4EC8A

Structure of full length cdk9 in complex with cyclint and drb
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
325
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 tail determines the reaction pathway of positive transcription elongation factor b.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 325
sequence length 333
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ec8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ec8A01
4PDPA 3Q60A 4FKTA 2PVMA 3DXNA 4J71A 5FGKA 3R6XA 3MB7A 3UNJA 5IEYA 1OIYA 3OWPA 3U4UA 4OAVB 2IG7A 5CLPA 3QD0A 5AUTA 4U43A 4AE6A 1Q41A 3NPCA 4CKIA 3F66A 3BE2A 5IQEA 4G9CA 3F5GA 4O27B 5HG9A 3TNHA 3U9CA 4ANSA 5TOZA 3U4WA 5CU4A 1OL1A 2X1NA 5CI6A 4BZOA 2WGJA 4BY9E 4B99A 4OTDA 2PULA 2JDOA 2OIDA 3HYHA 4FGBA 3Q5IA 5HI2A 3LCSA 4FEXA 2QVSE 1VR2A 3I7BA 3UIUA 3EN6A 4F7JA 4O0SA 4ZY6A 3G0FA 3PXFA 3GCPA 2BRGA 1OL2A 5K4IA 5DRDA 4F4PA 2PY3A 4OTRA 3ZO3A 3HUBA 2R5TA 3TIYA 2VU3A 3TNQB 3OZ6A 2GS2A 3ENMA 2QR8A 3MW1A 4JR7A 2RG6A 1DI8A 4WKQA 5FXQA 4BDCA 3HV6A 3DOGA 4FSNA 5EKNA 3IW6A 4PDYA 4RWKA 3K3JA 1E1VA 2C1AA 3GCQA 4X7QA 3U8WA 4GKHA 4G17A 1KV2A 3VW6A 1AGWA 4MYGA 1JNKA 3QZHA 3KFAA 4G1WA 3HMPA 1BUHA 4I4FA 4D1XA 4Y5HA 5IQCA 2XBAA 3LFBA 5LVPA 4H3QA 1BX6A 5JH6A 3ACJA 2X4ZA 4WD5A 4AUAA 5HO7A 1XH5A 5BMMA 2JKMA 2C0OA 4FG7A 1B38A 1OMWA 3QGYA 4MEDA 5CANA 2QC6A 2ZJWA 2EXEA 3E87A 2QKRA 3PRIA 3QTRA 4ZK5A 3QQFA 4QMVA 5K5NA 2B53A 4QMZA 3KULA 3OUKA 3TV6A 1FVVA 3KC3A 2E9PA 4CFWA 3VUTA 3DTCA 4CFMA 4EWQA 4UMUA 5J5SA 2HENA 4GT5A 3HECA 5AAGA 2XK3A 1MRYA 3EB0A 3OP5A 5J9YA 4FL2A 4W4WA 2R3PA 4Z7HA 3V3VA 2IZUA 4G3EA 2RSVA 2QCSA 2VAGA 2X81A 1REKA 3W18A 5BUJA 3D7TB 4RG0A 4ACDA 4DGGA 2QHNA 4YJRA 2ITZA 4L7SA 3W16A 3WBLA 4RX5A 4GRBA 4JX7A 4YU2A 4ID7A 4G5JA 1LPUA 3R04A 4FKRA 5KCVA 4XV1A 1O6LA 3COIA 1CSNA 4HVHA 2QOIA 1YVJA 3EQDA 3FZSA 3QGWA 1UNHA 3QWKA 2IZRA 4HJOA 5K0KA 3BHTA 3OHTA 4NU1A 3VS7A 4DBXA 3E3PA 3TDWA 4BCPA 3F69A 3A7GA 2GNHA 3VUGA 3OWKA 4DF3A 4EOLA 3SVVA 3P08A 3C5IA 3ZMMA 4FZ6A 4ACGA 4IC7A 3CBLA 4JG8A 4YLLA 3UVQA 4V0GB 1W83A 4LOOA 4HCUA 5M53A 2E9UA 5DNRA 1G3NA 1LUFA 4G16A 3L9LA 4IE9A 2J2IB 4RIYA 3E3BX 4BYIA 4BDFA 4E3CA 5HNIX 1U54B 4I0RA 3GNIB 3B8RA 1L3RE 3FSFA 3HP5A 4L3PA 3NYXA 5IA4A 5CY3A 1PMNA 3QTWA 3KVWA 2E9OA 5CEKA 3K5VA 3CPCA 4JG7A 4CKJA 2Z60A 3UG2A 4LM5A 3IK3A 3JVSA 4D1SA 2HCKA 5HD7A 4HVSA 4AE9A 1F3MC 2GDOA 3MIAA 4AFEA 2NP8A 4FK3A 4C3FA 5IEVA 1FVRA 1T46A 4GYGA 1MP8A 4PL3A 3UTOA 4D2WA 2EU9A 3QKLA 4MNEA 5H9BA 3E64A 2BAQA 3O96A 1YI4A 5M06A 1OIQA 3HAMA 5JFXA 2Y9QA 5LOHA 3VULA 3MTFA 4KWPA 4ANBA 4JAJA 4V0GA 4PL5A 5FP5A 1PXKA 1RJBA 1GAGA 3FY2A 3ORIA 4AX8A 3BGPA 3CJFA 1FGKA 2I7QA 2G9XA 3PY1A 2ZV7A 4AP7A 5HE2A 1FVTA 5EOLA 3FZRA 4S30A 5BUEA 3GOPA 2JBPA 4JL9A 4NFNA 3PY3A 4Y95A 3V6RA 2WELA 4FSQA 3ZLWA 3S1HA 3BHUA 3LJ0A 3OMVA 2ITXA 1UKIA 1U5QA 4JBPA 5IEXA 4FX3A 1R39A 1XJDA 3A8WA 2C5YA 4IAAA 1H0VA 2IJMA 2XK7A 4K8AA 2BDJA 4FVRA 5EM8A 1OGUA 5AWMA 2OXYA 5HX8A 3CPBA 4I1ZA 4X21A 2I40A 1YQJA 4R3RA 4FTKA 5L6OA 4MX9A 3EZVA 3ULZA 4YO4A 2HYYA 4LYNA 2JIVA 3LW0A 3PG1A 1YWNA 3R8UA 1H1PA 4M68A 3EFLA 4F09A 4KBKA 4X3FA 3LJ1A 3M1SA 5D12A 3WZEA 4BDIA 4DN5A 4DT9A 4Z3VA 1PHKA 1H25A 1ZMVA 4OT6A 5CSWA 5CZIA 5KKRC 2ZB0A 2EXMA 5E8XA 4EOJA 3LQ8A 3OTUA 3NUPA 4O0XA 4XRJA 2XB7A 2IWIA 4F9CA 3DKCA 3I60A 2W0JA 4HYUA 4AZSA 3ZOSA 2J0KA 4MBIA 4WNPA 1UKHA 3IECA 1QMZA 4FIFA 2BALA 3PPJA 4MF1A 4QTCA 4PPCA 5HEZA 3NVKI 4QYYA 1NVRA 1XHAA 2VWZA 5IQIA 1M7NA 3DK3A 5AP0A 5K0XA 4AN2A 3IG7A 3A4PA 2JAVA 3VW8A 3VO3A 3QC4A 1DAYA 5IH6A 3EQBA 4Q5HA 3DXQA 4IAIA 4XS2A 3R02A 4A9UA 5KBQA 3QF9A 4KIKB 1JBPE 1BI8A 4EYJA 4OTQA 3D5UA 4RJ6A 3UYTA 3ZDIA 3R8LA 3UOJA 4FV5A 3NIEA 2V22A 1P2AA 4TTHB 1VEBA 5AR8A 4FYOA 5A46A 1UU3A 5JK3A 4LI5A 3UZPA 5CAQA 3FHIA 3MH2A 4IHPA 2JKQA 3LLAA 2X8IA 4R8QA 4RWIA 1Q99A 2YCSA 4O7NA 2BILB 3P86A 3RAWA 1SMHA 2X39A 4HYSA 2JKKA 5EYMA 2X2LA 3FQEA 5IA2A 3R28A 3UP7A 2ETKA 2R0UA 3UYSA 3RKBA 2X2MA 1OL5A 2CKOA 2VTPA 1Y8GA 4OTGA 3BYVA 3UJGA 4WBBB 5I3RA 2YJRA 4R3CA 1IA9A 4MNFA 4KB8A 1MQ4A 5AUVA 2IVVA 2WU7A 1YWVA 3SXRA 4R78A 2I1MA 5HQ0A 2OZAB 4HGTA 5IA3A 2OJ9A 2I6LA 4AACA 4L68A 4J99A 3BRBA 4L6QA 1YDSE 3R1NA 3NX8A 3FKLA 3KN6A 4FKIA 5FEDA 5AUZA 5IISA 4ITJA 2QOLA 1UNGA 3FV8A 4KIKA 3GOKA 4QP9A 5EM5A 5CU0A 3H9FA 4IVAA 4NW6A 5K4JA 5DR9A 1ATPE 3R30A 2ESMA 3A2CA 1BI7A 4U6RA 3E5AA 2ITOA 3F2RA 2J51A 4E8AA 3Q6WA 4FIIA 3S3IA 3R22A 4E4NA 3FMNA 3R8ZA 1XWSA 2C4GA 4O1PA 3TTIA 4C62A 4EH3A 3HVCA 1FGIA 1MQBA 3OUNB 3O2MA 3GC0A 3QRJA 4FV9A 4JLCA 5AR4A 4GV1A 2VTOA 4I21A 4LMNA 4G6OA 4YNEA 4XV3A 5HIEA 3TEIA 3DDQA 3UOLA 4FTUA 4FIJA 2BRBA 3PIXA 2CNQA 3M42A 4JDJA 5AUWA 1YI6A 1Z9XA 2XIRA 4QP8A 5TR6A 4R1YA 3A4OX 1Z5MA 4QP4A 2UZBA 3FWQA 4G3GA 4ACCA 4AU8A 2BFYA 4KIQA 5IQFA 3BELA 3ZSHA 3Q4ZA 4Q9SA 4YSMA 2OZAA 2ZM1A 2WQMA 3EZRA 3WIGA 4BCFA 4ZSGA 3V5LA 3FHRA 2Z7RA 3NVMB 4D2RA 4NUSA 2C5VA 2VTQA 2C6KA 2ZV2A 2VWVA 3PPKA 4J1RA 3TTJA 2A0CX 3C1XA 3BWFA 1IG1A 3LFAA 4A9SA 5DH3A 5HLWA 4C34A 2UUEA 2UZNA 3E8EA 4BN1A 3Q9WA 3TDVA 3TZ7A 1IR3A 1YOJA 4GK2A 4FZAB 5EM7A 1TQPA 3V5QA 2JFLA 4FL1A 4FR4A 4RGJA 4EHVA 