4I93A

Structure of the bsk8 kinase domain (semet labeled)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
QFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable serine/threonine-protein kinase At5g41260
publication title Structural Characterization of the RLCK Family Member BSK8: A Pseudokinase with an Unprecedented Architecture
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 83
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i93A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i93A01
5FRIA 3IW8A 4RRVA 2VO6A 3FMDA 4OR5A 4Q2AA 5GNKA 3VNTA 3RK5A 5IKWA 3ZRKA 3TUCA 1ZYDA 3FDNA 4ITHA 5JK3A 4FODA 3EN9A 3H9RA 1GOLA 3IS5A 4UXQA 2PUPA 2RFNA 1MRYA 3UNJA 4EUTA 3TIYA 3UG2A 2XCKA 4CCUA 5KZ0A 2G01A 2HXLA 4RIWA 4BB4A 1MQ4A 4IX4A 3UYSA 2NRYA 4YLKA 5KBQA 4O27B 4JDJA 4J52A 3MI9A 3DU8A 3WYXA 4DEBA 4EK4A 4CYIA 1M2RA 4BN1A 4Q9ZA 3ORKA 4X3FA 4O7NA 3SG8A 1H07A 4MNEB 3NYNA 4M84A 4YJVA 4Y73A 3EN6A 3R9DA 4IB1A 5I4NA 4FIEA 2FSTX 1WBSA 2R3MA 4ACGA 4LUDA 3G6GA 3S4QA 4C4EA 2E9VA 5AJQA 3RKBA 5LVMA 2DQ7X 3BPRA 1GIIA 5EM5A 1J7IA 1E1VA 2A19B 3Q53A 2F7ZE 3Q32A 4U44A 5BVNA 1KOAA 4M97A 5AR3A 4JT3A 5HX8A 1GAGA 5HQ0A 3EKNA 3ORLA 2PL0A 3HDMA 5ANOA 4O0SA 2PVRA 2JIIA 2JIUA 3DK6A 5AWMA 3ZHPC 3I5NA 4O81A 2BILB 3TNWA 3CR0A 4ZP5A 5EOLA 4FK3A 3SQQA 4J8MA 1PYXA 5HG8A 4EC8A 2W4OA 4LFIA 4QPMA 4D1SA 5HNGA 4FKSA 4JIAA 4YZBA 3ZSHA 1A9UA 4E6AA 3MFRA 5ETIA 3C5IA 4J96A 2OZAA 1O9UA 5CU4A 2GTNA 4CMUA 3UQFA 3SHEA 4DEGA 1H4LA 4HCVA 2C6OA 3MA3A 4YP8A 3FSKA 4PDPA 4EKLA 1YWNA 4C62A 1ZXEA 2W1DA 2Q83A 2JGZA 2WTVA 3OCGA 4CT1A 1T46A 5IH6A 4ZTMA 4HVDA 1SM2A 4RJ4A 4X6RA 4GK2A 5IISA 2CKEA 4FG9A 4BIDA 4JXFA 5E8TA 5FP6A 4FL1A 3F5GA 5IQIA 4Y95A 1Q97A 2X4FA 2XK6A 5JGBA 5E4HA 3F7ZA 3NUYA 4O0TA 5AP4A 3R8PA 1OGUA 5I5ZA 3AMAA 3QGYA 1PW2A 3W2QA 4A4XA 5AAFA 4M69A 3QTQA 3DQWA 5TKDA 1XHAA 2BDJA 2VWWA 3NYVA 5LCJA 3CP9A 1F0QA 1YOJA 2BFYA 3JPVA 3Q9XA 1DM2A 4QO9A 4S30A 5AX3A 3R8ZA 3WYYA 2B9FA 5ANIA 5LCKA 2ITNA 4YZMA 2FYSA 1OMWA 3ZLWA 2GU8A 2XM9A 4E5BA 2HIWA 3HECA 5CF5A 3BV2A 1E1XA 3LM0A 2CJMA 3FWQA 1TQMA 4LG4A 3MN3A 4C2VA 5KHXA 4RIWB 3QUPA 4K77A 4P2KA 3CKWA 5T3QA 1R0PA 3OD6X 2F7XE 3ZRLA 4D9UA 5FDPA 3GBZA 3L9NA 4RIYA 3EOCA 4ANOA 1H1PA 5DA3A 4GRBA 5AV3A 3RAIA 4M15A 2EXMA 4C4GA 3L9PA 4I1ZA 4ZZMA 5AA9A 5HVKA 1FGKA 4X3FB 3RZBA 5JZJA 4FTLA 4L9IA 4X2JA 3ATSA 1UV5A 4EC9A 2WKMA 4G17A 1FVTA 2YA9A 2VTRA 4X3JA 5AP3A 4DFNA 1OITA 4BZNA 5J5SA 5I9YA 4GCJA 1E9HA 4OTRA 5CAUA 3U9NA 2SRCA 3P5KA 3EN7A 4GT4A 5DRDA 2R3HA 4OTHA 4XV9A 4FKOA 5A46A 3S2PA 3FPMA 2XA4A 4CCBA 4BZDA 2OF4A 3PTGA 2JBPA 1P4FA 2OF2A 3HV5A 3HLLA 3KMUA 4J8NA 4FEWA 3FV8A 3PIXA 3LXNA 2RG6A 2YM3A 2GTMA 2I0VA 2NPQA 4YSJA 2JKOA 5DI1A 3VS6A 2Y0AA 3MTLA 3RPSA 3FC2A 4U8ZA 3UZRA 3EKKA 3GFEA 4JDIA 4QYHA 4O7VA 1IASA 5FXSA 3UVQA 1BYGA 3EB0A 3L9LA 3PY3A 3W32A 4UMQA 2EU9A 2XM8A 2YAAA 3U6JA 3PVWA 2OZAB 1YOLA 4DH1A 4IX5A 5EK7A 4RVMA 3C4CA 4G3FA 1GY3A 2EB2A 3PLSA 5HG9A 2BTRA 4XOYA 2XZSA 2X8EA 3GI3A 2XNPA 4A9TA 4IIRA 2I40A 4FGBA 1ZZ2A 3TG1A 4NCTC 2ITYA 5AP6A 3UNKA 2BROA 2IVUA 3F5PA 4QP6A 4N0SA 3PZHA 3F66A 3KKVA 1U59A 1H26A 3EQPA 4OBQA 4JI9A 4F1TA 4EWQA 2PZIA 3DCVA 4MNFA 4XG9A 3VO3A 2BUJA 5ICPA 3RBWA 3DOGA 4HYSA 5TT7A 2J9MA 3BLHA 4C35A 2J0JA 2UUEA 3VJNA 5CZIA 5DGZA 3A8XA 4FV4A 4FZDB 2G1TA 4XG4A 4BIEA 4LRJA 5KNJA 3DBCA 4OTWA 2VRXA 1KE8A 4AX8A 4F0FA 2PVYA 3DDPA 3ZYAA 2OXXA 4NW5A 4YJSA 4ANQA 5FM3A 3FLNC 4FUXA 3R02A 4FEQA 3H0YA 3ETAA 4GIHA 4AZVA 4OTDA 5IU2A 2B0QA 1W84A 3F2AA 4H3PA 2F2CB 3Q4ZA 4ZZNA 1VYZA 2I0EA 3LFSA 2UW5A 4RIYB 5H8GA 3LKMA 3FMHA 3SRVB 4C34A 1JQHA 3AQVA 3D14A 5CF8A 4G34A 1XBCA 4MKCA 5C1QB 3FQEA 2ACXA 4ZTLA 3KXMA 4KS8A 5FLFA 2XYUA 4JL9A 4FL2A 5D7AA 2W1IA 4XMOA 4DE4A 5K5XA 4FTIA 2XK4A 3UVRA 4W9WA 3VS1A 2W96B 4YUQA 2R7IA 4JVGA 4EH6A 3F7WA 2KULA 4UMPA 3VWAA 4EZ3A 3KXGA 4MXOA 5CF4A 4HYUA 1YI3A 3LHJA 2QU6A 3FY2A 2ITVA 3TN8A 2JDRA 3F69A 5I3RA 2O64A 1FMKA 4IWOA 3FYJX 2XB7A 4FICA 2XK9A 3ZC6A 3SVVA 5CEOA 3IKAA 4CGAA 4BVUA 3GP0A 3DJ6A 2A2AA 5IA2A 4DTAA 3V5PA 4ANSA 4D1ZA 3RPVA 4IVAA 4UX9A 3LFEA 3Q2JA 4DAWA 3UZPA 3RAKA 4IAIA 3FXZA 5C4KA 5EOBA 1MP8A 2JDOA 3AD4A 5EFQA 5BYZA 5EM7A 4CMTA 3EWHA 1UU8A 2Y7JA 3ZLYA 5JQ5A 4DEAA 2UW3A 3JXWA 3PP1A 4V0GB 5CY3A 3WZEA 1V0PA 4DBNA 5L4QA 3DXNA 4QYGA 4D2VA 3TM0A 5E1SA 4U43A 3R28A 3RNYA 2RL5A 4KKEA 1VZOA 3S0OA 