4EC8A

Structure of full length cdk9 in complex with cyclint and drb
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
325
Chain Sequence
DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 tail determines the reaction pathway of positive transcription elongation factor b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 88
structure length 325
sequence length 333
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ec8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ec8A01
2WMQA 2PULA 4KBKA 4N70A 3T9TA 5E8SA 4DCEA 2W1HA 4USEA 1Q61A 5DA3A 4BDBA 2OF4A 3DB6A 3RAWA 4MXXA 5LWNA 4HPUE 4H58A 4WG4A 4JAIA 1Q41A 2BROA 2UW4A 3LCDA 4R7IA 1KSWA 3RPYA 4BZNA 4QT1A 3KN5A 4U44A 1CSNA 4WSYA 1UNGA 5KCVA 4O7WA 4PDYA 2HZIA 4K1BA 3G0FA 3OS3A 3ZFYA 1VEBA 2RKUA 4GK3A 4USDA 1FMKA 3SW4A 3LJ1A 4W9XA 4M67A 3A99A 3KRXA 4FUXA 4D28A 3EL7A 1Q3WA 3BBWA 3AMAA 4O2ZA 4XHKB 4KKHA 5CASA 2V22A 3IW6A 3KEXA 2Z7QA 3FMLA 5BYZA 3VS4A 5CAVA 2IVVA 4R7BA 2OF2A 5E90A 5GJGA 1JOWB 3S4QA 3UZPA 3NZ0A 3V6RA 3W2OA 2YIQA 3GI3A 4KBCA 2P55A 4G3GA 4F65A 4OUCA 3CQEA 4FTRA 2WTKB 4C62A 3GEQA 4OTIA 5GIOE 3DTCA 4JDKA 3R04A 2PZPA 4ZXTA 4V0GB 3ORTA 4M7IA 4MNEA 3K5VA 4HYIA 3SRVA 2C47A 5HE3A 3C4WA 3VW8A 4XP3A 1XH5A 4IWQA 5FP5A 3LCOA 2YAAA 2LGCA 4M12A 4D0XA 3ULIA 2NRUA 4UZDA 4EK6A 4W4YA 2WHBA 3WILA 3HX4A 3ZFMA 3ZLXA 4AW1A 4YHTA 3E7OA 3HECA 4MD9E 3MPTA 5DOSA 3VF9A 2CHLA 3K3JA 4O7TA 3FZOA 5ACKA 1PJKA 2OIDA 2XH5A 3AGMA 1M2QA 4W4XA 1Q8TA 3PVUA 5HTIA 1U59A 3HMIA 5BYLA 5M06A 2IPXA 2R9SA 3G2FA 3DKOA 4FSYA 4BHZA 4NW6A 5AUUA 5FD2A 3RHXA 4WNPA 3AGLA 5AV3A 3RAKA 4FT3A 4MNFA 4XV2A 5B0XA 2R7BA 1JKTA 2XUUA 3WE8A 4GUEA 5HE2A 3VUTA 3BE9A 5LCJA 3RM6A 3FMNA 5AUVA 4U79A 3RI1A 3ZLWA 3VBVA 5CF4A 3P78A 2AUHA 4WNKA 2VAGA 1H1SA 2WXVA 3L1SA 4KD1A 3VN9A 2C5OA 5I5ZA 2VWZA 2XK7A 1GAGA 5L2TA 4BCHA 3BGQA 3ORXA 4FVRA 4E6CA 4W4VA 4ZS0A 3M2WA 1KE6A 2R4BA 2BVAA 3GC0A 4FI1A 4QPMA 4JR3A 2G01A 1F3MC 4RQVA 2LAVA 5JSMA 3LMIA 4C38A 3ORIA 4O7ZA 2ZYBA 1VJYA 3Q9XA 4D2WA 3R9DA 2R3PA 4LRJA 4ANQA 2HZ0A 3KA0A 3ODZX 5E8VA 3CJGA 4O0XA 4DE4A 4CFWA 4DGNA 4NUSA 1E1VA 1OMWA 3NUPA 2J0LA 3A7HA 3DQXA 5JZNA 4BBMA 1VYZA 2W05A 4YO4A 3KULB 5HIDA 1H1WA 3KRJA 2IJMA 2XNMA 3G0EA 3KXHA 2WMWA 4MYGA 4P5QA 5EYCA 4Y46A 5HNIX 3H9OA 4FKWA 3VUHA 4CFUA 4DFNA 3CQUA 3CQWA 4I0SA 1MUOA 1V0BA 3Q4UA 1Q8UA 4TWOA 3KREA 2FO0A 2PE2A 5AWMA 4MHAA 4WRSA 4S2ZA 3ERKA 4MXAA 4DLIA 4DT9A 1Q5KA 3PXQA 3DBCA 4AZFA 4FV1A 3V5LA 2GHLA 2W1EA 3K5UA 4J95A 3A4PA 4C8BA 4ZSAA 2NO3A 2FB8A 5LMBA 4IVCA 5I0BA 2WEVA 4E8AA 4QD6A 3Q9ZA 2W1FA 2JKMA 3FQSA 4HVSA 3U6IA 3EYHA 2WQNA 4FA2A 2GDOA 1ATPE 3FMDA 4KIOA 5LVOA 1CKIA 5DYJA 1NY3A 2CGVA 2W96B 3IOPA 3RWQA 4CG8A 2CJMA 2R3QA 4Q5HA 4AG8A 2YM7A 4FTOA 1UU3A 5FBNC 4IX4A 5IA3A 1YHSA 2OFUA 3QLGA 2G15A 1CMKE 4IB3A 4UWYA 4XG6A 4RQKA 3D5WA 3C0IA 4F70A 1W98A 2BCJA 4LUEA 5HICA 4AW5A 4NTTA 3ELJA 4BZOA 3PXYA 2PY3A 4NJ3A 4DH3A 2JC6A 2OJJA 3A7IA 1IR3A 4C3FA 3AD5A 4FBXA 4USFA 2PUNA 2PUUA 4ZIMA 4M15A 4F7JA 4I0TA 1YXUA 3DNEA 4C57A 2VO7A 3OCGA 1NVSA 2BHEA 2R7IA 4IAKA 4FV4A 3WZUA 1I44A 2QVSE 4AACA 3TUBA 5I9YA 4UYNA 5E1EA 2QOOA 2ZV7A 3VRZA 3FY0A 2UV2A 4YTFA 4ZY4A 2WAJA 3AMBA 4L6QA 4YZ9A 2REIA 3KY2A 2ZB0A 3NLBA 4EH2A 1KOBA 4K33A 4OTGA 5EYKA 1OPLA 5T68A 1PMEA 3MH2A 4YLKA 3QA0A 4G6LA 5M08A 3HUCA 2YACA 1ZYJA 3R00A 5DPVA 4L3LA 5BVFA 3LW0A 2YWPA 4QQTA 3G90X 4H1JA 1BI8A 2YABA 3R7UA 4XS2A 2OXYA 5AIRA 3ZLSA 3FL4A 2DQ7X 4N57A 4FL1A 3D5UA 3VUKA 5BPYA 1W7HA 3FC1X 4BIEA 4IDTA 4JG8A 4O91A 4QYGA 2C5YA 5AUXA 1T45A 2QOFA 5ETCA 3AT4A 4CMUA 4ACMA 1OKZA 4U43A 4ERKA 4FK6A 2ITQA 2HZNA 2OJ9A 1YHVA 2PZYA 4NIFA 4ONAA 3LFEA 4LV8A 5ANJA 5K9IA 4TYIA 5EG3A 2RFSA 4F6WA 2PK9A 3DT1A 3L9PA 3PVBA 2UVYA 5KMNA 4GVAA 2CKQA 3QGWA 5L3AA 3FYKX 5JH6A 4F09A 4UXLA 5KMIA 5M53A 4FSMA 4DGMA 4O0WA 5KKRC 2QLQA 5L6PA 4BCQA 4FV5A 3BEAA 3EYGA 3A60A 5A54A 4NCTA 2QHMA 3P23A 1IA8A 2VZ6A 3C0GA 3QTRA 4RX7A 5IQAA 5AA8A 5HD7A 4TNBA 4LRKA 5L6OA 5F1ZA 4U80A 4X3FA 4Q2AA 4Y95A 4FTMA 4FSNA 4DN5A 2X1NA 4KS8A 3RK9A 3VBYA 3G51A 4R8QA 2OIBA 4ZSJA 3PZHA 1R0EA 4FSTA 1OVEA 2QU6A 3VRYA 3PP0A 5AR8A 5AUWA 5BYYA 4MWHA 1M17A 5CU2A 1JSUA 3Q2JA 4AQCA 5J5TA 2BRMA 4CGAA 5CU4A 5HBJA 4JDHA 2PVFA 5DGZA 4D2TA 3RNYA 1HCLA 2GNFA 3DB8A 3PZEA 3PSBA 4EONA 3PRIA 3LIJA 5DH3A 1SNXA 3BQRA 3LCSA 3K3IA 2C0IA 4DYMA 4AA5A 2EXEA 4IZ5A 4EWQA 3ZH8A 3PUPA 3QX4A 5HE0A 1WFCA 4RX9A 2ITVA 4HNFA 2EUFB 3O96A 3KQ7A 3KVXA 3NNXA 4Q9ZA 1DAWA 3TDVA 2XK3A 1ZLTA 2JITA 4E5BA 4RJ8A 3LLTA 3ET7A 3QQJA 4AW0A 5HNBA 3L9NA 4KRDA 5TKDA 1Z9XA 3EFWA 2WMRA 4YURA 3FLNC 3NVKI 3C50A 2UZBA 4BCIA 3NYXA 4WG5A 4IWOA 4ZZMA 3Q6UA 4RIWA 5T3QA 4BCNA 4R5YA 2JFLA 3WF8A 4C4EA 4WRGA 3SD0A 4GJ3A 3DA6A 1GZNA 4HGEA 5TR6A 2A1AB 2PWLA 1MQBA 2JKKA 3GU7A 5I3OA 5CALA 5HBHA 5EM8A 3VAPA 3Q9WA 2VTJA 3UVRA 4BTMA 4CRLA 3NX8A 5CSXA 5GZ9A 2CMWA 4HZRA 2PZIA 2VTPA 4HVHA 5AAFA 5JQ5A 3IGGA 3EQCA 4L42A 2IO6A 1PW2A 3SQQA 3QA8A 3ZBFA 3BYUA 4CVAA 3QD3A 4GH2A 2YIWA 1PYXA 3VS7A 4BC6A 5KBRA 3NNVA 4BZDA 2XNGA 4KKEA 4I20A 4HVDA 1WBPA 4A9TA 3D9VA 2IVTA 5HLWA 4IACA 4K18A 2XK4A 2BDFA 4DGGA 2BRGA 4RA4A 4X2GA 3P5KA 5TOZA 