4A9TA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
304
structure length
289
Chain Sequence
MSVYPKALRDEYIMSKTLGSGEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 289
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9tA01
3DZOA 2V7OA 3E88A 5FXQA 4FL1A 4QMYA 1CKJA 1OL7A 5AP3A 4BCNA 4DH1A 3R9HA 5A4TA 4RWLA 4IFGA 4EZ3A 4AN9A 1KE9A 3OY1A 4RJ8A 5CF5A 4F0IA 5FP6A 4FKGA 4IACA 3R7EA 4J98A 4EQUA 4N6ZA 1UWHA 2PVFA 3MVLA 4QQTA 2CGUA 2VTNA 5DE2A 2W7XA 5AWMA 2B1PA 5A6NA 4YNOA 2OZAB 3EKKA 1QPJA 5CENA 3JYAA 2OJGA 4NIFB 3CP9A 3HMNA 5J87A 2O8YA 3P5KA 3K2LA 4IANA 2PVMA 2BRBA 3LZBA 3A4OX 3V8WA 4BWXA 1MRYA 5A4QA 2OGVA 5EI2A 5IPJA 3F6XA 5AM6A 5AX9A 2DUVA 4MF1A 4EOMA 4PDPA 5JRSA 4OBOA 4MXAA 2C6MA 3VIDA 4USEA 4XNEA 5M4FA 4FKQA 4JIKA 2RFNA 5GNKA 4IB3A 3UODA 1OMWA 2CGXA 3TZ9A 4CFFA 4BCPA 3F82A 2YDKA 4CG9A 4G17A 3TACA 3VUTA 3NX8A 1H26A 2UZTA 3HV4A 4XV3A 2JD5A 4EHVA 1U54B 4G3DA 3OTUA 2J51A 4O0UA 3VS3A 4FG9A 4OTGA 5CI6A 4CG8A 4H1MA 2QO7A 1XH4A 2UUEA 4EKLA 5GZ8A 4M15A 4CT1A 3CKWA 2WMTA 1H4LA 4I41A 5CNOA 5CAPA 4O91A 1S9IA 5LMBA 2C68A 4IZ5A 2YIYA 5CU6A 4Z16A 5I9YA 2BKKA 4I5MA 4B8LA 3POZA 4YMJA 3LCTA 2R3RA 3FI4A 4IB5A 4C58A 4AU8A 2ITZA 1OKZA 2XM8A 2ZV2A 5TR6A 2QQ7A 4M12A 4ZTRA 4YBJA 3RI1A 3DXNA 3Q4UA 5L3AA 4AOJA 4NM5A 3CIKA 4IX4A 1LEWA 5CAVA 2QD9A 1KE5A 4IWOA 5EYMA 4KSQA 3KXHA 2YEXA 4M69A 5C8NA 4JQ8A 4E6QA 4R5SA 4C37A 1YXXA 4KRCA 1NA7A 1GZNA 4BIDA 3LAUA 4QO9A 1DS5A 4Z7HA 4AN3A 5FRIA 3DGKA 5EW3A 4DCAA 1O6LA 3MFTA 4G6OA 3UVPA 4I6HA 3LE6A 3T3VA 3NW5A 4CFNA 3DFCB 4Q9ZA 2XM9A 4EL9A 2A2AA 2XMYA 2BFXA 4BDJA 3MN3A 4ZZOA 5CVHA 3HV6A 5EH0A 4AT5A 2YZAA 4BBFA 1TQPA 3QYZA 2HYYA 4UWYA 4I0TA 4QMNA 5KHWA 1U5RA 4F70A 1TKIA 2WMXA 4USFA 4C4IA 1G8SA 1BX6A 1Q4LA 3PP1A 2WEIA 3SDJA 4FTQA 4TPTA 3QFVA 4P90A 3W2OA 3ZBXA 3H3CA 3I81A 5AP6A 4AP7A 4DGNA 4WRGA 2WXVA 1XH7A 1WVXA 4G2FA 3TCPA 4DBNA 2Z02A 3HA8A 4AFEA 1YXSA 4BC6A 4F09A 2VTSA 4ZTHA 4C36A 4NTTA 4WBOA 2YAAA 3ROCA 3OXIA 3BCEA 4WNKA 3GU7A 4D9UA 5J1VA 4ASDA 5EW9A 5LOHA 2ZV7A 1YQJA 1ZY4A 5T3QA 1ZYJA 4V0GA 3ZMMA 1YHVA 1ZMWA 3CD3A 5HBHA 1J3HA 4F4PA 1PMVA 3NZ0A 3UIMA 1L3RE 4NTSA 4X6QC 5C27A 2F7EE 2XK9A 3L8SA 3QZGA 3B8QA 5EOBA 4EC9A 5HBEA 5LCJA 5M09A 5CSVA 4R3CA 2PVYA 1A48A 4H39A 4FMQA 4EBVA 5H3QA 1ZARA 3NVKI 2XBJA 3I79A 2ZOQA 3VO3A 5IG1A 3Q96A 1KV2A 1TQIA 3GFEA 1SVHA 4FSYA 2XUUA 3ZEWA 2X8EA 2YIRA 3EFWA 2B55A 3GCVA 3P1AA 4RLKA 4GK4A 5J9ZA 2FYSA 2BCJA 1BL7A 3ORTA 2WMRA 4IAIA 3JY9A 4B6LA 5K4JA 2PVKA 2GQRA 4KB8A 4CCBA 4HPUE 3UBDA 3WF8A 4BCHA 5HO7A 3KULA 2QOBA 4ACGA 4D4RA 1H1QA 3EQGA 1S9JA 4FX3A 2GNGA 4OTWA 5JQ8A 1GZKA 2OIQA 3KMMA 5DRBA 4JJRA 2IZRA 1KE8A 1E9HA 4NT4A 5F20A 1YHSA 2XIRA 3RKBA 5EQYA 3NNUA 4FTNA 4UMUA 1Q8WA 3F69A 3VUDA 2WD1A 4HNIA 4M69B 5CU2A 2VRXA 4GFMA 4IE9A 4RRVA 5F1ZA 5BVWA 4ZTLA 2WIPA 3TI1A 4EOJA 2F7XE 4QNYA 4ZY4A 3KF7A 3SHEA 1FINA 4BI2A 3IDBA 4AZSA 5JT2A 3MVHA 3LFNA 4FTRA 3JY0A 1UA2A 3Q5ZA 1XQZA 2OJIA 2UW9A 3OWLA 4YPSA 3WILA 2VX0A 4FKIA 2OXYA 2I0VA 3F3WA 4QYYA 3OUKA 4KWPA 3UP7A 5KMKA 4FSTA 3TDWA 4G3FA 3TIYA 5M44A 2W4OA 2C6IA 3I7BA 3Q2JA 4B4LA 1UNHA 4PDYA 3ALNA 2FH9A 4C61A 3FZOA 2ETKA 3TKIA 4GKHA 1H01A 4FV6A 5L8KA 3QXOA 3D4QA 4L44A 3MJ2A 3OEFX 4LM5A 4QQ5A 3NMUF 2XK8A 2AUHA 3ZLXA 4BZNA 2I1MA 2QU5A 2HY81 3RK5A 4TWCA 2VWWA 3UPXA 2ONLA 5L6PA 3HEGA 3VC4A 3PVGA 2C5YA 3I6UA 3U9NA 3HV5A 5ETAA 3S2PA 3AG9A 5KE0A 3BU5A 3CY2A 5IA4A 1PRYA 4PMSA 5KKRB 2JKKA 4RT7A 1GIHA 4M0YA 3W8QA 5HIEA 1WAKA 3P23A 2OSCA 3HV7A 3FMHA 4KUJA 3RPOA 1MRUA 4TT7A 1UU7A 4L46A 3DBDA 4EH8A 1ATPE 1BLXA 2Y9QA 4ZZMA 2JKMA 4FTAA 3QTWA 4RQVA 1Q3DA 1J91A 3PLAE 4I94A 4R77A 3POOA 5EYDA 4LYNA 3TXOA 4CV8A 2WTVA 4PRJA 5L6OA 2B0QA 2YHVA 5E8WA 5FD2A 3I60A 4H1JA 4BCFA 3UOLA 4OAUC 2DYLA 3KULB 4XP0A 1Q3WA 3V5PA 5DVRA 2R2PA 1RE8A 4YJUA 1ZY5A 2XK7A 2YIXA 2BAJA 3KVXA 5BMSA 2XCHA 2VV9A 4ZSGA 5JSMA 3PSDA 3LW0A 1XR1A 4IX3A 4YHFA 4BIBA 4I93A 4KBCA 2JDVA 3QGYA 3N4VA 3NWWA 4UYNA 4YLKA 4KABA 3FY0A 1H28A 3P79A 4TYJA 4BTJA 1F5QA 4OTHA 5JKGA 2YLFA 2ITUA 2Y0AA 2FUMA 4JQEA 3VN9A 4DHFA 3BPRA 3BZ3A 3Q9WA 3ZO4A 5FG8A 4L67A 3T9TA 3NRMA 4HVSA 5CXZA 4EUUA 1WMKA 2WPAA 3EQRA 3PIZA 1R0PA 3LFAA 3QRIA 3UYSA 3WF6A 4LMNA 3WBLA 1IA8A 4Z9LA 3WF5A 5DG5A 3GUBA 3E7VA 4MX9A 4UX9A 4PY1A 4M97A 5LWNA 3CQWA 3QTQA 3R8PA 3UIXA 2PUPA 3IOKA 4EI4A 2BZHB 3UPZA 3A8WA 3HP2A 4GYIA 4R7HA 2V7AA 4B99A 5HTBA 4QT1A 2PE1A 4FTJA 4ASEA 2GQGA 1FMKA 1IRKA 3ZSGA 2HW6A 3WF7A 3F3UA 3ODZX 3GEQA 3HRBA 4UZHA 3SOCA 4ACHA 4ZLZA 4C3FA 1CKPA 4MWHA 1F3MC 2X4ZA 3PWDA 4FV9A 4YZMA 4TYIA 5BMMA 3ATTA 2F49A 4J97A 5L2WA 1KSWA 1A9UA 4L43A 2FB8A 2Z7QA 1CM8A 4G34A 1YOJA 4AT3A 4AA5A 2Y4IC 3GC8A 2XJ0A 2ESMA 4BZOA 1Q99A 5HU3A 5JFXA 3HA6A 3KKVA 3WZEA 3QCQA 4Z7GA 5HTCA 2XNMA 4MXOA 2W9FB 4YJOA 3MJ1A 2WZJA 4LUEA 3A7HA 4EUTA 4IJ9A 5F94A 2VX1A 2X7FA 2GTMA 4PDSA 4QD6A 4O0TA 5AR4A 4DYMA 3Q9ZA 1O6YA 3QZIA 1I44A 4I6BA 1WVYA 4D2SA 2NO3A 3HDMA 2W06A 3DQXA 2HZ4A 2PWLA 1OL1A 4BCKA 4B9DA 4JG6A 5AUUA 3QUPA 1B38A 2G15A 5JEBA 4TN6A 2UZWE 1PJKA 4FSWA 2G2IA 3PG1A 1YHWA 5F95A 2E9NA 2HZ0A 3CKXA 1RJBA 1PXNA 4QMTA 5EM6A 4DEEA 