3DS6A 3N4TA 1KOBA 1GZOA 3HA8A 4DH3A 4QYHA 4CCUA 4FSUA 2R3FA 3EJ1A 4AXAA 2DQ7X 4FT0A 5IUGA 3KY2A 3BYOA 5D7AA 3ZBXA 4W4VA 3UVRA 4BCKA 3EQRA 3O8UA 3CQWA 3GFEA 3PE1A 2YCFA 4M12A 2JITA 5FTQA 3TXOA 3V8SA 4AT3A 5LMKC 3UPZA 2Z02A 2FGIA 4OTIA 2O64A 5HO8A 4RIOA 2R3NA 2OG8A 2XK4A 4IACA 2VTIA 3NNWA 1UNLA 3DTWA 3SXSA 5H3QA 5GZ8A 3D83A 4AW0A 4S32A 4IEBA 3BBWA 4YJSA 4HCVA 4MKCA 5HVJA 4DFBA 2W05A 3NW5A 4IB3A 4TRLA 2OJGA 3F7ZA 3I4BA 4YURA 4TKSA 4C4IA 3DFCB 2F9GA 4YZNA 5HG7A 1XBBA 5L8JA 5KHWA 4L52A 4EHGA 2YDKA 2XNEA 3VUMA 4MD8E 4PX6A 2YACA 2YM7A 5BVKA 5HORA 3QZGA 2BHEA 5L8LA 3FI8A 4QP7A 2BTRA 3PTGA 3AC8A 4LV5A 3GI3A 1YI3A 5G1XA 3WARA 4BGGA 5J87A 1JKLA 5GZAA 4DYMA 5HE1A 3C4FA 2HY0A 3DK6A 3MB6A 4H05A 2IVTA 2OH0E 4M7IA 2RFSA 1PXJA 2JD5A 3KRLA 4BTKA 4D2VA 4EBWA 3KXNA 3WF5A 3RNIA 4CFUA 3LXPA 3OCSA 3DU8A 4AZVA 4F0FA 3DQWA 5JRQA 3EN9A 1TVOA 5ANEA 5GJFA 3QRIA 4EHZA 2VUWA 4BKJA 2PE1A 3OBGA 5HBEA 4EZ5A 3L8VA 1WBVA 3MFTA 4KSPA 5CF5A 3QAME 4ERKA 2YISA 4BGQA 4FOCA 2J0LA 4DBNA 4XG2A 3LQ5A 4EK4A 4UWBA 4XLVA 4J95A 2PZRA 4N6ZA 3CEKA 4LRKA 1RW8A 4KINA 3BZ3A 3ANRA 2GNGA 4FT7A 3F5PA 5J9LA 3A8XA 4X2JA 4PF4A 3EQGA 4JIKA 1XH9A 2G1TA 3OCBA 2UVYA 3T3VA 4EL9A 4FOBA 5LVOA 1STCE 3PG3A 2BDFA 4USEA 5C01A 4O7ZA 1F5QA 3ZFXA 5E8VA 4D55A 3UZRA 5E8UA 1GIJA 2JDRA 4W9WA 3ZLSA 2YZAA 4K11A 3NMUF 3QUEA 1VJYA 2Y0AA 3BHVA 3R8PA 3UQFA 2W4OA 4FKGA 2ITNA 4GT4A 1BKXA 1OKYA 1L8TA 1Q62A 1S9IA 2BHHA 3FLYA 2R3IA 3G6GA 3R00A 3EYGA 4XP2A 3RI1A 2CKPA 3DKGA 3ORPA 2VTMA 2XCHA 3LE6A 2XIYA 5M56A 3ZLXA 4YZ9A 4YTHA 2UW0A 3PSDA 5ETAA 3LMIA 4QTDA 3PVGA 1GZKA 3U6HA 5AAFA 2VTHA 3AGMA 5M55A 2PZ5A 2WXVA 4UWYA 5JSMA 4IZ7A 4R3PA 3EFWA 4FTCA 3RK7A 4RFZA 3BBTB 5KMLA 3EOCA 5AX9A 4FEUA 4DGOA 3GCSA 4NCTA 1CDKA 2X9FA 5J9ZA 1UA2A 3AD5A 1PXLA 3ULIA 3UMWA 3PDTA 3V8TA 2CHLA 5CF6A 4L42A 3MS9A 3TV7A 4E1ZA 3SOCA 3EN5A 1FQ1B 3Q96A 4IBMA 2PVHA 3DT1A 3MVHA 4IAKA 4ZOGA 5CASA 2F4JA 2WMXA 1Y6BA 1OKVA 2XIZA 4PTGA 4FUYA 4Y5QA 2QO9A 4DGNA 4F6SA 2O2UA 3ZBFA 5L8KA 4IFCA 1JQHA 1P14A 1PMUA 3CP9A 4CG9A 2O63A 1WBOA 4GJ3A 3LAUA 2JEDA 3GENA 4AWIA 4WSQA 3B2WA 5DG5A 3QX2A 4LUEA 2HW7A 3H9OA 3PSBA 4YJVA 5FRIA 3FXZA 5BVNA 2XBJA 3PPZA 4FZDB 1H07A 1VZOA 2EB2A 3E8CA 3KRRA 5E4HA 2C1BA 4CTBA 5IDNA 2VX0A 1URCA 2KULA 5FP6A 4D0WA 5EHLA 4YGAA 3E7OA 3SRVB 2BKZA 3IGOA 4BDGA 3SGCA 2GNIA 3D14A 3ZO1A 4QMWA 3THBA 3ODYX 4PP9A 4FKJA 4DFNA 2X8EA 1DI9A 2JIIA 3B8QA 4F64A 4D4YA 1H08A 1Y8YA 3O8PA 4CQEA 4R7IA 4C59A 4EORA 4M69B 3DAJA 2YITA 5I9ZA 4GH2A 4CGAA 5FWKK 3T3UA 5CVGA 1IAHA 4ZTNA 4NK9A 4LMUA 4BDDA 4YPSA 3NDMA 5EM6A 4HZSA 5H8BA 4WUAA 4C2WA 3I0QA 3C13A 5CTPA 3DCVA 2C5NA 3FMDA 5F1ZA 2C3IB 2UW5A 2OWBA 5DT0A 3R8MA 4BWXA 5M08A 3EKNA 5T3QA 5M4UA 5JMSA 3I1AA 2I0YA 2OK1A 5LVNA 4U9AA 2R3KA 5D1JA 4UYAA 1ZMUA 4BI1A 2A4LA 3GFWA 2PE0A 1H26A 3IGGA 3QTZA 2G15A 1O9UA 2WQOA 4FNWA 2XKCA 3BX5A 3AOXA 3H4JA 4KRDA 4MTAA 4BICA 4M0YA 3ZFMA 1KE6A 1H28A 5C03A 3SRVA 5HNGA 4O7YA 4I3ZA 3R0TA 4IB1A 3BIZA 4HVGA 5I9VA 3VS5A 5DN3A 5EQEA 2ZB1A 4E4LA 5CU3A 4I5CA 1OUKA 2DS1A 3I6WA 1XH4A 3ORKA 1LP4A 2ITTA 2Q0NA 2Y8OA 3KF7A 5M44A 5LJJA 1PW2A 3VRYA 4JX3A 5JZJA 2RFEA 2PE2A 3O71A 4FV2A 4D9UA 4KD1A 3LZBA 3A60A 3EL8A 4KBCA 3LFCA 4BDHA 5IQAA 2R3MA 4HNIA 5B2MA 3OD6X 4IVDA 3VUDA 1J91A 2WQNA 3EFJA 2XYNA 4EH6A 2CCIA 3W2QA 4A7CA 3R9NA 3CSVA 4QTBA 2VN9A 3PVWA 4QD6A 2C6MA 2IZTA 3FI4A 5AP6A 5JRSA 4EJNA 5FTGA 2BAKA 4ASEA 3ZUTA 2H96A 2QOKA 3AMAA 4MBLA 4UMQA 3KRJA 4MXYA 4ZSJA 4ZTRA 2J6MA 3HV4A 4FNXA 1BYGA 4GUEA 2C6DA 2YCQA 5JFWA 4EONA 4FV0A 2XRWA 4V05A 2H34A 3DZOA 5D7VA 3RCJA 3SXFA 1SM2A 3NUNA 4BR3A 4XG9A 4OTHA 3W2RA 5FXRA 1RE8A 4UX9A 2R7BA 4AN3A 4HVDA 4ALUA 2X4FA 3FL5A 5IKWA 3TN8A 4C35A 3FMJA 4OBPA 4Y83A 1PXOA 4F1MA 5A9UA 3NIZA 3UGCA 3IOKA 4FTAA 2PVJA 2ZV9A 3KXZA 4JAIA 3ZZEA 1HCLA 3VF9A 4XG4A 3ATSA 4B9DA 4WIHA 4CEGA 5LCKA 4RFMA 4V04A 3FQHA 2ZDTA 5CU6A 4KAOA 5IZFA 3VN9A 1PXMA 2C6LA 3OBJA 5BUIA 4CVAA 2WMWA 4J8NA 4PTEA 4RZWA 2YFXA 1J7LA 2XRUA 4M15A 4G34A 3H0YA 3DDPA 5E91A 3ZTXA 1KE5A 4NIFA 3BLRA 5DLSA 2HZ0A 5FQDC 1O6YA 4IX4A 4ANMA 1JLUE 2BDWA 4RMZA 4BCGA 4ZY4A 3ODZX 3G5DA 5CSVA 4Q5EA 2WFYA 3R1YA 2VO3A 3T8OA 3EQCA 3RM6A 4PUZA 4QPMA 4F1OA 5HTBA 4WSYA 1MRVA 2JDSA 3NLBA 1NY3A 2QLUA 4XMOA 3GT8A 4BZDA 4X2GA 4EKKA 3Q52A 3ZEWA 4HPUE 3QCXA 4GS6A 1J7UA 2QQ7A 3KKVA 3FZ1A 1BL7A 3L8XA 2GQRA 4OR5A 2C5XA 4DT8A 2BROA 3QUDA 1YW2A 4G9RA 4O21A 4QRCA 4AGDA 4ZTHA 2PUUA 4IX5A 3LXNA 4PWNA 2YLFA 3ANQA 2UV2A 3PP1A 4WRSA 5HCYA 3IOPA 4IX3A 4AAAA 4D5KA 3BEAA 5EOBA 4U44A 1OPKA 2BZKB 2F2UA 4FI1A 5KBRA 1E9HA 1QPDA 4FMQA 5DT3A 4ZLYA 3NYNA 1SZMA 4NJDA 5KKRB 3RPSA 3OXTA 4XP3A 4DE4A 3R9HA 2WTJA 3RNYA 4R77A 1WZYA 5J5TA 3AC3A 4GL9A 4QMOA 5J1WA 1H1RA 2JKOA 2WKMA 3FJQE 4WNKA 4C8BA 3UO5A 2NRUA 3WZDA 2GPHA 2RKUA 5M4CA 3GQIA 1IAJA 2B1PA 5HGIA 4RIWB 3VUHA 5L2TA 3LOKA 5TT7A 3FC1X 2YN8A 2OLCA 2VTJA 2VX1A 2X7FA 2BRMA 3UQGA 3PXQA 2XNPA 3O7LD 4TWCA 1ZOGA 4FTLA 2JDVA 4X2FA 2IPXA 3VC4A 4EHEA 4BRXA 3BQCA 5KMOA 3B2TA 5C9CA 3LKMA 4AQCA 2CJMA 3OW3A 3M11A 4I92A 1YWRA 2IZSA 3RWPA 4QQTA 4ONAA 3FLWA 5I0BA 2RFNA 3OWLA 4H39A 2UW3A 2W06A 3FZPA 4LOPA 5CENA 2X0GA 3P23A 