCA 3F9NA 3KRWA 2XJ1A 3KXGA 4BB4A 4O7SA 4CG8A 1XH8A 2YZAA 3H9OA 3QRIA 4FI1A 1XH4A 3H0ZA 3KY2A 4FNYA 4NFMA 4V0GA 5FXQA 4EYJA 3VJOA 5ACKA 4HVGA 4F78A 1SYKA 5EI2A 3HUCA 4DTKA 4ZTMA 1U59A 4NJDA 1IAHA 3U4WA 1SNXA 5GJDA 4BWPA 4FSRA 4PMTA 5A54A 3SXFA 4U6RA 4C3FA 4DBXA 3EYGA 4TYJA 2VTTA 4F1TA 4R8QA 5F95A 5M44A 5GIOE 4YPDA 4U43A 4N70A 4H3PA 3U51A 2PMIA 4M0YA 1UU9A 4ITIA 4YO6A 3F2RA 3MFSA 4DFZE 4BDJA 3UDTA 4C4HA 2C3IB 4IVCA 3AGMA 3G15A 3OROA 5IUIA 4DYMA 3LKMA 4I3ZA 4IHPA 3FLSA 1KE8A 3NWWA 2YM3A 4QPSA 1J7UA 3FSFA 2J7TA 4I5HA 4JG7A 4OTFA 4U81A 3QYZA 3ZO4A 4B99A 5L8LA 1WFCA 4L68A 5EQEA 4C37A 2Y6MA 2CGUA 4D28A 3K5VA 5KMIA 2H9VA 5CT0A 5A3XA 2XRUA 2I40A 3OTUA 4IX5A 3UDBA 4E6AA 3EN9A 2J6MA 3G5DA 4NJ3A 2ITZA 5HX8A 4P2KA 2WTDA 5KKRC 3S3IA 4D4YA 3DU8A 2PWLA 3DLSA 3OWKA 2PZ5A 4JI9A 3W8QA 1RW8A 1OI9A 4QYEA 4MAOA 4MNEB 4O7VA 2CGXA 2YZLA 3DAEA 3ZZWA 3RAHA 2PSQA 3R30A 5IH6A 2QU5A 4WOVA 4O22A 4YTFA 4PDOA 5TT7A 3D2KA 4K18A 5JK3A 4F6UA 5FTQA 3G33A 3NAYA 4MK0A 5M56A 4ZY4A 4JLCA 4UZDA 4Y5QA 3NS9A 1YDTE 3SG8A 2EXMA 4MQ2A 5LVNA 2WMUA 3LFQA 4BC6A 4C02A 4D9TA 3MY0A 3QTUA 2WU6A 2V7OA 3QTQA 4S32A 2P2IA 4E6CA 4A06A 4TXCA 4ZZOA 3RVGA 5I9WA 3FKOA 2GHMA 4RWKA 1Y8GA 4O6EA 4ZSEA 5K4JA 4XOYA 3UIMA 1ZRZA 2DWBA 5E8VA 3HV5A 5C03A 1OL7A 3O50A 3R9OA 1ZOHA 4JT3A 3TIZA 3RHKA 4JQEA 1QPJA 3O7LB 2WTKB 4G3DA 2XRWA 4FA2A 5CU3A 4D4RA 2R3JA 3R7YA 5HTCA 2W99B 4RIWB 3AOXA 3DY7A 4FVRA 1OMWA 4I23A 3SQQA 2C68A 2JBOA 2F7ZE 3PWYA 1ATPE 2VZ6A 4I20A 4OBOA 5L2WA 1OKWA 3FL5A 1WBVA 2VWBA 4OT5A 3ODYX 3SA0A 4PWNA 5FXSA 4BDHA 4GKIA 1W7HA 2WMQA 1FGIA 3BYMA 1ZYCA 2R3HA 2YM4A 3GT8A 4N6YA 4NM7A 4EC8A 1T45A 4H1JA 3NVMB 1Q24A 2A0CX 5AP6A 2J51A 5AV2A 3FI8A 3UNKA 3U8WA 4FTKA 4O82A 3BLQA 4QMYA 2H96A 3E7OA 2HWPA 4H1MA 4D5KA 3ZM9A 3R63A 3OVVA 3AD6A 3C1XA 2HZIA 5IEXA 2JIIA 2QKWB 3EQCA 3FLZA 4B8MA 