4CXAA 3VBQA 5BVNA 3ET7A 5FDPA 4AAAA 4D1SA 4QTBA 1G3NA 1P4OA 4IADA 1OPLA 3G33A 4HYSA 4QTAA 4U40A 4NM7A 3Q4CA 4J52A 4UWBA 2CNQA 4GT5A 1Y6AA 2UZBA 3TV6A 3A62A 2HAKA 5A4CA 4FIHA 2QG5A 2R3MA 4O7TA 3UIBA 2ZB1A 4MXYA 5FBNC 4I4FA 4E6DA 4FKLA 2GS6A 4FTIA 2VO3A 2WMSA 4MD9E 3D94A 4E20A 3OP5A 4KBAA 1W83A 1PW2A 5AFVA 1CSNA 4HGSA 3R71A 2ZDTA 3QQUA 5LMAA 4XV9A 3L8VA 5AV4A 2Z60A 1DI9A 3EJ1A 2G2FA 2J0KA 3IG7A 3PZEA 3ZM4A 3LIJA 3HMIA 4GSBA 5HD7A 2VWZA 5K5XA 2WNTA 2X6EA 4A06A 4D5KA 4M3QA 4OTRA 1AGWA 2OWBA 1UU8A 2HOGA 3LQ8A 5CTPA 2O65A 4C2VA 4ERWA 2QHMA 3GB2A 3PFQA 4XG9A 4L7FA 1FMOE 3PE2A 3KU2A 3COKA 2B9HA 4IAFA 3MH2A 5G6VA 3BGZA 5JGAA 4O83A 4NCTA 4ZTQA 2HWOA 1Z5MA 3BE9A 4CVAA 3LLTA 3DOGA 2DWBA 2OJ9A 2P2IA 3C4CA 2YM7A 5D9HA 3FPMA 4R1VA 1UVRA 4QYGA 4MH7A 3AD5A 3KC3A 4MTAA 4LOQA 4CLIA 1ZYDA 2NPQA 4WUAA 4FKWA 4DINA 3RBWA 3VBTA 2VO6A 5BQ0A 3LMHA 1OITA 5AEPA 5EDQA 2P33A 4RIOA 3U6IA 1OECA 4Y72A 3PY0A 4AZFA 2ERZE 4TNDA 4U5JA 1U4DA 3MIAA 3L8XA 3B2TA 1MUOA 4K6ZA 3LCOA 3GU5A 3H0YA 4FICA 4PTEA 5ACKA 4EJ7A 4ZS4A 4RQKA 3R04A 4CFXA 3DKFA 2FSMX 4IC7A 3MYGA 4H36A 4WO5A 1U46A 4I4EA 1WFCA 4ZAUA 3L8PA 3D5VA 4GG7A 5I5ZA 3V6RA 1KV1A 3CR0A 4RZWA 1YRPA 4ZSAA 2ITWA 4O7WA 3Q53A 1BKXA 2ZM4A 2GNJA 4W9WA 5CNNA 3SW4A 5JH6A 4XUFA 5E8ZA 5AR7A 1OL5A 5I9ZA 2YITA 3IQ7A 1Y8GA 4DFLA 3LFQA 4WNMA 4ZK5A 1IG1A 4FF8A 4IB1A 2HK5A 3F5UA 1WBVA 3QQLA 4AQCA 3PA3A 4MEDA 4E5AX 1UU9A 2GNFA 3R7VA 2RFEA 4HNFA 3DBQA 3CSVA 4O27B 3TZ8A 3FXXA 4Y46A 4ZTSA 5LCKA 3VHKA 3ANQA 5AM7A 4CYIA 1U59A 5D11A 2X9EA 5EHLA 4BB4A 4F7NA 2BHHA 3EQDA 2XNEA 4Y85A 2OXXA 4TWPA 3P7BA 4BCQA 2IW8A 4EKKA 2H9VA 3ZM9A 2WQMA 3IPHA 4GH2A 5E4HA 1IAJA 4FC0A 4XS2A 3F5GA 3WZDA 2R3IA 2C6LA 1KE6A 3PVBA 4RC3A 4S31A 4YTHA 5BVFA 4FZDB 1QMZA 2YWVA 4RA4A 1PKGA 4P5QA 3SC1A 2BUJA 4DEHA 4D5HA 3E87A 4FGBA 5FDXA 4MK0A 1WCCA 5IQDA 1PYEA 3CCNA 4MXCA 4EBWA 4IVBA 2R7BA 4RFZA 5HO6A 4YTCA 2A4LA 5CSPA 5KMLA 4WA9A 4E3CA 2J90A 2BFYA 3KRWA 4EH3A 3FLSA 4I22A 4CD0A 3E62A 3QRJA 3QA8A 4PL4A 4DGMA 3TJCA 1NY3A 4BRXA 3A4PA 4BBEA 5J1WA 3IOPA 1OKVA 5L6WL 2XZSA 3AXWA 5M4CA 1PY5A 2XA4A 1Q8YA 3FZPA 3VAPA 1ZLTA 3TTIA 5E8TA 3ZS5A 4FGRA 1LEZA 3PJ8A 4K8AA 3NAYA 4DA5A 3CTHA 5IH6A 2JGZA 1PXJA 3LLAA 2Z8CA 4G1WA 4OLIA 5HVKA 4ALUA 3RNIA 4BKZA 3ZSHA 4C4GA 2PMOX 2WTKC 5HE1A 2BDWA 1YXVA 3VWAA 3SRVA 1OBDA 4MVFA 2VZ6A 3IGOA 4YO6A 3PP0A 3H0ZA 4LOOA 3DT1A 4EJNA 4FA2A 5IEVA 1Y91A 2CDZA 5AV0A 3L9LA 3NYXA 1Y8YA 3S4QA 1A06A 4CQEA 3IS5A 4E1ZA 4GMYA 3CQUA 5EW8A 4L3PA 2F4JA 4OTIA 4EK3A 1V0PA 5K4IA 5HX8A 4PPBA 2OKRA 3CC6A 2R3GA 3VUKA 5L2TA 3E93A 4ZY6A 3KN5A 5AV2A 3IKAA 3DK7A 5AADA 3GCUA 3OW4A 2W1HA 3KFAA 3C4FA 5HI2A 3E64A 3OEZA 4EEVA 1RQQA 4F65A 3GCQA 4HJOA 3G90X 2ZVAA 3F88A 4V01A 4IVCA 5KMIA 2WTDA 5CEQA 3IW6A 2JC6A 3QWKA 4DLJA 5A54A 3DK3A 4N6YA 4NFMA 4ZS0A 4L00A 4L8MA 4BCGA 3C7QA 4O2ZA 4RJ4A 2R3KA 2ZJWA 3W55A 5E8VA 5CEOA 4FZ6A 2RKUA 3ITZA 2RIOA 3QZFA 3K5UA 3M2WA 4EOIA 5I0BA 1SYKA 4Y83A 4EOLA 4XEYA 3V5QA 4IQ6A 3Q3BA 2CNUA 4ERKA 3UO6A 4Z55A 4K77A 2QOHA 1APME 5DH3A 3UC3A 2WMUA 4YZ9A 3VJOA 4LGHA 5D10A 3R1YA 2CSNA 4KAOA 2J0IA 4AXAA 2P2HA 3FMKA 4O1PA 4W8EA 4O82A 3HX4A 3JVRA 4HYHA 4NW6A 2ITNA 4X2FA 3VULA 4YLLA 2ACXA 4O7YA 4G9CA 4FSZA 4AW1A 4XBUA 5E91A 3TNWA 4HCUA 3UC4A 3MA6A 3VW6A 2QURA 5CEIA 3G2FA 3E5AA 2EXEA 2B9FA 4PQNA 3I5NA 4DEBA 5B7VA 4RFYA 5KBQA 1PXKA 2RFSA 4NKSA 3FHRA 5KMMA 4FV7A 4S33A 4BDEA 3R9NA 4DEAA 3BLRA 4UYAA 4XH6A 5AP5A 4E4LA 5AAEA 3F7ZA 5BNJA 4WG5A 5DI1A 3GOKA 3F5PA 4FR4A 3JR1A 4NL0A 4E93A 4IEBA 4FZFB 2CJMA 4FK3A 3DCVA 2VO0A 3CY3A 2YM8A 3BU6A 3TL8A 4O2PA 4HCVA 3DDPA 2UW0A 3R30A 3FXWA 4TXCA 3SRVB 2I0YA 3ZH8A 4CFMA 3N9XA 2PVJA 4E8AA 1FPUA 4FTMA 2WKMA 2G2HA 3CLYA 5L2QA 2GTNA 1DAWA 4YSMA 5EKOA 2YZLA 3ORPA 2Y4IB 1H1SA 2VGOA 4XCUA 4HVIA 3UZTA 4IM2A 4U79A 4ZXTA 4H3BA 5IQGA 1Q24A 4G6NA 4CCUA 1WBSA 4IZYA 4ITIA 3FYKX 3PE1A 3VS5A 4M13A 2BVAA 3D0EA 4FSUA 2R3LA 1OL6A 5T6KA 4U3ZA 1L8TA 4BDKA 3A2CA 3QHRA 3K3IA 4MYGA 4XG8A 4KRDA 5LVLA 2PUIA 4M7IA 2Y6OA 3MPMA 2LGCA 5HE3A 5DMZA 3QTRA 3VS2A 3ZFXA 3OT8A 4EQCA 4NJ3A 3PJ1A 3IK3A 3VUMA 1K3AA 4W4VA 2OBJA 2EB2A 4BHNA 4F1OA 4HVDA 5HCXA 4RX9A 3OW3A 1VZOA 4FIEA 5AJQA 5CT7A 4F64A 4HPTE 3ROYA 5EQEA 1ZOHA 3OTVA 4I5HA 2C3LA 5C8MA 4RMZA 2GCDA 2PVHA 3H4JA 3II5A 4O6LA 3VQHA 4FKOA 2IVSA 3EN6A 3RAIA 1CTPE 4F1MA 3V8TA 1XH9A 2QONA 3BGPA 2WTJA 5CS6A 4MWIA 2HY0A 3DKGA 2C3KA 3A60A 4O0XA 3ODYX 3W2QA 5CAQA 2HELA 3V01A 4WKQA 4ZJJA 3ZONA 5IA1A 2WB8A 4N57A 4D55A 3AC3A 1FBNA 5CEKA 2O0UA 1Z57A 4FL3A 4O7ZA 2W1FA 3TM0A 5M56A 2XRWA 4L6QA 5KX8A 2XNBA 2PVLA 3EQBA 3G5DA 4Q5EA 2W1EA 3SLSA 4AW5A 3VJNA 5ETCA 5D41A 3E8NA 1O6KA 2W17A 3UQGA 2ZB0A 4LV5A 2VN9A 5BUJA 5AP2A 3QRUA 3P7CA 4C34A 5E8XA 2UW6A 3A7IA 4LFIA 4ZMFA 4I6FA 3LCDA 3NS9A 1Z9XA 5EHYA 1HOWA 4A4OA 4G16A 3R7IA 5CASA 1M2QA 3C51A 3BBTB 5BVEA 3ZEPA 4O21A 4AWIA 4HGTA 2C5OA 1UNLA 1PXOA 1YWNA 3HUBA 3PXQA 4B0GA 2VNWA 2WELA 2WU7A 3Q2MA 3QTXA 4Y5HA 4AZVA 2VTPA 3HZTA 2Z7SA 4GK3A 4QYEA 4YP8A 2R3JA 4UN0C 2IZUA 4HOKA 4HVGA 5LARA 4X2GA 4UXQA 4CQGA 3DZQA 3FBVA 3HKOA 3OG7A 3FQEA 4CMUA 4L52A 4A9RA 5KCVA 4NW5A 3F9NA 