3FMMA 5M55A 4F70A 2XKEA 3E64A 4UMUA 3BGZA 1KV1A 3Q60A 3BX5A 4BDCA 5KMJA 2YN8A 1Q41A 3TKHA 3M1SA 4IW0A 4OUCA 3SKCA 3ULZA 2QOOA 2B55A 3UMWA 3F3UA 1WBVA 3O71A 2R3RA 1UU9A 2ERKA 2VX3A 3G0FA 4JIKA 2YISA 4R6VA 3RAHA 4BL1A 4F9YA 3O17A 2OJFE 5HCXA 3R7GA 3Q4CA 4V01A 4AA4A 4Q5EA 5JH6A 2IO6A 3IQ7A 2QO2A 2C6TA 3GFWA 2PZYA 3H3CA 3KU2A 1KE9A 4FKPA 4OTIA 3EQIA 4GVAA 2UW6A 3FI2A 4ONAA 3BHVA 1PYEA 4LQMA 4IFGA 5CU0A 4MXYA 3NIZA 3BCEA 3MBLA 3PXYA 4Y85A 3PWYA 4M66A 3SW4A 2W5AA 4QOXA 2UZOA 1WVWA 3AXWA 1GIJA 3C0HA 3R7IA 2VZ6A 4H3QA 1BI7A 4OTPA 3UODA 4XV1A 4NTSA 5LOHA 2ZMDA 3C7QA 2ETKA 4ZXTA 4HYIA 3SA0A 3F2NA 5BMMA 2BHHA 1JKTA 3FMJA 3R1NA 5J9YA 2ITPA 4G6LA 4OBOA 4CV8A 2PU8A 4ZY6A 5BUIA 4OW8A 2PVHA 3R9HA 4C3FA 1Q5KA 2VX1A 3U6HA 2WTWA 4FG8A 2PVFA 2C30A 4BCPA 5HX6A 4F9WA 4BDKA 3BU5A 4WG4A 4RWJA 4IWDA 5ANDA 3MB7A 1YW2A 3DK3A 5F94A 2X7GA 3R21A 4CG9A 3TUDA 3OC1A 4BDDA 1RE8A 3QZFA 3LFQA 3L8XA 3W10A 5EW8A 3R73A 3MH3A 4UV0A 2NO3A 3Q6UA 2UVXA 3LCSA 4NM0A 5LMKC 3P23A 2OICA 2ZOQA 2GHGA 2H8HA 3OBGA 3U51A 3MWUA 3H0ZA 3FAAA 3NCGA 2OK1A 2A27A 4F7NA 3K3JA 3OTUA 2HY0A 2R3GA 3QQGA 3RALA 3ZSGA 3ZXTA 3R9OA 3BHYA 5J9ZA 4FSRA 2XS0A 2IJMA 3V5TA 1ERKA 4CZTA 2A4LA 2JFMA 3WZDA 5DFPA 4QTEA 1CSNA 2W7XA 1AD5A 3W2OA 4D0WA 5K4JA 2BRMA 3E63A 4LV5A 4PMSA 3ZO4A 2OJGA 3HA6A 4F7SA 5LJJA 2BRGA 3MFUA 4R3RA 4EORA 4CKIA 4MD8E 4Y46A 4CYJA 1K3AA 5IEVA 2QOKA 3RCJA 2OLCA 3ENMA 4O82A 4PMMA 4Z7GA 2R3LA 3EQFA 4KRDA 3KXZA 4AW5A 3U8WA 2XIYA 3VAPA 4ALWA 1A48A 3LVPA 2E9NA 2GNJA 5EHYA 4TYEA 4BR3A 5TR6A 3FZTA 5CEIA 3PJCA 2CKOA 4C4JA 3ANQA 5DOSA 3PYYA 4C36A 2Z8CA 4XV2A 3OUNB 4OTGA 4J98A 2XKFA 3QHRA 4S34A 1B39A 2UZDA 3LQ8A 5J8IA 2QG7A 2J0LA 4R3PA 3POOA 1W7HA 4E1ZA 3P7BA 2BVAA 4O0RA 5HVJA 4NW6A 2YM7A 4BF2A 3G9NA 1UWHA 1BI8A 4GS6A 4IVCA 4FTOA 4U3ZA 4WG3A 4M13A 4O38A 5DBXA 4AE6A 2C5YA 3N4UA 3AC2A 4FIGA 2OU7A 2B9IA 2O3PA 3E3PA 1Q8YA 4O0XA 4PDSA 4U79A 5DWRA 4XBRA 3T8OA 4OBPA 3FQSA 4M67A 3UOLA 3UC4A 3C9WA 2ZDTA 4F6SA 5A6OA 3JUHA 1G8SA 1Z9XA 2QC6A 5I3OA 5C8KA 5M57A 3R7OA 2P33A 2YIRA 4MQ2A 3V5JA 4EHEA 4A9YA 3FUPA 3DQXA 2IVVA 4O2ZA 1OKZA 2YEXA 4FV2A 4AGUA 3F88A 3D15A 4C4HA 5KBRA 5IPJA 4AZTA 4F7JA 2RFEA 2QOFA 1PXIA 3DT1A 3NZ0A 3BU6A 3E7OA 2XK7A 4J1RA 3ULIA 4N6ZA 3LQ3A 2DUVA 4ANLA 2W1HA 1XH6A 3LAUA 3V01A 2BIYA 3V6RA 5KMIA 4W4YA 1UKIA 3G51A 4BDGA 4O6LA 2OW3A 2C5OA 4LOOA 3EHAA 3OOGA 4AOJA 1QPCA 4YJUA 5JZNA 3PVGA 4BCJA 4O86A 3DTWA 4X6QC 2HK5A 5FEDA 3KRJA 3MESA 3HMMA 4EH5A 4PTEA 1MRVA 4HGTA 5BVEA 4BYJA 4MYGA 2JDVA 4ZLOA 3C51A 1SVGA 5CEMA 3O7LD 2E9PA 2V7OA 4G31A 3SD0A 2J7TA 2OI4X 4NK9A 3QKLA 4C58A 5CS6A 1LEZA 3OY3A 4WNMA 4WRSA 5A9UA 2I0HA 2HY81 2FGIA 5D1JA 4KB8A 4ASZA 3N51A 2YIQA 3TT0A 2IVSA 2C4GA 4GG5A 4I0TA 4QTCA 3R7UA 5M51A 3V8SA 5FTOA 2XKCA 1H01A 3GCVA 3AD6A 2XBAA 5FXQA 2QO9A 3E8CA 3TV6A 4IM3A 3DAEA 2ITXA 4C2WA 2XUUA 2PZPA 3G5DA 3GOKA 3FKLA 3QALE 4I6BA 3ZEPA 4H39A 2WMUA 1YQJA 5FEQA 5KMMA 2H6DA 5BPYA 3HAMA 2GS7A 2ONLC 2OJIA 4ZLYA 2YZLA 4DFYA 1M14A 2W9ZB 3GGFA 2V5QA 4QMPA 4AFJA 3JR1A 2YWPA 4DH8A 1Q24A 3FL5A 3LFCA 4AACA 4QD6A 4UB7A 4PRJA 3HEGA 4QMWA 4FA2A 4CFMA 5IMEA 2R9SA 3A62A 4PNIA 4YGAA 4F1OA 3COMA 3MPAA 2ZV9A 2B9JA 3CKXA 2QOBA 3DJ7A 3UG1A 4HPTE 5TO8A 5CXZA 4D2PA 2B9HA 3VUDA 2YM8A 3V5WA 2C6IA 1V0BA 2HWPA 3AC8A 2JDTA 4FZFB 2ITTA 4TPTA 4U40A 5E91A 4CFVA 2GNGA 3GT8A 5DG5A 2ESMA 1RDQE 3KREA 3DBEA 3KA0A 5AIRA 4W8EA 2O8YA 5FP5A 2H9VA 5HKMA 3UGCA 3W1FA 4W4WA 5DT0A 2EWAA 1UNLA 2JIVA 2YJSA 5IH4A 2B1PA 2HOGA 4TN6A 1RW8A 3C4XA 4HVSA 3ZDIA 3VS4A 2C68A 3R8LA 4XUFA 4DINA 5CWZA 5AR7A 4GFOA 3EFJA 4G3DA 4H3BA 2QR8A 3QQLA 1NVRA 2WIHA 4O21A 3WE4A 3OWPA 3FMEA 2QODA 4AW1A 5M4UA 2JKKA 2XBJA 3B8QA 2ZVAA 3SXRA 2XIRA 5IQFA 5E92A 3UBDA 1CKIA 5HNIX 4JQ8A 4G3GA 4JG8A 2CGXA 1OBGA 4L43A 1GIHA 4USFA 4YTIA 4QPAA 4D9TA 5H8EA 2HZ4A 3P0MA 2VAGA 2V55A 4LYNA 3WF7A 5EQPA 3BWJA 3CTQA 4QMMA 1YHSA 2C6EA 4JRVA 3UDBA 2Y4IC 3NYOA 2Z7SA 3QYWA 4OLIA 4B99A 4GYIA 4E20A 5C26A 4UWBA 4EYMA 3QL8A 4O96A 4OTQA 1PHKA 3IGOA 3GNIB 1VEBA 3LE6A 4IMYA 4E3CA 5HORA 3NGAA 1X8BA 3MJ2A 4BCQA 2BDFA 2XJ0A 4FSYA 2YCRA 5IA1A 3QCXA 3HUCA 4LL5A 3MVLA 4GEOA 4BIBA 4FEUA 3KQ7A 3ZZWA 4EH2A 5JN2A 4YJOA 3OWLA 3OXTA 4EOQA 1JAMA 3R7EA 2J5EA 2OBJA 4FTJA 3AC5A 1Q8TA 5EH0A 5F4NA 2QOHA 3DTCA 4QYFA 1RJBA 5CSHA 4NIFA 3WARA 1YHWA 4F9CA 3GEQA 4XX9A 3O51A 4FL3A 3VF8A 4MEDA 4WSYA 5D7VA 4KIKA 