2PUIA 3VS3A 3NPCA 1REJA 2SRCA 4C34A 5BVWA 1P4FA 2W1GA 4FSUA 3VW6A 3UMXA 2NNWB 2WKMA 2DUVA 3SDJA 2B7AA 2OZAA 1JKLA 1FBNA 2IWIA 4A7CA 4S34A 3HV3A 3O51A 4FV0A 4PP9A 5H2UA 4IAAA 4QP6A 3H3CA 3A7GA 4MXOA 2YM4A 4M69A 4QO9A 5JRSA 5HX6A 3KCKA 3Q4ZA 5ANGA 5K3YA 3Q3BA 4II5A 4RRVA 2BDJA 3I7CA 3VS5A 3O2MA 4HCTA 4MBLA 4K6ZA 3S2PA 4ZTLA 2OXDA 1UV5A 4IZAA 5EM6A 3H0ZA 4TKSA 4EK5A 4HYSA 1PXMA 4EORA 5A4TA 4GKHA 3GQIA 3ZDUA 1YDSE 4Y5HA 4CCUA 4G9RA 3G5DA 4GSBA 4E73A 4YLJA 5EKNA 3EB0A 4FYNA 5BUJA 4IHPA 4HGTA 3S00A 2RF9A 1GIIA 3EHAA 4FZAB 2BKKA 3DJ6A 3NEWA 1W83A 3Q5IA 2HENA 4JBVA 3HNGA 4N6YA 4XG7A 3PPJA 5LMAA 4ORKA 2EB2A 3OWKA 4J98A 4F1MA 4ZJIA 4E4XA 4A9UA 4DEAA 4EH9A 5DR6A 3ZO3A 3A4OX 4CTCA 3R9HA 4KSPA 4QYHA 3RTPA 1MRUA 1O6YA 5K5XA 4O86A 2CCIA 3LFSA 4N6ZA 2C5NA 5GHVA 2BRHA 3DGKA 4GCJA 4KIPA 3M42A 3MTFA 3V3VA 2VTAA 3L8SA 3NDMA 3CEKA 3FMKA 4FTAA 4CFFA 4AU8A 3D0EA 3NYNA 2E9PA 4WUAA 4PMMA 5C1QB 5KMOA 4UEUA 4AGUA 4PL3A 3ORPA 4U42A 3FMHA 3UO4A 5KNJA 3SG8A 2AYPA 4BGQA 4HJOA 4PDPA 3NIEA 3ANRA 5EW3A 3UODA 5LOHA 1L3RE 3AQVA 1SM2A 1OPJA 3PJ8A 4ITJA 1VZOA 2UVXA 3Q6WA 5FRIA 1FVTA 4FTLA 3HV7A 4EHZA 3GXLA 2CLXA 3ZLYA 3MJ1A 2ERKA 4O7NA 4PMTA 5H9BA 3IW4A 4FKIA 3UP7A 4EUTA 5JN2A 2X4ZA 4BRXA 5ANDA 2Z02A 1XO2B 2RG6A 4FKSA 3GCSA 5E8XA 3KMUA 4DBNA 3MPAA 3F2NA 3VBXA 4DFBA 3QCXA 4FR4A 1BYGA 4WD5A 4O0UA 4XOZA 4G5JA 4WIHA 5FEEA 2XIYA 2GFCA 4DC2A 3BHUA 5DN3A 4UX9A 4AT5A 3MB7A 4YUQA 2R0UA 3GBZA 4AGWA 4ZZOA 3QUDA 5AIKA 4JRNA 2H8HA 3KL8A 4NK9A 3KCFA 4XUFA 1OZ1A 5L4QA 5I4NA 3BYSA 2R3LA 5IUGA 4ZP5A 3ZONA 5LVNA 2QO9A 4FZDB 4ENXA 2AC5A 2Z8CA 2ZV8A 3NGAA 3V51A 4BCKA 3L8XA 3OWJA 5HG9A 4FV2A 2B9FA 3IG7A 4LRMA 3BHYA 4F9BA 5IISA 2OGVA 2YDIA 1GJOA 2GNIA 4KS7A 2YIXA 5ETIA 4FL2A 5BVKA 3G6GA 4E3CA 3ODYX 3IDCA 2CLQA 4BY9E 2UZNA 1HCKA 3EKNA 4ARKA 2FYSA 4JJRA 5HCYA 2VWUA 2XK8A 4HYHA 3CSVA 3VUGA 2J90A 2QODA 5L2SA 2KTYA 5CI6A 4AT3A 4L44A 3COIA 4EUUA 4V0GA 3KRWA 4Y73A 1TQPA 3MH3A 3CE3A 2FSTX 3FSFA 4KIKA 5CU3A 4CQEA 2PU8A 3GU8A 4U3ZA 3EMGA 4KAOA 4ZTHA 1HOWA 4JQ7A 5H8BA 2RFNA 5D11A 3V04A 1ZY5A 2Y4IC 4Z9LA 4K77A 1YKRA 4V04A 4FKLA 2C0TA 1PXPA 3BYVA 4O81A 4Z7HA 1RW8A 5FUTA 2CGUA 4DEBA 4HGSA 1Q99A 3IGOA 5B7VA 3U51A 4P4CA 1BI7A 3H30A 3R83A 2PMIA 2C6KA 4F6SA 4O0RA 2V7AA 3KN6A 4LOPA 4IMYA 2ZJWA 2FGIA 3OEZA 3W2QA 4CEGA 1S9IA 1FPUA 4FSRA 3AG9A 1VR2A 3FE3A 2YLEA 4MX9A 3WI6A 3F3TA 2Z2WA 2GNJA 3CBLA 3HRCA 4YZBA 2YM3A 3DOGA 3EKKA 4IB0A 4QMZA 3ZUVA 5TT7A 3SV0A 5M44A 4CD0A 2R0IA 1J7IA 3KGAA 3UYTA 3UP2A 4WBOA 3W8QA 1LR4A 3PG3A 4CZYB 1OBDA 1YOLA 2WO6A 4FNXA 5B2MA 5HZNA 3LVPA 3MI9A 3PXRA 3KC3A 5FXRA 1UNHA 2I6LA 2I0HA 3E8EA 4FV7A 2W9FB 3VJOA 2YM8A 1SNUA 1UKHA 4N4SA 2ZMDA 4OTPA 4WG3A 5AP2A 5LCKA 2F2UA 3UC3A 3W8LA 5LMKC 3DY7A 2B55A 3ORNA 1Y6AA 3IW7A 4G2FA 5DLSA 2PVMA 3AD4A 2P4IA 3QWKA 3E64A 2A0CX 3QTXA 3G33A 3ANQA 4PP7A 4LM5A 4GT4A 2BTRA 5ANKA 3QTIA 4L7FA 2VWYA 5G6VA 1V0OA 3LM5A 2W4OA 3IK3A 4YPSA 2YN8A 1J3HA 3QHRA 4FOBA 2ERZE 4CNHA 4EH5A 2XM9A 3Q4CA 4PRJA 1Q97A 2Z7LA 1OIUA 3V8TA 4DCAA 1P2AA 4L3PA 2A19B 1ZMWA 3PYYA 4BDIA 5HU3A 3GUBA 5EYMA 3BU5A 4RWLA 4MQ1A 2W1IA 3DDPA 4C2WA 1U54B 4NWMA 4DEIA 5BUEA 2VNYA 4KA3A 2WMBA 4ANBA 2GNLA 5AP4A 2ZB1A 3BQCA 4O21A 4AXAA 2CGWA 5IH5A 4FE2A 1Q8YA 1UU9A 3HL7A 5DEYA 4BCMA 3QKMA 2X9EA 1UWHA 5TF9A 2FH9A 4JT3A 4MF1A 2HIWA 5CT0A 4JI9A 4DAWA 4QP4A 5CEMA 5CS6A 2JKOA 2J5FA 5EDRA 5EI6A 2CNQA 4Z16A 2UW6A 1OIQA 4YJQA 4DEGA 3F3ZA 4DF3A 1H4LA 2JAMA 5J7HA 4MWIA 2YCFA 4TNDA 4KRCA 4M66A 3R2YA 4PNIA 4DLJA 4WOVA 4E93A 2J6MA 2Y8OA 5GZ8A 2J0JA 4BDFA 4RVMA 3P79A 1S9JA 5AP5A 1V0PA 3ZBXA 3NVMB 4X2JA 3AC2A 4A4XA 4QMQA 2ACXA 2PMOX 5AV2A 5KMMA 2H6DA 3U9NA 5CAOA 2WU6A 4EK4A 4JS8A 3LQ5A 3JVSA 3WE4A 4I21A 3DAJA 3I5ZA 1ZMVA 3F66A 3R9OA 5HOAA 2OXXA 1OITA 4GL9A 4YJUA 4F9YA 4G6OA 3UTOA 5CAUA 2ITYA 3LOKA 2JAVA 3UPZA 1SVGA 4FT7A 5AX9A 4BKYA 3Q60A 4XEYA 3RPOA 4O1PA 3BZ3A 1PXOA 1M7QA 4OGRA 4YJTA 4D9UA 5EW9A 4C0TA 2J5EA 4F64A 4HW7A 5JFWA 3O8PA 5E8YA 5IEVA 3R9RA 5IQGA 3JUHA 2BILB 4YU2A 2BAKA 5JGAA 3KMWA 4J7BA 5CNNA 2WQBA 1GOLA 4G31A 4QP8A 4ZTMA 2BMCA 4L53A 3SC1A 2ITPA 1W8CA 1OKWA 3ZRLA 4GVJA 3GQLA 5M07A 3ZSGA 4WO5A 4K2RA 3FHIA 1PF8A 3E7VA 4XV9A 5JEBA 5CSHA 5K5NA 3P08A 4I6BA 5CQWA 3U6JA 4H3BA 5A3XA 4TT7A 3I60A 4Z55A 2C4GA 3HAMA 2ZM1A 4GIIA 5EFQA 2ITTA 5D1JA 3Q9YA 4RVTA 5I3RA 1WZYA 5LVLA 2ZM4A 4YHFA 4CT2A 1GIHA 1H01A 2YITA 5JGDA 3GCPA 3DZQA 4QNAA 2QD9A 2X7GA 3KXZA 2IW6A 1K2PA 2Y4IB 4YC8A 4YSMA 4I23A 3FY2A 1ZZLA 2OBJA 5E8WA 5HD4A 3HDNA 3MA6A 3DLSA 3IO7A 3WYXA 4CYJA 3HDMA 3MIYA 3HP2A 4QP2A 5DMZA 4ZTRA 3DXPA 3RGFA 3EOCA 2XNOA 3VNTA 2GQGA 4FTQA 5IEYA 5K0XA 2UW8A 4BI2A 4UMPA 3EN9A 4QMUA 4BVUA 2GTMA 1JKKA 3UZRA 2A27A 2X2LA 1H0WA 1Y6BA 4CG9A 2H34A 3GFWA 5FEDA 4X7QA 4EH6A 5FTOA 4OTHA 3R30A 2PSQA 2ZV2A 1V1KA 1OECA 3FC2A 2RGPA 4LMUA 4S31A 2VX1A 4FKOA 4RIYA 3MGYA 2ONLC 4IM3A 4O6EA 4YNOA 3RNIA 3U9CA 1GZOA 3PE2A 4QMSA 4C4JA 2VWIA 2YCSA 4FIGA 2QOBA 1GZKA 3ZZEA 4B6LA 2V55A 4L46A 1FMOE 3AOXA 4B8LA 3ETAA 4BCGA 2G9XA 3ZUTA 4NU1A 4EBWA 2IZSA 5EYDA 3R7VA 4G1WA 3FHRA 3L9LA 3MDYA 2VX3A 5A6OA 4XCUA 4RSSA 2B9IA 2UZWE 5IQIA 3DV3A 3DKGA 1TKIA 4D1ZA 