4CQGA 3MVHA 4ZEGA 4G31A 1W83A 5BVKA 1SM2A 4J97A 4QMLA 1IAJA 3HMPA 3DBQA 4M69A 5IQDA 3CSVA 2F9GA 3LMIA 2R3OA 3M42A 2GQRA 4Z7GA 2XM8A 4IAKA 4MXYA 3KRLA 3VF8A 3LQ3A 2ETKA 4I5CA 3TJDA 1WZYA 5HD7A 1FQ1B 1MQBA 2Y8OA 3AC2A 3BHHA 5C9CA 2R9SA 4FODA 3R8ZA 4MUQA 3CIKA 5K3YA 4O7RA 2HW7A 3UP2A 3F3ZA 4KKHA 1NVQA 2VTOA 4UWBA 4XJ0A 2ZV2A 4AZVA 3LJ1A 5BYZA 5L6WL 2O3PA 4GUBA 1E1XA 2FO0A 4JG8A 4O0XA 4YJPA 3D5XA 3ORZA 2W06A 3QHRA 4H58A 5AV1A 1CDKA 5HQ0A 3U54A 2YIRA 1O6YA 3I0OA 2VUWA 2QHMA 4O91A 3P78A 5CNNA 4YC8A 3CKWA 3PA3A 2ZAZA 2ZM4A 3OWLA 3R8MA 3W2RA 2XMYA 3PPJA 3HRCA 3KEXA 4ERKA 2VTSA 5DHJA 5DVRA 4DFBA 3KVXA 4JBOA 4Q2AA 5EM8A 3MA3A 3W0PA 1Z9XA 4OTDA 4EH5A 1PMVA 5EDPA 1OPJA 5LVPA 4O7WA 2ZM3A 3ANQA 5KCVA 1K9AA 3LFEA 2NO3A 4TNBA 3Q5ZA 4CFMA 3W0SA 2ZMCA 3KK8A 4PNIA 3FKNA 2YWPA 2XUUA 4DEBA 4AZFA 4FEWA 1Z5MA 4LV5A 1WVYA 4DT9A 4CZUA 4EONA 2RL5A 3WOWA 4QQJA 4KBCA 3R7VA 4HGSA 3HP5A 3CQEA 4JBQA 4PQNA 5J1WA 5CU0A 2C5YA 5HE3A 4WBOA 1WVWA 2EB2A 2P3GX 2XF0A 4GMYA 4M97A 3ORKA 2CNUA 2IPXA 4EHGA 2P55A 4X3FC 3OY1A 3DKGA 4I5MA 5EQYA 1L8TA 3E5AA 1DAYA 1XJDA 2VWIA 3NUYA 3SDJA 4AAAA 3CE3A 4XS2A 4R7IA 4UV0A 4O7NA 4O83A 3PJ2A 5A4QA 1H1RA 4AXDA 5BV3A 1JSUA 2QR7A 4OTWA 5FLFA 2BZJA 3IS5A 3A7JA 3ZUVA 3OW3A 4WT6A 4AOTA 2C0OA 2X9FA 3R1QA 3TL8A 4ZSAA 2UZVA 4JG6A 1W82A 2XNNA 2PUUA 4RIXB 1GZNA 3IECA 3ZSIA 4C3RA 5JSMA 4CVAA 3CQUA 3EFWA 4HYIA 5HE0A 4G9RA 4EJ7A 4BVUA 2ITNA 3EH9A 4RFMA 4X3FA 3G6GA 3V5JA 5EDQA 3VJNA 4NCTC 5A14A 2LAVA 5IH5A 4JS8A 3PRFA 4UWYA 4EOLA 1H8FA 3WYXA 5CF5A 3Q9ZA 3ZUUA 3Q3BA 2PVNA 2W1IA 3QQHA 3BQCA 4FOCA 4MXOA 4K8AA 4PP9A 2J5EA 4A7CA 3QC9A 5BYYA 3D5WA 3I6UA 5CXZA 1G8AA 1W84A 3ZSHA 3O23A 4O96A 1OBGA 4O86A 2XBJA 5LMKC 3BLAA 3VONA 5IEYA 4PV0A 3H9FA 2BR1A 3KCFA 2ZDTA 3DZQA 4NCTA 4XMOA 5AR3A 1P14A 4ZK5A 3DAJA 3PP1A 4XH6A 2XBAA 5EHOA 4BL1A 4CYJA 4UMTA 