4L53A 2BAQA 4D2SA 3VUHA 4CVAA 3ZUTA 2IG7A 2JITA 4CKRA 3VUGA 2PE1A 4JNWA 1TQPA 5DR9A 2VWBA 2VO7A 2XF0A 4XP3A 1UNHA 4LL0A 5M07A 2QHMA 2XVDA 4R1YA 2GMXA 5E8ZA 4CZUA 1KE5A 1EH4A 2WMXA 3OOMA 2YLFA 3R6XA 5HI2A 4A4OA 5IF1A 3E93A 4RMZA 3W2PA 3CLYA 4PP7A 4B0GA 2JD5A 3G2FA 4CFXA 4CZYB 2IN6A 3AGMA 1ZMWA 2XK8A 2WMQA 4TKSA 5A4LA 3HRCA 3CGOA 4AGCA 4IWQA 4XG7A 4MF1A 4AWIA 4AAAA 5KHWA 4AFEA 2EB3A 3WF5A 4GT5A 1K9AA 1JBPE 4FZAB 2PTKA 3OZ6A 4FZ6A 3UIXA 5DLSA 5FBOA 3CSVA 2ETRA 5CF6A 5A4TA 3C4FA 3VHEA 3PY1A 3D7TA 5JEBA 5I9UA 5GIPE 3DAJA 1H25A 4W9XA 2BAJA 2VTNA 2KTYA 3KFAA 3R63A 5C8NA 4TWPA 5ACBC 1UVRA 2XP2A 2JAVA 5AAGA 3A4PA 1OBDA 1BMKA 4AXAA 4FGRA 5LMBA 3ZMMA 1XBAA 3HMOA 3FBVA 4ZS4A 2REIA 4XHKB 4CKJA 1XBBA 2VTOA 3ANRA 4QPSA 4BCMA 4YHFA 1WVXA 5DNRA 4ANMA 2C3IB 1OUYA 2RFDA 2W17A 4APPA 3G0EA 4L42A 3I0OA 4DFXE 1ZYCA 4O7YA 4FTQA 1IAJA 3GXLA 4IH8A 4IAYA 3VBXA 5JFXA 4FTAA 1P5EA 3BZ3A 5AV0A 2R3OA 3MS9A 4PV0A 4RT7A 1OL2A 3R7YA 4EI4A 2PZRA 4F09A 3AOXA 4I5CA 2HYYA 3Q4UA 2OZOA 2W5HA 2Z7LA 5E8WA 4ZY4A 5I9ZA 4TRLA 2RF9A 3F2RA 4ZSGA 2W05A 2E2BA 3V3VA 5FTGA 4A4LA 3CXWA 3SOCA 4YU2A 4IC8A 2WOUA 4E5AX 4JJRA 4TYHA 4EEVA 1YXUA 3C4ZA 4FK6A 3DXPA 3EL7A 3A7FA 2VD5A 2VV9A 3GUBA 2YDKA 3OCBA 4O7LA 3PSBA 4FIIA 4QT1A 1QL6A 3Q4TA 5J87A 3V04A 3ID6C 4I5PA 3H9FA 3ZDUA 4ENXA 5IQDA 5DR2A 4WRGA 3E3BX 4NIFB 3U6IA 4BC6A 5D12A 4C4FA 3NLBA 4RLKA 2W1GA 1OL7A 3TUBA 5DN3A 3KXHA 3S1HA 2CMWA 4FMQA 5EKOA 4CT2A 5CYIA 3TIZA 3A7JA 2HCKA 3QX4A 4U0IA 4PNKA 4KIKB 5F1ZA 3SX9A 4L45A 1SNUA 2GNLA 3D5UA 3OT8A 4XG3A 4U41A 5TE0A 1H1RA 1WBPA 3TI1A 4CLIA 5I0BA 3F82A 4L52A 1U54A 2Y9QA 1M2QA 4AZFA 3NPCA 3HMNA 2A0CX 1BX6A 2ZDUA 1CDKA 2GCDA 2WELA 4CG8A 3JYAA 1CTPE 3NW6A 3OW4A 5LWNA 4BCOA 5GJDA 3VS3A 3RJCA 4BWPA 3K5UA 1YI6A 3JVSA 5DPVA 4WHZA 4X21A 5AUXA 4R78A 1URWA 3WF6A 3BU3A 3MB6A 4FSQA 2Q0BA 1ZOGA 3FZOA 3ACKA 3K3IA 4QP3A 1QMZA 4U3YA 5EYDA 3UQCA 3T3VA 3PG1A 3HZTA 2B4SB 4UYAA 4LMNA 2NP8A 3PP0A 4IX3A 1YRPA 5FGKA 4AZSA 3FLYA 4WG5A 5DYJA 3AT2A 1L8TA 4IM2A 4IB0A 1ZARA 5AEPA 3EL8A 1H8FA 3D7TB 3QTIA 5ACKA 3R71A 4EJ7A 4EOSA 4QQ5A 4QMTA 5KX8A 3BLQA 1V0OA 4E4NA 4UN0C 5J1VA 4I23A 3KXNA 4FSMA 5HBJA 3R9RA 4I5MA 3VC4A 5AR8A 3OCSA 2G2IA 4YBJA 2IW9A 4ZAUA 5BUEA 1JOWB 5AV2A 3TNIA 2C5XA 3DK7A 4DFLA 1REJA 4ZSJA 2XIZA 2I6LA 3QBNA 2VU3A 2C1BA 4ALUA 2WQEA 5HHWA 5CAPA 4QP4A 2O0UA 4ZLZA 4RJ7A 4R7BA 3QLGA 2GNIA 4EHGA 2BALA 4M7IA 3RCDA 4MCVA 1H28A 1DS5A 1I44A 4RVKA 4FKIA 1OIUA 4YHJA 4XS2A 1B38A 4WO5A 3V8TA 3A4OX 4G6OA 4IVDA 4WIHA 4X7QA 5IQBA 3V5LA 4DLJA 4FI1A 3RK9A 2OIQA 3OWJA 4LRKA 4KS7A 3MVJA 3RTPA 4I92A 4YC8A 5EW9A 2XNGA 5EG3A 3WILA 5A4CA 3E88A 3BRBA 3SAYA 2PVMA 3U4UA 2QLQA 4FV5A 3CC6A 4QMSA 3Q6WA 1CM8A 5EI8A 4FG7A 4BCGA 3NUSA 4CMOA 3LFBA 3RHXA 4D2WA 2GQSA 3N4VA 3JY9A 3VBTA 3VS0A 1Q3WA 2WGJA 4R5SA 3PXKA 5EDPA 4X2GA 2IWIA 2QVSE 4R1VA 1NXKA 3TJCA 4L44A 5JGDA 4L46A 2FA2A 4FX3A 4IANA 4EBWA 3HL7A 1AQ1A 3DKOA 1U54B 3ALNA 3TNHA 4RWIA 3D2IA 5CSWA 1OIRA 5AP2A 4HGEA 3GC9A 3ROYA 2QQ7A 2WMVA 1GZ8A 4LOQA 4C38A 4CFWA 3P1AA 3PE2A 5IG1A 1KUTA 4KKGA 4RIOA 4PPBA 2OH0E 3R2BA 2W06A 2V22A 4FIFA 1KE7A 4GW8A 3P4KA 4RFYA 5CQWA 3HV4A 4FSWA 4ITJA 1ZZLA 4QP9A 4EK6A 3BE9A 3A7IA 4IADA 5LWMA 3HP2A 4PTCA 1U46A 4X3FC 3BYUA 3LJ2A 4E5WA 4YTFA 5B0XA 4DEEA 3CJFA 1H0VA 1Q8WA 3MVHA 4KBAA 3UE4A 2YM6A 4XYFA 4DN5A 4TW9A 5L8KA 4FKRA 4U9AA 4PL5A 2W4KA 3Q5IA 4ANNA 1KSWA 2YM5A 4UBAA 2GS2A 3QQFA 4EBVA 4M69B 2HZIA 4I94A 5DHJA 3A60A 4YLLA 4IZ7A 3F6XA 3E8DA 3KY2A 3ZCLA 2ZV8A 4FTMA 5M4IA 4BICA 3E8EA 4X2FA 5JSMA 5J95A 3LM5A 1SYKA 3CS9A 3QXPA 1JSTA 4DF3A 3GOPA 3PDTA 2YIYA 3OFMA 3QF9A 3Q52A 3K54A 4CRLA 5ETCA 4KUJA 5FG8A 3PPZA 3A2CA 5IA4A 4QMVA 1J3HA 5JT2A 4YJQA 4OGRA 4QQTA 2ZB1A 3RHKA 4I0RA 4QQJA 4O0WA 1FINA 5LQFA 5IH5A 2WMBA 5AUZA 4AW0A 3TDVA 4KBKA 4DYMA 3KF7A 1SZMA 5FUTA 4CTCA 3U87A 3R7VA 2XCHA 4B8MA 2PSQA 4BCKA 2BZJA 4FYNA 5BX0A 1QPJA 4L6QA 4BHZA 4JBVA 2JKMA 3NR9A 2AYPA 4QQCA 2FB8A 3FZRA 4WOVA 5EYMA 4BCFA 4R7HA 4U42A 4QMUA 4UXLA 2PE0A 4DEIA 4O7TA 4EQUA 2R3JA 4QRCA 3II5A 1ATPE 3UIMA 4QTAA 4RC2A 4YSMA 3MW1A 3A61A 2UW0A 5KZIA 4FTKA 3EQCA 4FKGA 2X81A 3BBWA 1GZNA 3QTZA 4GUEA 4P5QA 4ZSLA 4J53A 3BHUA 3QD2B 4RG0A 1Q3DA 3O8TA 2OSCA 3R1YA 1STCE 1URCA 3P86A 5JGAA 4JBQA 4S31A 4FNXA 3LMHA 5L6WL 3DZQA 4O83A 3BQCA 4K9YA 4D4RA 1IAHA 2YCQA 2NNWB 4ZTQA 3GU5A 5JMSA 2XIKA 1OKWA 4C59A 