3WF6A 3CLYA 4FKQA 3RWPA 2VGOA 4PTGA 1IEPA 2R64A 3NNUA 2YERA 1QPCA 2OG8A 3QCSA 2GQRA 2OJIA 5JK3A 5C9CA 4U5JA 3HAVA 2IZTA 2WMVA 5AM7A 3AT3A 4RVKA 4FNZA 3PY1A 4L8MA 3LFDA 3GFEA 1J91A 4IVAA 4IM0A 3WF9A 3QFVA 3COHA 4RWJA 5A4EA 4NZWB 1YDRE 2J0MB 2YM5A 4HVGA 5LVMA 5IUIA 3MFSA 3V5WA 2HW6A 3KRRA 2W4JA 3QX2A 5J5SA 1G5SA 1A06A 3D14A 3BELA 2V5QA 4BDDA 3PA4A 1OI9A 5CEPA 4DINA 1AQ1A 1XWSA 3LMHA 4NL0A 3DNDA 4GYIA 4GUBA 2JDVA 4JX3A 3ZRKA 1BKXA 4C4FA 2HOGA 3JVRA 3PXFA 2XVDA 2Y0AA 5CF6A 4I4FA 5HCXA 5GIPE 2XKCA 3PIYA 3QD2B 3LCTA 2VRXA 3AC4A 4M3QA 3N51A 3LFFA 4NKAA 4BDJA 5C4LA 4UY9A 5H3QA 5HTCA 3ZFXA 4FTIA 1OKYA 3VHEA 4BCJA 5BUIA 4BYIA 3B2TA 2R5TA 1M2RA 3OXIA 5M4IA 3OZ6A 2QOIA 1J7LA 4H05A 1JSTA 3EJ1A 3OWPA 4GT3A 3BV3A 3MVLA 1ZOEA 4RFYA 5T6KA 5EOBA 5AAGA 4G17A 3RPRA 2Z7RA 4A9SA 5J1WA 3PRFA 4H1MA 4HNIA 4XG9A 4BWKA 3C7QA 4NFNA 4OTFA 1PXKA 3LXLA 4J52A 1YXSA 3O71A 4QRCA 5CTPA 4ASZA 4FIEA 3RJCA 5D10A 4CV9A 5KBQA 1CM8A 5JKGA 3QC9A 4ASXA 3DJ7A 3DJ5A 4JQEA 3TJDA 4H39A 3BV2A 4NT4A 4OR5A 4LFIA 4UWCA 5DT0A 4X6RA 4IX6A 5BMMA 3U8WA 2WTVA 4B9DA 2B4SB 3MB6A 5DNRA 3TNIA 3AC1A 4GIHA 1XJDA 5AMNA 4AX8A 2W06A 3RZFA 3ZM4A 3ALNA 2BHHA 2WMTA 4RGJA 4Y72A 4IAZA 2VTHA 5JFXA 3RALA 4JDJA 4LL5A 4M8TA 1KOAA 5EM5A 3VS0A 4EOMA 3E92A 4AA0A 2W17A 3FQHA 2VTNA 3TZMA 3QLFA 5KUPA 5EQPA 1UNLA 2QCSA 3F5PA 3FZ1A 2R3FA 1YRPA 3KF4A 4YJVA 2PVYA 3W32A 4CT1A 4C36A 1BX6A 3RPVA 3KRLA 3V5JA 4AOJA 2OZOA 2VGPA 1TQIA 3GB2A 5DWRA 4F6UA 1RDQE 4V05A 1BL7A 3ZO1A 1XH4A 2QQ7A 4NJDA 2XA4A 5HEZA 4ZEGA 5BNJA 3LLAA 2UW5A 4TYEA 5J9ZA 2EU9A 2WOTA 3ZO4A 2P2HA 1J1CA 1E1XA 2R3HA 3NSZA 3W2RA 4ZAUA 3R6XA 3R02A 4EZ3A 2JIVA 5FG8A 3MFRA 2BUJA 4KUJA 5FM3A 4BI1A 3N4VA 2OH4A 3ZOSA 2PPQA 3H10A 4IZ7A 3F2RA 1GIJA 3CXWA 1M52A 2KULA 2ZOQA 3FMEA 4JRVA 4PL4A 5CVGA 3R2BA 3TJCA 4E6DA 5DFPA 5IDNA 1OB3A 3O8TA 3NW5A 5ANEA 4Y8DA 3T9IA 2E2BA 3BU6A 2WIPA 2ITUA 3MVHA 3QTQA 4JBPA 2JIIA 4MCVA 4QYYA 3LFAA 5CWZA 2WD1A 3U6HA 1ZMUA 1T46A 1H8FA 5CSWA 1WBVA 3HRFA 2YZLA 1FVRA 4G5PA 5I9WA 2WQMA 1PMNA 4I5CA 1W0XC 3RPSA 5CEOA 5J1VA 3GP0A 4O82A 5J8IA 2X9FA 1OBGA 4X2KA 2WIHA 3E3BX 4YZMA 2WTCA 1YHWA 3D7TB 4PMPA 4R78A 3POZA 5C27A 1XH8A 4D2PA 3TNWA 3BI6A 4FK3A 3NUYA 5AR5A 4FVPA 4IH8A 4DBXA 2GTNA 3MWUA 4TRLA 4RIXB 1B39A 2P0CA 3TKIA 2F7XE 4AGDA 3EN7A 5JFSA 1SYKA 1DAYA 4LGGA 4QOXA 3DK7A 4N0SA 3COKA 4E5WA 3FBVA 4G3CA 3VWAA 3MY0A 5CAQA 2QG7A 1U5RA 5DR2A 3R71A 4K0YA 4F99A 4OTDA 3CKXA 3GT8A 4XRJA 4FYOA 3FXXA 4IB1A 4F7SA 2CSNA 1UWJA 3GGFA 4R5SA 4YO6A 1RJBA 3DLZA 2XBJA 2YZAA 2BDWA 1DM2A 3OC1A 2XIKA 3ACKA 5M09A 3CS9A 3OF0A 2CN5A 4P5ZA 5E91A 5HU9A 2CN8A 5KMKA 4U45A 3PE1A 4BGHA 5IDPA 2B1PA 4ACDA 2WQOA 4IANA 3UVPA 4HVIA 5HIBA 2BZJA 5E9EA 4MNEB 5EI2A 4AA4A 2O5KA 2QLUA 1U46A 1TVOA 3PSCA 1FVVA 4E4LA 4IB5A 5C8NA 3V8WA 5M57A 4J8MA 4KBAA 3F5XA 3R1SA 3OOGA 4WBBB 5CANA 1Q24A 5KO1A 3DBEA 3HMNA 3R8PA 4ALWA 3FI4A 4XYFA 3LFBA 5CVFA 4YMJA 3Q32A 2QKWB 4FODA 2NRYA 4FT0A 1PKDA 3QQUA 4J53A 4XG8A 4GEOA 5TO8A 2W1DA 3RVGA 2WTIA 4ANMA 3I6UA 1H26A 2F49A 4TWNA 3P7CA 1UVRA 3TG1A 4EOIA 1RQQA 1GZ8A 2XF0A 4NCTC 1PYEA 2XNEA 4LMNA 5BVNA 1H07A 3FYJX 3EH9A 4F0IA 3R28A 4EKKA 2QU5A 4M0ZA 3PIZA 4QMVA 4AFJA 4FTNA 4EH4A 4A4OA 2RIOA 5AJQA 2XCKA 3ZM9A 5BX0A 5CSVA 2QR7A 2YDJA 2VTMA 5H8EA 4BYJA 2JDTA 4YBJA 3VS1A 4EOOA 4J96A 4LI5A 3UOHA 4DEEA 2QOLA 4EJNA 3C13A 3I0QA 3C51A 3Q4TA 3FLQA 2HAKA 3IDPA 1KV2A 1XR1A 2C3KA 2RFEA 3C4CA 2ZDTA 3QWJA 5AR7A 5AUYA 3MA3A 2B53A 3T3VA 3UIXA 2IZRA 4APCA 4IC7A 3C4EA 4M13A 3UQGA 1PXIA 3NUXA 3R63A 2Y6OA 4I3ZA 3MH0A 3F69A 4B8MA 3QQGA 4BR3A 3LCKA 2JDSA 2XKEA 3GC9A 4YJRA 3ROCA 3WF7A 3COMA 1O6KA 3CTQA 4GG7A 1KE5A 1YWNA 2J7TA 2X8IA 4O84A 1TQMA 2EVAA 3TN8A 1IG1A 5E92A 3CC6A 4NFMA 4CKRA 1OIYA 3CIKA 3CTHA 4C3RA 4NEUA 2WU7A 3QRTA 2C6IA 4BCPA 1SVEA 4J1RA 3EQBA 5CZHA 3FEGA 4ANSA 2WPAA 2HWPA 3A7JA 1U54A 5IMXA 3OMVA 3NMUF 3AXWA 3GENA 2NP8A 5IEXA 4K11A 4QMYA 3BEGA 3BLQA 2EB3A 3NR9A 4I93A 4CZUA 1PMUA 5HO8A 4NYEA 2Y6MA 1OL6A 1O6LA 4RMZA 1Q4LA 4A9YA 3Q52A 3DDQA 3R73A 5FDPA 3ZCLA 3NNWA 4UWBA 2OJGA 5HVJA 4FX3A 2CKEA 4YP8A 4XH6A 4X2NA 3II5A 4EH3A 3KXMA 3U87A 2CDZA 4FKUA 2HY81 4O2PA 2C5VA 3I79A 1IA9A 3JS2A 4QMOA 3N4UA 4DFUA 1RE8A 3FKNA 2FSOX 4UALA 5A14A 5E8TA 5CU6A 4C37A 4GYGA 4BGGA 3PA3A 4QMNA 1IAHA 3WZEA 4FNWA 2VWVA 1J1BA 4ANNA 1XH7A 3LXKA 1OL5A 2QURA 4KWPA 4PTCA 3LKMA 5C8KA 2J50A 1PKGA 1JKSA 5KX8A 4MXZA 4O22A 1OL1A 4FEWA 2RG5A 3O8UA 4Q9SA 4FZ7A 4GK4A 2JLDA 5LQFA 2OICA 1Y8YA 4ZSEA 4YC6A 3ZU7A 2W5BA 5EKOA 4XOYA 4DEHA 1XKKA 1DI9A 2XKFA 3RBWA 3CGOA 5HG7A 2C30A 2O2UA 4FOCA 3TCPA 5IA4A 2C68A 3EFKA 3ORMA 4APPA 3UE4A 5JMSA 3HMOA 4LGDA 5KKRB 4RLLA 5LVPA 5M4UA 2I40A 3QRIA 2BPMA 4FMQA 3G9NA 1K9AA 3ROYA 5FXQA 3OBGA 4RJ6A 3P7BA 4X21A 2YDKA 3FKOA 4PPBA 4ZY6A 4QMXA 3S3IA 3R0TA 3BYMA 3MFTA 3O17A 4IQ6A 4QQ5A 4E1ZA 5HESA 3S0OA 2YAKA 3TDWA 3HV5A 4B4LA 5M51A 1QCFA 2XZSA 4EJ7A 3R22A 4FKTA 2VWXA 2GS6A 4RFMA 3F6XA 5IQCA 1KWPA 3FQEA 5IH4A 1P4OA 3IONA 3Q2MA 4ZSLA 2HK5A 3L9MA 4ZZNA 4DITA 1M14A 3PJ1A 3QZFA 4FTKA 3CTJA 5EM7A 1Q62A 3C4FA 3JXWA 5CXHA 3OEFX 1ZARA 3QQFA 3SKCA 3BX5A 1WBTA 4IFGA 4PMSA 5IA0A 1STCE 3SLSA 