4BYJA 1FOTA 4RVTA 4W4YA 1DM2A 3H30A 5HGIA 5AUWA 2JDSA 3D15A 4O0RA 4AZWA 3ZO2A 4J71A 2QOLA 2IVVA 3O50A 3PLSA 4L01A 3R7OA 2UVXA 3VF9A 3R83A 3WOWA 5I9XA 3LKMA 3BYUA 4DLIA 4BDHA 5M4UA 2WMWA 3KCFA 3O0GA 2UVYA 3ZRKA 2UZLA 1LPUA 2BPMA 4KKGA 4O0VA 3NYNA 4WNOA 4WHZA 4RSSA 4AX8A 2X8IA 2XKEA 3C4XA 4GFOA 4U6RA 5A4LA 3FYJX 4QTDA 3L1SA 4DGOA 4F0FA 3H9OA 3RM6A 3V5TA 5K0XA 4MD8E 3EQHA 2Y7JA 3FMMA 4ZZNA 4BDBA 4O7LA 4XG6A 4FKUA 1FVRA 2EWAA 4U3YA 4GL9A 2EVAA 2J5FA 2XNGA 5JZNA 2BALA 3UMXA 3NIEA 4NM0A 5JZJA 5D7AA 3FI8A 4BR3A 4G31A 3TNQB 3TKUA 2OI4X 4NH1A 3JS2A 2C0IA 4RX7A 5A3XA 3ID6C 4YHTA 4JR7A 5AMNA 2JLDA 2W5BA 4FNZA 4R7IA 5CLPA 3WZUA 4MQ1A 5AP1A 5JMSA 5FTGA 1PXPA 4X3FC 4K18A 4JR3A 1J7IA 3EQCA 4BDCA 3QC4A 4X0MA 2O63A 4FTUA 4TWOA 1PXIA 5CF4A 4YZBA 4GVJA 3OY3A 3PXKA 2OU7A 2KULA 4HGEA 2YJRA 2C3IB 4FUYA 3ORIA 3COIA 3FZTA 4KINA 4D2TA 2VWIA 2OIBA 3NSZA 3ULIA 3A99A 4MQ2A 3GNIB 3SV0A 3LQ3A 3FQSA 4BN1A 4U44A 5FTQA 4GVAA 5M53A 2FGIA 4IDVA 5E1EA 5HCYA 3RTPA 1TQMA 4E4MA 4TZRA 3Q5IA 2ITXA 5HE2A 2R9SA 3KRRA 3OHTA 3Q9XA 4FKPA 3A7GA 4EHGA 4CMOA 1B39A 5ANDA 3AMAA 4C59A 4O7SA 2QOKA 5ACBC 1MQBA 4EK4A 4G3GA 4O81A 2PPQA 3EN5A 5IH5A 1UKIA 4RJ3A 2QR8A 5DA3A 1OUYA 2WGJA 4ZSLA 3RZBA 4FNXA 5BVOA 3EN9A 4PUZA 1LUFA 3HVCA 3QYWA 4EORA 3VBWA 5A4EA 3RHKA 3QD2B 3ZRLA 2W9ZB 3AD4A 4YU2A 3Q9YA 3EL8A 3BIZA 1XWSA 2W1GA 3W16A 4IX6A 4A07A 2BZIB 1KUTA 3DNEA 4OUCA 3GQIA 4NCTC 2WTKB 2VD5A 2YWPA 5DEWA 3MPAA 4PF4A 1MRVA 1Q8UA 1YXUA 5DR9A 1PF8A 4FEVA 2XK3A 3PXYA 3QZHA 3Q4ZA 4QPAA 2W99B 4JRVA 4QMXA 4WT6A 5CVFA 5DOSA 3TEIA 1OIUA 3CEKA 4D2VA 5HLWA 3SGCA 2ITVA 2ZV9A 3QQFA 1VR2A 2J50A 2OH0E 4ZOGA 2BAKA 4APCA 3V3VA 4D0XA 4EHEA 5DT4A 5IQAA 1GIJA 3BWFA 3UNZA 3FMNA 4YBKA 3F3TA 2VTAA 5I9WA 1P2AA 4GG5A 3C13A 4C4EA 2QCSA 1R39A 2X2LA 3VBVA 1T45A 2YABA 3C4ZA 3R7UA 3BBWA 2GNHA 2W0JA 2VWVA 2PUNA 2H96A 4V0GB 5IA0A 2HZIA 4CRLA 5ANKA 3PWYA 3KL8A 4KNBA 5E9EA 4MNFA 4G6LA 3QD0A 3OS3A 2C6KA 2P0CA 4FV8A 2PULA 1SNXA 2PZYA 5ICPA 4ALWA 2JKQA 4EHZA 3M42A 4D1XA 4I1ZA 2OW3A 3D5XA 5CU3A 4IVAA 3D7ZA 3W32A 2PE0A 3QGWA 4M0ZA 3EQIA 5DR2A 1IEPA 4BF2A 3GOPA 1YW2A 4WG4A 4GRBA 3BQRA 2BIKB 4RIYA 5EYCA 2UVZA 2DS1A 2FSOX 2QHNA 5AIKA 2X7GA 3UZRA 4MBLA 3KRJA 2XH5A 2FO0A 2IJMA 5AAGA 2C30A 4Z3VA 3TWJA 2GHMA 4NK9A 4R5YA 3ETAA 4ZSEA 3ZSIA 4GCJA 2O2UA 2VUWA 3CXWA 3Q04A 4FUXA 4GUEA 1G5SA 5FUTA 1MP8A 4BCJA 2YM4A 3FHIA 4ZJVA 3U6JA 3PRIA 3MTLA 3BHUA 2G01A 3EHAA 4EK8A 3FL5A 3OC1A 3V5WA 5BVKA 5HIBA 5CANA 5H8BA 5KNJA 3KK8A 3NLBA 2EB3A 3PPZA 4RX5A 2YIWA 4NKAA 4HVHA 1I09A 2PYWA 3V51A 5IUIA 4BGHA 5A9UA 2CKQA 2XEYA 5HHWA 3W1FA 2XIZA 3V04A 4BDFA 3OBGA 4R3RA 4YUQA 3ZBFA 3AGMA 3ZC5A 3QHWA 5G1XA 3C5UA 4S32A 4W4WA 2ZV8A 3R21A 3MI9A 2UZEA 1BI8A 4OTPA 5TF9A 5IQBA 3QC9A 4J99A 2QKRA 1JKKA 3ZLWA 4CT2A 4LRMA 1P14A 1E1XA 3LFCA 4M67A 1T46A 5E8YA 4ZJIA 5AUYA 1HCKA 4E6CA 1NXKA 5DFPA 4B8MA 5IQEA 2C4GA 2XYNA 3RK9A 3BV3A 2C1BA 3ZFMA 5HQ0A 3WIKA 2PUUA 3VRYA 4ANBA 3ORNA 4FK6A 3ZU7A 3GU8A 4JIAA 2PZPA 3FQHA 3QL8A 3E3BX 1UU3A 4R6VA 2JITA 3PA5A 2VGPA 3OUNB 3Q32A 2WO6A 5CSWA 3COMA 3WF9A 1MQ4A 1NVRA 2NRUA 4ZY5A 3QKLA 4KSPA 4XG4A 3AT2A 2HWPA 5FM2A 4D9TA 2HXQA 2C5XA 5HBJA 4L7SA 2R3OA 4FIFA 4NSTA 5J79A 1W98A 4AW0A 3UNKA 2X8DA 4IAKA 3NUAA 5CQWA 1JPAA 2X9FA 4J8NA 4KIOA 2OFVA 3QX4A 1YDSE 3NCGA 4A7CA 2Z2WA 1H1PA 5AV3A 2J0MB 2PHKA 3EFKA 4XRJA 3DXPA 4IHPA 4GIIA 4FT3A 4EYJA 4TW9A 4DBXA 3QQHA 4GJ3A 3VUGA 4UMTA 5CT0A 3VW8A 5AR2A 4MF0A 3EQPA 4M84A 3OOMA 4QMMA 5M06A 3D5UA 4K2RA 4LRKA 4ITHA 2QLQA 5JQ5A 4I3ZA 5LVPA 3BI6A 2WTWA 4AE9A 3EN4A 3R1QA 4JBOA 3VBYA 2J7TA 3EYGA 4ITJA 3FLQA 4JAIA 3ZLYA 4O0WA 3OWJA 5IUHA 1YKRA 2QO9A 2WU6A 3NIZA 3QUEA 4X3FA 4CV9A 4IM3A 2X7OA 1ZXEA 4YNEA 4CGAA 4C33A 1IR3A 3GCSA 3OCGA 4KKHA 5I3OA 4EK5A 2UW7A 3UQCA 4QYFA 3E63A 3MFSA 4QTEA 4FV0A 1XO2B 5ANGA 2V62A 3MS9A 3MY5A 2ZM1A 3DQWA 1OPJA 4QP3A 4O6EA 1OKYA 2RF9A 3KXZA 5HNBA 3DAKA 4AUAA 4DFBA 3AMYA 4QMUA 4BIEA 2UV2A 3VS0A 4XV2A 4FT7A 4F6UA 3ZYAA 3O2MA 5FP5A 2W5HA 1B6CB 2BKZA 2VAGA 5AR8A 4EOPA 4BDAA 4LRJA 5I9VA 2CKEA 3UDBA 3JVSA 2BRGA 2JDOA 3LMGA 5J95A 4K11A 3ZC6A 1ND4A 3SQQA 1OIYA 4BCMA 5FWKK 3ZO1A 3HUCA 2IG7A 5DIAA 4YZNA 2PVNA 2BTSA 2XIKA 3UO5A 4C4HA 4I0SA 2GMXA 2ITQA 5TO8A 3FL4A 1M17A 3W2CA 4AT4A 5AP4A 5EDRA 5AX3A 3NW6A 3K54A 4JT3A 5HG9A 4C8BA 2GNIA 3BV2A 4MNEA 4RJ7A 2UZUE 2PTKA 3GQLA 4G3EA 4CFVA 4CTBA 5C26A 3HP5A 2H34A 4CKRA 2ITPA 5IDPA 5IUGA 5AP0A 5M07A 3ORKA 2RL5A 3QXPA 3OWPA 1XH5A 1KWPA 1H07A 1YOLA 2XK4A 2XNPA 4Y8DA 3LFDA 1O9UA 4ID7A 3W2RA 3FKNA 2YISA 3D5WA 1YOMA 2IVTA 4FT9A 4ANLA 2RG6A 4QMQA 5JFWA 1YWRA 4IAAA 3WE4A 1V0BA 4RVKA 2JAVA 5M51A 3RCDA 1W8CA 5HTIA 1H8FA 2BZKB 4LL0A 1UKHA 4UEUA 3ZTXA 3FZ1A 5AV1A 5FGKA 3OVVA 2WQEA 4D2RA 3UJGA 3WE8A 4N70A 1ZYSA 2F9GA 3ZDUA 3SAYA 3FLNC 3MVJA 2XRUA 1BYGA 4PV0A 4YJSA 4FEXA 3G6GA 3FEGA 3U55A 2XBAA 4LGDA 2A27A 4XYFA 3OFMA 4X3FB 1V0OA 4EH2A 4AACA 2BZJA 2W1ZA 5A6OA 4BICA 4C4FA 4A9YA 3AOXA 1AQ1A 4UWCA 5D7VA 3O71A 3N51A 1PMEA 2CCIA 3LFSA 4I21A 1WBNA 4RIXA 4BYIA 4DFNA 5D1JA 2WMVA 3QQGA 4JBQA 5AAFA 4OR5A 4E73A 5CF6A 2YACA 5EM7A 3WYXA 2VU3A 2CPKE 