4C4JA 4TN6A 4FIEA 5BVDA 5IQHA 3F3VA 3SHEA 3AG9A 4G6NA 1I09A 2ZMCA 3F3UA 3IONA 1PYXA 4A4OA 3O7LB 2GQGA 4C0TA 3MH1A 3Q9YA 4RX9A 4KUJA 3ACKA 3LCKA 4AA4A 4JT3A 2WOTA 3LFDA 1K2PA 3MBLA 1EH4A 2XNNA 3PLSA 4F9BA 2UW8A 4U45A 4RA4A 2JFMA 3QKMA 4RLLA 2GU8A 5EDRA 5EI8A 4BB4A 2ZOQA 3R01A 4I6QA 4FG9A 3CGOA 4O2PA 4E93A 4O0TA 4BHNA 4RIWA 3C4EA 4EQMA 5I5ZA 4NH1A 5I9XA 4MXXA 3TJCA 3UG1A 3RPRA 3MESA 1QPCA 2J9MA 4EC8A 4QYGA 2WTWA 3R7IA 3VIDA 5BVFA 2W1DA 2VNYA 3P5KA 1Q4LA 3CKWA 1UU7A 5E92A 3R1QA 2VTRA 4J7BA 2J0JA 4K77A 4X6QC 5A4CA 5HU9A 1APME 3FZOA 2NO3A 1OL6A 5CEOA 2PVNA 3LM0A 4YO6A 2R3JA 2B9FA 3G15A 3W33A 1ZYLA 4H58A 4L9IA 1ZARA 4O96A 5KE0A 3T9IA 3UOKA 1WBPA 4ASXA 4N57A 3V01A 3WILA 3E8NA 3P7BA 3NUUA 5FBNC 5LMAA 3FI2A 1GZNA 2XEZA 1U4DA 4TWPA 2HOGA 4C2VA 5I9YA 5GINE 2VNWA 4CSVA 5IA1A 1Z57A 2FSOX 5DA3A 5T68A 4Q9ZA 2FSMX 4GYIA 3RALA 4F6WA 2BRHA 4HPTE 4PDSA 3SD0A 4ASDA 3PWDA 4KNBA 4BVUA 4IXPA 3MVMA 3MTLA 2IW9A 2A27A 4IAFA 4RIXB 2X7GA 4N70A 5DR2A 1RQQA 1Q3WA 1YXSA 2JAMA 2ZAZA 2RGPA 3G0EA 4DTAA 3R83A 4W4YA 2PZIA 3V6SA 1ZXEA 5AP5A 4AS0A 5B2KA 2HK5A 3D7TA 4GKIA 5I9UA 5C4KA 3DLSA 4IIRA 4D4SA 4YZDA 1TQIA 4F7SA 4UWCA 3MA6A 4EH5A 3NNXA 5AA8A 4JQ8A 4UMPA 4W9XA 4ERWA 3C0IA 2BZIB 3QXOA 3P7CA 4FKVA 4O0RA 4EH4A 5A14A 3FLNC 3C51A 3KRWA 1YXVA 2Z7QA 2G2HA 3BKBA 3BLQA 5CU2A 4JBQA 2QONA 4QP3A 3ZRMA 3BHYA 3E92A 4B8MA 3UQCA 4FTQA 4GFMA 2ZDUA 3PYYA 2Z2WA 4BBEA 3NUXA 5AUYA 2R2PA 2W1IA 4DEAA 4ZJIA 1PXPA 4CFNA 5IUIA 2X9EA 4BGHA 4C61A 3F5XA 3OXZA 1WBWA 5CVHA 3HA6A 3SC1A 5KX8A 3EWHA 4C33A 1WBSA 3F82A 3JPVA 1OECA 1IRKA 5BNJA 3I5NA 5AR7A 4IM3A 5A6OA 3QA8A 5L2WA 2WEVA 4D0XA 1CKPA 4P5ZA 3KA0A 3IQ7A 4RC4A 2OFVA 5CYIA 5IH4A 2EXCX 3IPHA 3Q4CA 3QRKA 4O2ZA 4U0IA 2IW8A 3ZDUA 2CKQA 3NZ0A 4GW8A 5CVFA 5ACBC 2GNFA 1WVYA 3ZHPC 3RGFA 4MQ2A 4YLJA 3W2OA 1U54A 3BU3A 3HDMA 3DJ7A 2JDTA 4NW5A 5A4LA 3QD3A 2HXQA 2HZNA 4GVJA 5AP3A 5CEQA 4YR8A 3DZQA 3QXPA 4FTNA 4HGSA 4J96A 4P2KA 5F4NA 3RAHA 2PPQA 3BLHA 3HV5A 3RTPA 5LMBA 4KKEA 4F9WA 3DKFA 4BFMA 4C37A 2V5QA 3QFVA 3OVVA 3JY0A 5DPVA 5EK7A 4FNZA 3NCGA 2XKFA 2XKDA 3U54A 3FY0A 3IW4A 2O65A 5LMKA 3ZCLA 5CSHA 3ORNA 2GSFA 4FL3A 1H1QA 4HGLA 3HUCA 4GJ2A 2GTMA 1GZ8A 3EFKA 4M8TA 4FTOA 3N4UA 2F7ZE 2P2IA 3AT4A 4MWIA 4F0IA 3PY0A 4DITA 3GUBA 3WF8A 3UC4A 2QOHA 1YHWA 3SA0A 1ND4A 1YXXA 3DA6A 4ACMA 3WF7A 2P4IA 4RBLA 4MVFA 4XG6A 5DE2A 4ASZA 4ZIMA 4MF0A 3D2KA 3ROCA 3H9RA 3QWJA 4IM2A 3N9XA 3K54A 4GG7A 4BDAA 2I0HA 3HAVA 1Q24A 1M7QA 2YAKA 4KSQA 4A9TA 4EK5A 3VHEA 4JJRA 1A9UA 5AFVA 2ONLC 3HGKA 5M4IA 3DB8A 1ZYCA 4OW8A 4MXCA 3DB6A 1HOWA 5C8MA 3UMXA 4E4XA 3ZZWA 3BV2A 4IAZA 4ZZOA 2KTYA 2ETRA 2OGVA 1W98A 2WMTA 3H30A 1JAMA 2C0TA 4Y72A 3QUPA 3C4ZA 3PE2A 5F94A 2QG7A 2V55A 3VBTA 5AV2A 4I41A 4XCUA 2P33A 2QU6A 3QQKA 1XH7A 4X6RA 3ZEPA 4BIEA 1Q8TA 1ZWSA 4O0WA 4H3PA 3NSZA 2CN5A 3PJ8A 3OY1A 3OCGA 4TYGA 4FTMA 4YHJA 2QNJA 1R0EA 3MPMA 3HKOA 4EK3A 1SNUA 4S33A 4YJUA 3FSKA 3KMWA 4I6HA 4ZS4A 4BC6A 4C38A 3GC9A 4YJNA 2ITPA 3VUKA 4YPDA 2GFCA 4GK3A 4CTCA 5KMNA 1OPJA 3MYGA 4FEQA 4FKPA 3MDYA 4OTPA 4EOQA 3PXYA 4BI2A 5K5XA 2V7AA 5HIBA 4XNEA 2XJ2A 2WMSA 4Y46A 5DEWA 5H8EA 2PHKA 4O7VA 3QRUA 2GS7A 2YA9A 5A4EA 2VTNA 4I5PA 1DM2A 1R78A 2AC5A 4XV2A 5ANGA 2PVRA 3KVXA 4Y85A 3QKKA 2R0IA 4E73A 5AX3A 2A1AB 2YM5A 1Q97A 3L9NA 3QLGA 4MXAA 1PXNA 4AGUA 4JR3A 4ZLZA 3PZEA 1UWJA 4RX7A 5HG8A 2GQSA 4L53A 3BU5A 5IA5A 5B7VA 5A54A 4L43A 3VBYA 4AFJA 5CAVA 5CNNA 5HU3A 2PUIA 2C6OA 4O0UA 4Y73A 1NVQA 4RT7A 4RWLA 4IJ9A 4CV9A 1Q8YA 4ANNA 5LXMA 5BYLA 3O23A 4YC6A 2CGWA 1CKJA 2QKWB 3DJ6A 4FSMA 4KIPA 2EB3A 2UZVA 2QU5A 4F9YA 2C6TA 3PP0A 4QTAA 4E5WA 3BYSA 3EN7A 4I22A 3L9PA 4WBOA 3ZUUA 4O6LA 1ZYSA 4IDTA 2W5HA 4AZFA 3LCTA 5AA9A 3D5XA 4KS7A 3LFQA 4D58A 3E63A 4LFIA 3KN5A 3HV3A 1IEPA 2QD9A 4L8MA 2H6DA 3C50A 3JR1A 1JKKA 3DBFA 4FT5A 4O91A 4A9YA 4FV6A 5DHJA 1PRYA 3G90X 3CGFA 1M52A 4G3FA 4QYEA 1IASA 2GHLA 3CTQA 4M3QA 4QP6A 2C47A 2WU6A 4DCAA 3O0GA 1O6KA 4EK6A 2YWVA 4JDKA 5DBXA 3PVUA 2VD5A 5HHWA 5KUPA 2PUNA 3P4KA 2QLQA 4NEUA 3QQGA 2B54A 3I81A 5E8TA 5GJGA 5C4LA 3C9WA 2EWAA 2WMAA 3O50A 1J1CA 1GOLA 2R7IA 3O17A 3NEWA 4FKLA 4MXOA 5C26A 2NNWB 1E1XA 3C5UA 1LEWA 2YWPA 3CIKA 5DIAA 4ZEGA 3ORZA 3DBCA 4F1TA 2F7XE 2F7EE 3DPKA 2BRNA 2G2FA 4I94A 3S4QA 4WUNA 5JGDA 5DI1A 2R9SA 3PWYA 4XRLA 3HMIA 4GK4A 2Y4IB 2W4KA 3OF0A 4XG8A 5EYDA 1KWPA 3W8LA 4ZP5A 4D2TA 5DT4A 3KL8A 2W17A 1WVXA 1BL6A 3RM7A 3UIXA 4DEHA 2J7TA 5LCJA 3HMMA 3MPAA 5CSXA 4BF2A 2CNUA 4G3DA 3WIKA 3D9VA 5CZHA 3VQHA 3F2NA 4IANA 5CI7A 1YOLA 3R63A 4X3FC 5DR6A 1ZYDA 4QMSA 1WMKA 4BCJA 2OKRA 3QU0A 2P55A 2R3QA 3RBWA 1VYWA 5J1VA 3BI6A 2X2KA 2XA4A 2YIQA 5EI6A 3C4WA 4BZNA 4TNBA 4HNFA 4CCBA 3VBXA 3NAXA 3FDNA 2OXXA 1OPLA 1YXTA 3UC3A 3K2LA 2GHMA 2PVKA 2XF0A 4B6LA 2ZM4A 2B55A 4AN9A 4H36A 4QMTA 5ANKA 4PNKA 3FYJX 4I24A 2PSQA 3MY1A 3FMEA 3EL7A 4UXLA 3OT3A 2B52A 5TE0A 4ZTMA 2REIA 2XNOA 3F3TA 4LGDA 3E8DA 5CXHA 3SW4A 4CMUA 3CKXA 2FB8A 2CGVA 4N6YA 4ARKA 1X8BA 2VTAA 3A7FA 5HIDA 4AF3A 5FD2A 4NYEA 3SG9A 4JRNA 5ANDA 4EUUA 4F7NA 3VRZA 4RJ7A 4YUQA 4JNWA 4O83A 3RJCA 3D5VA 2W1EA 3OFMA 3TUBA 4MAOA 4IADA 4ORKA 4USDA 2F2CB 2ZVAA 3V8WA 2Q83A 