3MY1A 4FG9A 3E93A 4IWPA 3W18A 2ZM3A 4R7HA 3BLHA 3MW1A 3M1SA 4C4IA 2GHMA 3QKKA 4FTUA 3MFUA 5IU2A 3R9NA 3MSSA 3UIMA 4E7WA 4JOAA 3RMFA 3S1HA 2B9JA 3PPKA 4IFCA 3RKBA 5CEQA 5IKWA 3F3VA 4X6QC 1I09A 4EH8A 1NVQA 4GFGA 1JWHA 1QPDA 3V5QA 3QTUA 4AZWA 3QYZA 2XIXA 3FJQE 5ITAA 4FV8A 3B8QA 1Y57A 3BWJA 3FI3A 5CXZA 5EQYA 5JZJA 4LQMA 4XG3A 3I1AA 3V5TA 4FIJA 1H1RA 4GRBA 3OVVA 4W9WA 4U97A 1G8SA 2C3IB 3HV4A 3O7LD 4IVDA 4F7NA 5KMJA 3DXNA 3BU3A 4I6FA 3NYOA 4R1YA 4F0FA 3O23A 4UB7A 2UZDA 2BZHB 2W0JA 5F9EA 4DGLC 3VC4A 4EOQA 1FINA 4CXAA 4D1XA 5IF1A 2PVNA 5DR9A 4QMPA 4RWKA 2HYYA 4IX3A 2FUMA 3WF5A 4DTBA 5DEWA 1H08A 3VBTA 3I4BA 3VULA 4IC8A 4XJ0A 3LAUA 5CEKA 2VNWA 1H27A 3PWYA 1QPEA 4U9AA 4U81A 2O8YA 5DVRA 3RZBA 1ND4A 3MIAA 3C1XA 2Y4PA 3QZHA 3EQDA 4GFMA 2C6MA 2YJSA 4NKSA 5TE0A 3VQUA 5LMKA 3EZVA 2BIYA 4R3CA 2W5AA 4O0VA 5D12A 3U4UA 4FV3A 3H0YA 4FF8A 4KNBA 5DT4A 4YSJA 5JRQA 3D15A 2QI8A 3KU2A 3K2LA 3OP5A 3ZEPA 3LZBA 4YJPA 4KABA 1WVWA 4CFNA 2QONA 5DT3A 5M56A 2OW3A 3OTVA 2YCRA 3QBNA 4ZSGA 2W7XA 2C6TA 4FIHA 4GK2A 4EKLA 4GFOA 2I1MA 2UZUE 4O7VA 3I7BA 4X2FA 3EN6A 3ZSIA 2VTIA 3ZDIA 3OD6X 3QUEA 3OFMA 4OBPA 3ORKA 2WTKC 4E4MA 4NM7A 3DZOA 2VO3A 1IAJA 1JLUE 4L45A 4PQNA 3QQLA 4MH7A 2JIUA 1LP4A 3QUPA 4FGRA 2VD5A 2V0DA 4CQGA 4RZVA 3DPKA 3QD0A 5FXSA 3ZXTA 4C58A 4TL0A 1YI3A 4JBOA 3AT2A 2X6DA 4WA9A 3Q04A 2W4KA 4S33A 4AE6A 3UOLA 2UW0A 4IW0A 3E88A 4IADA 3HV6A 4MEDA 4FSWA 4DEDA 4L43A 3R8VA 4EZ7A 4EBVA 3BKBA 3KULA 4EWHA 3W1FA 4L7SA 3KFAA 3NW7A 3TKUA 5AV4A 1DS5A 2WNTA 1YXXA 4HYUA 3QD4A 3HP5A 1OIRA 4RJ4A 3GOPA 3DTWA 4L67A 5AX3A 3MN3A 4I1ZA 3IPHA 2VWWA 4I22A 3V8SA 2BALA 1ZAOA 1YDTE 2PHKA 4ITIA 4KSQA 4L68A 5EW8A 5HE1A 3W2CA 3PVGA 4L01A 4CRSA 3R7EA 4P90A 4E6QA 3CPBA 3DAEA 2PVLA 4OT6A 3D83A 4AP7A 3LM0A 3OXZA 3LJ2A 4UMQA 4WSQA 3TXOA 2ETKA 3UC4A 4BCOA 4D5HA 4KKGA 2I0VA 4TPTA 2X81A 2YIYA 5EHOA 2HXQA 3DQWA 5E8UA 2YFXA 3OT3A 4FSZA 2RSVA 3KXNA 3QTZA 4M69B 3PWDA 3TZ9A 3AMYA 2J9MA 2PE1A 4P2KA 4PX6A 4FV9A 2GS2A 2UZVA 4TYHB 3VBQA 4O6LA 3N4TA 4E5AX 4D4RA 5IQHA 3DK3A 4JIAA 4ANLA 3PVWA 3D7ZA 3L8PA 2PTKA 5HLNA 4NM0A 1ERKA 4YZNA 1PMVA 1NT2A 2BRNA 2YLFA 2OH0E 4TTHB 3UMWA 3MBLA 2OKRA 5FP6A 4IAYA 4A07A 4C59A 4O0SA 4ZLOA 4D0WA 3ZYAA 3GCVA 2JFMA 4OBQA 1U4DA 2Q0BA 3THBA 2XJ0A 4TY1A 2YHVA 3NUUA 2XK6A 2OI4X 4EOJA 5L2WA 4XRLA 5DHJA 3UOJA 3P1AA 4IIRA 3F9NA 5J9YA 2A4LA 5J95A 2OJFE 3NAYA 2C6DA 4G3DA 3C4ZA 4ASDA 1WCCA 2B52A 3KB7A 3BRBA 5CQUA 5D7VA 3H9FA 5FLFA 2UZTA 3JPVA 4JVGA 3D94A 1AGWA 5FTGA 4RJ7A 3I0OA 3F88A 3G6HA 2EXCX 3CD3A 3F7WA 3F2AA 3OCSA 2IZUA 4HOKA 1B6CB 2ITWA 1Q8WA 2OWBA 5HO6A 2J2IB 4BIDA 3RK5A 4JG7A 1MP8A 1ZYLA 4RX5A 5FBOA 3UZTA 2R3RA 3IS5A 4AGCA 4PPCA 2XNBA 4C4HA 1DI8A 5G1XA 4Y85A 3R8MA 1G3NA 3MVMA 4JDIA 3ENHA 1Q8ZA 1QPJA 3DXQA 3TTIA 5CY3A 4AZTA 4QTEA 1A9UA 5AEPA 1FOTA 3DFCB 2XCHA 1PXNA 3E3PA 3H9RA 3QTSA 2W99B 3D7TA 4WNMA 4Y5QA 5E1SA 3V5PA 4QP1A 4CFXA 1SMHA 3FZSA 3QYWA 2WGJA 5DRDA 1ZOHA 2WZJA 3LXNA 3PG1A 3ZO2A 2X8DA 5AADA 1EH4A 1R3CA 3ALOA 3NRMA 4NW5A 2JGZA 2FA2A 4RIXA 5I9UA 1H1QA 2XS0A 2RL5A 3FLWA 3TTJA 3E8DA 3QU0A 4F9WA 2R3MA 4PF4A 4MAOA 3FXWA 5AR4A 5LJJA 4S30A 3QZIA 2ZMCA 4BDAA 4BWPA 2QO2A 3R7IA 3PLSA 4NSTA 3TV4A 4FVQA 4HPTE 3ZMMA 3ZHPC 4B7TA 4MVFA 4TWCA 2WELA 3FV8A 1NVRA 3A8WA 3JY9A 1BUHA 4L3JA 5BVEA 2UUEA 4RC3A 2XNNA 2OSCA 2ITXA 4FT9A 4KB8A 3CCNA 4PL5A 4TWPA 5EQEA 4YR8A 3PTGA 3W2SA 4EQUA 3OBJA 3GC7A 4BBFA 3PIXA 4IWDA 3OG7A 5HLPA 4ALUA 4J99A 3WOWA 4EL9A 5BMSA 5KHWA 2PUPA 4U0IA 3LFQA 5CI7A 1WVXA 5D9HA 1XH9A 4JXFA 3TIZA 4RJ3A 4C61A 4QPAA 2HW7A 4PUZA 4ZOGA 4TYGA 2UZEA 5DI1A 4KIKB 5HGIA 2XB7A 4FTCA 4L9IA 2ZAZA 3HMPA 1Y8GA 3FLSA 4K8AA 3AD6A 1F0QA 4EHGA 5J87A 2C3JA 2ITOA 3NUSA 4R1VA 4RC2A 3FZTA 2CCHA 2RFDA 4EYJA 3BHHA 4A4LA 1MQ4A 3A61A 3IQ7A 3UG1A 4MXYA 2A2AA 4UMTA 3LJ0A 5F95A 3FI8A 3BHTA 4GKIA 4ZTQA 4UBAA 5DBXA 5E8ZA 1IASA 2QO7A 2I0YA 2UVZA 4JR7A 3HRBA 4M97A 3CJFA 3ORLA 3QRUA 4J71A 2ETRA 3OT8A 4FKPA 4Z3VA 2XRUA 2JBPA 3MJ2A 1Q3DA 2VTLA 4FEVA 1ZY4A 4XV3A 3LXPA 4GMYA 4LGHA 3SXSA 1B38A 4MBJA 1H0VA 3W16A 4D4SA 4EH7A 3KF7A 2XKDA 4O96A 4G6NA 4LYNA 3H4JA 4RC4A 3VO3A 3TI1A 3GC8A 2ESMA 1UA2A 4BKJA 5AV0A 1J7UA 4JAJA 3SHEA 3LFCA 3AC8A 5IPJA 2X8EA 4MTAA 2X39A 1CTPE 1NW1A 2B54A 4AW2A 3FPMA 3MTLA 5HCZA 3VS2A 3A2CA 4C4GA 5D41A 5A6NA 4GG5A 2PVHA 4DFYA 4EC8A 1NA7A 4D4YA 2GQSA 4WT6A 3D5VA 3G9LX 5I9XA 3TL8A 4I5PA 2GFSA 3R1QA 4IEBA 3R8UA 4BB4A 4HCUA 2ZDUA 5E4HA 4BHNA 3P0MA 2GPHA 4FTJA 3UIUA 2R3GA 5GINE 3FWQA 2VTSA 5EHLA 2YA9A 3KXXA 3FMJA 3ITZA 1WBNA 3BGPA 3ZS5A 3R8ZA 4QQJA 5D7AA 3OY1A 4ZY5A 1M2PA 3MPMA 3P9JA 3HZTA 3LHJA 5E7RA 2XEYA 4UZHA 4CKIA 1PXLA 3JY0A 2G2IA 1YXTA 4U8ZA 4YPDA 5AUZA 2OK1A 3VIDA 2XJ1A 2Z7SA 2GU8A 3ZEWA 4FKVA 4BL1A 5CX9A 5IA5A 3HUBA 4TZRA 4AOTA 4Q5EA 3GVUA 1ZOGA 3OOMA 4BF2A 5L8KA 2QR8A 2PYWA 2PE0A 1F5QA 4X3JA 4ASEA 1KV1A 5AR2A 2JBOA 1H28A 3NIZA 5FEQA 4F63A 3ZTXA 4YJSA 4BI0A 4LOQA 5B2LA 3QALE 4G16A 2X6EA 2BAQA 2J4ZA 3QQHA 1P14A 3Q5ZA 5HG5A 4EQMA 4F7LA 4ZS4A 3A8XA 2AC3A 4F4PA 4O27B 2C69A 2WMAA 3LE6A 4FL3A 2WMUA 1UU8A 3WBLA 5L8JA 4QMWA 3S95A 3I81A 3EFLA 4O7LA 4F0GA 4JX7A 5ANIA 4AZVA 2O63A 3QCYA 3LFNA 3QCQA 