3CPBA 4IH8A 4RX8A 4YZDA 4BKYA 2J9MA 3E92A 3D2KA 1REKA 3KXNA 4P2KA 2Y4PA 2YERA 4U43A 3UMWA 2BAQA 2J0JA 3I6WA 4DE4A 5BYLA 2RSVA 2C5NA 3ZOSA 1CMKE 4JXFA 2C6DA 3RAHA 4HCTA 3GC7A 2XIXA 3QTSA 3N4TA 3S95A 2VWXA 4XX9A 2PE2A 3MDYA 3LQ5A 3O17A 4IZ7A 3NCZA 3CGOA 3QTIA 5HNIX 4DN5A 1QCFA 2JIUA 4FL2A 1STCE 3FXZA 4RA5A 1H00A 3R0TA 4MBJA 4K9YA 4NFNA 5CI7A 5M55A 4TL0A 3LFFA 1PMUA 3GCPA 5HCZA 3S1HA 2R0IA 3AT4A 4MNEB 3PPJA 5EQPA 1OPKA 5LWMA 3NUSA 4JQ7A 3VBXA 3PUPA 5CU0A 2WOUA 2JIVA 1YI6A 2QVSE 4ASXA 4BVUA 3OBJA 4CFWA 5AUVA 2VTQA 2JFLA 4J95A 5DNRA 2PVRA 1JKSA 4QMZA 1J7UA 4QOXA 3VF8A 3C1XA 3ERKA 3OROA 2VTJA 2YDIA 4IFCA 2IVUA 4ZEGA 1FVTA 3RINA 4DCEA 4F7LA 3H9FA 3ZUVA 5IDNA 3T9IA 4C2WA 3HECA 2P3GX 3C5IA 3M1SA 2R3NA 4EK6A 3QCYA 3ZRMA 2C47A 3QLGA 3UE4A 5E8UA 4U41A 5AR3A 5CEPA 3FMEA 2GHLA 4OW8A 3FPQA 2OH4A 4IBMA 1DI8A 2PU8A 2KTYA 3Q6UA 4BTMA 2VTMA 4KA3A 4KD1A 5FXSA 5LVNA 3LJ2A 4F08A 2RFDA 3BHYA 4HZRA 4W9XA 5EDPA 1JVPP 1Q41A 2I40A 2QOQA 3OCBA 3PXZA 3D7TA 4O96A 4KIKA 5A14A 4CZUA 1SMHA 1W84A 4JDJA 5DT3A 2XK6A 5AP7A 4WBBB 3U4WA 1TVOA 4WG3A 3C9WA 1UV5A 4RLLA 3R28A 1WZYA 4C57A 3V8SA 1LP4A 1QPDA 4ZTMA 1KOBA 3E8EA 3R8UA 4D58A 2X0GA 3I4BA 3GVUA 4FG8A 4WOVA 4ZLOA 1AD5A 4U97A 3MY0A 3REPA 2QNJA 4FKTA 3MH0A 3GT8A 2X4FA 2W4KA 3GC9A 1BUHA 2V0DA 3C0IA 4L3JA 4IWDA 1FQ1B 3HNGA 5HKMA 3BLQA 1URWA 1Q61A 3ATSA 4ONAA 1J7LA 3E8CA 1M2RA 3MFRA 1OB3A 2BRMA 1ERKA 5IKWA 4AG8A 1SZMA 3QX2A 3KEXA 4H3PA 1VYZA 4IXPA 4FBXA 5HE0A 3AC2A 5LVMA 1P4FA 3LM5A 3UOHA 3DBEA 4J53A 5J9YA 3IW5A 1Q5KA 2C6TA 4EQMA 3QCXA 2WMQA 3MH1A 5KMOA 1WBTA 4XP2A 4QP4A 3ZFYA 3EMGA 2X6DA 4F9YA 1ZYLA 1ZZLA 4PDOA 4QP2A 5CX9A 3F66A 5IMXA 5GJGA 4FEUA 4IM0A 2QODA 4O0SA 1KE7A 3KMUA 2VX3A 5ITAA 1W7HA 3TUCA 3LMIA 1Q8TA 3QUDA 3V6SA 3ACJA 3HL7A 4O0YA 4QMVA 4QTCA 5KUPA 5GIPE 4FV1A 2XEZA 4LL5A 5TKDA 4RWKA 5L4QA 4ZIMA 1E1VA 2AYPA 4H3QA 4KIPA 3MSSA 3RP9A 3SG9A 3E3PA 3PVUA 1EH4A 5HICA 3D14A 5CALA 2C3JA 1JBPE 4FNWA 2ZAZA 4QP9A 2ZYBA 2AC5A 1PMNA 2E9VA 3QLFA 4N0SA 3MFUA 2YDJA 5IA5A 3BGQA 3MGYA 3MIYA 4LUDA 3DBCA 4I20A 4KIKB 3ZZWA 3LXKA 4RJ5A 2I7QA 4FTLA 3NNXA 3OXZA 3ZCLA 4QMSA 3MY1A 2R5TA 3THBA 4A9UA 5CQUA 1REJA 3B2WA 3HRFA 3WARA 4CZYB 4PMPA 2YN8A 3GENA 1YI4A 3IECA 4K33A 3WZKA 5HO8A 2XF0A 3MPTA 5TT7A 1Q97A 5HZNA 3KCKA 4PL5A 3U9CA 4KS7A 1JLUE 2QLUA 4YPDA 4M66A 5KZ0A 3W10A 1OGUA 5KMJA 5E7RA 1H08A 1GZOA 3FI3A 5K3YA 5JK3A 3HMMA 4FKSA 4C3PA 4TYHA 2B7AA 3HDNA 4FIIA 4BY9E 4GV1A 5TE0A 3FE3A 3R01A 3QU0A 4ZTNA 4MBIA 3U8WA 3H9RA 5H2UA 3U6HA 2Q83A 2ERKA 4YC8A 3DNDA 2OF2A 5BPYA 4GT3A 4AZTA 2XYUA 5IMEA 1ZAOA 1GOLA 3KRXA 4PMMA 5L8JA 2XJ1A 5GJDA 3O23A 3LJ0A 4AGCA 2A1AB 3EIDA 3TUBA 2YM3A 4TNBA 3RHXA 4DAWA 1XBBA 2B52A 4GU9A 5A46A 3Q6WA 3IDCA 3R1SA 3UTOA 2F57A 4GT4A 3DLSA 1JSVA 3EWHA 5M57A 1U5QA 1SVGA 2EXMA 2UZOA 4YLJA 4JOAA 5JRQA 2QOOA 4C3RA 1GAGA 4C62A 4JI9A 2QKWB 3TNPC 3NR9A 5EKNA 3F2NA 3TDVA 2E9OA 4UALA 2B54A 3PG3A 3BLHA 3FWQA 3RPVA 3DY7A 3OXTA 3AC1A 4W4XA 2IW6A 4XOYA 4PTCA 5L2SA 2PMNX 3FSFA 3TN8A 4WNPA 4IVDA 2IN6A 3R73A 3BX5A 4R8QA 4Q2AA 2VO7A 2V22A 5AR5A 4PP7A 3R00A 4JS8A 4MD7E 5FLFA 4EH5A 4RVMA 4E4NA 3P86A 3BHVA 3GU4A 1BI7A 2X2MA 3KGAA 3RJCA 2G9XA 3UNJA 5JGBA 3RPRA 3FLYA 5GINE 3ORZA 2J4ZA 3KB7A 4L53A 4TTHB 4XG2A 3L9PA 5CU4A 1UWJA 2XKCA 3I0OA 4D2WA 4DEGA 5BX0A 3QD4A 2JIIA 2OLCA 3NUYA 4GJ2A 3LM0A 4BGQA 3DAJA 4JDKA 3R2BA 3D9VA 5CWZA 3OT3A 4QNAA 5AA8A 1ZZ2A 3NAXA 1SNUA 2Y6MA 2PSQA 4UY9A 5C03A 2PMLX 2YCSA 2V55A 4V04A 3JPVA 4C7TA 4UB7A 5JFVA 2W1IA 3FAAA 4PTGA 4WSYA 5DHJA 4AGUA 4FVQA 1Y57A 2A19B 3DKCA 1H1RA 2QU6A 3PSCA 4S34A 3VS7A 4ANNA 2GU8A 2QOCA 4OT5A 1ZWSA 2W96B 4NU1A 4ANMA 3AD6A 2QOIA 5JGDA 4I5CA 4TYHB 3O7LD 4DFXE 2BR1A 5ETIA 3U51A 4E7WA 3GI3A 4CKJA 2YCRA 4GW8A 4I24A 5EM5A 3PIXA 4GUBA 4EH6A 3PSBA 4TWNA 4X2KA 1PYXA 3RAWA 4TKSA 4DH8A 3KQ7A 3HAVA 4P4CA 3DV3A 4KKEA 2BTRA 2PZRA 3T3UA 1Y6BA 2LAVA 2C6OA 3GGFA 3OZ6A 2ZM3A 2B9IA 2V5QA 5EI8A 3ZO3A 5LMKC 3COHA 4FOCA 2FSTX 1LR4A 4F99A 5CAOA 3FLZA 4EYMA 2C6EA 1FGKA 3TIZA 5CSXA 3PXFA 1ZYCA 3RCJA 4C0TA 5IA3A 4RZVA 2ZDUA 2XKFA 5E1SA 2OJFE 4EH4A 3DKOA 4EOOA 2OXDA 3B8RA 2UZNA 3IGGA 3MV5A 3LVPA 3FUPA 4GEOA 3TZ7A 4HYIA 5IZFA 4WIHA 3TJDA 4RPVA 3DK6A 3LFEA 4XJ0A 1JOWB 2XCKA 3C0GA 5FBOA 4EC8A 3R8ZA 3QTZA 3PVWA 2JDTA 4FZ7A 4BFMA 4XMOA 4ZLYA 3BELA 4II5A 4DEDA 3FMLA 3LCKA 4WUNA 4FKVA 2CNVA 4X2JA 3FLWA 5IEXA 4U45A 3VUIA 4KBKA 3ALOA 4XLIA 2F7ZE 2JBPA 2VTIA 4PPAA 4QPMA 3RWPA 3UP2A 1R1WA 4BDGA 2XKDA 4AGDA 4CMTA 3QF9A 4E5WA 1OIQA 4BDDA 4I23A 3QWJA 4MXZA 4F7JA 4XHKB 3MESA 3C0HA 4FSQA 2CN5A 2GSFA 2EUFB 2IO6A 4D28A 4DTAA 1ZMVA 2UZVA 4FKJA 5EYKA 5FXRA 2W05A 3KXGA 3KK9A 4FNYA 1BL6A 4IDTA 4ZSJA 2XVDA 5J7BA 3QQKA 2ZMCA 3LPBA 2OF4A 3PTGA 3R8MA 2YIQA 3UQFA 2X81A 4HGLA 1M14A 2B4SB 4JDIA 2GPHA 3IW8A 2VTRA 2E2BA 2YAKA 3FC1X 4IWPA 4Y95A 4D4SA 5CEMA 5HORA 4FEQA 5DEYA 2C5VA 4QPSA 4X7QA 3BYSA 4IC8A 1Q8ZA 4X3JA 3FMJA 4FE2A 3S00A 4J7BA 3DJ6A 2A0CX 4FTKA 1J1CA 4I0RA 3EB0A 3I5ZA 5HG8A 3EZVA 2IW9A 5CZHA 3P4KA 3R1NA 4FI1A 1YI3A 2UW4A 2XS0A 5ANJA 1OVEA 4RGJA 5FTOA 4EWQA 5FM3A 3LXLA 4UBAA 1H0VA 4D1ZA 5HU9A 4WD5A 