3QYWA 1B6CB 3PSCA 5JGAA 2WQBA 5ANIA 4DTKA 3L8PA 2ITQA 4C3RA 4DEIA 3S95A 4JXFA 5CS6A 3BEGA 5A4TA 2YZLA 3HRFA 1WBTA 3H10A 4R1VA 1QPJA 2XZSA 4H3BA 4EZ7A 5FEEA 3TM0A 1YHSA 2XEYA 4JS8A 1F0QA 5ACKA 4BWPA 3ELJA 5AR2A 2XUUA 5HNBA 4QNYA 1BMKA 2XKEA 5E1EA 3LMGA 4QMUA 4Z7GA 3EQHA 5GZ9A 4EH9A 3FMLA 5IH5A 3Q9ZA 1DS5A 3VBVA 1AQ1A 2YDIA 3HEGA 2XVDA 4XOZA 4FV4A 4JRVA 4L3LA 2R3RA 3CTJA 3RP9A 4BCMA 4XUFA 1GJOA 5LVLA 3C0HA 1KE8A 4B8LA 4DH1A 4E6DA 5EG3A 5L6WL 3QTXA 5DEYA 4PQNA 5JN2A 3UBDA 2CMWA 4XBUA 5FTOA 3BCEA 3RPYA 5KMJA 4OLIA 5EDQA 5HOAA 4IWDA 3NUYA 1K9AA 3A7IA 4RC2A 2ITWA 4FKSA 4K0YA 2VTTA 3KCKA 3EIDA 1S9JA 2ITVA 5I9WA 4ZMFA 1XO2B 4L45A 4E7WA 4ANLA 2YAAA 4DAWA 1V1KA 4ACHA 1YDRE 2UZEA 2OW3A 2BKKA 1M2RA 5H8GA 5JGBA 4PMTA 2CSNA 3AD6A 3MPTA 5M51A 2OJFE 2CGXA 2ERKA 3DV3A 4FTJA 4OBQA 4RVMA 3FLSA 2BTSA 4GVAA 4LG4A 4NM0A 5CEIA 5I4NA 5JQ5A 3CTHA 4II5A 4B0GA 4IQ6A 5CWZA 5ITAA 4LRJA 2HWPA 2XYUA 4G5PA 4RLKA 4RSSA 4O7LA 2ACXA 1NXKA 5L6PA 3C4CA 4R7HA 4XHKB 4GFOA 4APCA 2HW6A 4FEVA 1RDQE 4DG3E 3SDJA 4AZTA 3HRBA 5FDPA 3BWJA 4IWOA 5A4QA 3QCYA 3ROYA 2R3LA 5BVOA 3TL8A 2VZ6A 4EOSA 2PMLX 2RIOA 2ZV8A 3GVUA 2HAKA 2YM3A 3F6XA 3TUDA 2ZM3A 2EUFB 5AIKA 4P4CA 3RHXA 5CNOA 4JBOA 4G3CA 3NW6A 4ZMEA 3QTSA 3EH9A 5DRBA 4FK6A 4DFLA 1MUOA 3G51A 4CFFA 4DEBA 3SX9A 3OROA 4AT4A 3UPXA 4HGEA 3KGAA 4JDHA 4IB5A 2C30A 4FTTA 4K1BA 3MI9A 3ZM4A 4CFVA 3AD4A 1NA7A 2UW4A 4IW0A 2BPMA 4OAUC 4EQCA 1JPAA 4H1MA 4BCQA 2VO7A 5EYKA 4EH8A 1FBNA 2EVAA 2VTSA 3Q32A 4M0ZA 3PVBA 4FV7A 3TWJA 2P2HA 3REPA 2BIYA 4C7TA 5J79A 4S31A 4FICA 3WZJA 3R9RA 5A6NA 2Y4IC 1YHVA 1OUYA 4UALA 2QOCA 3VVHA 3OOGA 3WYYA 5D9HA 1AD5A 1KUTA 2VO6A 4S34A 2G01A 2HZ4A 3QQLA 5C27A 1ZY5A 3R9DA 4CNHA 5JFVA 4BDKA 2YDJA 3HMOA 3MY0A 4FIHA 2V7OA 2WTDA 3A7HA 1UVRA 4TY1A 4O7TA 4M13A 4AA5A 2HELA 1CM8A 4YJOA 3UODA 2QO2A 3ZLYA 3Q2JA 3G2FA 2OXDA 1NVSA 3LCOA 2CLQA 4GFGA 4M69A 2G2IA 2OI4X 2CGUA 3ZSIA 4EI4A 4NM5A 3LM5A 4RJ4A 2W1HA 3BYMA 4GEOA 5EH0A 4E26A 4EZ3A 1Y6AA 2W5AA 2W1FA 3C0GA 2PK9A 1OBDA 1U59A 2XM8A 1W7HA 4QQJA 4BCIA 3Q3BA 5I3OA 2GCDA 3QZFA 3W2CA 4BBMA 4ZTQA 4BHZA 4DLJA 5AM7A 3JS2A 4BKZA 5E8WA 2BZJA 4APPA 1XBAA 2LAVA 5M4FA 5M09A 3HZTA 3KREA 3SQQA 2J50A 2VTLA 5AMNA 3UE4A 3MY5A 3R71A 2B9JA 3CJGA 3PA3A 5IMXA 3AC1A 5GNKA 2YM6A 3QTUA 4NJ3A 4CG8A 3DLZA 1V0OA 1M14A 2RL5A 4EOKA 5BPYA 5IMEA 1OI9A 5EW3A 2Y7JA 5HLNA 2XP2A 3WOWA 5AP4A 3NNVA 2AUHA 3UO6A 3V04A 4FA2A 2VWXA 3VF8A 4DG0E 4R5SA 2W4JA 4U7ZA 2GHGA 2CPKE 1UU9A 2X7OA 3ZRKA 5C8NA 5HTCA 5KMIA 4CYIA 3TUCA 3R7VA 3S0OA 3IDCA 2O5KA 4ANOA 2R64A 1JWHA 4FV3A 5LARA 5FXSA 1H01A 5J95A 4O6EA 1JOWB 1OB3A 2NPQA 4K33A 4TWNA 4Z55A 3S00A 3RZFA 2XK8A 4MXZA 2UW9A 4XYFA 4I6BA 2FH9A 1ZRZA 3U87A 3BV3A 5HTIA 5L4QA 3OTVA 4XP0A 3OT8A 4LL5A 4CZUA 5C1QB 3OXIA 3I6UA 3M2WA 3F3ZA 5EYCA 4YSJA 3V5WA 4D2PA 1H24A 2QOQA 3LIJA 3OCTA 4ZZNA 5HBHA 1OKZA 3MJ1A 5EI2A 2UW6A 1KSWA 3PIYA 4AT5A 5JQ8A 3KRXA 2BCJA 1PJKA 4JVGA 2WTKC 5J7BA 5IQBA 4IAYA 3CXWA 4IDVA 1B39A 2VWWA 3DAEA 4YBKA 4FC0A 4M14A 4LUDA 4BCNA 3LFFA 3PFQA 2OBJA 3FUPA 3HMNA 5HICA 4AGWA 3AC2A 4J97A 2X8DA 4UMTA 2B0QA 3LJ2A 4QMQA 4PPBA 3TZ9A 4LL0A 4IVBA 1URWA 2GNLA 2XJ0A 3LMHA 4IWPA 4JDIA 4NZWB 3SV0A 5FG8A 2JLDA 3FPQA 4HYIA 2NRYA 4Y8DA 5CAPA 4YJPA 2ERZE 4EBVA 3RMFA 1GNGA 3DFAA 3LXLA 4Z9LA 4O0YA 5T6KA 3PXRA 2PYWA 1CKIA 5CXZA 4A06A 2J0MB 4F08A 1WAKA 2IVUA 5H2UA 5KMMA 2OFUA 2J5FA 3W1FA 3HL7A 2Y4PA 1DAWA 3JVRA 3PXKA 3W32A 1Q8WA 3U55A 2YIYA 3AT2A 3WE8A 2WD1A 3ALOA 1JVPP 3KMMA 4P7EA 5FM2A 4DC2A 4PP7A 1M17A 2ITUA 2W5BA 3GCUA 4O22A 3R7YA 2WQEA 3EKKA 3MFRA 4TWOA 2UZOA 3QQJA 5CT7A 3UNZA 3IW5A 4JG6A 5KZ0A 3DBQA 3HDNA 2ZMDA 2XS0A 4TYEA 4CV8A 3ZO4A 5BX0A 3EQFA 4ZAUA 2XIKA 2PTKA 3JYAA 3Q6UA 4L00A 4PL4A 4MWHA 2F49A 3ETAA 3HP2A 2B9HA 4H1JA 3TG1A 1LEZA 2XJ1A 3KULB 1PXIA 4YC3A 2I0VA 3EQPA 4ENYA 1PYEA 1K3AA 2C5OA 3MV5A 5K3YA 2WO6A 1SYKA 2JIUA 4UV0A 4QNAA 2B4SB 4PPAA 3FI3A 2C3KA 5HZNA 4QMPA 3CY2A 4TYHB 3R1SA 3TZMA 4NT4A 1T45A 5ETFA 4DGMA 3EHAA 5G6VA 3I5ZA 3ZXTA 5EQYA 2FSTX 5D10A 4E20A 5HE0A 3P78A 3FE3A 3UZTA 2YM8A 3VS2A 2ONLA 4IVCA 4WNMA 3DXPA 5IUHA 1NW1A 2W9FB 2C69A 4IJPA 3QCQA 2C68A 2OIBA 3CC6A 3NWWA 3QL8A 4I0SA 1ZAOA 3VJNA 3Q04A 4FYNA 3F7WA 2WTIA 4G2FA 4U41A 1U5RA 4LV8A 2PWLA 3LCDA 2QG5A 3V5JA 5L2IA 4I20A 1VYZA 3F3WA 4K6ZA 2UZLA 3SW7A 4WNOA 5AJQA 3N4VA 1KV1A 4NWMA 2R3GA 2UZTA 3MFUA 4CRLA 1PKDA 1SVEA 4DFUA 2A2AA 4DLIA 1OZ1A 2VWUA 4MK0A 4TYHA 3W2SA 3JXWA 3K5UA 3P0MA 4RIYB 4FG8A 4FEWA 3OS3A 4DFZE 2WMVA 1JSTA 3DNDA 3ZXZA 3JY9A 4TW9A 5JKGA 2VRXA 3GU4A 1OIRA 3WF6A 4CFXA 2VWIA 2XIXA 3D15A 3GU6A 3LVPA 3QQUA 4A9RA 4ZJVA 3D4QA 1XBCA 4C57A 2OF2A 4MH7A 4JBVA 4NL0A 2FYSA 4O7SA 1V0PA 2OF4A 5AM6A 3ALNA 3COMA 3KK8A 3NGAA 3NNUA 3AQVA 4CQGA 2IO6A 1KE9A 2WHBA 3A7JA 3ZU7A 5JT2A 5AP1A 5L3AA 2CCHA 4GIHA 2UW7A 4YBJA 5HO6A 5AV0A 3PJCA 4U80A 4MNEB 3GQLA 4X3JA 3KK9A 3FLQA 3OC1A 4MBJA 4PMSA 5E9EA 3QLFA 3VS6A 5IQGA 4DEDA 1OVEA 3F61A 3MJ2A 5A3XA 3ZRLA 2XMYA 4BDBA 5DFPA 2W1CA 1UU8A 3ZONA 5BMSA 3TJDA 4LQMA 3RAIA 4IZ5A 3TIZA 4TYIA 2BR1A 2FSLX 1OM1A 4YTCA 4CD0A 1J3HA 1G8AA 4BDEA 4TZRA 2XK9A 4RIXA 4ZTLA 3GXLA 5EHOA 5L2SA 