4J98A 2RFSA 2BRMA 4EC9A 3A7IA 4G34A 2HOGA 3PDTA 5IQFA 3R6XA 4AZTA 4LFIA 1JWHA 1PXPA 3KULA 4DAWA 3KN6A 3LCOA 3TJCA 3CS9A 1IA9A 4CRLA 3CGFA 1DI9A 5E8WA 3TZ7A 1WAKA 3BL7A 3PYYA 3DBEA 3OTVA 5K9IA 1RJBA 1Q41A 3QALE 5I9YA 5LMKA 4FT9A 2OH0E 2UZBA 4TKSA 4AA5A 4EOKA 3AKLA 2GHLA 4G3FA 3SG9A 5AR7A 4ACMA 3A99A 5DFPA 5CENA 4ANMA 3CLYA 1YWRA 3MJ1A 1H24A 2C6DA 2R3IA 2IEWA 3F3WA 3ZDUA 4U44A 3BCEA 4ZTNA 3N51A 3NNUA 3BHVA 3KGAA 3QA0A 3QCSA 3GUBA 3HRFA 4TPTA 4L3LA 2R3FA 3DA6A 3O8UA 3ACJA 3KU2A 3V8TA 3PY1A 3ALOA 2QOIA 4A4OA 3PE2A 4AXCA 3PSBA 1QPEA 4L43A 4C61A 4BHNA 4MH7A 2G2HA 3W16A 1QL6A 2HELA 2Y9QA 3GQLA 3IGGA 5KX8A 1UV5A 2FSOX 2O64A 1OZ1A 3DJ7A 2X39A 2OJFE 3TV6A 2X6EA 1S9JA 3V04A 5J9LA 3TDVA 3MFUA 4MF1A 5CI7A 3PXFA 1B38A 2DUVA 4HVDA 2BIYA 4AAYA 2O63A 2ZMDA 5HD4A 3V5WA 3MY1A 4QTBA 1G8KA 1ZOEA 4KIKA 3O17A 4IAFA 5J8IA 4ID7A 4D2SA 1YVJA 4IAYA 4O0SA 4DFXE 1ZZ2A 2OF2A 4F4PA 3MPMA 4RGJA 5HBJA 4FZDB 2FSLX 3D5UA 3DBFA 3GU6A 3QCXA 5AUWA 3ZO3A 4AX8A 4FOBA 4X2KA 5CNOA 3C7QA 3GU8A 2WTJA 3P79A 3HNGA 3QTSA 3QUPA 4FKPA 4IDVA 5M4CA 4ASZA 4FT7A 4BDDA 3JR1A 4E93A 3E3BX 3BBWA 1HCLA 2ZB1A 5IH4A 1CM8A 1JBPE 2G9XA 5CQUA 4GK4A 3VS6A 2CPKE 4EBWA 2UVXA 3HECA 4C36A 2X2MA 4FG8A 5T6KA 4J96A 2QOQA 4EQMA 3S0OA 3NCZA 4PMSA 2QO9A 4HPTE 3BZ3A 3KXXA 2YA9A 1Q62A 4FC0A 3GC8A 4QRCA 1SVGA 1PXKA 3MVMA 5EQPA 2OLCA 5HBEA 2GNIA 1JLUE 1V0PA 3ZBXA 2QC6A 2OK1A 4MD7E 4KB8A 2CGWA 4E20A 1LR4A 3CTHA 3CCNA 2GNHA 4DE4A 5FP5A 2BAKA 5FWKK 5JRSA 4CXAA 1WBWA 4L8MA 3QD3A 2OFUA 3AG9A 2JAVA 3V3VA 3G0EA 5DGZA 3UBDA 5ACBC 3TG1A 4OW8A 2BTRA 5C1QB 3LXPA 4IC8A 4DLIA 1WVXA 3P23A 1RQQA 2RG5A 4GK2A 3VBXA 4XG2A 4OTHA 4D2RA 3PXKA 4J99A 2QONA 1FBNA 5LQFA 5LOHA 2X0PA 2XANA 4HVSA 4BY9E 3P5KA 3V8WA 1SVEA 3CGOA 3DK3A 4CNHA 2OXDA 4IVBA 1Y6BA 3MH2A 2IG7A 4L45A 4QNYA 3UVRA 2WFYA 3EN7A 4QYGA 2UZLA 5CQWA 5IU2A 