4YJPA 2C0TA 4DTBA 5DLSA 4C4JA 3ZXTA 3C4WA 5ANEA 4O86A 4ALVA 1OZ1A 2R4BA 3UOKA 1H25A 4BDIA 4CRSA 2Y8OA 4EONA 2G1TA 3CGFA 3IW7A 3ULZA 3PZHA 4J8MA 4BCOA 4BZDA 3HYHA 3SVVA 3IW4A 5KHXA 4QP8A 4ACMA 5C4LA 3C50A 4QMWA 5C4KA 1YWVA 3NNWA 2XNOA 1OBGA 4RC4A 4AS0A 4IMYA 4E6AA 3KF4A 3NYVA 4ARKA 3CE3A 4JVGA 1PKDA 4D0WA 2X1NA 3W8LA 1JWHA 4I5PA 3LXNA 3LJ1A 3P7AA 5GHVA 4MHAA 4CSVA 4EH9A 3QKMA 4D4YA 3F5XA 3TTJA 4FTOA 4A9TA 3ORMA 4R7BA 4O22A 4JAJA 4S30A 3BEGA 1WBWA 3KMWA 4QRCA 4QQCA 4PWNA 2VTOA 2CMWA 3NUXA 3U4UA 3ZUUA 3LOKA 2ZMDA 4YZCA 4BHZA 4EOKA 2BIYA 3D2IA 1NVQA 3BYMA 4YTIA 3SOAA 4QQJA 2GFSA 5AUTA 4YO4A 1JNKA 3AQVA 3FKOA 5B2LA 3Q52A 4BTKA 3O96A 4Y5QA 5ANOA 2XNNA 4IAYA 4EZ5A 2J5EA 2OZOA 1H24A 1OKWA 4DH3A 4FTCA 4BI1A 2PK9A 5DWRA 3TT0A 4DG2E 3G51A 4LMUA 2FVDA 3PJ3A 3ZXZA 4AA4A 2RG5A 3CPCA 4ZMEA 3R02A 3BHTA 3WYYA 4U80A 3I1AA 4HYUA 4O38A 2WOTA 1H0WA 3EKNA 3R9OA 4BWPA 3OMVA 4DFUA 4XOZA 2QG7A 4XBRA 3CS9A 4FSRA 3V5JA 4DH5A 5L8LA 5L2IA 5B0XA 4F9BA 3BE2A 1JSUA 3QALE 1ZMUA 5M08A 2BRNA 3ORXA 3MB7A 4RBLA 2UW5A 5DT0A 5J8IA 2C1AA 1M7QA 4X6RA 4FIJA 4DGLC 2EU9A 2VWUA 2R0UA 4G5JA 4YSJA 4P7EA 4XV1A 4RWIA 1GIIA 2OK1A 5GJFA 2NRYA 5IH4A 4FV3A 1GZ8A 5LVOA 4ZP5A 5J7HA 2FSLX 3FV8A 4UV0A 4O84A 4MKCA 5IQFA 4YR8A 5KBRA 2GQSA 2H6DA 4PX6A 5DRDA 2Q0NA 5IQHA 1M2PA 2WHBA 3OF0A 4EH7A 4CKIA 2YJSA 1XHAA 3BYOA 4BWKA 1R78A 2I0EA 4DITA 5BUEA 3NNVA 1JAMA 1WBOA 3DPKA 3VS6A 2CGWA 4FYNA 3IDPA 4DG3E 1JKLA 3W33A 3HV3A 4F7SA 5FEQA 3VQUA 4AE6A 1JQHA 3MWUA 1PHKA 4QP6A 5M4IA 1YDRE 3R7YA 2OO8X 3EOCA 4XG7A 5IISA 3S0OA 4ORKA 3ZZEA 3P78A 1CDKA 3OCTA 3QRTA 1CKIA 3EN7A 1OL2A 3WIGA 3QA0A 5DGZA 2UZDA 1JKTA 3KVWA 4RIYB 5LMKA 2YCQA 2XP2A 5AUZA 3NUPA 4GYGA 4PNKA 4Q9SA 2WQOA 4J1RA 3V5LA 5BUIA 5H8GA 3SXSA 4O7NA 1XKKA 4PPCA 2BRHA 4JRNA 5KMNA 2R3HA 3HGKA 4FZAB 4TY1A 4HZSA 4DTKA 3MTFA 2HZNA 3UO4A 3U87A 3QD3A 3KXXA 4AN2A 1GJOA 3CBLA 3MBLA 4AZEA 4BTFA 4EZ7A 4F6WA 5FEEA 3EZRA 1K2PA 4FSNA 3UIUA 1DAYA 3AC8A 4GS6A 5IQCA 3A61A 5EI6A 4IZAA 4HW7A 5DR6A 1NVSA 2BROA 3N4UA 3OWKA 5BYYA 4U42A 1OM1A 4AFJA 4C35A 3R22A 4MXXA 1W82A 2R64A 2X2KA 3ACKA 4LV8A 5JFSA 4LG4A 1NT2A 1ZRZA 4U7ZA 4CTCA 5CSHA 1VYWA 1IASA 3ELJA 2HIWA 5FQDC 4ANSA 4GK2A 4M14A 2OJJA 2UW3A 5K9IA 5EFQA 4S2ZA 5D12A 3ZHPC 4DH7A 4XP3A 3DFAA 4IB0A 3AMBA 4ANOA 3K3JA 4L42A 5DN3A 3SA0A 2OFUA 2VTTA 3RWQA 2CKPA 1XH6A 3F7WA 4OTFA 1OI9A 3BEAA 3DS6A 4YTFA 2VWBA 4C38A 4M68A 4L68A 4U81A 3G0EA 4OGRA 1V1KA 2PY3A 3NYOA 4YJNA 4IIRA 3DJ7A 4BKJA 5C01A 3UGCA 2CN8A 2WFYA 2W1CA 4LGGA 4AOTA 4ACDA 3DU8A 1F0QA 2JDRA 2PL0A 4UXLA 4XG3A 5EK7A 5F4NA 3AC5A 3G9NA 3PY3A 4XRLA 3RGFA 4BI0A 3FC2A 3PDTA 2HW7A 5BVDA 3CJFA 3CJGA 4YJQA 2B53A 2J0LA 2VWYA 3VS4A 4O1OA 2ETRA 4ACCA 3R9RA 4RFMA 1BMKA 3FKLA 3G6HA 5T68A 3TZMA 3UYTA 4JL9A 4R3PA 1XBAA 2C69A 2PMIA 3VRZA 1XH8A 3GBZA 3BQCA 4RG0A 3BHHA 4FKRA 1FVVA 3MVMA 2P4IA 2I0HA 2JAMA 3AT3A 3JUHA 3M11A 4FSMA 4USDA 1WBPA 4DF3A 4YGAA 1RW8A 5HLPA 4AW2A 3TNHA 3QRKA 1YXTA 5DPVA 4D4VA 3RNYA 3F2AA 3TG1A 5J5TA 3G15A 5HEZA 2IZSA 4EWHA 1UNGA 2QI8A 4X21A 4OAVB 2NP8A 3TUDA 4FEWA 4JLCA 5BYZA 4EOQA 1SVEA 4BBMA 4PP9A 2F2CB 4M8TA 3R9DA 4QMOA 2WAJA 2CGVA 2OICA 2E9UA 2UW8A 1WVWA 1JSTA 3FZRA 5HIDA 2R3PA 2QR7A 2R3FA 1ZOGA 2CLXA 3GC0A 3O8PA 4UMRA 3UVQA 4IJPA 3SXFA 4ENXA 3SXRA 4B7TA 4I92A 3VNTA 3KRLA 3LXPA 3ENMA 5C1QB 4FIGA 3G0FA 4CYJA 2W4JA 1NW1A 4AGWA 3PY1A 2WQNA 2YFXA 3GFWA 3ORLA 4DG0E 5IEYA 4CEGA 2ITYA 3KY2A 4G5PA 4CLJA 4UMPA 2GNLA 3P0MA 4NM3A 4DFYA 5FEDA 5EOLA 4Y73A 3DB6A 3F61A 4V05A 5CYIA 4DT9A 5E90A 3PXRA 4ENYA 3S3IA 1VEBA 1URCA 1W0XC 5HD4A 4G9RA 4U0IA 3FSKA 4KS8A 3RZFA 3KA0A 2BILB 2QOFA 3RVGA 4E26A 1G8AA 4FV5A 3LFBA 4YJTA 2XB7A 4BL1A 5CF8A 3NW7A 3CTJA 4GU6A 4IWQA 5HLNA 4WRSA 3BRBA 1QL6A 3MB6A 1X8BA 2GS2A 3IONA 4RVLA 3ZUTA 3C4EA 3NGAA 4ASZA 4GIHA 4Q5HA 4DEIA 1H1WA 2DQ7X 3RK7A 2OG8A 3EQFA 3GXLA 4FT5A 3WI6A 5E92A 3TNIA 4E5BA 3DXQA 4YHJA 2VTLA 3BKBA 4D2PA 4F1TA 1R0EA 2WMAA 2X39A 4A4XA 2NNWB 4NUSA 3HAMA 3R8LA 1K9AA 2IWIA 4W8DA 3A7JA 3R7GA 5F9EA 4FYOA 4FV4A 2AC3A 5CY3A 3KREA 2WEVA 3R8VA 1FGIA 2BHEA 3HMPA 4H58A 5DYJA 4DC2A 3VHEA 3K5VA 5HVJA 1M7NA 3ENHA 4E4XA 2BDFA 3NUNA 4JG7A 5HNGA 1IAHA 3DB8A 4DFZE 3OD6X 5GIOE 3ANRA 4EOSA 3IO7A 4YC3A 4GFGA 5K5NA 4RC2A 2XIYA 3MA3A 2CKOA 5LQFA 3EFLA 2HCKA 2WTIA 3JXWA 5KZIA 5AUXA 2CHLA 1Q62A 3NUUA 4JDHA 4MCVA 3AGLA 4JBPA 2W5AA 4AF3A 4A9SA 5E8SA 5C8KA 3UG2A 3FI2A 1OIRA 1PXLA 4JNWA 4NZWB 4RIXB 5B2KA 2CCHA 2O3PA 3FJQE 3RMFA 3SG8A 3OCSA 5H8EA 2REIA 3FY2A 4AOIA 2HENA 5IF1A 5EHOA 3TV4A 5CZIA 3EYHA 3RALA 3P9JA 3KN6A 5TOZA 4L9IA 3SX9A 3FMDA 5HVYA 1YDTE 2JFMA 5ETFA 2J6MA 4OBPA 4JX7A 5LJJA 3PA4A 2XJ2A 4FVPA 4AA0A 5HX6A 2ITTA 2IZTA 2PZIA 3DTWA 3DTCA 3O7LB 4JG8A 3VS1A 1OUKA 1IA9A 4FOBA 4NEUA 4LQMA 3R63A 3Q60A 4C02A 2WQBA 4RIWA 4TRLA 4CFUA 1J1BA 3AC4A 3VUHA 2QO2A 1XBCA 3W2PA 3DLZA 3NVMB 4O7VA 4I6QA 3UVRA 3BYVA 5LXMA 4CNHA 2WMBA 3MW1A 5HOAA 3UOJA 3RAKA 2P55A 3PIYA 3T8OA 3CQEA 3U54A 3FDNA 3PPKA 2CLQA 4K0YA 3QCSA 3SD0A 2J2IB 3SKCA 2C0OA 2F2UA 4ANQA 3A7FA 4UMQA 4FG7A 5I9UA 2WTCA 1H27A 2WIHA 3KXMA 4L45A 4DGGA 4QMLA 4XLVA 4IAZA 