3COHA 2WNTA 2OJJA 1YXUA 3AC4A 3RHKA 3CQUA 1UWHA 3E62A 1KOAA 3PJ3A 3TI1A 3VUIA 1OITA 3OG7A 3R7UA 3ZC5A 4A4LA 3GU8A 4AOIA 5EDPA 2BAJA 3ZSGA 3POOA 1R0PA 4O7WA 4XJ0A 4XX9A 3CD8A 2PZPA 3QD2B 5AV3A 3UVPA 4DG2E 5KHXA 4BI0A 4X3FB 3JUHA 5AR5A 4E4MA 2AC3A 5M07A 1A06A 4IM0A 5EW9A 4CXAA 2O8YA 3O8TA 3R7GA 2WTVA 5DOSA 3ET7A 4DGLC 3LQ3A 4NTTA 4O1OA 4FSRA 4FZ7A 5TF9A 3AC5A 3QQHA 3QZIA 4V01A 4WOVA 4YTFA 1FMOE 5ANOA 4DINA 3BGZA 2H8HA 4YC8A 1W0XC 3WI6A 4BL1A 2Y6MA 4CMTA 2I0EA 4ZLOA 1MRUA 3GGFA 3FMKA 3C7QA 4BDJA 4BIDA 4O82A 5E1SA 4N0SA 4FKQA 3GU7A 3GBZA 1BLXA 3TZ8A 2OSCA 4KBAA 4RC3A 4QMYA 4ALWA 4AOJA 3AMBA 4RJ3A 4ZS0A 4EEVA 5JZNA 4U8ZA 4O38A 4EOPA 4QPAA 3PUPA 4QT1A 3U51A 5HVKA 3FQSA 4D5HA 4UZHA 4TL0A 1J1BA 2CLXA 4MD7E 2PVFA 2YIXA 5ETCA 3NYVA 4EKLA 4FTRA 4CYJA 5AV1A 1FPUA 1CTPE 5GIPE 4L01A 4KKGA 4RFYA 4R6VA 4UEUA 2LGCA 4U5JA 3GB2A 3E88A 3T9TA 2VWBA 3R8VA 3KU2A 4XEYA 4GUBA 4ZSAA 2BIKB 2WMQA 3GU5A 3PA4A 5HX6A 2E2BA 4UBAA 3DK7A 2XNGA 2FUMA 4TYJA 4EOMA 4AGCA 2HWOA 4OT5A 4XG3A 3VBWA 1CMKE 4YTIA 2UZUE 4FNYA 3AMYA 3FAAA 5B0XA 2PVYA 4QPSA 5F95A 4EC9A 4QO9A 3QA0A 2R4BA 3ORMA 3RAKA 2C6EA 4HCTA 2JGZA 2W7XA 1OKWA 4I93A 3TV4A 4ZSLA 5DMZA 3R73A 4DHFA 1IA8A 4ALVA 3FKNA 4GU6A 4AA0A 4I23A 4RVKA 4B4LA 3CD3A 5IDPA 2XCKA 1P4OA 3A99A 4ZJJA 5TKDA 3TKUA 4D2SA 2YJSA 4S2ZA 3BYUA 4FSZA 3VWAA 4CT2A 2OICA 5AR3A 4OUCA 3IW7A 3DJ5A 4JI9A 4U40A 4MHAA 4CRSA 4UMRA 4ANQA 4WG4A 4FT3A 4IZAA 2WB8A 3A61A 3NR9A 5KZIA 3R2BA 3ATTA 4FTIA 4I0TA 3F9NA 5CSPA 1ZOEA 4F7LA 4JOAA 5C8KA 3UIMA 3P7AA 3EMGA 3I0OA 3MH3A 5HCXA 3WZUA 4DEGA 3KQ7A 5AUUA 2WMUA 1ZOHA 3RINA 5GIOE 4CZYB 2WPAA 3L9MA 4ZXTA 4RRVA 3F88A 4FUXA 4YZBA 3GEQA 3GC8A 4W8EA 4BWKA 4QMXA 2QR7A 4UYNA 5KNJA 3D2IA 3PA5A 4XG7A 3FXXA 3FPMA 3ID6C 3IW8A 4TNDA 1OBGA 3VJOA 5CX9A 2WAJA 4FVPA 4YLKA 4FF8A 4DA5A 3FKOA 1PY5A 4O86A 2O3PA 4FE2A 3ZFYA 1KE7A 4WHZA 2WIHA 2HY81 3L8SA 3V51A 2P3GX 2CN8A 5FEQA 4FV8A 5GHVA 4LGGA 3NS9A 4L3JA 2OIQA 2QOOA 2XNBA 3IDBA 2RF9A 3AGLA 3LXKA 4UXQA 5DWRA 3KXHA 3SOAA 3NCZA 4E5BA 4KS8A 3E7VA 2IN6A 3OOMA 2YABA 4MD9E 4RVTA 5CQWA 1FOTA 2PL0A 4IMYA 3UOHA 5HBJA 1HCKA 4Z16A 5FDXA 3ZM9A 4FV1A 4DH8A 2GMXA 2PMOX 4J52A 5J7HA 3IKAA 4QP2A 3TCPA 3ZYAA 5K9IA 3FC2A 3SAYA 4IB0A 1PF8A 1YRPA 5LWNA 2GTNA 1QL6A 1W82A 2P0CA 3PRFA 4LGHA 5HG5A 5IG1A 5FM3A 5AADA 2E9NA 5IPJA 3BPRA 4L46A 5LWMA 4UB7A 1OIUA 1YDTE 3R21A 5BVWA 5E8SA 4WG5A 4L7FA 3RWQA 4M84A 3LPBA 4UZDA 1XKKA 1ZYJA 3K3IA 3Q2MA 1W8CA 2Z7LA 5ETIA 5FBOA 3OEFX 3IS5A 4KA3A 2YM4A 2YEXA 3KXMA 4KIOA 3MWUA 4QTEA 4HVIA 2WIPA 4G6LA 4FKOA 3S2PA 3FMMA 3MIYA 3R7EA 5DGZA 4C3PA 1P5EA 4RX8A 4F65A 4RJ8A 2B7AA 4WO5A 3KXGA 2ZYBA 3ORXA 3G9LX 2C0IA 3BGQA 4NKSA 3G9NA 4FSTA 4QYFA 3ZO2A 4YMJA 2XH5A 4FSWA 4ZSEA 4WA9A 5LVMA 5CALA 3ORTA 4FGRA 1JSUA 1XH8A 3KF4A 4QMLA 4FBXA 4IZYA 4O0VA 1ERKA 3HX4A 3QTIA 5HKMA 4DH7A 4ITIA 4EJ7A 3N51A 2JBOA 5BYYA 4CT1A 4AG8A 5JFSA 1WCCA 2ETMA 3HV7A 3ORLA 2C6IA 1JSVA 1SVHA 1WBNA 3DBDA 3QX4A 4HOKA 4XOYA 3QRTA 3NYOA 4ITHA 5FLFA 4RA5A 4EH2A 2W1GA 3O51A 4F99A 4DTBA 3QHWA 1ZLTA 2WEIA 4U81A 2OJIA 5AIRA 4GMYA 2VX3A 2WZJA 1WFCA 1ZY4A 3LFEA 3MFSA 3RCDA 4C58A 4LRMA 3TT0A 4E6QA 1I44A 4EOIA 4M97A 2HZIA 3DQXA 4RPVA 3RVGA 3CQEA 3OY3A 2VV9A 3ZH8A 3A62A 3VS4A 3VS1A 3QD4A 2BZHB 4DFXE 4QMMA 4WT6A 2CKEA 4TT7A 4IWQA 5AP2A 5KMKA 4N4SA 1J7IA 3PLAE 2WTCA 4A07A 4AW1A 5CEPA 5HE3A 4PRJA 1XQZA 4UN0C 3SLSA 4DFYA 3TNWA 3EYHA 4HYHA 5HD4A 3P9JA 2V62A 4O7RA 4JQ7A 4C4FA 4KABA 2C3JA 5TO8A 5F20A 3RK5A 4YHTA 2YIRA 5BVEA 4IFGA 2Y6OA 3TKIA 3MA3A 3G6HA 4XBRA 4OTWA 1P4FA 2F57A 3DNEA 1PMEA 5AAEA 1TKIA 2W96B 3IDPA 3II5A 4R5YA 4CLJA 4KRCA 5E90A 3WZKA 1YKRA 4F0GA 4JIAA 2GFSA 2RG5A 3CCNA 3PJ1A 1FINA 3QTQA 3FYKX 1H8FA 2QODA 2XM9A 3COKA 3CS9A 4XH6A 5AV4A 1SVGA 4G31A 4M66A 3UDBA 5E8YA 3POZA 3Q4UA 3RPVA 1JKSA 4AZWA 4B7TA 3ENHA 4AW2A 1PMVA 3E93A 1XH6A 2J5EA 4PDOA 1W84A 4GG5A 2J0IA 3QYZA 4USFA 3WE4A 1NT2A 3QCSA 2YCRA 5F9EA 5KO1A 4RVLA 3WF9A 3VS3A 4ZY5A 3QHRA 5CEMA 5IU2A 2WTKB 4CMOA 2BMCA 3Q9XA 4GU9A 1WVWA 4X2NA 4K9YA 3FEGA 3R9OA 3BE9A 3UNKA 4AOTA 4D4RA 5HVYA 3GCVA 3PJ2A 3AXWA 3LLTA 2PVLA 2Z7SA 4BBFA 2QHMA 3FBVA 5CT0A 2YIWA 2YHVA 2DWBA 3LHJA 3UIBA 2C3LA 2X6EA 2UVXA 3F5UA 5EFQA 4C02A 1QCFA 3L1SA 3C4XA 2QOFA 4BTJA 5IA0A 1SNXA 4OBOA 4J53A 5GJDA 4A4XA 3TNIA 5D41A 4PMMA 1FMKA 4QOXA 3U9NA 5ANJA 4I5MA 3CE3A 4DH5A 4DEEA 4GT3A 4OTFA 5IQDA 1H0WA 4RQVA 4YNOA 2BUJA 5J8IA 4W8DA 4X0MA 3R2YA 3NAYA 4YZCA 4E5AX 2CNVA 2A19B 3LFNA 2YERA 3DAKA 3QALE 2UZWE 3D0EA 2FA2A 3UP2A 2WMRA 1R1WA 4NFMA 4FKUA 4R7BA 5CQUA 4QP1A 3Q4TA 3V5TA 3D7ZA 1H1SA 4MQ1A 3Q5ZA 4C4GA 4F70A 2ITYA 3PZHA 4O84A 1Q3DA 2UZDA 4FZFB 4P5QA 4C4HA 3VAPA 3VQUA 1G5SA 1XR1A 4FSYA 4FVQA 1H1WA 1ZMWA 3FZTA 3LFSA 2QOBA 3HLLA 2V0DA 2PMNX 3VS0A 3QC9A 3DBEA 3ZC6A 4U3ZA 3DY7A 4FT9A 4XV9A 5AUXA 3PXZA 4EH7A 4WRGA 4BCOA 3HRCA 4HZRA 4RWJA 3MH0A 3I7CA 3F2AA 2R3HA 2FVDA 4I5HA 4DCEA 3EQIA 3HNGA 3KEXA 2XK6A 4GIIA 4ENXA 1JKTA 4YHFA 5LQFA 4AW5A 4QMNA 2PZYA 4F63A 2O0UA 4U79A 2AYPA 5JEBA 4OGRA 5E7RA 4C36A 1M2QA 4CZTA 2YLEA 3GP0A 5L2QA 2FO0A 1Q5KA 1ZZLA 4K2RA 3Q53A 4X2KA 5D11A 3FLZA 3BQRA 3DGKA 4GCJA 4I6FA 4ZZMA 