4D58A 4E26A 1A48A 1Z57A 4XX9A 1SZMA 1MRYA 4WHZA 3I5NA 2CGXA 2E9OA 5LWMA 4QMTA 4M84A 5AP6A 2J0KA 3OY3A 3C9WA 2NPQA 3EQFA 3AC3A 3UDBA 4OT5A 4BCFA 4F08A 1JVPP 3U55A 3TV7A 5F20A 4XP2A 3WZJA 1LEWA 5A4QA 3TKHA 5HTBA 1FGKA 4I92A 4FT5A 2R2PA 4FEUA 2WOUA 3DCVA 1CKPA 3ZSHA 3HEGA 4CTBA 3EQGA 3GU4A 4PY1A 4AT4A 3FI2A 2F9GA 3IDBA 5CEIA 2C0OA 4O7SA 1JPAA 3NAXA 2BZKB 1QMZA 3FDNA 3EIDA 3HA8A 4RFZA 5B2KA 3IW8A 3NWWA 4MK0A 3OXTA 4IM2A 3VQHA 3HLLA 1YW2A 4FSQA 3F61A 4L00A 4DFXE 4DH7A 2BKZA 3MY5A 3OUNB 4RA5A 4IBMA 2I0EA 5FM2A 3RAIA 4CLIA 1R78A 4BIBA 3BCEA 4WUNA 1BLXA 4AN2A 2G1TA 2GMXA 4AWIA 3C5IA 2O65A 4ITHA 5C8MA 1KUTA 2YEXA 3OWLA 5KE0A 1YVJA 4E20A 4YTHA 4R3PA 5KZ0A 2ITZA 3W2PA 1X8BA 4AOIA 4CCBA 1ZZ2A 4V01A 5KMLA 4H3QA 2C6LA 3DFAA 3QC4A 1PXJA 5A4LA 1ZXEA 3WZDA 3FKLA 4QP7A 3F5GA 3KK9A 3HYHA 4MKCA 3ZC5A 1G8AA 2PL0A 3WIGA 1R0PA 5AV1A 4IE9A 4U3YA 1KE8A 1OL2A 2X2MA 4QTDA 2W1ZA 5J7BA 5AUTA 3PJ2A 3B2WA 4GT5A 3MYGA 4QYFA 5LARA 4ANOA 5GZAA 1ZYDA 3GNIB 1XBAA 4UV0A 5M4CA 3RM7A 2WB8A 3IECA 3QZGA 2OFVA 3F3UA 3ENMA 5F4NA 4YZDA 3SXFA 3BE2A 2C3LA 4RJ5A 4D2VA 3R1YA 4GU9A 3TACA 3TV6A 3TIYA 4I6HA 4BDKA 3C0HA 3R8LA 4C02A 4QMLA 5CT7A 3MESA 2DYLA 3FLZA 3UJGA 2B0QA 1XBCA 2GNGA 4EHEA 4QTAA 3A7FA 1WVYA 4A06A 4FIFA 4BICA 3RK7A 5A9UA 2Q83A 4Z7GA 4RBLA 3PJ3A 4R77A 4OTWA 3BYOA 4QTCA 4A9RA 2UW9A 4JG6A 3W33A 4U41A 4EI4A 4AN9A 3SRVB 4GW8A 3E8CA 1LUFA 4RIYB 2ITNA 3O50A 5CAPA 2X2KA 2QOCA 4FICA 5AP0A 4DFLA 3UVQA 2VO0A 4OAUC 2XYNA 4EOLA 1H24A 1M7NA 3FLYA 2W9ZB 2XJ2A 4IDVA 2VWBA 3N9XA 3UNKA 2QOKA 2VO6A 1OUYA 2YM6A 5A46A 4ZMEA 4XMOA 3ACJA 1XQZA 4G3FA 5GJDA 3FL5A 5EI8A 4ERWA 4XNEA 4TXCA 4IAIA 3BBTB 4CSVA 4I41A 5EDPA 3W55A 2H96A 4BTFA 2OLCA 5L6WL 4DA5A 3EN5A 4ZTNA 3V01A 4AFEA 3EWHA 2YWVA 4B0GA 4PV0A 3TWJA 3R7OA 2PVJA 4IXPA 5L2IA 4XBUA 5CENA 2JDOA 3W10A 3QRKA 4EK3A 1WAKA 3LPBA 4X3FC 5AP3A 5EOLA 4UYAA 2O0UA 3BHVA 2YIRA 4ACHA 3KK8A 4O7YA 4EZ5A 4PDSA 5DG5A 4NH1A 4AN3A 4FEXA 1KE7A 4YGAA 5DE2A 3RINA 3GOKA 2CNVA 5F94A 4HGLA 5HKMA 4JNWA 5IA2A 3P4KA 3TNPC 4YTCA 2ZVAA 4XBRA 5HORA 3VVHA 2IW8A 3FZRA 2BFXA 4EOKA 3PA5A 4D2SA 4IVBA 4D9TA 3QTWA 1APME 1OGUA 1CKJA 2GSFA 1LEZA 2WTJA 2UZLA 3BWFA 3TT0A 4ZLZA 4CV8A 4FGBA 1U5QA 1CDKA 3HMMA 5EDQA 4BWXA 4CMOA 1KE9A 5CF5A 5HVKA 3F82A 3MV5A 3SG9A 2ZV9A 4EHVA 2R3IA 3FSKA 3R1NA 5EK7A 5K0KA 3F7ZA 4AUAA 2GCDA 1YOMA 4FZFB 4M68A 3TNQB 5IZFA 1L8TA 3VUMA 3UO5A 4JQ8A 4NTSA 4IJ9A 5EH0A 2VTQA 2HWOA 4XLIA 4GV1A 3VBWA 3E63A 4CZTA 3TZ8A 2YCQA 5ETAA 2X7FA 2OIQA 1GY3A 3WZKA 4B99A 1IRKA 3TUDA 3C4XA 4F9AA 2P2IA 4R6VA 3VF8A 2BRBA 2JD5A 3QRJA 4E6AA 3NUNA 4EQCA 3RAHA 3UOKA 4QQCA 3QQKA 4MD8E 4IJPA 3E5AA 3DAKA 3OROA 3G15A 5IQFA 3ORZA 2XIRA 4MD7E 3RHKA 3SGCA 4MQ2A 5BVDA 3UQFA 4F1TA 4U7ZA 3FAAA 3Q53A 3PFQA 3SAYA 4D4VA 1YWRA 4RLKA 4DTAA 3V6SA 4O83A 4F1OA 4AF3A 5CNOA 3FPQA 3KMMA 4YBKA 4DH8A 4DFZE 4I0RA 4ZJJA 3Q96A 5AA9A 4O0YA 3VUDA 4D5KA 5DIAA 4O7RA 4EEVA 4TYHA 1R1WA 2R3KA 4QNYA 4D1SA 5GNKA 1FQ1B 3HVCA 4ZK5A 4IZYA 3NS9A 4FKJA 5JQ8A 3T8OA 4ZTSA 4UMRA 2GS7A 4U40A 3P7AA 4CMTA 3POOA 4OTQA 2G2FA 4ACGA 2GNHA 1XBBA 1O9UA 2FVDA 4ZLYA 5DRBA 4DT8A 4GJ2A 2Y9QA 4E4NA 2IG7A 3DK6A 3GU6A 3NUAA 5L8LA 2C1BA 3MS9A 4MXCA 3GCQA 2F7ZE 3U4WA 4YHJA 3VUIA 3E62A 1OKVA 3IOKA 3KVWA 1OPKA 4BDEA 4U6RA 2HY0A 5FWKK 5HO7A 3QGYA 4OAVB 2JEDA 4I4EA 2QG5A 2OU7A 3DKFA 2GHGA 2V7OA 4I5MA 4BN1A 4EK8A 3ID6C 4C7TA 3EQHA 4RT7A 4DHFA 2PMNX 3BIZA 4TN6A 4AZSA 4IAFA 3P86A 3WIKA 2XNPA 2X7OA 3NCZA 5C03A 3EFJA 4PDOA 4PTEA 3PPZA 5EHYA 1JSVA 3SW7A 2XP2A 3QAME 4FKRA 1WMKA 4YZCA 2C1AA 2EWAA 3GCUA 2VN9A 2WFYA 3FXZA 3CP9A 4F9CA 2R3OA 4G9CA 5IH6A 2CPKE 4ZMFA 3LQ8A 2IN6A 4OLIA 4RX8A 4BFMA 2PVKA 5A4CA 1AD5A 4D2RA 4G3EA 5HNGA 4BBEA 1YQJA 1Y91A 4I6QA 2YJRA 1WBOA 3CKWA 4O0TA 3ZUUA 2VV9A 5IUHA 3DBQA 4I5HA 4DTKA 2QC6A 4NIFB 3E8NA 1YOJA 5AM6A 1H00A 2PZRA 3VS6A 2VUWA 4W8DA 1E9HA 2F4JA 4QTBA 4G34A 2WMSA 3OCTA 3JR1A 3DBFA 1W84A 4FNYA 4OTRA 3ATSA 4C2VA 5HX8A 3CY3A 5H8GA 4AE9A 5CYIA 5FTQA 4M0YA 5CLPA 3ZC6A 4CFMA 3CR0A 3RCDA 3DBDA 5ANOA 3MVJA 1Z5MA 2XRWA 3D2KA 4AAAA 5K4IA 2WTDA 5IQDA 3HGKA 2JKQA 2QKRA 3MH1A 3QL8A 3UO6A 4X0MA 3KKVA 3UPXA 4QMMA 3EN4A 4H36A 4ACCA 4RPVA 2VTOA 3QHWA 3R21A 3SX9A 4ALVA 2C6EA 3OCBA 4RIOA 3SXRA 3I6WA 1BL6A 2Q0NA 4DG3E 4CKJA 3LQ3A 2G2HA 2W5HA 2YISA 4X3FB 2IVUA 4FV6A 5AR3A 4M14A 3UNJA 5LXMA 2FSMX 3ULZA 4PPAA 5C4KA 4D55A 4HZSA 5AAEA 1ZYCA 1PRYA 2E9UA 3E87A 5HVYA 5HG8A 4O1OA 1YWVA 1YXVA 3A62A 3OW3A 4NM5A 1URWA 3D5XA 1W82A 4LOOA 3EQIA 3FUPA 4LG4A 5CZIA 3ATTA 3ZXZA 1FGIA 1UU7A 4IX5A 2C6OA 3UG2A 3CPCA 1JAMA 2PMLX 4XP0A 5CVHA 4GU6A 4NM3A 3D4QA 5JGBA 4I24A 2E9NA 1URCA 2BZIB 4GS6A 3SA0A 3GU5A 3OUKA 2ETMA 3OHTA 4DGOA 4WNOA 5IA1A 2HXLA 2XEZA 4J8NA 4FEQA 2VTTA 2WTWA 1JNKA 4I94A 3QF9A 3SVVA 5IG1A 1BMKA 4HCVA 5KHXA 3RP9A 3K54A 5FDXA 3RCJA 5J79A 3OTUA 1VYWA 3D2IA 4FKGA 3PXZA 4L52A 5HBEA 3TM0A 3REPA 3PJCA 4JL9A 4S32A 3WARA 3LMGA 4XG4A 3L8VA 2B9HA 2J0IA 1UKIA 1YI4A 4LL0A 4Y83A 5IQBA 4RIWB 4P7EA 3TEIA 5IQEA 2W1CA 2XYUA 2CKOA 2IW9A 3DKCA 5M55A 2XK9A 1OM1A 3R7GA 4J97A 4QYEA 1XHAA 3HA6A 3HKOA 4LUDA 3UGCA 2H9VA 1XH6A 3F5UA 2UW3A 2O64A 2UW7A 4ID7A 4BDCA 