2ITOA 2IPXA 2YM6A 3SW7A 2FA2A 3R2YA 4QYHA 5KKRC 3RM7A 4NYEA 3I0QA 3HMOA 3HRCA 4FV2A 4FVRA 4OT6A 3QQJA 4YJVA 2RGPA 3DBFA 4G3CA 3DA6A 3EL7A 4IX5A 4R1YA 3O51A 4YJRA 5HG7A 2BMCA 3TKHA 4MAOA 4F9CA 2YM5A 5IQIA 2JBOA 3P08A 2R7IA 4OBQA 4FODA 3BWJA 3DAEA 5KO1A 4F63A 3R6XA 1QPEA 4N4SA 3NEWA 4QMPA 5DBXA 1P5EA 5HESA 3NDMA 2BDJA 2OZAA 3EH9A 4PNIA 5GZ9A 1R3CA 4NIFA 4P5ZA 1ZOEA 3PRFA 3DDQA 2W1DA 4LOPA 5ANIA 4F9WA 3G9LX 4U9AA 5EM8A 2Z7RA 4GKIA 2ETMA 3ZLSA 4BGGA 5EG3A 3CD8A 3GP0A 5AA9A 4APPA 5B2MA 4YC6A 5I3RA 2YA9A 4NJDA 3I7CA 1QPCA 1KOAA 3F2RA 3QAME 2OIDA 4L3LA 2YLEA 4FTTA 3W18A 3OOGA 2B9JA 2GS7A 3E8DA 1SM2A 1PXMA 3GU6A 5AIRA 3A8XA 2VTHA 2YCFA 3D7TB 4KIQA 4TYEA 4UZDA 3UZPA 3PJ2A 5CXHA 4F0GA 1VJYA 1XJDA 1RDQE 4U8ZA 3ZDIA 4DT8A 3BU3A 2Q0BA 3F3VA 4K1BA 1GY3A 4J96A 3RPSA 5CAUA 3H10A 5IU2A 3D83A 1U54A 2E9PA 3UG1A 4LI5A 2QC6A 5I4NA 3TV7A 5CVGA 1M52A 5K0KA 3E7OA 2SRCA 2VNYA 3EFJA 4YURA 5C9CA 4IW0A 3L9NA 4X2NA 2EXCX 3Q4TA 2PZ5A 3NPCA 4JX3A 3QTUA 4F6SA 1GNGA 2R3QA 2H8HA 3MH3A 2Z7LA 2O5KA 4OTDA 4QP1A 2I6LA 4RIWB 4WSQA 4PMTA 4TYGA 3W2SA 1YVJA 4QP7A 3FZSA 2GHGA 5H9BA 3WZJA 3QBNA 5J9LA 5JN2A 3DJ5A 5GZAA 2JEDA 3PJCA 2HXLA 3LCSA 4BCIA 4F9AA 4RWJA 3HLLA 2GFCA 3O8TA 2ONLC 2O64A 3L9MA 4NWMA 4OTQA 4PL3A 3CTQA 4RJ6A 4CZTA 4H05A 3O8UA 3PYYA 3RPYA 3VVHA 4R78A 5IA2A 5HG5A 3F3ZA 4FT0A 4JBVA 2GDOA 2JKOA 3QKKA 4O7RA 4A4LA 1HCLA 3LHJA 5J5SA
chains in the Genus database with same CATH superfamily
3DZOA 2V7OA 3E88A 5FXQA 4FL1A 4QMYA 1CKJA 1OL7A 5AP3A 4BCNA 4DH1A 3W0RA 3R9HA 5A4TA 4RWLA 4IFGA 4EZ3A 4AN9A 1KE9A 3OY1A 4RJ8A 5CF5A 4F0IA 5FP6A 4FKGA 4IACA 3R7EA 4J98A 4EQUA 4N6ZA 1UWHA 2PVFA 3MVLA 4QQTA 2CGUA 2VTNA 5DE2A 2W7XA 5AWMA 2B1PA 5A6NA 4YNOA 2OZAB 3EKKA 1QPJA 5CENA 3JYAA 2OJGA 4NIFB 3CP9A 3HMNA 5J87A 2O8YA 3P5KA 3K2LA 4IANA 2PVMA 2BRBA 3LZBA 3A4OX 3V8WA 4BWXA 1MRYA 5A4QA 2OGVA 5EI2A 5IPJA 3F6XA 5AM6A 5AX9A 2DUVA 4MF1A 4EOMA 4PDPA 5JRSA 4OBOA 4MXAA 2C6MA 3VIDA 4USEA 3PFYA 4XNEA 5M4FA 4FKQA 4JIKA 2RFNA 5GNKA 4IB3A 3UODA 1OMWA 2CGXA 3TZ9A 4CFFA 4BCPA 3F82A 2YDKA 4CG9A 4G17A 3TACA 3VUTA 3NX8A 1H26A 2UZTA 3HV4A 4XV3A 2JD5A 4EHVA 1U54B 4G3DA 3OTUA 2J51A 4O0UA 3VS3A 4FG9A 4OTGA 5CI6A 4CG8A 4H1MA 2QO7A 1XH4A 2UUEA 4EKLA 5GZ8A 4M15A 4CT1A 3CKWA 2WMTA 1H4LA 4I41A 5CNOA 5CAPA 4O91A 1S9IA 5LMBA 2C68A 4IZ5A 2YIYA 5CU6A 4Z16A 5I9YA 2BKKA 4I5MA 4B8LA 3POZA 4YMJA 3LCTA 2R3RA 3FI4A 4IB5A 4C58A 4AU8A 2ITZA 1OKZA 2XM8A 2ZV2A 5TR6A 2QQ7A 4M12A 4ZTRA 4YBJA 3RI1A 3DXNA 3Q4UA 5L3AA 4AOJA 4NM5A 3CIKA 4IX4A 1LEWA 5CAVA 2QD9A 1KE5A 4IWOA 4O4EA 5EYMA 4KSQA 3KXHA 2YEXA 4M69A 5C8NA 4JQ8A 4E6QA 4R5SA 4C37A 1YXXA 4KRCA 1NA7A 1GZNA 4BIDA 3LAUA 4QO9A 1DS5A 4Z7HA 4AN3A 5FRIA 3DGKA 5EW3A 4DCAA 1O6LA 3MFTA 4G6OA 3UVPA 4I6HA 3LE6A 3T3VA 3NW5A 4CFNA 3DFCB 4Q9ZA 2XM9A 4EL9A 2A2AA 2XMYA 2BFXA 4BDJA 3MN3A 4ZZOA 3W0SA 5CVHA 3HV6A 5EH0A 4AT5A 2YZAA 4BBFA 1TQPA 3QYZA 2HYYA 4UWYA 4I0TA 4QMNA 5KHWA 1U5RA 4F70A 1TKIA 2WMXA 4USFA 4C4IA 1G8SA 1BX6A 1Q4LA 3PP1A 2WEIA 3SDJA 4FTQA 4TPTA 3QFVA 4P90A 3W2OA 3ZBXA 3H3CA 3I81A 5AP6A 4AP7A 4DGNA 4WRGA 2WXVA 1XH7A 1WVXA 4G2FA 3TCPA 4DBNA 2Z02A 3HA8A 4AFEA 1YXSA 4BC6A 4F09A 2VTSA 4ZTHA 4C36A 4NTTA 4WBOA 2YAAA 3ROCA 3OXIA 3BCEA 4WNKA 3GU7A 4D9UA 5J1VA 4ASDA 5EW9A 5LOHA 2ZV7A 1YQJA 1ZY4A 5T3QA 1ZYJA 4V0GA 3ZMMA 1YHVA 1ZMWA 3CD3A 5HBHA 1J3HA 4F4PA 1PMVA 3NZ0A 3UIMA 1L3RE 4NTSA 4X6QC 5C27A 2F7EE 2XK9A 3L8SA 3QZGA 3B8QA 5EOBA 4EC9A 5HBEA 5LCJA 5M09A 5CSVA 4R3CA 2PVYA 1A48A 4H39A 4FMQA 4EBVA 5H3QA 1ZARA 3NVKI 2XBJA 3I79A 2ZOQA 3VO3A 5IG1A 3Q96A 1KV2A 1TQIA 3GFEA 1SVHA 4FSYA 2XUUA 3ZEWA 2X8EA 2YIRA 3EFWA 2B55A 3GCVA 3P1AA 4RLKA 4GK4A 5J9ZA 2FYSA 2BCJA 1BL7A 3ORTA 2WMRA 4IAIA 3JY9A 4B6LA 5K4JA 2PVKA 2GQRA 4KB8A 4CCBA 4HPUE 3UBDA 3WF8A 4BCHA 5HO7A 3KULA 2QOBA 4ACGA 4D4RA 1H1QA 3EQGA 1S9JA 4FX3A 2GNGA 4OTWA 5JQ8A 1GZKA 2OIQA 3KMMA 5DRBA 4JJRA 2IZRA 1KE8A 1E9HA 4NT4A 5F20A 1YHSA 2XIRA 3RKBA 3FI8A 3NNUA 4FTNA 4UMUA 5EQYA 1Q8WA 3F69A 3VUDA 2WD1A 4HNIA 4M69B 5CU2A 2VRXA 4GFMA 4IE9A 4RRVA 5F1ZA 5BVWA 4ZTLA 2WIPA 3TI1A 4EOJA 2F7XE 4QNYA 4ZY4A 3KF7A 3SHEA 1FINA 4BI2A 3IDBA 4AZSA 5JT2A 3MVHA 3LFNA 4FTRA 3JY0A 1UA2A 3Q5ZA 1XQZA 2OJIA 2UW9A 3OWLA 4YPSA 3WILA 2VX0A 4FKIA 4O4BB 2I0VA 2OXYA 3F3WA 4QYYA 3OUKA 4KWPA 3UP7A 5KMKA 4FSTA 3TDWA 4G3FA 3TIYA 5M44A 2W4OA 2C6IA 3I7BA 3Q2JA 4B4LA 1UNHA 4PDYA 3ALNA 2FH9A 4C61A 3FZOA 2ETKA 3TKIA 4GKHA 1H01A 4FV6A 5L8KA 3QXOA 3D4QA 4L44A 3MJ2A 3OEFX 4LM5A 4QQ5A 3NMUF 2XK8A 2AUHA 3ZLXA 4BZNA 2I1MA 2QU5A 2HY81 3RK5A 4TWCA 2VWWA 3UPXA 2ONLA 5L6PA 3HEGA 3VC4A 3PVGA 2C5YA 3I6UA 3U9NA 3HV5A 5ETAA 3S2PA 3AG9A 5KE0A 3BU5A 3CY2A 5IA4A 1PRYA 3UDSA 4PMSA 5KKRB 2JKKA 4RT7A 1GIHA 4M0YA 3W8QA 5HIEA 1WAKA 3P23A 2OSCA 3HV7A 3FMHA 4KUJA 3RPOA 1MRUA 4TT7A 1UU7A 4L46A 3DBDA 4EH8A 2NYAA 1ATPE 1BLXA 2Y9QA 4ZZMA 2JKMA 4FTAA 3QTWA 4RQVA 1Q3DA 1J91A 3PLAE 4I94A 4R77A 3POOA 5EYDA 4LYNA 3TXOA 4CV8A 2WTVA 4PRJA 5L6OA 2B0QA 2YHVA 5E8WA 5FD2A 3I60A 4H1JA 4BCFA 3UOLA 4OAUC 2DYLA 4DDGA 3KULB 4XP0A 1Q3WA 3V5PA 5DVRA 2R2PA 1RE8A 4YJUA 1ZY5A 2XK7A 2YIXA 2BAJA 