2G1TA 4JBPA 2W9FB 3U4UA 4XYFA 4BIBA 3MDYA 3Q5IA 4BBFA 3TM0A 3B8RA 1W2DA 4XUFA 4OR5A 5DR2A 3PIXA 4EHVA 4J7BA 3ML1A 1UNLA 4DHIB 4C4GA 2J0JA 2ERZE 3C51A 2B0QA 2YHVA 3VW8A 2X8DA 3AD4A 5C8NA 3RCDA 4IM0A 3QQJA 2IN6A 2GNGA 3D7ZA 5F9EA 3GP0A 3OT3A 5B2MA 3MVLA 4OUCA 2WMTA 4LMUA 4DN5A 3EHAA 3LVPA 3ROCA 4ITHA 3EQRA 4F7NA 1OGYA 1Q4LA 5BQ0A 4R3PA 4L6QA 4KRDA 4RC2A 2G2IA 4F1OA 2ZV9A 5ANOA 3COKA 2I0YA 3PIZA 2YITA 5L2IA 4B6LA 2UVYA 3L8XA 3PIYA 3NIEA 3NX8A 5CTPA 5IZFA 1K3AA 4YJVA 2CSNA 2ITOA 4F08A 5BUEA 3HP2A 2RG6A 1E9HA 4FZ6A 4F64A 5AA8A 3WE4A 1H27A 2C5XA 4S30A 4N4SA 5AAEA 1A06A 1ZY4A 3UQCA 3S95A 4C2VA 4PDPA 5M4UA 2XARA 4BWKA 4W9WA 4PTGA 5HO6A 4O4FA 3N9XA 3ENHA 4U40A 1PXIA 5DNRA 3DBCA 3OBJA 4IB3A 3WF7A 5GZ8A 4MXCA 2E2BA 2IZSA 2OZAA 2XP2A 4GS6A 4RLKA 2O8YA 3EQDA 3KRXA 3NNWA 4EWHA 5AP7A 3A61A 3EQPA 4FTNA 4DH3A 2A4LA 2WB8A 1PXLA 3GU4A 1ZXEA 5LMAA 3Q4TA 5J87A 3QZHA 2JGZA 4AW5A 4A9YA 4MEDA 4TYEA 4I0RA 3KXZA 1VYWA 3MH3A 4USEA 3A8XA 5EW3A 1YOMA 4AGDA 5BMSA 3R00A 4V05A 5IQEA 4WSYA 5J5SA 2VTNA 1ZYSA 2W1EA 4WG4A 1PXOA 3QUDA 4IQ6A 3Q96A 3PP0A 2B54A 3OEFX 3UO4A 3PZEA 3QRUA 1WCCA 2HW6A 4KBAA 3RM6A 1NXKA 3FL4A 4CTBA 3F3UA 3MH0A 2G15A 4AFJA 3MSSA 3NR9A 4L3JA 4GJ2A 4PRJA 4EOIA 3C13A 4UMPA 5IG1A 5DOSA 1JVPP 5E92A 2I6LA 4F7LA 3QZFA 4CKJA 4HZSA 2GHGA 4ZJJA 3GCPA 3GU5A 3HV4A 4K77A 5L6PA 2KTYA 1WBNA 4P5QA 2VAGA 3DOGA 3FPMA 3ZRKA 3D9VA 4O0RA 4RJ3A 3U6IA 5DT4A 5AUVA 3ANRA 4ZXTA 4GKHA 3VW6A 3RPVA 3WZJA 2XKFA 4KNBA 5IDNA 2A2AA 3FLQA 3SXSA 3OP5A 3RWPA 1R39A 5AUXA 3ZYAA 1UU7A 4PL4A 1Q8YA 1R0EA 1MRUA 2YABA 3HLLA 3SVVA 4UB7A 1APME 4RLLA 4TTHB 3E87A 3RK9A 2YM8A 5JZJA 3UIXA 3AC1A 2AC5A 5HOAA 5ANEA 4DH5A 5AP4A 3D4QA 3CD8A 4U7ZA 5M09A 4I6BA 5GNKA 3BHYA 3V6RA 3FC1X 2Z7RA 3DDPA 1XH5A 3HMMA 2VTLA 5AWMA 4QP3A 3DNEA 3ZFXA 2BFXA 3C4WA 4QP9A 3UMWA 3LFDA 3WE8A 3ID6C 1FMKA 