3RK9A 3SKCA 4RQKA 5DYJA 3CR0A 5CF8A 3KB7A 4L44A 3KXXA 4TPTA 4XLIA 4RZVA 3KMUA 1Y57A 2W9ZB 3GC7A 2J90A 3MSSA 4J98A 4K18A 1UV5A 5ICPA 1YOMA 4YZMA 3WYXA 4QQCA 3P1AA 3RPOA 4EUTA 1LR4A 2Q0BA 2Z8CA 4BTMA 4D28A 4TXCA 2OO8X 5FUTA 4PNIA 3D94A 2QURA 1GY3A 3OW4A 4F6UA 4BCHA 3U6JA 3TKHA 4EK8A 4EQUA 3MVJA 1Q8ZA 2B9IA 4D1ZA 3TNPC 4BKYA 4GSBA 4MCVA 3H3CA 2VO0A 4AZEA 5EW8A 3W2PA 2W1ZA 4HW7A 5CF4A 3QBNA 4L67A 4BTFA 4CKRA 4U42A 2JC6A 2VGPA 3FMHA 1Q61A 2OZOA 4IC8A 4ZTSA 4F9AA 2PU8A 2J4ZA 1QPEA 3ZUVA 3ITZA 3VBQA 2QO7A 2DYLA 2IW6A 3NRMA 2WMBA 4WG3A 2BVAA 3MN3A 4W4XA 3W10A 5EHYA 1U46A 3BHHA 3DKOA 2OU7A 4YP8A 3BU6A 3OWJA 3ZS5A 2GNJA 3I79A 4JQEA 3CY3A 2QI8A 4U97A 2IVSA 2XNMA 3KCFA 2VWYA 3FL4A 5BQ0A 1H4LA 1M2PA 3AT3A 3TACA 4EOOA 3D5WA 3MVLA 1H27A 2RFDA 1GIHA 2W99B 2OH4A 5EQPA 3H0ZA 4NIFB 1REJA 3VHKA 3MGYA 4NTSA 3P79A 4PTCA 1H00A 3OEZA 4EWHA 5DVRA 1G8SA 5B2LA 1V0BA 4PY1A 4FIGA 4U3YA 4BYJA 1GIIA 3U6IA 4RJ5A 2HXLA 5CAUA 3VNTA 5M57A 5E8ZA 5BYZA 4NM3A 4Q2AA 4UY9A 3RZBA 4O81A 2X6DA 4IH8A 2BFXA 1Q8UA 5CAOA 5HCZA 2CDZA 4M67A 3EN4A 2PMIA 3NW7A 4NCTC 2PUPA 4NKAA 2R3OA 4EYMA 2GS6A 4PV0A 4YJQA 4J8MA 4P90A 3R7OA 3W8QA 4E6CA 4E6AA 3ERKA 5EKOA 3PIZA 1PKGA 1OL7A 5HLPA 2H9VA 2SRCA 1ZZ2A 3NUSA 3CLYA 4FKWA 3W55A 4LOQA 4BIBA 5AEPA 4CLIA 4D4VA 2VGOA 3IO7A 4D9TA 5IF1A 4KKHA 4FODA 4PMPA 4NM7A 2HIWA 2UVZA 5HESA 2WOUA 3SG8A 4IX6A 2DUVA 4NSTA 4I4EA 3NUAA 4C4EA 4YJTA 1TQMA 1A48A 1R3CA 3V5PA 3UO4A 2E9VA 5AP7A 3FXWA 1Y91A 4QQ5A 3G33A
chains in the Genus database with same CATH superfamily
4PDPA 3Q60A 4FKTA 2PVMA 3DXNA 4J71A 5FGKA 3R6XA 3MB7A 3UNJA 5IEYA 1OIYA 3OWPA 3U4UA 4OAVB 2IG7A 5CLPA 3QD0A 5AUTA 4U43A 4AE6A 1Q41A 3NPCA 4CKIA 3F66A 3BE2A 5IQEA 4G9CA 3F5GA 4O27B 5HG9A 3TNHA 3U9CA 4ANSA 5TOZA 3U4WA 5CU4A 1OL1A 2X1NA 5CI6A 4BZOA 2WGJA 4BY9E 4B99A 4OTDA 2PULA 1W2FA 2JDOA 2OIDA 3HYHA 3Q5IA 4FGBA 5HI2A 3LCSA 4FEXA 2QVSE 1VR2A 2XALA 3I7BA 3UIUA 3EN6A 4F7JA 4O0SA 4ZY6A 3G0FA 3PXFA 3GCPA 2BRGA 1OL2A 5K4IA 5DRDA 4F4PA 2PY3A 3W0NA 4OTRA 3ZO3A 3HUBA 2R5TA 3TIYA 2VU3A 3TNQB 3OZ6A 2GS2A 3ENMA 2QR8A 3MW1A 4JR7A 2RG6A 1DI8A 4WKQA 5FXQA 3W0SA 4BDCA 3HV6A 3DOGA 4FSNA 5EKNA 3IW6A 4PDYA 4RWKA 3K3JA 1E1VA 2C1AA 3GCQA 4X7QA 3U8WA 4GKHA 4G17A 1KV2A 3VW6A 1AGWA 4MYGA 1JNKA 3QZHA 3KFAA 4G1WA 3HMPA 1BUHA 4I4FA 4D1XA 4Y5HA 5IQCA 2XBAA 3LFBA 5LVPA 4H3QA 1BX6A 5JH6A 3ACJA 2X4ZA 4WD5A 4AUAA 5HO7A 1XH5A 5BMMA 2JKMA 2C0OA 4FG7A 1B38A 1OMWA 3QGYA 4MEDA 5CANA 2QC6A 2ZJWA 2EXEA 3E87A 2QKRA 3PRIA 3QTRA 4ZK5A 3QQFA 4QMVA 5K5NA 2B53A 4QMZA 3KULA 3OUKA 3TV6A 1FVVA 3KC3A 2E9PA 4CFWA 2X0QA 3VUTA 3DTCA 4CFMA 4EWQA 4UMUA 5J5SA 2HENA 4GT5A 3HECA 5AAGA 2XK3A 1MRYA 3EB0A 3OP5A 5J9YA 4FL2A 4W4WA 2R3PA 4Z7HA 3V3VA 2IZUA 4G3EA 2RSVA 2QCSA 2VAGA 2X81A 1REKA 3W18A 5BUJA 3NFFB 3D7TB 4RG0A 4ACDA 4DGGA 2QHNA 4YJRA 2ITZA 4L7SA 3W16A 3WBLA 4RX5A 4GRBA 4JX7A 4YU2A 4QEBA 4ID7A 4G5JA 1LPUA 3R04A 4FKRA 3W0OA 5KCVA 4XV1A 1O6LA 3COIA 1CSNA 4HVHA 2QOIA 1YVJA 3EQDA 3FZSA 3QGWA 1UNHA 3QWKA 2IZRA 4HJOA 5K0KA 3BHTA 3OHTA 4NU1A 3VS7A 4DBXA 3E3PA 3TDWA 4BCPA 3F69A 3A7GA 2GNHA 3VUGA 3OWKA 4DF3A 4EOLA 3SVVA 3P08A 4AAYA 3C5IA 3ZMMA 4FZ6A 4ACGA 4IC7A 3CBLA 4JG8A 4YLLA 3UVQA 4V0GB 1W83A 4LOOA 4HCUA 5M53A 2E9UA 5DNRA 1G3NA 1LUFA 4G16A 3L9LA 4IE9A 2J2IB 4RIYA 3E3BX 4BYIA 4BDFA 4E3CA 5HNIX 1ST0A 4LDTA 1U54B 4I0RA 3GNIB 3B8RA 1L3RE 3FSFA 3HP5A 4L3PA 3NYXA 5IA4A 5CY3A 1PMNA 3QTWA 3KVWA 2E9OA 5CEKA 3K5VA 3CPCA 4JG7A 4CKJA 2Z60A 3UG2A 4LM5A 3IK3A 3JVSA 4D1SA 2HCKA 5HD7A 4HVSA 4AE9A 1F3MC 2GDOA 3MIAA 4AFEA 2NP8A 4FK3A 4C3FA 5IEVA 1FVRA 1T46A 4GYGA 1MP8A 4PL3A 3UTOA 4D2WA 2EU9A 3QKLA 4MNEA 5H9BA 3E64A 2BAQA 3O96A 1YI4A 5M06A 1OIQA 3HAMA 5JFXA 3PFYA 2Y9QA 5LOHA 3VULA 3MTFA 4KWPA 4ANBA 4F78A 4JAJA 4V0GA 4PL5A 5FP5A 1PXKA 1RJBA 1GAGA 3FY2A 3ORIA 4AX8A 3BGPA 3CJFA 1FGKA 2I7QA 2G9XA 3PY1A 2ZV7A 4AP7A 5HE2A 1FVTA 5EOLA 3FZRA 4S30A 5BUEA 3GOPA 2JBPA 4JL9A 4NFNA 3PY3A 4Y95A 3V6RA 2WELA 4FSQA 3ZLWA 3S1HA 3BHUA 3LJ0A 3OMVA 2ITXA 1UKIA 1U5QA 4JBPA 5IEXA 4FX3A 1R39A 1XJDA 3A8WA 2C5YA 4IAAA 1H0VA 2IJMA 2XK7A 4K8AA 2BDJA 4FVRA 5EM8A 1OGUA 5AWMA 2OXYA 5HX8A 3CPBA 4I1ZA 4X21A 2I40A 1YQJA 4R3RA 4FTKA 5L6OA 4MX9A 3EZVA 3ULZA 4YO4A 2HYYA 4LYNA 2JIVA 3LW0A 3PG1A 1YWNA 3R8UA 1H1PA 4M68A 3EFLA 4F09A 4KBKA 4X3FA 3LJ1A 3M1SA 5D12A 3WZEA 4BDIA 4DN5A 4DT9A 4Z3VA 1PHKA 1H25A 1ZMVA 4OT6A 5CSWA 5CZIA 3TYKA 5KKRC 2ZB0A 2EXMA 5E8XA 4EOJA 3LQ8A 3OTUA 3NUPA 4O0XA 4XRJA 2XB7A 2IWIA 4F9CA 3DKCA 3I60A 2W0JA 4HYUA 4AZSA 3ZOSA 2J0KA 4MBIA 4WNPA 1UKHA 3IECA 1QMZA 4FIFA 2BALA 3PPJA 4MF1A 4QTCA 4PPCA 5HEZA 3NVKI 4QYYA 1NVRA 1XHAA 2VWZA 5IQIA 1M7NA 3DK3A 5AP0A 5K0XA 4AN2A 3IG7A 3A4PA 2JAVA 3VW8A 3VO3A 3QC4A 1DAYA 5IH6A 3EQBA 4Q5HA 3DXQA 4IAIA 4XS2A 3R02A 4A9UA 5KBQA 3QF9A 4KIKB 1JBPE 1BI8A 4EYJA 4OTQA 3D5UA 4RJ6A 3UYTA 3ZDIA 3R8LA 3UOJA 4FV5A 3NIEA 2V22A 1P2AA 4TTHB 1VEBA 5AR8A 4FYOA 5A46A 1UU3A 5JK3A 4LI5A 3UZPA 5CAQA 3FHIA 3MH2A 4IHPA 2JKQA 3LLAA 2X8IA 2X0OA 4R8QA 4RWIA 1Q99A 2YCSA 4O7NA 2BILB 3P86A 3RAWA 1SMHA 2X39A 4HYSA 2JKKA 5EYMA 2X2LA 3FQEA 5IA2A 3R28A 3UP7A 2ETKA 2R0UA 3UYSA 