3KVXA 5BMSA 2XCHA 2VV9A 4ZSGA 5JSMA 3PSDA 3LW0A 1XR1A 4IX3A 4YHFA 4BIBA 4I93A 4KBCA 2JDVA 3QGYA 3N4VA 3NWWA 4UYNA 4YLKA 4KABA 3FY0A 1H28A 3P79A 4TYJA 4BTJA 1F5QA 4OTHA 5JKGA 2YLFA 2ITUA 2Y0AA 2FUMA 4JQEA 3VN9A 4DHFA 3BPRA 3BZ3A 3Q9WA 3ZO4A 5FG8A 4L67A 3T9TA 3NRMA 4HVSA 5CXZA 4EUUA 1WMKA 2WPAA 3EQRA 3PIZA 1R0PA 3LFAA 3QRIA 3UYSA 3W0OA 3WF6A 4LMNA 3WBLA 1IA8A 4Z9LA 3WF5A 5DG5A 3GUBA 3E7VA 4MX9A 4UX9A 4PY1A 4M97A 5LWNA 3CQWA 3QTQA 3R8PA 3UIXA 2PUPA 3IOKA 3ML1A 4EI4A 2BZHB 3UPZA 3A8WA 3HP2A 4GYIA 4R7HA 2V7AA 4B99A 5HTBA 4QT1A 2PE1A 4FTJA 4ASEA 2GQGA 1FMKA 1IRKA 3ZSGA 2HW6A 3WF7A 3F3UA 3ODZX 3GEQA 3HRBA 4UZHA 3SOCA 4ACHA 4ZLZA 4C3FA 1CKPA 4MWHA 1F3MC 2X4ZA 3PWDA 4FV9A 4YZMA 4TYIA 5BMMA 3ATTA 2F49A 4J97A 5L2WA 1KSWA 1A9UA 4L43A 2FB8A 2Z7QA 1CM8A 4G34A 1YOJA 4AT3A 4AA5A 2Y4IC 3GC8A 2XJ0A 2ESMA 4BZOA 1Q99A 5HU3A 5JFXA 4DHIB 3HA6A 3KKVA 3WZEA 3QCQA 4Z7GA 5HTCA 2XNMA 4MXOA 2W9FB 4YJOA 3MJ1A 2WZJA 4LUEA 3A7HA 4EUTA 4IJ9A 5F94A 2VX1A 2X7FA 2GTMA 4PDSA 4QD6A 4O0TA 5AR4A 4DYMA 4F78A 3Q9ZA 1O6YA 3W0PA 3QZIA 1I44A 4I6BA 1WVYA 4D2SA 2NO3A 3HDMA 2W06A 3DQXA 2HZ4A 2PWLA 1OL1A 4BCKA 4B9DA 4JG6A 5AUUA 3QUPA 1B38A 2G15A 5JEBA 4TN6A 2UZWE 1PJKA 4FSWA 2G2IA 3PG1A 1YHWA 5F95A 2E9NA 2HZ0A 3CKXA 1RJBA 1PXNA 4QMTA 5EM6A 4DEEA 4CXAA 3VBQA 5BVNA 3ET7A 5FDPA 4AAAA 4D1SA 4QTBA 1G3NA 1P4OA 4IADA 1OPLA 3G33A 4HYSA 4QTAA 4U40A 4NM7A 3Q4CA 4J52A 4UWBA 2CNQA 4GT5A 1Y6AA 2UZBA 3TV6A 3A62A 2HAKA 5A4CA 4FIHA 2QG5A 2R3MA 4O7TA 3UIBA 2ZB1A 4MXYA 5FBNC 4I4FA 4E6DA 4FKLA 2GS6A 4FTIA 2VO3A 2WMSA 4MD9E 3D94A 4E20A 3OP5A 4KBAA 1W83A 1PW2A 5AFVA 1CSNA 4HGSA 3R71A 2ZDTA 3QQUA 5LMAA 4XV9A 3L8VA 5AV4A 2Z60A 1DI9A 3EJ1A 2G2FA 2J0KA 3IG7A 3PZEA 3ZM4A 3LIJA 3HMIA 4GSBA 5HD7A 2VWZA 5K5XA 2WNTA 2X6EA 4A06A 4D5KA 4M3QA 4OTRA 1AGWA 2OWBA 1UU8A 2HOGA 3LQ8A 5CTPA 2O65A 4C2VA 4ERWA 2QHMA 3GB2A 3PFQA 4XG9A 4L7FA 1FMOE 3PE2A 3KU2A 3COKA 2B9HA 4IAFA 3MH2A 5G6VA 3BGZA 5JGAA 4O83A 4NCTA 4ZTQA 2HWOA 1Z5MA 3BE9A 4CVAA 3LLTA 3DOGA 2DWBA 2OJ9A 2P2IA 3C4CA 2YM7A 5D9HA 3FPMA 4R1VA 1UVRA 4QYGA 4MH7A 3AD5A 3KC3A 4MTAA 4LOQA 4CLIA 1ZYDA 2NPQA 4WUAA 4FKWA 4DINA 3RBWA 3VBTA 2VO6A 5BQ0A 3LMHA 1OITA 5AEPA 5EDQA 2P33A 4RIOA 3U6IA 1OECA 4Y72A 3PY0A 4AZFA 2ERZE 4TNDA 4U5JA 1U4DA 3MIAA 3L8XA 3B2TA 1MUOA 4K6ZA 3LCOA 3GU5A 3H0YA 4FICA 4PTEA 5ACKA 4EJ7A 4ZS4A 4RQKA 3R04A 4CFXA 3DKFA 2FSMX 4IC7A 3MYGA 4H36A 4WO5A 1U46A 4I4EA 1WFCA 4ZAUA 3L8PA 3D5VA 4GG7A 5I5ZA 3V6RA 1KV1A 3CR0A 4RZWA 1YRPA 4ZSAA 2ITWA 4O7WA 3Q53A 1BKXA 2ZM4A 2GNJA 4W9WA 5CNNA 3SW4A 5JH6A 4XUFA 5E8ZA 5AR7A 1OL5A 5I9ZA 2YITA 3IQ7A 1Y8GA 4DFLA 3LFQA 4WNMA 4ZK5A 1IG1A 4FF8A 4IB1A 2HK5A 3F5UA 1WBVA 3QQLA 4AQCA 3PA3A 4MEDA 4E5AX 1UU9A 2GNFA 3R7VA 2RFEA 4HNFA 3DBQA 3CSVA 4O27B 3TZ8A 3FXXA 4Y46A 4ZTSA 5LCKA 3VHKA 3ANQA 5AM7A 4CYIA 1U59A 3TMOA 5D11A 2X9EA 5EHLA 4BB4A 1G8JA 4F7NA 2BHHA 3EQDA 2XNEA 4Y85A 2OXXA 4TWPA 3P7BA 4BCQA 2IW8A 4EKKA 2H9VA 3ZM9A 2WQMA 3IPHA 4GH2A 5E4HA 1IAJA 4FC0A 4XS2A 3F5GA 3WZDA 2R3IA 2C6LA 1KE6A 3PVBA 4RC3A 4S31A 1TZDA 4YTHA 4FZDB 1QMZA 5BVFA 4RA4A 1PKGA 4P5QA 3SC1A 2BUJA 4DEHA 4D5HA 3E87A 4FGBA 5FDXA 4MK0A 1WCCA 5IQDA 1PYEA 3CCNA 4MXCA 4EBWA 4IVBA 2R7BA 4RFZA 5HO6A 4YTCA 2A4LA 5CSPA 5KMLA 4WA9A 4E3CA 2J90A 2BFYA 3KRWA 4EH3A 3FLSA 4I22A 4CD0A 3E62A 3QRJA 3QA8A 4PL4A 4DGMA 3TJCA 1NY3A 4BRXA 2AQXA 3A4PA 4BBEA 5J1WA 3IOPA 1OKVA 5L6WL 2XZSA 3AXWA 5M4CA 1PY5A 2XA4A 1Q8YA 3FZPA 3VAPA 1ZLTA 3TTIA 5E8TA 3ZS5A 4FGRA 1LEZA 3PJ8A 4K8AA 3NAYA 4DA5A 3CTHA 5IH6A 2JGZA 1PXJA 3LLAA 2Z8CA 4G1WA 4OLIA 1VLRA 5HVKA 4ALUA 3RNIA 4BKZA 3ZSHA 4C4GA 2PMOX 2WTKC 5HE1A 2BDWA 1YXVA 3VWAA 3SRVA 1OBDA 4MVFA 2VZ6A 3IGOA 4YO6A 3PP0A 3H0ZA 4LOOA 3DT1A 4EJNA 4FA2A 5IEVA 1Y91A 2CDZA 5AV0A 3L9LA 3NYXA 1Y8YA 3S4QA 1A06A 4CQEA 3IS5A 4E1ZA 4GMYA 3CQUA 5EW8A 4L3PA 2F4JA 4OTIA 4EK3A 1V0PA 5K4IA 5HX8A 4PPBA 2OKRA 3CC6A 2R3GA 3VUKA 5L2TA 3E93A 4ZY6A 3KN5A 5AV2A 3IKAA 3DK7A 5AADA 3GCUA 3OW4A 2W1HA 3KFAA 3C4FA 5HI2A 3E64A 3OEZA 4EEVA 1RQQA 4F65A 3GCQA 4HJOA 3G90X 2ZVAA 3F88A 4V01A 4IVCA 5KMIA 2WTDA 5CEQA 4QEBA 3IW6A 2JC6A 3QWKA 4DLJA 5A54A 3DK3A 4N6YA 4NFMA 4ZS0A 4L00A 4L8MA 4BCGA 3C7QA 4O2ZA 4RJ4A 2R3KA 2ZJWA 3W55A 5E8VA 5CEOA 4FZ6A 2RKUA 3ITZA 2RIOA 3QZFA 3K5UA 3M2WA 4EOIA 5I0BA 1SYKA 4Y83A 4EOLA 4XEYA 3V5QA 4IQ6A 3Q3BA 2CNUA 4ERKA 3UO6A 4Z55A 4K77A 2QOHA 1APME 5DH3A 3UC3A 2WMUA 4YZ9A 3VJOA 4LGHA 4AXEA 5D10A 3R1YA 2CSNA 4KAOA 2J0IA 4AXAA 2P2HA 3FMKA 4O1PA 4W8EA 4O82A 3HX4A 3JVRA 4HYHA 4NW6A 2ITNA 4X2FA 3VULA 4YLLA 2ACXA 4O7YA 4G9CA 4FSZA 4AW1A 4XBUA 5E91A 3TNWA 4HCUA 3UC4A 3MA6A 3VW6A 2QURA 5CEIA 3G2FA 3E5AA 2EXEA 2B9FA 4PQNA 3I5NA 4DEBA 5B7VA 4RFYA 5KBQA 1PXKA 2RFSA 4NKSA 3FHRA 5KMMA 4FV7A 4S33A 4BDEA 3R9NA 4DEAA 3BLRA 4UYAA 4XH6A 5AP5A 4E4LA 5AAEA 3F7ZA 5BNJA 4WG5A 5DI1A 3GOKA 3F5PA 4FR4A 3JR1A 4NL0A 4BJJA 4E93A 4IEBA 4FZFB 2CJMA 4FK3A 3DCVA 2VO0A 3CY3A 2YM8A 1G8KA 3BU6A 3TL8A 4AXDA 4O2PA 4HCVA 3DDPA 2UW0A 3R30A 3FXWA 4TXCA 3SRVB 2I0YA 3ZH8A 4CFMA 3N9XA 2PVJA 4E8AA 1FPUA 4FTMA 2WKMA 2G2HA 3CLYA 5L2QA 2GTNA 1DAWA 4YSMA 5EKOA 2YZLA 