3LLTA 3R1SA 4S32A 1H1QA 4XV3A 4TNDA 1H27A 1V1KA 3E7VA 4EKKA 3KRWA 4I3ZA 2C3JA 4F9AA 3QFVA 5EQEA 3JS2A 5A4QA 2DS1A 4PPCA 5AP5A 2BKKA 3M2WA 3ZSIA 3COIA 3MJ1A 3I7CA 3MV5A 1WBNA 3P7AA 3ZONA 3HP5A 4ACDA 4BWXA 3ATTA 1G5SA 2WAJA 2UW4A 3EZVA 1BL7A 5A54A 3MDYA 2WNTA 5EW3A 3QD0A 2CSNA 2XNMA 2XRWA 5DT3A 2WMSA 2W9FB 4EH7A 2GNHA 4EQMA 5BYLA 5IQCA 4L3JA 4GJ3A 2IPXA 2Z7QA 1OIQA 1PXKA 3E8NA 5EM8A 5IQAA 5HCZA 3IGGA 3TV7A 1TQIA 3VS5A 2HAKA 3PXQA 4G16A 5HE0A 4EK3A 3DKCA 3ZOSA 2QD9A 1J91A 3IOKA 5AP7A 3QYZA 5CEQA 4I0SA 2R3NA 4D4YA 3OS3A 2BR1A 3DA6A 5HEZA 4D58A 1KWPA 5B2LA 4Q9SA 4DGOA 4M0YA 2V0DA 4MD7E 2WTIA 3P9JA 3VS2A 4EHVA 3OTVA 5CTPA 3I79A 5EYKA 3D94A 3TZMA 1IG1A 3NYXA 2UZBA 3LJ0A 3QA8A 5LVNA 5B7VA 4KNBA 5DT4A 2H96A 4E7WA 2CPKE 4ARKA 4JR3A 4DHFA 4NTTA 4QTBA 3RZFA 1PMVA 4NM5A 2CLXA 4G9RA 5HGIA 2B7AA 2XNNA 4O91A 3BQRA 4H1MA 4NKAA 5HLNA 1OI9A 2W5BA 2PVJA 4IAZA 4TWNA 3DBQA 3IECA 3RVGA 4KA3A 2YIXA 4YMJA 2Y4PA 4ID7A 2RIOA 4HCTA 5IZFA 3LJ1A 5HE3A 4UALA 3ET7A 4BDHA 2BFXA 5BQ0A 4FUYA 4G3EA 2IZSA 3FY0A 3S00A 2XNOA 2CNVA 3F3WA 5AM7A 2YHVA 3R30A 2XRUA 5HTBA 4IHPA 3KCKA 2UW9A 3IDBA 4AF3A 2BRNA 2Q0NA 2VNYA 3WF9A 1M52A 4JDHA 5F20A 1OZ1A 3HV7A 4QMZA 4AN9A 1DI9A 2YDJA 4FKTA 1UWJA 2PY3A 2ZAZA 4DH5A 1CMKE 5FM2A 4KINA 5KO1A 3SLSA 3BEAA 4AZWA 4TNBA 5AR5A 1KOBA 1PXJA 5HD4A 5IQGA 3FYKX 1XKKA 4DA5A 2CNUA 1Z5MA 2QU5A 2YCFA 5HIEA 2W0JA 3FXXA 4DGMA 2OFUA 3SC1A 4IZAA 2R5TA 4TTHB 4CD0A 5HU3A 4QMOA 3HMIA 3RI1A 4BKJA 1LUFA 3G6HA 4FTNA 1FMOE 4GFMA 2Z60A 1ZY4A 3O7LB 3OEFX 5D9HA 4ZK5A 3TNPC 4TY1A 4BBFA 4K11A 2Z2WA 3KMMA 2IZUA 2WMTA 4E6QA 1CKJA 2UVZA 4V05A 5HIBA 2P3GX 2VO3A 3F61A 5DH3A 4FR4A 4AE9A 3ODYX 3CPBA 3COKA 2VO0A 3ORZA 3IDCA 4S33A 2C5VA 3HUBA 2VTSA 4C37A 4G5PA 4DG2E 4ORKA 4IB3A 4R8QA 3UTOA 5IA3A 5H9BA 5KMNA 3KGAA 4FOBA 1HCLA 1JVPP 3TZ7A 4AS0A 4MTAA 1TKIA 2WTDA 2WU7A 2FH9A 3OXIA 4RJ6A 2WEIA 1OL6A 3UZTA 1SVEA 3VHKA 3VBWA 1Q62A 2GQGA 4UMTA 4MXCA 3UO6A 2RG5A 4FV7A 1O6LA 5AADA 5BVOA 3TEIA 4ZJIA 3OT3A 5DMZA 4QTDA 2OO8X 4ZIMA 2ZM1A 4AT3A 4RX5A 5AFVA 4JLCA 5CAQA 4YTHA 4YJTA 3L8SA 3BHHA 2G15A 5EM6A 5CENA 3DFCB 3R00A 4OT6A 3NAYA 4PP9A 4ITIA 2YCSA 3DZOA 2VTAA 4W8DA 5CEPA 4U81A 4AGWA 1MUOA 3CEKA 1NW1A 4FKVA 4PUZA 1OM1A 5TOZA 1R39A 3TWJA 4A7CA 4AN2A 2RSVA 5FWKK 5DVRA 3MYGA 4FT0A 2C6LA 5AX9A 2G9XA 2YLEA 4JOAA 4YJRA 4K18A 5AV1A 2QKWB 3W33A 4DGGA 5HU9A 2PVNA 4CRSA 2C6KA 4X2NA 1YDTE 4EZ5A 2GHMA 1JLUE 4EJNA 3NUNA 4RIXA 4W4VA 4YR8A 4PL4A 4E6DA 2WO6A 3D2KA 3ENHA 4FKJA 4EH3A 2YDIA 3DBDA 3HA8A 2LGCA 3MY1A 4JQEA 3UMXA 2XEZA 3KN6A 4TYJA 3NNVA 4MXXA 3L8PA 5AIKA 2WQMA 3KK9A 1IA8A 3GC7A 5IDNA 3LW0A 4ASXA 4JX7A 4I41A 4XEYA 1KV2A 5M09A 3VQUA 3R9NA 3D5VA 3MVMA 4E26A 5L8JA 2CGVA 3PJ3A 5AR4A 3B2WA 4RJ8A 1G3NA 3QGWA 4HPUE 2J90A 3FLZA 5HE2A 1Q4LA 5E8XA 2VTMA 3CY2A 3DBFA 3R1QA 1U5RA 2RKUA 3O96A 3QTXA 4MXZA 1FBNA 4EOIA 2JDSA 4XNEA 3AMYA 3NUUA 3FL4A 3KVWA 4YO6A 3AG9A 1XJDA 4XRJA 4O1OA 1XWSA 4EQCA 3GC0A 4GU9A 3DGKA 4FYOA 4NH1A 2WXVA 3ZFXA 2I1MA 2UW8A 5LXMA 2R3PA 1I09A 1ZMUA 4YNOA 3ZFMA 2F57A 4BKYA 2BRBA 4GKIA 5L3AA 5GZ9A 4FSUA 2C0OA 4CQEA 2VWVA 5AA8A 3SOAA 3DJ5A 1FVRA 4O0YA 3LQ5A 2PK9A 4DTBA 3KCFA 2ITOA 4O0VA 5D11A 3ZUUA 4LRMA 3REPA 4QMQA 4YZ9A 2BZIB 3PIYA 4ACMA 5IEYA 1PXPA 4GU6A 1OIYA 4PY1A 3Q2MA 3SDJA 3PXRA 3CTHA 1YXTA 3M42A 3QA0A 4MD9E 2CNQA 4DC2A 1REKA 3DLZA 3C50A 3Q96A 3SXFA 5IA0A 2QONA 4R3CA 2YZAA 3FE3A 4BBMA 4F63A 3E62A 4DG0E 5KKRB 1ZOEA 4AZEA 3I4BA 2ZV2A 1WBOA 4HJOA 2BCJA 4NYEA 4EOJA 2UW7A 1SVHA 4ZS0A 4FEXA 1DAYA 4AOIA 3Q5ZA 3QLFA 1PKDA 3PSDA 3RPYA 3CQUA 4L00A 5KMKA 2EXCX 2PUUA 2CN5A 3IO7A 4MBIA 2Z7RA 1PXLA 3VS7A 2PUIA 2OKRA 2P4IA 2VTJA 2UV2A 4TT7A 4B7TA 1QCFA 2HW7A 3IW6A 4GT3A 3FLSA 2Z02A 3DXQA 5ANKA 4EOMA 3QWJA 3EQHA 3OBJA 2ITZA 1JPAA 3QKMA 4H1JA 3EYGA 4FE2A 3EH9A 1W98A 2CLQA 1BKXA 4IVBA 4Y8DA 3Q3BA 2J6MA 4K1BA 4YZDA 4YC6A 4C33A 3H30A 4BZOA 2P2HA 5M06A 4XBUA 2VWYA 5KMOA 4DFBA 3E87A 3LFFA 3CTJA 3ORIA 4I21A 2AC5A 2VTQA 3NRMA 4WA9A 3TZ9A 3H10A 3ZO2A 5JFWA 4KIOA 4XLVA 3W2RA 2X8DA 2C6DA 1YXVA 3GU4A 5AAEA 5CX9A 3S95A 3D0EA 2QG5A 4FTRA 4D55A 5IEXA 3PWDA 2W4JA 3W18A 4MK0A 2VWXA 3WOWA 5JFSA 5G6VA 2VGOA 5AUTA 2BHEA 4O6EA 2PULA 4BDFA 5IA5A 3PVUA 4DFZE 4I20A 4EONA 1ZOHA 3HDNA 4NKSA 4KRCA 4Z9LA 3V6SA 3A7GA 5CI6A 3RK7A 3VF9A 4NJDA 4A07A 3KRXA 4C57A 5ITAA 3GCPA 4IDTA 4MNEA 4UYNA 2F4JA 1HOWA 4J71A 