3RKBA 2X2MA 1OL5A 2CKOA 2VTPA 1Y8GA 4OTGA 3BYVA 3UJGA 4WBBB 5I3RA 2YJRA 4R3CA 1IA9A 4MNFA 4KB8A 1MQ4A 5AUVA 2IVVA 2WU7A 1YWVA 3SXRA 2A98A 2I1MA 4R78A 5HQ0A 2OZAB 4HGTA 5IA3A 2OJ9A 2I6LA 4AACA 4L68A 4J99A 3BRBA 4L6QA 1YDSE 3R1NA 3NX8A 3FKLA 3KN6A 4FKIA 5FEDA 5AUZA 5IISA 4ITJA 2QOLA 1UNGA 3FV8A 4KIKA 3GOKA 4QP9A 5EM5A 5CU0A 3H9FA 4IVAA 4NW6A 5K4JA 1ST4A 5DR9A 1ATPE 3R30A 2ESMA 3A2CA 1BI7A 4U6RA 3E5AA 2ITOA 3F2RA 2J51A 4E8AA 3Q6WA 4FIIA 3S3IA 3R22A 4E4NA 3FMNA 3R8ZA 1XWSA 2C4GA 4O1PA 3TTIA 4C62A 4EH3A 3HVCA 1FGIA 1MQBA 3OUNB 3O2MA 3GC0A 3QRJA 4FV9A 4JLCA 5AR4A 4GV1A 2VTOA 4I21A 4LMNA 4G6OA 4YNEA 4XV3A 5HIEA 3TEIA 3DDQA 3UOLA 4FTUA 4FIJA 2BRBA 3PIXA 2CNQA 3M42A 4JDJA 5AUWA 1YI6A 1Z9XA 2XIRA 4QP8A 5TR6A 4R1YA 3A4OX 1Z5MA 4QP4A 2UZBA 3FWQA 4G3GA 4ACCA 4AU8A 2BFYA 4KIQA 5IQFA 3BELA 3ZSHA 3Q4ZA 4Q9SA 4YSMA 2OZAA 2ZM1A 2WQMA 3EZRA 3WIGA 4BCFA 4ZSGA 3V5LA 3FHRA 2Z7RA 3NVMB 2XANA 4D2RA 4NUSA 2C5VA 2VTQA 2C6KA 2ZV2A 2VWVA 3PPKA 4J1RA 3TTJA 2A0CX 3C1XA 3BWFA 1IG1A 3LFAA 4A9SA 5DH3A 5HLWA 4C34A 2UUEA 2UZNA 3E8EA 4BN1A 3Q9WA 3TDVA 3TZ7A 1IR3A 1YOJA 4GK2A 4FZAB 5EM7A 1TQPA 3V5QA 2JFLA 4FL1A 4FR4A 4RGJA 4EHVA 3DS6A 3N4TA 1KOBA 1GZOA 3HA8A 4DH3A 4QYHA 4CCUA 4FSUA 2R3FA 3EJ1A 4AXAA 2DQ7X 4FT0A 5IUGA 3KY2A 3BYOA 5D7AA 3ZBXA 4W4VA 3UVRA 4BCKA 3EQRA 3O8UA 3CQWA 3GFEA 3PE1A 2YCFA 4M12A 2JITA 5FTQA 3TXOA 3V8SA 4AT3A 5LMKC 3UPZA 2Z02A 2FGIA 4OTIA 2O64A 5HO8A 4RIOA 2R3NA 2OG8A 2XK4A 4IACA 2VTIA 3NNWA 1UNLA 3DTWA 3SXSA 5H3QA 5GZ8A 3D83A 4AW0A 4S32A 4IEBA 3BBWA 4YJSA 4HCVA 4MKCA 5HVJA 4DFBA 2W05A 3NW5A 4IB3A 4TRLA 2OJGA 3F7ZA 3I4BA 4YURA 4TKSA 4C4IA 3DFCB 2F9GA 4YZNA 5HG7A 1XBBA 5L8JA 5KHWA 4L52A 4EHGA 2YDKA 2XNEA 3VUMA 4MD8E 4PX6A 2YACA 2YM7A 5BVKA 5HORA 3QZGA 2BHEA 5L8LA 3FI8A 4QP7A 2BTRA 3PTGA 3AC8A 4LV5A 3GI3A 1YI3A 5G1XA 3WARA 4BGGA 5J87A 1JKLA 5GZAA 4DYMA 5HE1A 3C4FA 2HY0A 3DK6A 3MB6A 4H05A 2IVTA 2OH0E 4M7IA 2RFSA 1PXJA 2JD5A 3KRLA 4BTKA 4D2VA 4EBWA 3KXNA 3WF5A 3TMOA 3RNIA 4CFUA 3LXPA 3OCSA 3DU8A 4AZVA 4F0FA 3DQWA 5JRQA 3EN9A 1TVOA 5ANEA 5GJFA 3QRIA 4EHZA 2VUWA 4BKJA 2PE1A 3OBGA 5HBEA 4EZ5A 1TFFA 3L8VA 1WBVA 3MFTA 4KSPA 5CF5A 3QAME 4ERKA 2YISA 4BGQA 4FOCA 2J0LA 4DBNA 4XG2A 3LQ5A 4EK4A 4UWBA 4XLVA 2XAMA 4J95A 2PZRA 4N6ZA 3CEKA 4LRKA 1RW8A 4KINA 3BZ3A 3ANRA 2GNGA 4FT7A 3F5PA 5J9LA 3A8XA 4X2JA 4PF4A 3EQGA 4JIKA 1XH9A 2G1TA 3OCBA 2UVYA 3T3VA 4EL9A 4FOBA 5LVOA 1STCE 3PG3A 2BDFA 4USEA 5C01A 4O7ZA 1F5QA 3ZFXA 5E8VA 4D55A 3UZRA 5E8UA 1GIJA 2JDRA 4W9WA 3ZLSA 2YZAA 4K11A 3NMUF 3QUEA 1VJYA 2Y0AA 3BHVA 3R8PA 3UQFA 2W4OA 3UDTA 4FKGA 2ITNA 4GT4A 1BKXA 1OKYA 1L8TA 1Q62A 1S9IA 2BHHA 3FLYA 2R3IA 3G6GA 3R00A 3EYGA 4XP2A 3RI1A 2CKPA 3DKGA 3ORPA 2VTMA 2XCHA 3LE6A 2XIYA 5M56A 3ZLXA 4YZ9A 4YTHA 2UW0A 3PSDA 5ETAA 3LMIA 4QTDA 3PVGA 1GZKA 3U6HA 5AAFA 2VTHA 3AGMA 5M55A 2PZ5A 2WXVA 4UWYA 5JSMA 4IZ7A 4R3PA 3EFWA 4FTCA 3RK7A 4RFZA 3BBTB 5KMLA 3EOCA 5AX9A 4FEUA 4DGOA 3GCSA 4NCTA 1CDKA 2X9FA 5J9ZA 1UA2A 3AD5A 1PXLA 3ULIA 3UMWA 3PDTA 3V8TA 2CHLA 5CF6A 4L42A 3MS9A 3TV7A 4E1ZA 3SOCA 3EN5A 1FQ1B 3Q96A 4IBMA 2PVHA 3DT1A 3MVHA 4IAKA 4ZOGA 5CASA 2F4JA 2WMXA 1Y6BA 1OKVA 2XIZA 4PTGA 4FUYA 4Y5QA 2QO9A 4DGNA 4F6SA 3W0MA 2O2UA 3ZBFA 5L8KA 4IFCA 1JQHA 1P14A 1PMUA 3CP9A 4CG9A 2O63A 1WBOA 4GJ3A 3LAUA 2JEDA 3GENA 4AWIA 4WSQA 3B2WA 5DG5A 3QX2A 4LUEA 2HW7A 3H9OA 3PSBA 4YJVA 5FRIA 3FXZA 3W0QA 5BVNA 2XBJA 3PPZA 4FZDB 4DHZA 1H07A 1VZOA 2EB2A 3E8CA 3KRRA 5E4HA 2C1BA 4CTBA 5IDNA 2VX0A 1URCA 2KULA 5FP6A 4D0WA 5EHLA 4YGAA 3E7OA 3SRVB 2BKZA 3IGOA 4BDGA 3SGCA 2GNIA 3D14A 3ZO1A 4QMWA 3THBA 3ODYX 4PP9A 4FKJA 4DFNA 2X8EA 1DI9A 2JIIA 3B8QA 4F64A 4D4YA 1H08A 1Y8YA 3O8PA 4CQEA 4R7IA 4C59A 4EORA 4M69B 3DAJA 2YITA 5I9ZA 4GH2A 4CGAA 5FWKK 3T3UA 5CVGA 1IAHA 4ZTNA 4NK9A 4LMUA 4BDDA 4YPSA 3NDMA 5EM6A 4HZSA 5H8BA 4WUAA 4C2WA 3I0QA 3C13A 5CTPA 3DCVA 2C5NA 3FMDA 5F1ZA 2C3IB 2UW5A 2OWBA 5DT0A 3R8MA 4BWXA 5M08A 3EKNA 5T3QA 5M4UA 5JMSA 3I1AA 2I0YA 2OK1A 5LVNA 4U9AA 2R3KA 5D1JA 4UYAA 1ZMUA 4BI1A 2A4LA 3GFWA 2PE0A 1H26A 3IGGA 3QTZA 2G15A 1O9UA 2WQOA 4FNWA 2XKCA 3BX5A 3AOXA 3H4JA 4KRDA 4MTAA 4BICA 4M0YA 3ZFMA 1KE6A 1H28A 5C03A 3SRVA 4O4EA 5HNGA 4O7YA 4I3ZA 3R0TA 4DHJA 4IB1A 3BL9A 3BIZA 4HVGA 5I9VA 3VS5A 5DN3A 5EQEA 2ZB1A 4E4LA 5CU3A 4I5CA 1OUKA 2DS1A 3I6WA 1XH4A 3ORKA 1LP4A 2ITTA 2Q0NA 2Y8OA 3KF7A 5M44A 5LJJA 1PW2A 3VRYA 4JX3A 5JZJA 2RFEA 2PE2A 3O71A 4FV2A 4D9UA 4KD1A 3LZBA 3A60A 3EL8A 4KBCA 3LFCA 4BDHA 5IQAA 2R3MA 4HNIA 5B2MA 3OD6X 4IVDA 3VUDA 1J91A 2WQNA 3EFJA 2XYNA 4EH6A 2CCIA 3W2QA 4A7CA 3R9NA 3CSVA 4QTBA 2VN9A 3PVWA 4QD6A 2C6MA 2IZTA 3FI4A 5AP6A 5JRSA 4EJNA 5FTGA 2BAKA 4ASEA 3ZUTA 2H96A 4AXDA 2QOKA 3AMAA 4MBLA 4UMQA 3KRJA 4MXYA 4ZSJA 4ZTRA 2J6MA 3HV4A 4FNXA 1BYGA 4GUEA 2C6DA 2YCQA 5JFWA 4EONA 4FV0A 2XRWA 4V05A 2H34A 3DZOA 5D7VA 3RCJA 3SXFA 1SM2A 3NUNA 4BR3A 4XG9A 4OTHA 3W2RA 5FXRA 1RE8A 4UX9A 2R7BA 4AN3A 4HVDA 4ALUA 2X4FA 3FL5A 5IKWA 3TN8A 4C35A 3FMJA 4OBPA 4Y83A 1PXOA 4F1MA 5A9UA 3NIZA 3UGCA 3IOKA 4FTAA 2PVJA 2ZV9A 3KXZA 4JAIA 3ZZEA 1HCLA 3VF9A 4XG4A 3ATSA 4B9DA 4WIHA 4CEGA 5LCKA 4RFMA 4V04A 3FQHA 2ZDTA 5CU6A 