3IONA 5ICPA 4KUJA 4QMUA 1URCA 5IQGA 3ROYA 4EK4A 3PUFC 2FGIA 4MNEA 5L8JA 4I93A 2I0HA 5BVNA 2YACA 3GENA 2WMAA 5KMJA 4WSQA 2BMCA 4AW2A 3MPTA 3TACA 2W1HA 3MFRA 4FKSA 5B2KA 2VWXA 4JVGA 2R3GA 4O0YA 4RX9A 2WTKC 2ZYBA 5BX0A 3I7BA 2PE1A 2GCDA 3LM5A 3W2QA 2CGVA 4ERWA 1JKSA 2AEGA 4CGAA 3QTWA 3ZCLA 3ZOSA 3NLBA 3TKHA 3I81A 3LHJA 4IX4A 4M12A 4XG4A 4RVMA 4C7TA 4DG3E 2XYNA 4AWIA 4N0SA 4Q5EA 1V0BA 4DGGA 1H00A 2UZDA 3RPRA 5C26A 1YRPA 1OVEA 4BCFA 1VR2A 5IUGA 2X4FA 1RE8A 2H6DA 4GJ3A 5KE0A 4FV0A 3U9CA 3FJQE 3WIKA 3GOPA 4S31A 3O96A 5A9UA 4RIWA 5KNJA 5IMXA 5JFSA 4HNIA 2JAMA 3HAMA 3TYKA 2O5KA 4GH2A 4XRJA 4C62A 4XV9A 2VO6A 4DFLA 4DITA 3I79A 3FMDA 3UNJA 1BI7A 3OS3A 3UO6A 5M53A 4FVPA 4OT6A 5TOZA 4YLJA 3ALNA 5CZIA 4Z9LA 3VUDA 2BIKB 3WIGA 2HY0A 4FIEA 4QMOA 3RALA 4F6WA 3NUUA 4FIGA 2YCQA 5IA3A 3N4TA 4KSPA 3LMGA 4PX6A 3FZPA 3MH1A 3EKKA 3UOLA 2PPQA 1QPDA 3MWUA 4BKJA 4WUNA 1CKPA 2BRHA 2R2PA 3TUCA 5EYDA 2XNPA 3FLWA 3NPCA 5IA2A 4HJOA 5CAOA 3FXZA 5GJFA 4I41A 1OM1A 4UALA 4IH8A 5FEDA 3I4BA 3UO5A 4IBMA 4LRMA 3JY9A 2E9VA 1M7NA 4FUYA 2W1CA 3OT8A 3TZ9A 1G8JA 5AMNA 2XALA 4QDEA 2Y6OA 4ONAA 4CCBA 3E62A 4DEDA 4EH9A 3K2LA 2C1AA 2CNQA 1YHSA 2WTIA 5FRIA 1Q61A 2XVDA 1TQPA 2UW9A 3C50A 3CJGA 3OHTA 5FD2A 2PUIA 1VZOA 4QQCA 4BI1A 5L2SA 3DXPA 4FVQA 4EQCA 1CKJA 2W1GA 5JFVA 3D7TA 1H0VA 3CQWA 5T3QA 2WQNA 4NTSA 2J90A 4RJ4A 2OU7A 5CWZA 2YEXA 1R3CA 2VTRA 4M68A 5ANGA 1GIHA 2JKMA 2HK5A 2C1BA 1ZYDA 2XIKA 3GFEA 4PDYA 5J7HA 3O51A 5D41A 3PWDA 3LXLA 4AG8A 5E8YA 3W1FA 4XG9A 2V22A 5CAQA 5KMNA 2PUNA 2X0GA 3DCVA 5HICA 4AN2A 2VTHA 4LI5A 3MW1A 3T9TA 3UJGA 4BDAA 3SW7A 4WBBB 3LJ0A 2PVJA 3Q4UA 4GIHA 1ZMVA 4WO5A 5EOLA 3UMXA 4FIIA 4KA3A 4K9YA 1Q99A 2PHKA 3BIZA 4R1VA 3AT4A 3BBTB 4CZYB 4F9WA 3DKCA 3QFVA 4XG3A 4DHFA 3MYGA 2B55A 3GEQA 4J1RA 3FQEA 2XIXA 4H3QA 2JDVA 2J2IB 4QP4A 4FG7A 3ZDIA 3BELA 4CKRA 