4NT4A 3QAME 4DTKA 3LLAA 5CLPA 4EUUA 3UJGA 3KXXA 5CQUA 5EQYA 5B2MA 2WHBA 4BTJA 3O23A 4MX9A 5C03A 3H9OA 4HVGA 4IAFA 3QKKA 2A1AB 4U45A 1FGIA 3QRTA 1VJYA 4GFGA 2YIWA 4BGQA 4BY9E 4USEA 4FNYA 4GMYA 2YITA 3DDQA 3KEXA 4MH7A 3T9IA 4PX6A 4RWLA 4ERKA 2RFSA 4TXCA 3CBLA 4CXAA 3C0GA 4KIQA 5TF9A 5HLWA 5CSXA 4DFUA 3HYHA 5E90A 4E4XA 3KL8A 3UPXA 4A06A 5DE2A 4Z3VA 3VVHA 2R3KA 3RM6A 3ZFYA 4JAIA 3ZH8A 4EOPA 1QPEA 4RGJA 4JAJA 3RWPA 2W1FA 4TWOA 3AC3A 5M4FA 2UZWE 2J0MB 2X9FA 3EQGA 1YWVA 1ZAOA 4IBMA 3QRKA 5CVGA 4DGLC 5IMXA 3LMIA 4RX9A 4YC3A 4O84A 1XO2B 4NFMA 1PRYA 4QP1A 4GSBA 3NMUF 4FT5A 4HZSA 4EOLA 3T9TA 1PXNA 4CFNA 5M08A 4XG8A 1CKPA 3DNEA 4HGLA 4KKHA 4N6YA 5B2KA 3UC3A 3O8UA 3DV3A 4U97A 1PXMA 2XMYA 3VW6A 5AUUA 5E9EA 3ELJA 2CDZA 5AP0A 3MY0A 4F08A 1GNGA 1OKVA 1Y6BA 4EK8A 5KUPA 3QHWA 3RWQA 1XH8A 4P4CA 3P7CA 3PIZA 5E8YA 1M7NA 4JG7A 1S9JA 1J7LA 3FHIA 2JAMA 3F5UA 4UMRA 3OCTA 4MBJA 4AP7A 3FMNA 4YBKA 3NW7A 4YTCA 2VWIA 5CASA 2CHLA 5E8VA 2WQBA 3VULA 2QOIA 2XYNA 3ZU7A 4IAAA 2J0KA 2WMRA 3N4TA 5EDQA 2HWOA 1O6YA 3R22A 4FBXA 4IB5A 5K0XA 4JDKA 4YJNA 3OWKA 3WE8A 2I7QA 1SMHA 3ALOA 3L9MA 5HNBA 4BDJA 2VTPA 2WQNA 2GFSA 2FO0A 1YXSA 3NX8A 4JG6A 4RWKA 1YDRE 2O2UA 2JEDA 4GIIA 3RINA 3VN9A 4XOZA 4NUSA 3WZUA 3VUTA 2BKZA 5HD7A 1FOTA 2I0YA 2XKDA 3ITZA 2X6DA 3PZEA 3F3ZA 3VQHA 2WQOA 4HGSA 5F95A 4HNFA 3TCPA 2FUMA 3UP2A 4NCTA 1P2AA 2CGUA 3OY1A 4M68A 4BDAA 3FZSA 2X7OA 3C13A 4HNIA 4IEBA 3FMKA 4JS8A 3MH0A 2CCIA 3ZZEA 3QC9A 3ZO1A 1TVOA 3NUAA 4ASEA 3ZBFA 2W1CA 4IM0A 3G15A 1H0WA 4CLJA 3WZJA 4GVJA 4AA0A 4ENYA 3I5ZA 1FQ1B 4AN3A 4WBBB 3D83A 1K2PA 2PMIA 2X2KA 3OMVA 4ZOGA 4D1XA 1M7QA 2FSLX 4IZYA 3BLRA 3QQHA 2BMCA 3EMGA 1P4OA 5GHVA 3BE2A 4FSTA 4MWHA 3S3IA 4RA4A 4XJ0A 2QURA 5BVKA 3EIDA 4GK3A 2X2MA 3BYSA 3KRRA 4K0YA 5HESA 2UZTA 4FEVA 2DWBA 2C69A 4FZ7A 3SXSA 4BYIA 2OXYA 5BVFA 3NUPA 4U7ZA 5GJGA 3WZKA 2VWZA 3QU0A 4I6FA 4IC7A 2UZUE 2XJ2A 3ORPA 4W4XA 5CU6A 1W0XC 5CALA 4YPDA 3MSSA 4LUEA 2LAVA 4DEDA 3ODZX 4L3PA 2CGWA 2GNFA 5FEEA 2JKQA 4IZ5A 3NUXA 3MH1A 1IEPA 1PMUA 1UA2A 4KSPA 4WNPA 5L8LA 1VR2A 3VJOA 1R3CA 4BRXA 4APCA 3PA3A 5CAOA 5HE1A 3BBTB 4NJ3A 5ETFA 3MPMA 3QTSA 2R3IA 1J7UA 1RQQA 4F6WA 2XIXA 4WNKA 3R8UA 4MVFA 3FI4A 4I4FA 3AC4A 4Z55A 5IQHA 4FT9A 3KN5A 4EL9A 4RX7A 3GC8A 3W55A 3G90X 4E8AA 4R7IA 4BGHA 3MIYA 3LCTA 2VUWA 1YHVA 1U4DA 1O6KA 3GB2A 4KBCA 4PF4A 5K9IA 3HRFA 4Y5HA 5M44A 4BCIA 2R4BA 3PVBA 3MFSA 4RSSA 4TYHB 3VW8A 2F7EE 1Q8UA 4I24A 3FXWA 2PUNA 3P79A 3DB6A 4IE9A 3TDWA 3LPBA 1OKYA 1ZRZA 1IRKA 1ZY5A 3FLQA 2F2UA 3ERKA 3GCQA 4KD1A 4M3QA 4RPVA 4UZDA 2HZNA 4EH4A 3Q9ZA 3PA4A 4O2PA 5HO6A 5JRSA 1MQBA 4JBPA 4C02A 2R64A 3SRVA 4RBLA 4H05A 1H1SA 3DFAA 2PYWA 5CT0A 3R83A 1JWHA 5HTCA 3ZEWA 2PVKA 5AV4A 4PL3A 5A4EA 1WAKA 4C7TA 3PXZA 5AUWA 2WB8A 3PA5A 2BIKB 4QNAA 4L7FA 4AOTA 4HCUA 4J99A 1OPLA 4C8BA 5LVPA 3P08A 5FTQA 3AC1A 4KSQA 4FT7A 3TTIA 1XQZA 5A3XA 3QCYA 4O7RA 4PDYA 4RA5A 1P14A 4FNWA 3ZBXA 4CV9A 1KE6A 5I9WA 1ZMVA 3QWKA 4FKUA 4BCHA 3QQJA 5HICA 4CSVA 5K5NA 2F9GA 1R1WA 4J7BA 1Q8ZA 2FSMX 2C47A 2DYLA 2ITQA 4NFNA 5CU2A 2OFVA 3BYMA 4D5HA 3QCQA 3NSZA 3MIAA 4QP8A 2C1AA 3HKOA 4FKQA 2HZ0A 2QNJA 3UOKA 5KCVA 4G9CA 3E92A 3A99A 3LMGA 4ZY5A 3BWFA 4C3RA 5IDPA 3LCKA 3POZA 4NWMA 4EK5A 4HOKA 3VUKA 2AC3A 4DH3A 3RGFA 1WCCA 3OXZA 2UZLA 4V0GA 4XG6A 2Y8OA 3ZRMA 5BUJA 4ZMEA 4LGGA 2P0CA 5GIOE 5M53A 5FD2A 3IOPA 2WIPA 5HBEA 1OECA 2R3QA 1Z57A 4UWCA 3NAXA 5E1EA 3ZO3A 4AGDA 2QHNA 1Y57A 3KC3A 3T3UA 4BTMA 3HX4A 2PE2A 4F64A 4AT5A 5AUVA 4F1MA 5F9EA 3FLWA 2UVYA 1OPKA 4RX8A 1GJOA 1IR3A 4PPAA 4IDVA 3OF0A 3Q04A 5BVWA 4ZSEA 3SV0A 4E4LA 4HW7A 3FKOA 2C6MA 3VRZA 5HO7A 5LMKA 2WTJA 4XRLA 2WMWA 3DB8A 4A9UA 4B9DA 2VTIA 4KAOA 2V62A 4YURA 5KMLA 2JLDA 5FQDC 4Y5QA 3HAVA 5CNNA 2YJRA 4L01A 3Q9YA 2PZ5A 4FV3A 4OTFA 4BCNA 5CANA 3ORXA 3UO4A 3R0TA 2OJ9A 3HMPA 4BHNA 2CCHA 1QPDA 2J50A 3EFWA 1XH7A 3F5XA 4IJ9A 4E6CA 3IW4A 2FVDA 2YACA 4LM5A 4P90A 1DI8A 3CCNA 4FT3A 3MY5A 2GHLA 2G2HA 3BKBA 3PY0A 3UIUA 3ORTA 2O65A 4B8LA 1WFCA 4AG8A 1Y8YA 1OPJA 5A6NA 3WIGA 5T6KA 3QCSA 1WVYA 4C61A 3UOHA 4K6ZA 2R7BA 2ZM3A 3CQWA 1NA7A 3DLSA 3L1SA 3BV3A 4YO4A 3NNXA 3PG3A 2XNEA 4WKQA 3PJ2A 1U5QA 3ZXZA 3VBYA 3RM7A 2B52A 3ZM4A 4Z7HA 4ZJVA 5L2IA 2WPAA 5HTIA 4G1WA 5G1XA 3KULA 4FTTA 1H1WA 3A8WA 4GUBA 4RJ5A 2W1EA 3LXLA 3SW7A 4FKLA 2XNBA 4F9BA 2AUHA 4MBLA 2XH5A 4OAUC 1M2PA 3NWWA 1Q61A 4ACCA 3AD5A 3P78A 