4KAOA 5IZFA 3VN9A 1PXMA 2C6LA 3OBJA 5BUIA 4CVAA 2WMWA 4J8NA 4PTEA 4RZWA 2YFXA 1J7LA 3AKLA 2XRUA 4M15A 4G34A 3H0YA 3DDPA 5E91A 3ZTXA 1KE5A 4NIFA 3BLRA 5DLSA 2HZ0A 5FQDC 1O6YA 4IX4A 4ANMA 1JLUE 2BDWA 4RMZA 4BCGA 4ZY4A 3ODZX 3G5DA 5CSVA 4Q5EA 2WFYA 3R1YA 2VO3A 3T8OA 3EQCA 3RM6A 4PUZA 4QPMA 4F1OA 5HTBA 4WSYA 1MRVA 2JDSA 3NLBA 1NY3A 2QLUA 4XMOA 3GT8A 4BZDA 4X2GA 4EKKA 3Q52A 3ZEWA 4HPUE 3QCXA 4GS6A 1J7UA 2QQ7A 3KKVA 3FZ1A 1BL7A 3L8XA 2GQRA 4OR5A 2C5XA 4DT8A 2BROA 3QUDA 1YW2A 4G9RA 4O21A 4QRCA 4AGDA 4ZTHA 2PUUA 4IX5A 3LXNA 4PWNA 2YLFA 3ANQA 2UV2A 3PP1A 4WRSA 5HCYA 3IOPA 4IX3A 4AAAA 4D5KA 3BEAA 5EOBA 4U44A 1OPKA 2BZKB 2F2UA 4FI1A 5KBRA 1E9HA 1QPDA 4FMQA 5DT3A 4ZLYA 3NYNA 1SZMA 4NJDA 5KKRB 3RPSA 3OXTA 4XP3A 4DE4A 3R9HA 2WTJA 3RNYA 4R77A 1WZYA 5J5TA 3AC3A 4GL9A 4QMOA 5J1WA 1H1RA 2JKOA 2WKMA 3FJQE 4WNKA 4C8BA 3UO5A 2NRUA 3WZDA 2GPHA 2RKUA 5M4CA 3GQIA 1IAJA 2B1PA 5HGIA 4RIWB 3VUHA 5L2TA 3LOKA 5TT7A 3FC1X 2YN8A 2OLCA 2VTJA 2VX1A 2X7FA 2BRMA 3UQGA 3PXQA 2XNPA 3O7LD 4TWCA 1ZOGA 4FTLA 2JDVA 4X2FA 2IPXA 3VC4A 4FJVA 4EHEA 4BRXA 3BQCA 5KMOA 3B2TA 5C9CA 3LKMA 4AQCA 2CJMA 3OW3A 3M11A 4I92A 1YWRA 2IZSA 3RWPA 4QQTA 4ONAA 3FLWA 5I0BA 2RFNA 3OWLA 4H39A 2UW3A 2W06A 3FZPA 4LOPA 5CENA 2X0GA 3P23A 4C4JA 4TN6A 4FIEA 5BVDA 5IQHA 3F3VA 3SHEA 3AG9A 4G6NA 1I09A 2ZMCA 3F3UA 3IONA 1PYXA 4A4OA 3O7LB 2GQGA 4C0TA 3MH1A 3Q9YA 4RX9A 4KUJA 3ACKA 3LCKA 4AA4A 4JT3A 2WOTA 3LFDA 1K2PA 3MBLA 1EH4A 2XNNA 3PLSA 4F9BA 2UW8A 4U45A 4RA4A 2JFMA 3QKMA 4RLLA 2GU8A 5EDRA 5EI8A 4BB4A 2ZOQA 3R01A 4I6QA 4FG9A 3CGOA 4O2PA 4E93A 4O0TA 4BHNA 4RIWA 3C4EA 4EQMA 5I5ZA 4NH1A 5I9XA 4MXXA 3TJCA 3UG1A 3RPRA 3MESA 1QPCA 2J9MA 4EC8A 4QYGA 2WTWA 3R7IA 3VIDA 5BVFA 2W1DA 2VNYA 3P5KA 1Q4LA 3CKWA 1UU7A 5E92A 3R1QA 2VTRA 4J7BA 2J0JA 4K77A 4X6QC 5A4CA 5HU9A 1APME 3FZOA 2NO3A 1OL6A 5CEOA 2PVNA 3LM0A 4YO6A 2R3JA 2B9FA 3G15A 3W33A 1ZYLA 4H58A 4L9IA 1ZARA 4O96A 5KE0A 3T9IA 3UOKA 1WBPA 4ASXA 4N57A 3V01A 3WILA 3E8NA 3P7BA 3NUUA 5FBNC 5LMAA 3FI2A 1GZNA 2XEZA 1U4DA 4TWPA 2HOGA 4C2VA 5I9YA 5GINE 2VNWA 4CSVA 5IA1A 1Z57A 2FSOX 5DA3A 5T68A 4Q9ZA 4BJJB 2FSMX 4GYIA 3RALA 4F6WA 2BRHA 4HPTE 4PDSA 3SD0A 4ASDA 3PWDA 4KNBA 4BVUA 4IXPA 3MVMA 3MTLA 2IW9A 2A27A 4IAFA 4RIXB 2X7GA 4N70A 5DR2A 1RQQA 1Q3WA 1YXSA 2JAMA 2ZAZA 2RGPA 3G0EA 4DTAA 3R83A 4W4YA 2PZIA 3V6SA 1ZXEA 5AP5A 4AS0A 5B2KA 2HK5A 3D7TA 4GKIA 5I9UA 5C4KA 3DLSA 4IIRA 4D4SA 4YZDA 1TQIA 4F7SA 4UWCA 3MA6A 4EH5A 3NNXA 5AA8A 4JQ8A 4UMPA 4W9XA 4ERWA 3C0IA 2BZIB 3QXOA 3P7CA 4FKVA 4O0RA 4EH4A 5A14A 3FLNC 3C51A 3KRWA 1YXVA 2Z7QA 2G2HA 3BKBA 3BLQA 5CU2A 4JBQA 2QONA 4QP3A 3ZRMA 3BHYA 3E92A 4B8MA 3UQCA 4FTQA 4GFMA 2ZDUA 3PYYA 2Z2WA 4BBEA 3NUXA 5AUYA 2R2PA 2W1IA 4DEAA 4ZJIA 1PXPA 4CFNA 5IUIA 2X9EA 4BGHA 4C61A 3F5XA 3OXZA 1WBWA 5CVHA 3HA6A 3SC1A 5KX8A 3EWHA 4C33A 1WBSA 3F82A 3JPVA 1OECA 1IRKA 5BNJA 3I5NA 5AR7A 4IM3A 5A6OA 3QA8A 5L2WA 2WEVA 4D0XA 1CKPA 4P5ZA 3KA0A 3IQ7A 4RC4A 2OFVA 5CYIA 5IH4A 2EXCX 3IPHA 3Q4CA 3QRKA 4O2ZA 4U0IA 2IW8A 3ZDUA 2CKQA 3NZ0A 4MUQA 4GW8A 5CVFA 5ACBC 2GNFA 1WVYA 3ZHPC 3RGFA 4MQ2A 4YLJA 3W2OA 1U54A 3BU3A 3HDMA 3DJ7A 2JDTA 4NW5A 5A4LA 3QD3A 2HXQA 2HZNA 4GVJA 5AP3A 5CEQA 4YR8A 3DZQA 3QXPA 4FTNA 4HGSA 4J96A 4P2KA 5F4NA 3RAHA 2PPQA 3BLHA 3HV5A 3RTPA 5LMBA 4KKEA 4F9WA 3DKFA 4BFMA 4C37A 2V5QA 3QFVA 3OVVA 3JY0A 5DPVA 5EK7A 4FNZA 3NCGA 2XKFA 2XKDA 3U54A 3FY0A 3IW4A 2O65A 5LMKA 3ZCLA 5CSHA 3ORNA 2GSFA 4FL3A 1H1QA 4HGLA 3HUCA 4GJ2A 2GTMA 1GZ8A 3EFKA 4M8TA 3ML1A 4FTOA 3N4UA 2F7ZE 2P2IA 3AT4A 4MWIA 4F0IA 3PY0A 4DITA 3GUBA 3WF8A 3UC4A 2QOHA 1YHWA 3SA0A 1ND4A 1YXXA 3DA6A 4ACMA 3WF7A 2P4IA 4RBLA 4MVFA 4XG6A 5DE2A 4ASZA 4ZIMA 4MF0A 3D2KA 3ROCA 3H9RA 3QWJA 4IM2A 3N9XA 3K54A 4GG7A 4BDAA 2I0HA 3HAVA 1Q24A 1M7QA 2YAKA 4KSQA 4A9TA 4EK5A 3VHEA 4JJRA 1A9UA 5AFVA 2ONLC 3HGKA 5M4IA 3DB8A 1ZYCA 4OW8A 4MXCA 3DB6A 1HOWA 5C8MA 3UMXA 4E4XA 3ZZWA 3BV2A 4IAZA 4ZZOA 2KTYA 2ETRA 2OGVA 1W98A 2WMTA 3H30A 1JAMA 2C0TA 4Y72A 3QUPA 3C4ZA 3PE2A 5F94A 2QG7A 2V55A 3VBTA 5AV2A 4I41A 4XCUA 2P33A 2QU6A 3QQKA 1XH7A 4X6RA 3ZEPA 4BIEA 1Q8TA 1ZWSA 4O0WA 4H3PA 3NSZA 2CN5A 3PJ8A 3OY1A 3OCGA 4TYGA 4FTMA 4YHJA 2QNJA 1R0EA 3MPMA 3HKOA 4EK3A 1SNUA 4S33A 2NYAA 4YJUA 3FSKA 3KMWA 4I6HA 4ZS4A 4BC6A 4C38A 3GC9A 4YJNA 2ITPA 3VUKA 4YPDA 2GFCA 4GK3A 4CTCA 5KMNA 1OPJA 3MYGA 4FEQA 2X0PA 4FKPA 3MDYA 4OTPA 4EOQA 3PXYA 4BI2A 5K5XA 2V7AA 5HIBA 4XNEA 2XJ2A 2WMSA 4Y46A 5DEWA 5H8EA 2PHKA 4O7VA 3QRUA 2GS7A 2YA9A 5A4EA 2VTNA 4I5PA 1DM2A 1R78A 2AC5A 4XV2A 5ANGA 2PVRA 3KVXA 4Y85A 3QKKA 2R0IA 4E73A 5AX3A 2A1AB 2YM5A 2XARA 1Q97A 3L9NA 3QLGA 4MXAA 1PXNA 4AGUA 4JR3A 4ZLZA 3PZEA 1UWJA 4RX7A 5HG8A 2GQSA 4L53A 3BU5A 5IA5A 5B7VA 5A54A 4L43A 3VBYA 4AFJA 5CAVA 5CNNA 5HU3A 2PUIA 2C6OA 4O0UA 4Y73A 1NVQA 4RT7A 4RWLA 4IJ9A 4CV9A 1Q8YA 4ANNA 5LXMA 5BYLA 3O23A 4YC6A 2CGWA 1CKJA 2QKWB 3DJ6A 4FSMA 4KIPA 2EB3A 2UZVA 2QU5A 4F9YA 3AKJA 2C6TA 3PP0A 4QTAA 4E5WA 3BYSA 3EN7A 4I22A 3L9PA 4WBOA 3ZUUA 4O6LA 1ZYSA 4IDTA 2W5HA 4AZFA 3LCTA 5AA9A 3D5XA 4KS7A 3LFQA 4D58A 3VONA 3E63A 4LFIA 3KN5A 3HV3A 1IEPA 2QD9A 4L8MA 2H6DA 3C50A 3JR1A 1JKKA 3DBFA 4FT5A