4CFVA 5CSPA 3SOCA 3R01A 2F7EE 3BGZA 4O38A 4PWNA 1P5EA 5AP1A 2IVSA 3UQCA 4BDHA 3NYVA 5I9VA 5ACBC 2Z60A 3NCGA 4MF0A 3T3UA 4BKZA 4QP3A 4C35A 4FUYA 5L2QA 3UBDA 5C26A 2HCKA 5CF8A 4OW8A 4YLLA 4FG8A 3PY0A 4W4WA 1H25A 2WEIA 1ZRZA 1GNGA 3IW5A 1MRVA 1LPUA 5AP7A 4AZEA 2X4FA 2XIZA 4C33A 4DG2E 3B8RA 3PY3A 3SOAA 3QXOA 4DG0E 2I7QA 5BVOA 4H3PA 1WBSA 3O0GA 2R3JA 2X0GA 2JDRA 2OZAB 1K3AA 4JIKA 2XMYA 2BFYA 3PDTA 3AC5A 5IMEA 4XLVA 4FTTA 2EXMA 4RWIA 4TYJA 3DS6A 3CGFA 3FMMA 3OW4A 2P3GX 4MBIA 4BTJA 2BTSA 1H1PA 2VX0A 3UYSA 1OL7A 5FGKA 1QL6A 3JYAA 5K4JA 3ZZWA 3PSDA 3EL8A 3NW6A 4BTKA 4EOSA 3ZRMA 4YNEA 1NXKA 1WBWA 4C3PA 3UNZA 5HQ0A 2BAJA 2F2CB 2WMXA 5ETFA 4TW9A 3VHKA 4BDGA 5JFVA 4W8EA 2BR1A 4FIIA 1R39A 4RVLA 4XG2A 4YJNA 3TUCA 5HHWA 4JBQA 5JT2A 4RG0A 5AFVA 2HZ4A 2DS1A 5ICPA 1JQHA 4DH1A 4OBOA 4WKQA 1PHKA 2HELA 2PVRA 4FZ6A 4XV1A 5BQ0A 4EC9A 2DWBA 3EZRA 3PXKA 2FSLX 4EYMA 2P33A 3BPRA 4RZWA 3C5UA 5FQDC 1OUKA 1JBPE 3TZ7A 5M4FA 4ZJVA 2XBAA 4K9YA 3EQPA 3QXPA 4EOPA 5GJFA 3IKAA 4AS0A 3VJNA 3M11A 4R3RA 2UZOA 1ZYSA 4ENYA 1YI6A 4QPSA 4YTIA 3TNHA 3BLRA 4FG7A 2R3NA 4DH5A 5J9LA 2VU3A 3DU8A 5C01A 2V62A 2QHNA 2QOQA 2CNUA 2BIKB 3QKLA 3CD8A 3F3WA 5I9ZA 2PZ5A 3FZPA 4CLJA 3KXGA 3O7LB 1ZWSA 3CY2A 3UIBA 2CKPA 4KIQA 4QP9A 3EQRA 5CU0A 3U54A 4KINA 4FC0A 2XM8A 5KZIA 2VTRA 1SVHA 2QNJA 1REKA 2QOHA 2OO8X 3PP1A 4LV5A 4PNKA 2C5XA 2E9VA 2J51A 3WYYA 2F57A 4JLCA 2O3PA 4UMUA 4UN0C 1PY5A 5HIEA 2ONLA 3PLAE 2Y7JA 4UXQA 5HI2A 3R7YA 4CYIA 2WQEA 4YC3A 4YJOA
chains in the Genus database with same CATH superfamily
2WMQA 2PULA 4KBKA 4N70A 3T9TA 5E8SA 4DCEA 2W1HA 4USEA 1Q61A 5DA3A 4BDBA 2OF4A 3DB6A 3RAWA 4MXXA 5LWNA 4HPUE 4H58A 4WG4A 4JAIA 1Q41A 2BROA 2UW4A 3LCDA 4R7IA 1KSWA 3RPYA 4BZNA 4QT1A 3KN5A 4U44A 1CSNA 4WSYA 1UNGA 5KCVA 4O7WA 4PDYA 2HZIA 4K1BA 3G0FA 3OS3A 3ZFYA 1VEBA 2RKUA 4GK3A 4USDA 1FMKA 3SW4A 3LJ1A 4W9XA 4M67A 3A99A 3KRXA 4FUXA 4D28A 3EL7A 1Q3WA 3BBWA 3AMAA 4O2ZA 4XHKB 4KKHA 5CASA 2V22A 3IW6A 3KEXA 2Z7QA 3FMLA 5BYZA 3VS4A 5CAVA 2IVVA 4R7BA 2OF2A 5E90A 5GJGA 1JOWB 3S4QA 4FRFA 3NZ0A 3UZPA 3V6RA 2YIQA 3GI3A 4KBCA 3W2OA 2P55A 4G3GA 4F65A 4OUCA 3CQEA 4FTRA 2WTKB 4C62A 3GEQA 4OTIA 5GIOE 3DTCA 4JDKA 3R04A 2PZPA 4ZXTA 4V0GB 3ORTA 4M7IA 4MNEA 3K5VA 4HYIA 3SRVA 2C47A 5HE3A 3C4WA 3VW8A 4XP3A 1XH5A 4IWQA 5FP5A 3LCOA 2YAAA 2LGCA 4M12A 4D0XA 3ULIA 2NRUA 4UZDA 4EK6A 4W4YA 2WHBA 3WILA 3HX4A 3ZFMA 3ZLXA 4AW1A 4YHTA 3E7OA 3HECA 4MD9E 3MPTA 5DOSA 3VF9A 2CHLA 3K3JA 4O7TA 3FZOA 5ACKA 1PJKA 2OIDA 2XH5A 3AGMA 1M2QA 4W4XA 1Q8TA 3PVUA 5HTIA 1U59A 3HMIA 5BYLA 5M06A 2IPXA 2R9SA 3G2FA 3DKOA 4FSYA 4BHZA 4NW6A 5AUUA 5FD2A 3RHXA 4WNPA 3AGLA 5AV3A 3RAKA 4FT3A 4MNFA 4XV2A 5B0XA 2R7BA 1JKTA 2XUUA 3WE8A 4GUEA 5HE2A 3VUTA 3BE9A 5LCJA 3RM6A 3FMNA 5AUVA 4U79A 3RI1A 3ZLWA 3VBVA 5CF4A 3P78A 2AUHA 4WNKA 2VAGA 1H1SA 2WXVA 3L1SA 4KD1A 3VN9A 2C5OA 5I5ZA 2VWZA 2XK7A 1GAGA 5L2TA 4BCHA 3BGQA 3ORXA 4FVRA 4E6CA 4W4VA 4ZS0A 3M2WA 1KE6A 2R4BA 2BVAA 3GC0A 4FI1A 4QPMA 4JR3A 2G01A 1F3MC 4RQVA 2LAVA 5JSMA 3LMIA 4C38A 3ORIA 4O7ZA 2ZYBA 1VJYA 3Q9XA 4D2WA 3R9DA 2R3PA 4LRJA 4ANQA 2HZ0A 3KA0A 3ODZX 5E8VA 3CJGA 4O0XA 4DE4A 1XMMA 4CFWA 4DGNA 4NUSA 1E1VA 1OMWA 3NUPA 2J0LA 3UDZA 3A7HA 3DQXA 5JZNA 4BBMA 1VYZA 2W05A 4YO4A 3KULB 5HIDA 1H1WA 3KRJA 2IJMA 2XNMA 3G0EA 3KXHA 2WMWA 4MYGA 4P5QA 5EYCA 4Y46A 5HNIX 3H9OA 4FKWA 3VUHA 4O4FA 4CFUA 4DFNA 3CQUA 3CQWA 4I0SA 1MUOA 1V0BA 3Q4UA 1Q8UA 4TWOA 3KREA 2FO0A 2PE2A 5AWMA 4MHAA 4WRSA 4S2ZA 3ERKA 4MXAA 4DLIA 4DT9A 1Q5KA 3PXQA 3DBCA 4AZFA 4FV1A 3V5LA 2GHLA 2W1EA 3K5UA 3BLAA 4J95A 3A4PA 4C8BA 4ZSAA 2NO3A 2FB8A 5LMBA 4IVCA 5I0BA 2WEVA 4E8AA 4QD6A 3Q9ZA 2W1FA 2JKMA 3FQSA 4HVSA 3U6IA 3EYHA 2WQNA 4FA2A 2GDOA 4DHJA 1ATPE 3FMDA 4KIOA 5LVOA 1CKIA 5DYJA 1NY3A 2CGVA 2W96B 3IOPA 3RWQA 4CG8A 2CJMA 2R3QA 4Q5HA 4AG8A 2YM7A 4FTOA 1UU3A 5FBNC 4IX4A 5IA3A 1YHSA 2OFUA 3QLGA 2G15A 1CMKE 4IB3A 4UWYA 4XG6A 4RQKA 3D5WA 3C0IA 4F70A 1W98A 2BCJA 4LUEA 5HICA 4AW5A 4NTTA 3ELJA 4BZOA 3PXYA 2PY3A 4NJ3A 4DH3A 2JC6A 2OJJA 3A7IA 1IR3A 4C3FA 3AD5A 4FBXA 4USFA 2PUNA 2PUUA 4ZIMA 4M15A 4F7JA 4I0TA 1YXUA 3DNEA 4C57A 2VO7A 3OCGA 1NVSA 2BHEA 2R7IA 4IAKA 4FV4A 3WZUA 1I44A 2QVSE 4AACA 3TUBA 5I9YA 4UYNA 5E1EA 2QOOA 2ZV7A 3VRZA 3FY0A 2UV2A 4YTFA 4ZY4A 2WAJA 3AMBA 4L6QA 4YZ9A 2REIA 3KY2A 2ZB0A 3NLBA 4EH2A 1KOBA 4K33A 4OTGA 5EYKA 1OPLA 5T68A 1PMEA 3MH2A 4YLKA 3QA0A 4G6LA 5M08A 3HUCA 2YACA 1ZYJA 3R00A 5DPVA 4L3LA 5BVFA 3LW0A 2YWPA 4QQTA 3G90X 4H1JA 1BI8A 2YABA 3R7UA 4XS2A 2OXYA 5AIRA 3ZLSA 3FL4A 2DQ7X 4N57A 4FL1A 3D5UA 3VUKA 5BPYA 1W7HA 3FC1X 4BIEA 4IDTA 4JG8A 4O91A 4QYGA 2C5YA 5AUXA 1T45A 2QOFA 5ETCA 3AT4A 4CMUA 4ACMA 1OKZA 4U43A 4ERKA 4FK6A 2ITQA 2HZNA 2OJ9A 1YHVA 2PZYA 4NIFA 4ONAA 3LFEA 4LV8A 5ANJA 4QDVA 5K9IA 4TYIA 5EG3A 2RFSA 4F6WA 2PK9A 3DT1A 3L9PA 3PVBA 2UVYA 5KMNA 4GVAA 2CKQA 3QGWA 5L3AA 3FYKX 5JH6A 4F09A 4UXLA 5KMIA 4MUQA 5M53A 4FSMA 4DGMA 4O0WA 5KKRC 2QLQA 5L6PA 4BCQA 4FV5A 3BEAA 3EYGA 3A60A 3VONA 5A54A 4NCTA 2QHMA 3P23A 1IA8A 2VZ6A 3C0GA 3QTRA 4RX7A 5IQAA 5AA8A 5HD7A 4TNBA 3PUFC 4LRKA 5L6OA 5F1ZA 4U80A 4X3FA 4Q2AA 4Y95A 4FTMA 4FSNA 4DN5A 2X1NA 