4C4IA 2HELA 1W8CA 4WSQA 4F4PA 2ZMCA 2HXQA 3UOJA 3PJ8A 4RVTA 2X39A 2GS6A 2HENA 4TL0A 1Y91A 3OEZA 1OL1A 5EKNA 5H2UA 4LV8A 2QO7A 4OT5A 4DLIA 4NU1A 3V51A 3TJDA 4U6RA 4M14A 3QRJA 3UVPA 4K2RA 4NM3A 4FSZA 4S2ZA 4EYJA 3AGLA 1BL6A 4FV6A 2W1ZA 4FV9A 4RC3A 4ZMFA 2YFXA 3RAWA 4DH7A 2WOTA 2C3KA 2IW6A 4WNOA 1VYWA 4DEHA 1UU3A 2GDOA 2VTHA 4V04A 3ZUVA 5CVFA 4U80A 2O63A 4C0TA 3SGCA 4USDA 4BTFA 2B53A 2ZV7A 3LXPA 1ZYJA 2YAKA 3O8PA 5DRBA 5EHLA 3COHA 4AW2A 3VBQA 4PDOA 4K8AA 3QD4A 5D41A 5BVDA 3EN5A 4B6LA 3UIBA 3G9LX 3OUKA 4ALVA 3F3TA 4GV1A 4E4MA 3O2MA 2JBOA 4BKZA 5IUGA 1A06A 4FV8A 3U55A 1B6CB 5GJFA 2GSFA 2X7FA 5A14A 3FI8A 3W8QA 2P55A 3FZ1A 3K2LA 3IK3A 5AUYA 1JSUA 3DPKA 3L8VA 2ZYBA 4YPSA 4L3LA 5FBNC 4AT4A 4DT9A 2E9UA 4O7SA 3DAKA 5HG5A 4QMLA 3UYTA 5K4IA 3GQIA 4BFMA 4DCEA 3VRYA 3ZTXA 4NEUA 3GVUA 4FTCA 2ZM4A 1XH9A 4D4VA 3NW5A 4FNZA 2X9EA 4I4EA 3ZC5A 2CKQA 3GCUA 1W83A 1R78A 1UNGA 2OG8A 3U9CA 3RNIA 3OW3A 1H24A 1J1CA 3I6UA 4I5HA 3A7HA 3FMLA 4PQNA 4UEUA 3QUDA 3PRFA 3I81A 1S9IA 3CPCA 3RPOA 4D5KA 1NT2A 2JFLA 2PPQA 4RLLA 4TZRA 4MHAA 4ACHA 3B2TA 3UP7A 2YABA 2ONLA 3I60A 3CJGA 3PFQA 3LFAA 4L67A 4R5YA 3RPRA 3D9VA 4O7WA 4CTBA 1LR4A 4QMXA 2RGPA 3IW7A 3PE1A 3TTJA 3D5XA 2BTSA 3KULB 4ERWA 4CEGA 1J1BA 2X4ZA 3HV3A 3U4WA 5IUHA 2Y6MA 3ZLXA 4FIHA 5L2QA 3LFNA 4L8MA 5L2SA 3IW5A 4RZWA 5M4CA 4DCAA 3MTFA 2ERZE 3GQLA 2VX0A 4M12A 3IPHA 3WIKA 4I93A 2YERA 4MF0A 3JVRA 4I22A 3RMFA 3THBA 1Q99A 3UQGA 4ZSAA 4PMPA 3FKNA 1PKGA 4Q5HA 2WZJA 3ORNA 5C27A 5AM6A 4HVIA 5L6OA 3FSFA 4QYEA 4EOOA 3KK8A 2BPMA 3KB7A 4B4LA 1ZWSA 3LFDA 3MH2A 4TYGA 4BWKA 3KRLA 4IFCA 1G8AA 4DT8A 1YI4A 3TKIA 4XP0A 4EOKA 3PPKA 5GZ8A 3KMWA 1UKHA 2X2LA 2IZTA 3OROA 3R8MA 3ZS5A 4DGNA 5FXRA 4K33A 4A9SA 5J1WA 3Q9WA 2IW8A 2QI8A 5J9LA 4ZTHA 3KF4A 1NY3A 2V7AA 2XEYA 4KABA 4N70A 5HCYA 3R04A 4CFFA 5H3QA 3WF8A 4DBXA 4F0IA 4MAOA 4WUAA 2E9OA 3JY0A 4H58A 4KWPA 5HBHA 4UZHA 3QUEA 4D4SA 4N57A 2WU6A 1JKSA 4E93A 1JNKA 4L7SA 5DR6A 1DAWA 3W16A 3QZHA 3CD3A 4ZJJA 3NDMA 3UNZA 3MGYA 1XH4A 3C5UA 5M56A 2QOQA 3D7ZA 5HO8A 4QP2A 5EHOA 3NNWA 5DIAA 3QX2A 4UWYA 5T68A 5CVHA 4Z16A 4YJPA 4DITA 3HVCA 4FF8A 3SG9A 5D10A 5J7BA 3PXFA 1WBWA 5IQEA 4WT6A 5DEWA 3NNUA 1APME 3EJ1A 3WI6A 5EDRA 2FSOX 4RQVA 4XH6A 4Y83A 2QOCA 2X1NA 3W8LA 3TZ8A 5HZNA 3PUPA 2VWUA 3CGFA 1YWRA 2R3FA 3QTRA 4LGDA 4X0MA 2OJJA 3GU7A 4PTGA 4BGGA 2J51A 3OP5A 3V8WA 1YOMA 2QKRA 3I1AA 2B54A 3BYOA 4NSTA 3UO5A 5JQ8A 3CE3A 2NRUA 2Y6OA 4CFUA 5K0KA 2WTKB 3AMBA 4Y72A 5LMAA 1YKRA 3EQRA 3KVXA 3M11A 3NS9A 3FPQA 3FEGA 2UZEA 3QRIA 2X0GA 4ASDA 2PMNX 5K3YA 3TNQB 4BDBA 3HRBA 4WBOA 1PY5A 2IVTA 3K5VA 3N9XA 3NVMB 5C4LA 2W99B 3OG7A 4F7LA 3WBLA 5CSPA 1R0EA 2ITWA 3QQKA 3LIJA 4JR7A 4D0XA 5ANGA 4RZVA 4D2RA 2OWBA 5JFVA 3QXOA 3DY7A 4J97A 1IA9A 5C9CA 2C5NA 3DS6A 1LPUA 2G2FA 2C0IA 3FJQE 3ROCA 4GL9A 4IX6A 4GG7A 4WUNA 2H34A 4NM7A 4RFZA 1JKKA 2ZJWA 4L68A 4O22A 5LARA 4FTUA 2GFCA 2ZB0A 4N4SA 2O5KA 3LZBA 4FOCA 5CNOA 3DKGA 5EI6A 1H00A 3FI3A 3IG7A 5HLPA 2VTLA 5E7RA 5J79A 1PJKA 3H4JA 1YDSE 3BIZA 3I6WA 3W2SA 4FVPA 1FPUA 4O1PA 3NVKI 3O50A 4EH8A 4II5A 5CU3A 5CZHA 3QZIA 3UPZA 2QLUA 1WBTA 1JKLA 4BDEA 3OHTA 2VTTA 3IONA 3LXKA 4LI5A 2WD1A 5CI7A 4ZZOA 1ZYLA 5GINE 5C01A 1ND4A 4ZTNA 3DKFA 4X2KA 4I6HA 4AUAA 3BHTA 1WZYA 4LOPA 4RC4A 2WTKC 4M8TA 3VUIA 3B8RA 3ORMA 1W82A 3QTWA 4QNYA 4TYIA 4G6NA 4AQCA 3EFKA 5LVLA 5C8MA 4QMNA 4BDIA 3TACA 3RP9A 5GZAA 3D4QA 3FHRA 1F3MC 4I6QA 4CQGA 2OIBA 3D5WA 4YZNA 3EQBA 2IZRA 5LVOA 4IQ6A 4JX3A 4GJ2A 3CQEA 2HW6A 4CNHA 5JRQA 1LP4A 1NVQA 2YM4A 5ETAA 2Y4IB 3I0QA 3PJ1A 4FVQA 5BMSA 4FV0A 4RVLA 4E73A 3TL8A 2J5FA 3R8VA 3HGKA 1Y8GA 2WFYA 5CT7A 2XJ1A 5KE0A 4OAVB 2BAKA 2BZKB 3FC1X 4XG2A 4EHZA 2J0IA 2VNWA 3EFLA 2PMOX 2R2PA 4KIPA 3TKUA 4FSNA 2UZNA 4HZRA 3BELA 1GZOA 1F5QA 3BGPA 3E5AA 4JBOA 3PLAE 4EZ7A 1JSVA 4BI2A 1OB3A 2ITUA 4EH9A 3MA6A 4M0ZA 5HIDA 4JQ7A 4BI0A 5AR2A 4J95A 3CIKA 4IWPA 4ANBA 3CY3A 2CN8A 4GH2A 5L2WA 3QC4A 3ZLSA 1ZLTA 2VN9A 1BLXA 1SNXA 1YXXA 1Y6AA 3C4EA 3GU8A 4ZTSA 3W2CA 5AMNA 4D28A 1OVEA 4FIJA 4GK4A 4LGHA 4U5JA 2XK3A 4XLIA 2VGPA 3GU6A 3G33A 3NEWA 4AU8A 3LCOA 2OXDA 4RIXB 3C1XA 4JRNA 3F9NA 2JC6A 2QR7A 2WMAA 4O0UA 2F49A 3VIDA 4F6UA 1XR1A 3BGQA 1MRUA 2R0IA 5HVYA 5CAVA 5HG7A 3ACJA 4MQ1A 3AT4A 4F65A 3TV4A 5EI2A 4HVHA 3EQDA 2BRHA 5H8BA 2GPHA 4O7ZA 3QZGA 3C4WA 3BI6A 5J7HA 2X6EA 1PXOA 3R2YA 2P2IA 4G5JA 4ZTRA 4QYYA 4A9RA 