3ORPA 2Y4IB 3PUFC 1H1SA 2XALA 2VGOA 4XCUA 4HVIA 3UZTA 4IM2A 4U79A 4ZXTA 4H3BA 5IQGA 1Q24A 4G6NA 4CCUA 1WBSA 4IZYA 4ITIA 3FYKX 3PE1A 3VS5A 4DHZA 4M13A 2BVAA 3D0EA 4FSUA 2R3LA 1OL6A 5T6KA 4U3ZA 1L8TA 4BDKA 3A2CA 3QHRA 3K3IA 4MYGA 4XG8A 4KRDA 5LVLA 2PUIA 4M7IA 2Y6OA 3MPMA 2LGCA 5HE3A 5DMZA 3QTRA 3VS2A 3ZFXA 3OT8A 4EQCA 4NJ3A 3PJ1A 3IK3A 3VUMA 3UDZA 1K3AA 4W4VA 2OBJA 2EB2A 4BHNA 4F1OA 4HVDA 5HCXA 4RX9A 3OW3A 1VZOA 4FIEA 5AJQA 5CT7A 4F64A 4HPTE 3ROYA 5EQEA 1ZOHA 3OTVA 4I5HA 2C3LA 1OGYA 5C8MA 4RMZA 2GCDA 2PVHA 3H4JA 3II5A 4O6LA 3VQHA 4FKOA 2IVSA 3EN6A 3RAIA 1CTPE 4F1MA 3V8TA 1XH9A 2QONA 3BGPA 2WTJA 5CS6A 4MWIA 2HY0A 3DKGA 2C3KA 3A60A 4O0XA 3ODYX 3W2QA 5CAQA 2HELA 3V01A 4WKQA 4ZJJA 3ZONA 5IA1A 2WB8A 4N57A 4D55A 3AC3A 1FBNA 5CEKA 2O0UA 1Z57A 4FL3A 4O7ZA 2W1FA 3TM0A 5M56A 2XRWA 4L6QA 5KX8A 2XNBA 2PVLA 3EQBA 3G5DA 4Q5EA 2W1EA 3SLSA 4AW5A 3VJNA 5ETCA 5D41A 3E8NA 1O6KA 2W17A 3UQGA 2ZB0A 4LV5A 2VN9A 5BUJA 5AP2A 3QRUA 3P7CA 4C34A 5E8XA 2UW6A 3A7IA 4LFIA 4ZMFA 4BJJB 4I6FA 3LCDA 3NS9A 1Z9XA 5EHYA 1HOWA 4A4OA 4G16A 3R7IA 5CASA 1M2QA 3C51A 3BBTB 5BVEA 3ZEPA 4O21A 4AWIA 4HGTA 2C5OA 1UNLA 1PXOA 1YWNA 3HUBA 3PXQA 4B0GA 2VNWA 2WELA 2WU7A 3Q2MA 3QTXA 4Y5HA 4AZVA 2VTPA 3HZTA 2Z7SA 4GK3A 4QYEA 4YP8A 1TFFA 2R3JA 4UN0C 2IZUA 4HOKA 4HVGA 5LARA 4X2GA 4UXQA 4CQGA 3DZQA 3FBVA 3HKOA 3OG7A 3FQEA 4CMUA 4L52A 4A9RA 5KCVA 4NW5A 3F9NA 4BYJA 1FOTA 4RVTA 4W4YA 1DM2A 3H30A 5HGIA 5AUWA 2JDSA 3D15A 4O0RA 4AZWA 3ZO2A 4J71A 2QOLA 2IVVA 3O50A 3PLSA 4L01A 3R7OA 2UVXA 3VF9A 3R83A 3WOWA 5I9XA 3LKMA 3BYUA 4DLIA 4BDHA 5M4UA 2WMWA 3KCFA 2IEWA 2UVYA 3O0GA 3ZRKA 2UZLA 1LPUA 2BPMA 4KKGA 4O0VA 3NYNA 4WNOA 4WHZA 4RSSA 4AX8A 2X8IA 2XKEA 3C4XA 4GFOA 4U6RA 5A4LA 3FYJX 4QTDA 3L1SA 4DGOA 4F0FA 3H9OA 3RM6A 3V5TA 5K0XA 4MD8E 3EQHA 2Y7JA 3FMMA 4ZZNA 4BDBA 4O7LA 4XG6A 4FKUA 1FVRA 2EWAA 4U3YA 4GL9A 2EVAA 2J5FA 2XNGA 5JZNA 2BALA 3UMXA 3NIEA 4NM0A 2X0OA 5D7AA 5JZJA 4BR3A 4G31A 3TNQB 3TKUA 2OI4X 4NH1A 3JS2A 2C0IA 4RX7A 5A3XA 3ID6C 4YHTA 4JR7A 5AMNA 2JLDA 2W5BA 4FNZA 4R7IA 5CLPA 3WZUA 4MQ1A 5AP1A 5JMSA 5FTGA 1PXPA 4X3FC 4K18A 4JR3A 1J7IA 3EQCA 4BDCA 3QC4A 4X0MA 2O63A 4FTUA 4TWOA 1PXIA 5CF4A 4YZBA 4GVJA 3OY3A 3PXKA 2OU7A 2KULA 4HGEA 2YJRA 2C3IB 4FUYA 3ORIA 3COIA 3FZTA 4KINA 4D2TA 2VWIA 2OIBA 3NSZA 3ULIA 3A99A 4MQ2A 3GNIB 3SV0A 3BL9A 3LQ3A 3FQSA 4BN1A 4U44A 5FTQA 4GVAA 5M53A 2FGIA 4IDVA 5E1EA 5HCYA 3RTPA 1TQMA 4E4MA 4TZRA 3Q5IA 2ITXA 5HE2A 2R9SA 3KRRA 3OHTA 3Q9XA 4FKPA 3A7GA 4EHGA 4CMOA 1B39A 5ANDA 3AMAA 4C59A 4O7SA 2QOKA 5ACBC 1MQBA 4EK4A 4G3GA 4O81A 2PPQA 3EN5A 5IH5A 1UKIA 4RJ3A 2QR8A 5DA3A 1OUYA 2WGJA 4ZSLA 3RZBA 4FNXA 5BVOA 3EN9A 4PUZA 1LUFA 3HVCA 3QYWA 4EORA 3VBWA 5A4EA 3RHKA 3QD2B 3ZRLA 2W9ZB 3AD4A 4YU2A 3Q9YA 3EL8A 3BIZA 1XWSA 2W1GA 3W16A 4IX6A 4A07A 2BZIB 1KUTA 3DNEA 4OUCA 3GQIA 4NCTC 2WTKB 2VD5A 2YWPA 5DEWA 3MPAA 4PF4A 1MRVA 1Q8UA 1YXUA 5DR9A 1PF8A 4FEVA 2XK3A 3PXYA 3QZHA 3Q4ZA 4QPAA 2W99B 4JRVA 4QMXA 4WT6A 5CVFA 5DOSA 3TEIA 1OIUA 3CEKA 4D2VA 5HLWA 3SGCA 2ITVA 2ZV9A 3QQFA 1VR2A 2J50A 2OH0E 4ZOGA 2BAKA 4APCA 3V3VA 4D0XA 4EHEA 5DT4A 5IQAA 1GIJA 3BWFA 3UNZA 3FMNA 4YBKA 3F3TA 2VTAA 5I9WA 1P2AA 4GG5A 3C13A 4C4EA 2QCSA 1R39A 2X2LA 3VBVA 4QDVA 1T45A 2YABA 3C4ZA 3R7UA 3BBWA 2GNHA 2W0JA 2VWVA 2PUNA 2H96A 4V0GB 5IA0A 2HZIA 4CRLA 5ANKA 3PWYA 3KL8A 4KNBA 5E9EA 4MNFA 4G6LA 3QD0A 3OS3A 2C6KA 2P0CA 4FV8A 2PULA 1SNXA 2PZYA 5ICPA 4ALWA 2JKQA 4EHZA 3M42A 4DDIA 4D1XA 4I1ZA 2OW3A 3D5XA 5CU3A 2ZFYA 4IVAA 3D7ZA 3W32A 2PE0A 3QGWA 4M0ZA 3EQIA 5DR2A 1IEPA 4BF2A 3GOPA 1YW2A 4WG4A 4GRBA 3BQRA 2BIKB 4RIYA 5EYCA 2UVZA 2DS1A 2FSOX 2QHNA 5AIKA 2X7GA 3UZRA 4MBLA 3KRJA 2XH5A 2FO0A 2IJMA 5AAGA 2C30A 4Z3VA 3TWJA 2GHMA 4NK9A 4R5YA 3ETAA 4ZSEA 3ZSIA 4GCJA 2O2UA 2VUWA 3CXWA 3Q04A 4FUXA 4GUEA 1G5SA 5FUTA 1MP8A 4BCJA 2YM4A 3FHIA 4ZJVA 3U6JA 3PRIA 3MTLA 3BHUA 2G01A 2YWVA 3EHAA 4EK8A 3FL5A 3OC1A 3V5WA 5BVKA 5HIBA 5CANA 5H8BA 5KNJA 3KK8A 3NLBA 2EB3A 3PPZA 4RX5A 2YIWA 4NKAA 4HVHA 1I09A 2PYWA 3V51A 5IUIA 4BGHA 5A9UA 2CKQA 2XEYA 5HHWA 3W1FA 2XIZA 3V04A 4BDFA 3OBGA 4R3RA 4YUQA 3ZBFA 3AGMA 3ZC5A 3QHWA 5G1XA 3C5UA 4S32A 4W4WA 2ZV8A 3R21A 3MI9A 2UZEA 1BI8A 4OTPA 5TF9A 5IQBA 3QC9A 4J99A 2QKRA 1JKKA 3ZLWA 4CT2A 4LRMA 1P14A 1E1XA 3LFCA 4M67A 1T46A 5E8YA 4ZJIA 5AUYA 1HCKA 4E6CA 1NXKA 5DFPA 4B8MA 5IQEA 2C4GA 2XYNA 3RK9A 3BV3A 2C1BA 3ZFMA 5HQ0A 3WIKA 2PUUA 3VRYA 4ANBA 3ORNA 4FK6A 3ZU7A 3GU8A 4JIAA 2PZPA 3FQHA 3QL8A 3E3BX 1UU3A 4R6VA 2JITA 3PA5A 2VGPA 3OUNB 3Q32A 2WO6A 5CSWA 3COMA 3WF9A 1MQ4A 1NVRA 2NRUA 4ZY5A 3QKLA 3O5AA 1W2FA 4KSPA 4XG4A 3AT2A 2HWPA 5FM2A 4D9TA 2HXQA 2C5XA 5HBJA 4L7SA 2R3OA 4FIFA 4NSTA 5J79A 1W98A 4AW0A 3UNKA 2X8DA 4IAKA 3NUAA 5CQWA 1JPAA 2X9FA 4J8NA 4KIOA 2OFVA 3QX4A 1YDSE 3NCGA 4A7CA 2Z2WA 1H1PA 5AV3A 2J0MB 2PHKA 3EFKA 4XRJA 3DXPA 4IHPA 4GIIA 4FT3A 4EYJA 4TW9A 4DBXA 3QQHA 4GJ3A 3VUGA 4UMTA 5CT0A 3VW8A 5AR2A 4MF0A 3EQPA 4M84A 3OOMA 4QMMA 5M06A 3D5UA 4K2RA 4LRKA 4ITHA 2QLQA 5JQ5A 4I3ZA 5LVPA 3BI6A 2WTWA 4AE9A 3EN4A 3R1QA 4JBOA 3VBYA 2J7TA 3EYGA 4ITJA 3FLQA 4JAIA 3ZLYA 4O0WA 3OWJA 5IUHA