4KS8A 3RK9A 3VBYA 3G51A 4R8QA 2OIBA 4ZSJA 3PZHA 1R0EA 4FSTA 1OVEA 2QU6A 3VRYA 3PP0A 5AR8A 5AUWA 5BYYA 4MWHA 1M17A 5CU2A 1JSUA 3Q2JA 4AQCA 3TMOA 5J5TA 2BRMA 4CGAA 5CU4A 5HBJA 4JDHA 2PVFA 5DGZA 4D2TA 3RNYA 1HCLA 2GNFA 3DB8A 3PZEA 3PSBA 4EONA 3PRIA 3LIJA 5DH3A 3AKLA 1SNXA 3BQRA 3LCSA 3K3IA 2C0IA 4DYMA 4AA5A 2EXEA 4IZ5A 4EWQA 3ZH8A 3PUPA 3QX4A 5HE0A 1WFCA 4RX9A 2ITVA 4HNFA 2EUFB 3O96A 3KQ7A 3KVXA 3NNXA 4Q9ZA 1DAWA 3TDVA 2XK3A 1ZLTA 2JITA 4E5BA 4RJ8A 3LLTA 3W0QA 3ET7A 3QQJA 4AW0A 5HNBA 3L9NA 4KRDA 5TKDA 1Z9XA 3EFWA 2WMRA 4YURA 3FLNC 3NVKI 3C50A 2UZBA 4BCIA 3NYXA 4WG5A 4IWOA 4ZZMA 3Q6UA 4RIWA 5T3QA 4BCNA 4R5YA 2JFLA 3WF8A 4C4EA 4WRGA 3SD0A 4GJ3A 3DA6A 1GZNA 4HGEA 5TR6A 2A1AB 2PWLA 1MQBA 2JKKA 3GU7A 5I3OA 5CALA 5HBHA 5EM8A 3VAPA 3Q9WA 2VTJA 3UVRA 4BTMA 4CRLA 3NX8A 5CSXA 5GZ9A 2CMWA 4HZRA 2PZIA 2VTPA 4HVHA 5AAFA 5JQ5A 3IGGA 3EQCA 4L42A 2IO6A 1PW2A 3SQQA 3QA8A 3ZBFA 3BYUA 4CVAA 3QD3A 4GH2A 2YIWA 1PYXA 3VS7A 4BC6A 5KBRA 3NNVA 4BZDA 2XNGA 4KKEA 4I20A 4HVDA 1WBPA 4A9TA 3D9VA 2IVTA 5HLWA 4IACA 4K18A 2XK4A 2BDFA 4DGGA 2BRGA 4RA4A 4X2GA 3P5KA 5TOZA 2PUIA 3VS3A 3NPCA 1REJA 2SRCA 4C34A 5BVWA 1P4FA 2W1GA 4FSUA 3VW6A 3UMXA 2NNWB 2WKMA 2DUVA 3SDJA 2B7AA 2OZAA 1JKLA 1FBNA 2IWIA 4A7CA 4S34A 3HV3A 3O51A 4FV0A 4PP9A 5H2UA 4IAAA 4QP6A 3H3CA 3A7GA 4MXOA 2YM4A 4M69A 4QO9A 5JRSA 5HX6A 3KCKA 3Q4ZA 5ANGA 5K3YA 3Q3BA 4II5A 4RRVA 2BDJA 3I7CA 3VS5A 3O2MA 4HCTA 4MBLA 4K6ZA 3S2PA 4ZTLA 2OXDA 1UV5A 4IZAA 5EM6A 3H0ZA 4TKSA 4EK5A 4HYSA 1PXMA 4EORA 5A4TA 4GKHA 3GQIA 3ZDUA 1YDSE 4Y5HA 4CCUA 4G9RA 3G5DA 4GSBA 4E73A 4YLJA 5EKNA 2XARA 3EB0A 4FYNA 5BUJA 4IHPA 4HGTA 3S00A 2RF9A 1GIIA 3EHAA 4FZAB 2BKKA 3DJ6A 3NEWA 1W83A 3Q5IA 2HENA 4JBVA 3HNGA 4N6YA 4XG7A 3PPJA 5LMAA 4ORKA 2EB2A 3OWKA 4J98A 4F1MA 4ZJIA 4E4XA 4A9UA 4DEAA 3O5AA 4EH9A 5DR6A 3ZO3A 3A4OX 4CTCA 3R9HA 4KSPA 4QYHA 2X0QA 1MRUA 1O6YA 3RTPA 5K5XA 2CCIA 4O86A 3LFSA 4N6ZA 2C5NA 5GHVA 2XALA 2BRHA 3DGKA 4GCJA 4KIPA 3M42A 3MTFA 3V3VA 2VTAA 3L8SA 3NDMA 3CEKA 3FMKA 4FTAA 4CFFA 4AU8A 3D0EA 3NYNA 2E9PA 4WUAA 4PMMA 5C1QB 5KMOA 4UEUA 4AGUA 4PL3A 3ORPA 4U42A 3FMHA 3UO4A 5KNJA 3SG8A 2AYPA 4BGQA 4HJOA 4PDPA 3NIEA 3ANRA 5EW3A 3UODA 5LOHA 4QEBA 1L3RE 3AQVA 1SM2A 1OPJA 3PJ8A 4ITJA 1VZOA 2UVXA 3Q6WA 5FRIA 1FVTA 4FTLA 3HV7A 4EHZA 3GXLA 2XAOA 2CLXA 3ZLYA 3MJ1A 3P5JC 2ERKA 4O7NA 4BJJA 4PMTA 5H9BA 3IW4A 4FKIA 3UP7A 4EUTA 5JN2A 2X4ZA 4BRXA 5ANDA 2Z02A 1XO2B 2RG6A 4FKSA 3GCSA 5E8XA 3KMUA 4DBNA 3MPAA 3F2NA 3VBXA 4DFBA 3QCXA 4FR4A 1BYGA 4WD5A 4O0UA 4XOZA 4G5JA 4WIHA 5FEEA 2XIYA 2GFCA 4DC2A 3BHUA 5DN3A 4UX9A 4AT5A 3MB7A 4YUQA 2R0UA 3GBZA 4AGWA 4ZZOA 3QUDA 5AIKA 4JRNA 2H8HA 3KL8A 4NK9A 3KCFA 4XUFA 1OZ1A 5L4QA 5I4NA 3BYSA 2R3LA 5IUGA 4ZP5A 3ZONA 5LVNA 2QO9A 4FZDB 4ENXA 2AC5A 2Z8CA 2ZV8A 3NGAA 3V51A 4BCKA 3L8XA 3OWJA 5HG9A 4FV2A 2B9FA 3IG7A 4LRMA 3BHYA 4F9BA 5IISA 2OGVA 2YDIA 1GJOA 2GNIA 4KS7A 2YIXA 5ETIA 4FL2A 5BVKA 3G6GA 4E3CA 3ODYX 3IDCA 2CLQA 4BY9E 2UZNA 1HCKA 3EKNA 4ARKA 2FYSA 4JJRA 5HCYA 2VWUA 2XK8A 4HYHA 3CSVA 3VUGA 2J90A 2QODA 5L2SA 2KTYA 5CI6A 1ST4A 4AT3A 4L44A 3COIA 4EUUA 4V0GA 3KRWA 4Y73A 1TQPA 3MH3A 3CE3A 2FSTX 3FSFA 4KIKA 5CU3A 4CQEA 2PU8A 3GU8A 4U3ZA 3EMGA 4KAOA 4ZTHA 1HOWA 4JQ7A 5H8BA 2RFNA 5D11A 3V04A 3UDSA 1ZY5A 2Y4IC 4Z9LA 4K77A 1YKRA 4V04A 4FKLA 2C0TA 1PXPA 3BYVA 4O81A 4Z7HA 1RW8A 5FUTA 2CGUA 4DEBA 4HGSA 1Q99A 3IGOA 5B7VA 3U51A 4P4CA 3AKJA 1BI7A 3H30A 3R83A 2PMIA 2C6KA 4F6SA 1W2DA 4O0RA 2V7AA 3KN6A 4LOPA 4IMYA 2ZJWA 2FGIA 3OEZA 3W2QA 4CEGA 1S9IA 1FPUA 4FSRA 3AG9A 1VR2A 3FE3A 2YLEA 4MX9A 3WI6A 3F3TA 2Z2WA 2GNJA 3CBLA 3HRCA 4YZBA 2YM3A 3DOGA 3EKKA 4IB0A 4QMZA 3ZUVA 5TT7A 3SV0A 5M44A 4CD0A 2R0IA 1J7IA 3KGAA 3UYTA 3UP2A 4WBOA 3W8QA 1LR4A 3PG3A 4CZYB 1OBDA 1YOLA 2WO6A 4FNXA 5B2MA 4O4BB 3LVPA 5HZNA 3MI9A 3PXRA 3KC3A 5FXRA 1UNHA 2I6LA 2I0HA 3E8EA 4FV7A 2W9FB 3VJOA 2YM8A 1SNUA 1UKHA 4N4SA 2ZMDA 4OTPA 4WG3A 5AP2A 5LCKA 2F2UA 3UC3A 3W8LA 5LMKC 3DY7A 2B55A 3ORNA 1Y6AA 3IW7A 4G2FA 5DLSA 2PVMA 3AD4A 2P4IA 3QWKA 3E64A 2A0CX 3QTXA 3G33A 3ANQA 4PP7A 4LM5A 4GT4A 2BTRA 5ANKA 3QTIA 4L7FA 2VWYA 5G6VA 1V0OA 3LM5A 2W4OA 3IK3A 4YPSA 2YN8A 1J3HA 3QHRA 4FOBA 2ERZE 4CNHA 4FJVA 4EH5A 2XM9A 3Q4CA 4PRJA 1Q97A 2Z7LA 1OIUA 3V8TA 4DCAA 1P2AA 4L3PA 2A19B 1ZMWA 3PYYA 4BDIA 5HU3A 3GUBA 5EYMA 3BU5A 4RWLA 4MQ1A 2W1IA 3DDPA 4C2WA 1U54B 4NWMA 4DEIA 5BUEA 2VNYA 4KA3A 2WMBA 4ANBA 2GNLA 5AP4A 2ZB1A 3BQCA 4O21A 4AXAA 2CGWA 5IH5A 4FE2A 1Q8YA 1UU9A 3HL7A 5DEYA 4BCMA 3QKMA 2X9EA 1UWHA 5TF9A 2FH9A 4JT3A 4MF1A 2HIWA 5CT0A 4JI9A 4DAWA 4QP4A 5CEMA 5CS6A 2JKOA 2J5FA 5EDRA 5EI6A 2CNQA 4Z16A 2UW6A 1OIQA 4YJQA 4DEGA 3F3ZA 4DF3A 1H4LA 2JAMA 5J7HA 4MWIA 2YCFA 4TNDA 4KRCA 4M66A 3R2YA 4PNIA 4DLJA 4WOVA 4E93A 2J6MA 2Y8OA 5GZ8A 2J0JA 4BDFA 4DHZA 4RVMA 3P79A 1S9JA 5AP5A 1V0PA 3ZBXA 3NVMB 4X2JA 3AC2A 4A4XA 4QMQA 2ACXA 2PMOX 5AV2A 5KMMA 2H6DA 3U9NA 5CAOA 2WU6A 4EK4A 4JS8A 3LQ5A 3JVSA 3WE4A 4I21A 3DAJA 3I5ZA 1ZMVA 3F66A 3R9OA 5HOAA 2OXXA 1OITA 4GL9A 4YJUA 4F9YA 4G6OA 3UTOA 5CAUA 2ITYA 3LOKA 2JAVA 3UPZA 1SVGA 4FT7A 5AX9A 4BKYA 3Q60A 4XEYA 3RPOA 4O1PA 3BZ3A 1PXOA 1M7QA 3NFFB 4OGRA 