2EVAA 4BBEA 3U54A 2ETMA 4XCUA 1M17A 4DG3E 2BZHB 4NZWB 3PSCA 3HNGA 5L2TA 4ZEGA 3QRUA 4IACA 3MPTA 5KKRC 3QQUA 2WEVA 4IAKA 4WD5A 2OGVA 4EWHA 4FV1A 2X8IA 4XP2A 5ANEA 1HCKA 3VUMA 3LOKA 4RQKA 1AGWA 5I9VA 3PRIA 4MWIA 5HOAA 1OL5A 1T45A 3OVVA 5CEKA 3R01A 4R77A 4QP7A 2J4ZA 4C3PA 3IDPA 5AP1A 1BUHA 3FQHA 4IJPA 1NVSA 1PMEA 4YNEA 1LEWA 4G2FA 3I7BA 4G3CA 5DEYA 2PHKA 2GQRA 4GYGA 4MXAA 3V5QA 2C3LA 3GCSA 5FDXA 3QTUA 3FZPA 4LMUA 1L3RE 3VBVA 3HV6A 4P5ZA 5E8SA 2PWLA 4UY9A 4RJ3A 3CD8A 3BYVA 2R0UA 2OH4A 3PPJA 2PVLA 4QMYA 2EXEA 4PWNA 4TWCA 3F3VA 3LCDA 4YZCA 4YHTA 1XH5A 3MFTA 3BEGA 4FC0A 1PMNA 1YVJA 4RFMA 3TXOA 4HYHA 4F0GA 2OIDA 3DNDA 5CSVA 3NCZA 5IUIA 1GZKA 2YWVA 4FVRA 4FKWA 2CKPA 2BDWA 3GENA 5EYCA 1WMKA 2EUFB 3EZRA 5CXHA 2C0TA 4BI1A 3QD3A 5BNJA 4BTKA 4YLJA 3EYHA 3EN4A 3C0IA 5L6PA 4NL0A 4H36A 5BYYA 5JKGA 1PF8A 4PMTA 4F99A 2WTCA 3AT3A 5J5TA 3ZM9A 1FVVA 3O0GA 2QCSA 1UU7A 1OUKA 2PMLX 4IXPA 4AA5A 4D2TA 3NIEA 1H08A 1ZYSA 5I9XA 4GKHA 2QOLA 2J2IB 4P7EA 2UZVA 5ANJA 5E8UA
chains in the Genus database with same CATH superfamily
5FRIA 3IW8A 4RRVA 2VO6A 3FMDA 4OR5A 4Q2AA 5GNKA 3VNTA 3RK5A 5IKWA 3ZRKA 3TUCA 1ZYDA 3FDNA 4ITHA 5JK3A 4FODA 3EN9A 3H9RA 1GOLA 3IS5A 4UXQA 2PUPA 2RFNA 1MRYA 3UNJA 4EUTA 3TIYA 3UG2A 2XCKA 4CCUA 5KZ0A 2G01A 2HXLA 4RIWA 4BB4A 1MQ4A 4IX4A 3UYSA 2NRYA 4YLKA 5KBQA 4O27B 4JDJA 4J52A 3MI9A 3DU8A 3WYXA 4DEBA 4EK4A 4CYIA 1M2RA 4BN1A 4Q9ZA 3ORKA 4X3FA 4O7NA 3SG8A 1H07A 4MNEB 3NYNA 4M84A 4YJVA 4Y73A 3EN6A 3R9DA 4IB1A 5I4NA 4FIEA 2FSTX 1WBSA 2R3MA 4ACGA 4LUDA 3G6GA 3S4QA 4C4EA 2E9VA 5AJQA 3RKBA 5LVMA 2DQ7X 3BPRA 1GIIA 5EM5A 1J7IA 1E1VA 2A19B 3Q53A 2F7ZE 3Q32A 4U44A 5BVNA 1KOAA 4M97A 5AR3A 4JT3A 5HX8A 1GAGA 5HQ0A 3EKNA 3ORLA 2PL0A 3HDMA 5ANOA 3PUFC 4O0SA 2PVRA 2JIIA 2JIUA 3DK6A 5AWMA 3ZHPC 3I5NA 4O81A 2BILB 3TNWA 3CR0A 4ZP5A 5EOLA 4FK3A 3SQQA 4J8MA 1PYXA 5HG8A 4EC8A 2W4OA 4LFIA 4QPMA 4D1SA 5HNGA 4FKSA 4JIAA 4YZBA 3ZSHA 1A9UA 4E6AA 3MFRA 5ETIA 3C5IA 4J96A 2OZAA 1O9UA 5CU4A 2GTNA 4CMUA 3UQFA 3SHEA 4DEGA 1H4LA 4HCVA 2C6OA 3MA3A 4YP8A 3FSKA 4PDPA 4EKLA 1YWNA 4C62A 1ZXEA 1W2CA 2W1DA 2Q83A 2JGZA 2WTVA 3OCGA 4CT1A 1T46A 5IH6A 4ZTMA 4HVDA 1SM2A 4RJ4A 4X6RA 4GK2A 5IISA 2CKEA 4FG9A 4BIDA 4JXFA 5E8TA 5FP6A 4FL1A 3F5GA 5IQIA 4Y95A 1Q97A 2X4FA 2XK6A 5JGBA 1G8JA 5E4HA 3F7ZA 3NUYA 4O0TA 5AP4A 3R8PA 1OGUA 5I5ZA 3AMAA 3QGYA 1PW2A 3W2QA 4A4XA 5AAFA 4M69A 3QTQA 3DQWA 5TKDA 1XHAA 2BDJA 2VWWA 3NYVA 5LCJA 3CP9A 1F0QA 1YOJA 2BFYA 3JPVA 3Q9XA 1DM2A 4QO9A 4S30A 5AX3A 3R8ZA 3WYYA 2B9FA 5ANIA 5LCKA 2ITNA 4YZMA 2FYSA 1OMWA 3ZLWA 2GU8A 2XM9A 4E5BA 2HIWA 3HECA 5CF5A 3BV2A 1E1XA 3LM0A 2CJMA 3FWQA 1TQMA 4LG4A 3MN3A 4C2VA 5KHXA 4RIWB 3QUPA 4K77A 4P2KA 3CKWA 5T3QA 1R0PA 3OD6X 2F7XE 3ZRLA 4D9UA 5FDPA 3GBZA 3L9NA 4RIYA 3EOCA 4ANOA 1H1PA 5DA3A 4GRBA 5AV3A 3RAIA 4M15A 2EXMA 4C4GA 3L9PA 4I1ZA 4ZZMA 5AA9A 5HVKA 1FGKA 4X3FB 3RZBA 5JZJA 4FTLA 4L9IA 4X2JA 3ATSA 1UV5A 4EC9A 2WKMA 4G17A 1FVTA 2YA9A 2VTRA 4X3JA 5AP3A 4DFNA 1OITA 4BZNA 5J5SA 5I9YA 4GCJA 1E9HA 4OTRA 5CAUA 3U9NA 2SRCA 3P5KA 3EN7A 4GT4A 5DRDA 2R3HA 4OTHA 4XV9A 4FKOA 5A46A 3S2PA 3FPMA 2XA4A 4CCBA 4BZDA 2OF4A 3PTGA 2JBPA 1P4FA 2OF2A 3HV5A 3HLLA 3KMUA 4J8NA 4FEWA 3FV8A 3PIXA 3LXNA 2RG6A 2YM3A 2GTMA 2I0VA 2NPQA 4YSJA 2JKOA 5DI1A 3VS6A 2Y0AA 3MTLA 3RPSA 3FC2A 4U8ZA 3UZRA 3EKKA 3GFEA 4JDIA 4QYHA 4O7VA 1IASA 5FXSA 3UVQA 1BYGA 3EB0A 3L9LA 3PY3A 3W32A 4UMQA 2EU9A 2XM8A 2YAAA 3U6JA 3PVWA 2OZAB 1YOLA 4DH1A 4IX5A 5EK7A 4RVMA 3C4CA 4G3FA 1GY3A 2EB2A 3PLSA 5HG9A 2BTRA 4XOYA 2XZSA 2X8EA 3GI3A 2XNPA 4A9TA 4IIRA 2I40A 4FGBA 1ZZ2A 3TG1A 4NCTC 2ITYA 5AP6A 3UNKA 2BROA 2IVUA 3F5PA 4QP6A 4N0SA 3PZHA 3F66A 3KKVA 1U59A 1H26A 3EQPA 4OBQA 4JI9A 4F1TA 4EWQA 2PZIA 3DCVA 4MNFA 4XG9A 3VO3A 2BUJA 5ICPA 3RBWA 3DOGA 4HYSA 5TT7A 2J9MA 3BLHA 4C35A 2J0JA 2UUEA 3VJNA 5CZIA 5DGZA 3A8XA 4FV4A 4FZDB 2G1TA 4XG4A 4BIEA 4LRJA 5KNJA 3DBCA 4OTWA 2VRXA 1KE8A 4AX8A 4F0FA 2PVYA 3DDPA 3ZYAA 2OXXA 4NW5A 4YJSA 3ML1A 4ANQA 5FM3A 3FLNC 4FUXA 3R02A 4FEQA 3H0YA 3ETAA 4GIHA 4AZVA 4OTDA 5IU2A 2B0QA 1W84A 3F2AA 4H3PA 2F2CB 3Q4ZA 4ZZNA 1VYZA 2I0EA 3LFSA 2UW5A 4RIYB 5H8GA 3LKMA 3FMHA 3SRVB 4C34A 1JQHA 3AQVA 3D14A 5CF8A 4G34A 1XBCA 4MKCA 5C1QB 3FQEA 2ACXA 4ZTLA 3KXMA 4KS8A 5FLFA 2XYUA 4JL9A 4FL2A 5D7AA 2W1IA 4XMOA 4DE4A 4DHJA 5K5XA 4FTIA 2XK4A 3UVRA 4W9WA 3VS1A 2W96B 4YUQA 2R7IA 