3ZBFA 5JN2A 4NUSA 4E4XA 1VJYA 2YDIA 3BGZA 4BIEA 1J7IA 1O6LA 1EH4A 4F7JA 2ITPA 2PVLA 4GT5A 4V04A 4WNOA 1KUTA 2BZHB 4BJJA 4YHJA 1J1CA 4FTCA 4DFNA 2IF8A 4O38A 4YJOA 4HGLA 4F09A 1R1WA 5AR5A 2J5FA 3AT2A 5DRBA 4AUAA 2BDJA 1YHVA 4PMMA 2FUMA 4BGQA 4CFVA 4DGNA 2Y0AA 5JMSA 5M4IA 4LV8A 3I60A 4IM2A 1PYXA 4L7FA 5CI6A 3UP7A 3VN9A 2XEZA 5C4LA 5GINE 2AQXA 5IPJA 3V8SA 1U4DA 4MBIA 5M51A 2WEIA 4WNPA 4CZTA 3L8SA 3SGCA 4EH4A 3W0OA 4YPSA 2QG7A 3VRYA 2R0UA 4CT2A 3VBTA 1URWA 4QTDA 4KBKA 2UZTA 3W0RA 4EK5A 3IG7A 4KRCA 1UNGA 3EQIA 3VUTA 3QHWA 4R78A 4TT7A 4W4XA 3A62A 3OCGA 4U9AA 4KKEA 3WF8A 2CNVA 2VTQA 2YIXA 4JDJA 4Z55A 5I9XA 2VX1A 3PSDA 3AC5A 1Q3WA 1TFFA 2IZUA 2XK6A 3LFFA 2W9ZB 2Z7SA 4AA0A 3QTIA 2CKEA 4QMWA 4ZAUA 2VTAA 1HOWA 5CU4A 5I3OA 3DK7A 3NYNA 4WG5A 4Q5HA 1UKIA 3ORMA 2NPQA 5EHLA 4A9SA 3A60A 3GVUA 3TNHA 1E1VA 4O2ZA 4I6LA 3DV3A 4FSWA 2F2CB 2W5AA 2Z02A 4DA5A 4P7EA 2WNTA 4FSTA 5F20A 5DRDA 5AV4A 3WZUA 3TMOA 1Q8TA 4HCTA 4E7WA 4RWJA 2BAQA 3L9PA 2ITUA 2FA2A 3COIA 3KF7A 4GFOA 4MBJA 4X2GA 2W5HA 4ZLZA 3QD0A 3DS6A 4KIQA 4YNEA 2VTJA 3LFSA 5H2UA 1U5RA 1BYGA 1H07A 2O0UA 2GFSA 3HX4A 1BKXA 3PJCA 3RHXA 4MXZA 4ENYA 4FT3A 3LQ5A 1BUHA 4QP6A 3OG7A 3P86A 2XNEA 1J1BA 3FAAA 2JIVA 3ORLA 3VS7A 3Q04A 1CTPE 3MS9A 3PXZA 4RJ5A 4D2VA 2PYWA 3VS1A 4BCPA 2OO8X 4CMOA 1S9IA 4UN0C 5K0XA 2C6EA 4EBVA 4EHEA 5AADA 2C6OA 3ZRMA 2VTIA 5BMMA 2C5OA 2XCHA 4FKUA 2VV9A 1H4LA 2OW3A 4E8AA 4LYNA 4NYEA 2HXLA 3LFNA 1FPUA 3HMNA 3FXXA 4YHTA 4CFUA 1R0PA 2UW7A 4XX9A 3EQBA 3E8CA 2OJGA 3V5QA 2HYYA 4BKZA 2BRBA 4L3PA 4HOKA 3FZSA 2C0IA 3F82A 4G6LA 2F49A 2VTMA 4DGOA 5IQIA 2QOLA 2ERKA 2RKUA 1LUFA 3R9NA 4M7IA 4Y85A 5BPYA 3PVBA 3FSKA 5HG9A 4G6OA 3JPVA 3O2MA 4FTMA 4EK6A 3HDMA 1OIYA 4GRBA 3LFAA 4LL5A 4OAVB 4IVAA 5FQDC 2UVZA 1UU8A 4QPAA 4QTCA 4EH6A 3QX4A 4XEYA 4QMTA 3VAPA 5HX6A 2ITTA 4CTCA 4JBVA 2VX3A 4ZS0A 