4YJTA 4D9UA 5EW9A 4C0TA 2J5EA 4F64A 4HW7A 5JFWA 3O8PA 5E8YA 5IEVA 3R9RA 5IQGA 3JUHA 2BILB 4YU2A 2BAKA 5JGAA 3KMWA 4J7BA 5CNNA 2WQBA 1GOLA 4G31A 4QP8A 4ZTMA 2BMCA 4L53A 3SC1A 2ITPA 1W8CA 1OKWA 3ZRLA 4GVJA 3GQLA 5M07A 3ZSGA 4WO5A 4K2RA 3FHIA 1PF8A 3E7VA 4XV9A 5JEBA 5CSHA 5K5NA 3P08A 4I6BA 5CQWA 3U6JA 4H3BA 5A3XA 4TT7A 3I60A 4Z55A 2C4GA 3HAMA 2ZM1A 4GIIA 5EFQA 2ITTA 5D1JA 3Q9YA 4RVTA 5I3RA 1WZYA 5LVLA 2ZM4A 4YHFA 4CT2A 1GIHA 1H01A 2YITA 5JGDA 3GCPA 3DZQA 5BV3A 4QNAA 2QD9A 2X7GA 3KXZA 2IW6A 1K2PA 2Y4IB 4YC8A 4YSMA 4I23A 3FY2A 4JMQA 1ZZLA 2OBJA 5E8WA 5HD4A 3HDNA 3MA6A 3DLSA 3IO7A 3WYXA 4CYJA 3HDMA 3MIYA 3HP2A 4QP2A 5DMZA 4ZTRA 3DXPA 3RGFA 3EOCA 2XNOA 3VNTA 2GQGA 4FTQA 5IEYA 5K0XA 2UW8A 4BI2A 4UMPA 3EN9A 4QMUA 4BVUA 2GTMA 1JKKA 3UZRA 2A27A 2X2LA 1H0WA 1Y6BA 4CG9A 2H34A 3GFWA 5FEDA 4X7QA 4EH6A 5FTOA 4OTHA 3R30A 2PSQA 2ZV2A 1V1KA 1OECA 3FC2A 2RGPA 4LMUA 4S31A 2VX1A 4FKOA 4RIYA 3MGYA 2ONLC 4IM3A 4O6EA 4YNOA 3RNIA 3U9CA 1GZOA 3PE2A 4QMSA 4C4JA 2VWIA 2YCSA 4FIGA 2QOBA 1GZKA 3ZZEA 4B6LA 2V55A 4L46A 1FMOE 3AOXA 4B8LA 4AXCA 3ETAA 4BCGA 2G9XA 3ZUTA 4NU1A 4EBWA 2IZSA 5EYDA 3R7VA 3AKKA 4G1WA 3FHRA 3L9LA 3MDYA 2VX3A 5A6OA 4XCUA 4RSSA 2B9IA 1TZDA 2UZWE 5IQIA 3DV3A 3DKGA 1TKIA 4D1ZA 3WF6A 2AQXA 3CLYA 4FKQA 3RWPA 2VGOA 4PTGA 1IEPA 2R64A 3NNUA 2YERA 1QPCA 2OG8A 3QCSA 2GQRA 2OJIA 5JK3A 5C9CA 4U5JA 3HAVA 2IZTA 2WMVA 5AM7A 3AT3A 4RVKA 4FNZA 3PY1A 4L8MA 3LFDA 3GFEA 1J91A 4IVAA 4IM0A 3WF9A 3QFVA 3COHA 4RWJA 5A4EA 4NZWB 1YDRE 2J0MB 2YM5A 4HVGA 5LVMA 5IUIA 3MFSA 3V5WA 2HW6A 3KRRA 2W4JA 3QX2A 5J5SA 1G5SA 1A06A 3D14A 3BELA 1XMLA 2V5QA 4BDDA 3PA4A 2X0PA 1OI9A 5CEPA 4DINA 1AQ1A 1XWSA 4AXFA 3LMHA 4NL0A 3DNDA 4GYIA 4GUBA 2JDVA 4JX3A 3ZRKA 1BKXA 4C4FA 2HOGA 3JVRA 3PXFA 2XVDA 2Y0AA 5CF6A 4I4FA 5HCXA 5GIPE 2XKCA 3PIYA 3QD2B 3LCTA 2VRXA 3AC4A 4M3QA 3N51A 3LFFA 4NKAA 4BDJA 5C4LA 4UY9A 5H3QA 5HTCA 3ZFXA 4FTIA 1OKYA 3VHEA 4BCJA 5BUIA 4BYIA 3B2TA 2R5TA 1M2RA 3OXIA 5M4IA 3OZ6A 2QOIA 1J7LA 4H05A 1JSTA 3EJ1A 3OWPA 4GT3A 3BV3A 3MVLA 1ZOEA 4RFYA 5T6KA 5EOBA 5AAGA 4G17A 3RPRA 2Z7RA 4A9SA 5J1WA 4AQKA 3PRFA 4H1MA 4HNIA 4XG9A 4BWKA 3C7QA 4NFNA 4OTFA 1PXKA 3LXLA 4J52A 1YXSA 3O71A 4QRCA 5CTPA 4ASZA 4FIEA 3RJCA 5D10A 4CV9A 5KBQA 1CM8A 5JKGA 3QC9A 4ASXA 3DJ7A 3DJ5A 4JQEA 3TJDA 4H39A 3BV2A 4NT4A 4OR5A 4LFIA 4UWCA 5DT0A 4X6RA 4IX6A 5BMMA 3U8WA 2WTVA 4B9DA 3W0PA 2B4SB 3MB6A 5DNRA 3TNIA 3AC1A 4GIHA 1XJDA 5AMNA 4AX8A 2W06A 3RZFA 3ZM4A 3ALNA 1VLRA 2BHHA 2WMTA 4RGJA 4Y72A 4IAZA 2VTHA 5JFXA 3RALA 4JDJA 4LL5A 4M8TA 1KOAA 5EM5A 3VS0A 4EOMA 3E92A 4AA0A 2W17A 3FQHA 2VTNA 3TZMA 3QLFA 5KUPA 5EQPA 1UNLA 2QCSA 3F5PA 3FZ1A 2R3FA 1YRPA 3KF4A 4YJVA 2PVYA 3W32A 4CT1A 4C36A 1BX6A 3RPVA 3KRLA 3V5JA 4AOJA 2OZOA 2VGPA 1TQIA 3GB2A 5DWRA 4F6UA 1RDQE 4V05A 1BL7A 3ZO1A 1XH4A 2QQ7A 4NJDA 2XA4A 5HEZA 4ZEGA 5BNJA 3LLAA 2UW5A 4TYEA 5J9ZA 2EU9A 2WOTA 3ZO4A 2P2HA 1J1CA 1E1XA 2R3HA 3NSZA 3W2RA 4ZAUA 3R6XA 3R02A 4EZ3A 2JIVA 5FG8A 3MFRA 2BUJA 4KUJA 5FM3A 4BI1A 3N4VA 2OH4A 3ZOSA 2PPQA 3H10A 4IZ7A 3F2RA 1GIJA 1M52A 2ZOQA 2KULA 3CXWA 3FMEA 4JRVA 4PL4A 5CVGA 3R2BA 3TJCA 4E6DA 5DFPA 5IDNA 1OB3A 3O8TA 3NW5A 5ANEA 4Y8DA 3T9IA 2E2BA 3BU6A 2WIPA 2ITUA 3MVHA 3QTQA 4JBPA 2JIIA 4MCVA 4QYYA 3LFAA 5CWZA 3PFYA 2WD1A 3U6HA 1ZMUA 1T46A 1H8FA 5CSWA 1WBVA 3HRFA 2YZLA 1FVRA 4G5PA 5I9WA 2WQMA 1PMNA 4I5CA 1W0XC 3RPSA 5CEOA 5J1VA 3GP0A 4O82A 5J8IA 2X9FA 1OBGA 4X2KA 2WIHA 3E3BX 4YZMA 2WTCA 1YHWA 3D7TB 4PMPA 4R78A 3POZA 5C27A 1XH8A 4D2PA 3TNWA 3BI6A 4FK3A 3NUYA 5AR5A 4FVPA 4IH8A 4DBXA 2GTNA 3MWUA 4TRLA 4RIXB 1B39A 2P0CA 3TKIA 2F7XE 3W0OA 4AGDA 3EN7A 5JFSA 1SYKA 1DAYA 4LGGA 4QOXA 3DK7A 4N0SA 3COKA 4E5WA 3FBVA 4G3CA 3VWAA 3MY0A 5CAQA 2QG7A 1U5RA 5DR2A 3R71A 4K0YA 4F99A 4OTDA 3CKXA 3GT8A 4XRJA 4FYOA 3FXXA 4IB1A 4F7SA 2CSNA 1UWJA 3GGFA 4R5SA 4YO6A 1RJBA 3DLZA 2XBJA 2YZAA 2BDWA 1DM2A 3OC1A 2XIKA 3ACKA 5M09A 3CS9A 3OF0A 2CN5A 4P5ZA 5E91A 5HU9A 2CN8A 5KMKA 4U45A 3PE1A 4BGHA 5IDPA 2B1PA 4ACDA 2WQOA 4IANA 3UVPA 4HVIA 5HIBA 2BZJA 5E9EA 4MNEB 5EI2A 4AA4A 2O5KA 2QLUA 1U46A 1TVOA 3PSCA 1FVVA 4E4LA 4IB5A 5C8NA 3V8WA 5M57A 4J8MA 4KBAA 3F5XA 3R1SA 3OOGA 4WBBB 5CANA 1Q24A 5KO1A 3DBEA 3HMNA 3R8PA 4ALWA 3FI4A 4XYFA 3LFBA 5CVFA 4YMJA 3Q32A 2QKWB 4FODA 2NRYA 4FT0A 1PKDA 3QQUA 4J53A 4XG8A 4GEOA 5TO8A 2W1DA 3RVGA 2WTIA 4ANMA 3I6UA 1H26A 2F49A 4TWNA 3P7CA 1UVRA 3TG1A 4EOIA 1RQQA 1GZ8A 2XF0A 4NCTC 1PYEA 2XNEA 4LMNA 5BVNA 1H07A 3FYJX 2A98A 3EH9A 3R28A 4EKKA 4F0IA 2NYAA 2QU5A 4M0ZA 3PIZA 4QMVA 4AFJA 4FTNA 4EH4A 4A4OA 2RIOA 5AJQA 2XCKA 3ZM9A 5BX0A 5CSVA 2QR7A 2YDJA 2VTMA 5H8EA 4BYJA 2JDTA 4YBJA 3VS1A 2AEGA 4EOOA 4J96A 4LI5A 3UOHA 4DEEA 2QOLA 4EJNA 3C13A 3I0QA 3C51A 3Q4TA 3FLQA 2HAKA 3IDPA 1KV2A 1XR1A 2C3KA 2RFEA 3C4CA 2ZDTA 3QWJA 5AR7A 5AUYA 3MA3A 2B53A 3T3VA 3UIXA 2IZRA 4APCA 4IC7A 3C4EA 4M13A 3UQGA 1PXIA 3NUXA 3R63A 2Y6OA 4I3ZA 3MH0A 3F69A 4B8MA 3QQGA 4BR3A 3LCKA 2JDSA 2XKEA 3GC9A 4YJRA 3ROCA 3WF7A 3COMA 1O6KA 3CTQA 4GG7A 1KE5A 1YWNA 2J7TA 2X8IA 4O84A 1TQMA 2EVAA 3TN8A 1IG1A 5E92A 3CC6A 4NFMA 4CKRA 1OIYA 3CIKA 3CTHA 4C3RA 4NEUA 2WU7A 3QRTA 2C6IA 4BCPA 1SVEA 4J1R<