3PLSA 4U79A 4FT0A 4HZRA 4DTAA 3L9LA 5K0KA 2W1ZA 4NZWB 4GT3A 4BRXA 4QMNA 4YTHA 2IW9A 4DHZA 3TKUA 3GC9A 1H25A 4FG9A 4LDTA 3CC6A 4EH7A 2WXVA 3QX2A 1I09A 2ITXA 4X7QA 5JGDA 4AGWA 3KRJA 1F5QA 1ERKA 3RAKA 3O7LD 4ZIMA 4MYGA 4BDIA 4TL0A 3QQFA 5J9ZA 1T46A 2GPHA 5EYKA 3C5IA 3T9IA 4YUQA 3BV2A 4PPBA 4TY1A 2G01A 3E92A 4JXFA 4IWDA 3ORNA 5FM3A 4AXFA 4ZLOA 3D94A 4FKRA 3U6HA 3DXNA 2XK4A 2WZJA 4F9YA 5DA3A 1SVHA 2PL0A 1PXNA 1H01A 2XB7A 5HG5A 3TT0A 4FJVA 4O0TA 3VUKA 3RCJA 3ENMA 1OKYA 4FKTA 5ETFA 4UXLA 4IADA 2CN8A 4TYIA 5HLPA 3R01A 3OWPA 3MB6A 1MQ4A 2JEDA 3FBVA 3KN5A 4S34A 4BZDA 3TN8A 4HW7A 3RAWA 5A4CA 3R22A 4DEGA 3PXQA 1YI3A 3PY0A 3CEKA 4FSYA 4LRJA 4Y5HA 4UMUA 3OXTA 4U3ZA 3PJ8A 5C8KA 4ORKA 1OPLA 4J71A 2XJ2A 5EYMA 1O9UA 2P33A 1OKZA 1PHKA 2A27A 4FZFB 3IGOA 3DB8A 1QPCA 4C4JA 2WIPA 5T68A 3F88A 5HKMA 3CP9A 5AM6A 5I0BA 4YSMA 4GT4A 5HO8A 5HLWA 1AD5A 3LFCA 3JYAA 4DH7A 3SW4A 3EL7A 4YZCA 4WUAA 3BRBA 4M15A 2O65A 3R7UA 4FV1A 4AE6A 3NDMA 3POOA 3GCSA 3NFGB 4HGEA 2PMLX 4LL0A 4X21A 1TVOA 3KREA 3BLRA 5HE2A 5A46A 5AR2A 3GC7A 3HGKA 4D1SA 3P08A 2ZVAA 3A7FA 1UVRA 2NNWB 1O6KA 1V0OA 2RF9A 2C6MA 4MD8E 4FK6A 2XIRA 1OPKA 4BZNA 3PA5A 3LJ2A 4JNWA 1SMHA 2PZYA 3FHRA 3LCSA 4CFXA 4DT8A 4CRSA 4I6HA 4WIHA 3QXPA 4Y83A 2BHHA 3MJ2A 3KVWA 3AGLA 4KAOA 4EOQA 4CV9A 3O8TA 2XNMA 5EW9A 2R3QA 3UG2A 1OUYA 4FKOA 4G5JA 5GHVA 2CN5A 4E4LA 2WHBA 4X2FA 3TDWA 1Y8YA 4G9CA 3DGKA 2GQGA 2BROA 3OZ6A 3R9HA 3F6XA 4EUTA 2OXXA 3TZ8A 3WF6A 1F3MC 3IDBA 2JITA 1Q8ZA 4OLIA 5HORA 2J0LA 1BMKA 2DS1A 3MY5A 1GY3A 2BDWA 4GVJA 4GV1A 3TNWA 5CVHA 3VBWA 2Z7QA 2B1PA 4M13A 3UZTA 5LXMA 4FTOA 4IB1A 3Q6UA 4YP8A 3R8VA 4QT1A 2GMXA 3HKOA 4U45A 1REJA 2IVSA 4EHZA 5KMMA 3MA6A 3UZRA 4JDHA 4NKSA 4C0TA 3EFKA 4IZ7A 2X7FA 2WIHA 3B2WA 3C4EA 3H9RA 2I0EA 4IAAA 4GFMA 4FTQA 3IW6A 1Q5KA 4BYIA 3OW4A 4C4FA 4RA5A 3NW6A 5JQ5A 4H39A 4YZDA