4JVGA 4EH6A 3F7WA 2KULA 4UMPA 3VWAA 4EZ3A 3KXGA 4MXOA 5CF4A 4HYUA 1YI3A 3LHJA 2QU6A 3FY2A 2ITVA 3TN8A 2JDRA 3F69A 5I3RA 2O64A 1FMKA 4IWOA 3FYJX 2XB7A 4FICA 2XK9A 3ZC6A 3SVVA 5CEOA 3IKAA 4CGAA 4BVUA 3GP0A 3DJ6A 2A2AA 5IA2A 4DTAA 3V5PA 4ANSA 4D1ZA 3RPVA 4IVAA 4UX9A 3LFEA 3Q2JA 4DAWA 3UZPA 3RAKA 4IAIA 3FXZA 5C4KA 5EOBA 1MP8A 2JDOA 3AD4A 5EFQA 5BYZA 5EM7A 4CMTA 3EWHA 1UU8A 2Y7JA 3ZLYA 5JQ5A 4DEAA 2UW3A 3JXWA 3PP1A 4V0GB 5CY3A 3WZEA 1V0PA 4DBNA 5L4QA 3DXNA 4QYGA 4D2VA 3TM0A 5E1SA 4U43A 3R28A 3RNYA 2RL5A 4KKEA 1VZOA 3S0OA 3FMMA 5M55A 4F70A 2XKEA 3E64A 4UMUA 3BGZA 1KV1A 3Q60A 3BX5A 4BDCA 5KMJA 2YN8A 1Q41A 3TKHA 3M1SA 4IW0A 4OUCA 3SKCA 3ULZA 2QOOA 2B55A 3UMWA 3F3UA 1WBVA 3O71A 2R3RA 1UU9A 2ERKA 2VX3A 3G0FA 4JIKA 2YISA 4R6VA 3RAHA 4BL1A 4F9YA 3O17A 2OJFE 5HCXA 3R7GA 3Q4CA 4V01A 4AA4A 4Q5EA 5JH6A 2IO6A 3IQ7A 2QO2A 2C6TA 3GFWA 2PZYA 3H3CA 3KU2A 1KE9A 4FKPA 4OTIA 3EQIA 4GVAA 2UW6A 3FI2A 4ONAA 3BHVA 1PYEA 4LQMA 4IFGA 5CU0A 4MXYA 3NIZA 3BCEA 3MBLA 3PXYA 4Y85A 3PWYA 4M66A 3SW4A 2W5AA 4QOXA 2UZOA 1WVWA 3AXWA 1GIJA 3C0HA 3R7IA 2VZ6A 4H3QA 1BI7A 4OTPA 3UODA 4XV1A 4NTSA 5LOHA 2ZMDA 3C7QA 2ETKA 4ZXTA 4HYIA 3SA0A 3F2NA 5BMMA 2BHHA 1JKTA 3FMJA 3R1NA 5J9YA 2ITPA 4G6LA 4OBOA 4CV8A 2PU8A 4ZY6A 5BUIA 4OW8A 2PVHA 3R9HA 4C3FA 1Q5KA 2VX1A 3U6HA 2WTWA 4FG8A 2PVFA 2C30A 4BCPA 5HX6A 4F9WA 4BDKA 3BU5A 4WG4A 4RWJA 4IWDA 5ANDA 3MB7A 1YW2A 3DK3A 5F94A 2X7GA 3R21A 4CG9A 3TUDA 3OC1A 4BDDA 1RE8A 3QZFA 3LFQA 3L8XA 3W10A 5EW8A 3R73A 3MH3A 4UV0A 2NO3A 3Q6UA 2UVXA 3LCSA 4NM0A 5LMKC 3P23A 2OICA 2ZOQA 2GHGA 2H8HA 3OBGA 3U51A 3W0SA 3MWUA 3H0ZA 3FAAA 3NCGA 2OK1A 2A27A 4F7NA 3K3JA 3OTUA 2HY0A 2R3GA 3QQGA 3RALA 3ZSGA 3ZXTA 3R9OA 3BHYA 5J9ZA 4FSRA 2XS0A 2IJMA 3V5TA 1ERKA 4CZTA 2A4LA 2JFMA 3WZDA 5DFPA 4QTEA 1CSNA 2W7XA 1AD5A 3W2OA 4D0WA 5K4JA 2BRMA 3E63A 4LV5A 4PMSA 3ZO4A 2OJGA 3HA6A 4F7SA 5LJJA 2BRGA 3MFUA 4R3RA 4EORA 2AEGA 4CKIA 4MD8E 4Y46A 4CYJA 1K3AA 5IEVA 2QOKA 3RCJA 2OLCA 3ENMA 4O82A 4PMMA 4Z7GA 3AKKA 2R3LA 3EQFA 4KRDA 3KXZA 4AW5A 3U8WA 2XIYA 3VAPA 4ALWA 1A48A 3LVPA 2E9NA 2GNJA 5EHYA 4TYEA 4BR3A 5TR6A 3FZTA 5CEIA 3PJCA 2CKOA 4C4JA 3ANQA 5DOSA 3PYYA 4C36A 2Z8CA 4XV2A 3OUNB 4OTGA 4J98A 2XKFA 3QHRA 4S34A 1B39A 2UZDA 3LQ8A 5J8IA 2QG7A 2J0LA 4R3PA 3POOA 1W7HA 4E1ZA 3P7BA 2BVAA 4O0RA 5HVJA 4NW6A 2YM7A 4BF2A 3G9NA 1UWHA 1BI8A 4GS6A 4IVCA 4FTOA 4U3ZA 4WG3A 4M13A 4O38A 5DBXA 4AE6A 2C5YA 3N4UA 3AC2A 4FIGA 2OU7A 2B9IA 2O3PA 3E3PA 1Q8YA 4O0XA 4PDSA 4U79A 5DWRA 4XBRA 3T8OA 4OBPA 3FQSA 4M67A 3UOLA 3UC4A 3C9WA 2ZDTA 4F6SA 5A6OA 3JUHA 1G8SA 1Z9XA 2QC6A 5I3OA 5C8KA 5M57A 3R7OA 2P33A 2YIRA 4MQ2A 3V5JA 4EHEA 4A9YA 3FUPA 3DQXA 2IVVA 4O2ZA 1OKZA 2YEXA 4FV2A 4AGUA 3F88A 3D15A 4C4HA 5KBRA 5IPJA 4AZTA 4F7JA 2RFEA 2QOFA 1PXIA 3DT1A 3NZ0A 3BU6A 3E7OA 2XK7A 4J1RA 3ULIA 4N6ZA 3LQ3A 2DUVA 4ANLA 2W1HA 1XH6A 3LAUA 3V01A 2BIYA 3V6RA 5KMIA 4W4YA 1UKIA 3G51A 4BDGA 4O6LA 2OW3A 2C5OA 4LOOA 3EHAA 3OOGA 4AOJA 1QPCA 4YJUA 5JZNA 3PVGA 4BCJA 4O86A 3DTWA 4X6QC 2HK5A 5FEDA 3KRJA 3MESA 3HMMA 4EH5A 4PTEA 1MRVA 4HGTA 5BVEA 4BYJA 4MYGA 2JDVA 4ZLOA 3C51A 1SVGA 5CEMA 3O7LD 2E9PA 2V7OA 4G31A 3SD0A 2J7TA 2OI4X 4NK9A 3QKLA 4C58A 5CS6A 1LEZA 3OY3A 4WNMA 4WRSA 5A9UA 2I0HA 2HY81 2FGIA 5D1JA 4KB8A 4ASZA 3N51A 2YIQA 3TT0A 2IVSA 2C4GA 4GG5A 4I0TA 4QTCA 3R7UA 5M51A 3V8SA 5FTOA 2XKCA 1H01A 3GCVA 3AD6A 2XBAA 5FXQA 2QO9A 3E8CA 3TV6A 4IM3A 3DAEA 2ITXA 4C2WA 2XUUA 2PZPA 3G5DA 3GOKA 3FKLA 3QALE 4I6BA 3ZEPA 4H39A 2WMUA 1YQJA 5FEQA 5KMMA 2H6DA 5BPYA 3HAMA 2GS7A 2ONLC 2OJIA 4ZLYA 2YZLA 4DFYA 1M14A 2W9ZB 3GGFA 2V5QA 4QMPA 4AFJA 3JR1A 2YWPA 4DH8A 1Q24A 3FL5A 3LFCA 4AACA 4QD6A 4UB7A 4PRJA 3HEGA 4QMWA 4FA2A 4CFMA 5IMEA 2R9SA 3A62A 4PNIA 4YGAA 4F1OA 3COMA 3MPAA 2ZV9A 2B9JA 3CKXA 2QOBA 3DJ7A 3UG1A 4HPTE 5TO8A 5CXZA 4D2PA 2B9HA 3VUDA 2YM8A 3V5WA 2C6IA 1V0BA 2HWPA 3AC8A 2JDTA 4FZFB 2ITTA 4TPTA 4U40A 5E91A 4CFVA 2GNGA 3GT8A 5DG5A 2ESMA 1RDQE 3KREA 2XAMA 3DBEA 3KA0A 5AIRA 4W8EA 2O8YA 5FP5A 2H9VA 5HKMA 3UGCA 3W1FA 4W4WA 5DT0A 4DHZA 2EWAA 3W0QA 1UNLA 2JIVA 2YJSA 5IH4A 2B1PA 2HOGA 4TN6A 1RW8A 3C4XA 4HVSA 3ZDIA 3VS4A 2C68A 3R8LA 4XUFA 4DINA 5CWZA 5AR7A 4GFOA 3EFJA 4G3DA 4H3BA 2QR8A 3QQLA 1NVRA 2WIHA 4O21A 3WE4A 3OWPA 3FMEA 2QODA 4AW1A 4O4EA 5M4UA 2JKKA 2XBJA 3B8QA 2ZVAA 3SXRA 2XIRA 5IQFA 5E92A 3UBDA 1CKIA 5HNIX 4JQ8A 4G3GA 4JG8A 2CGXA 1OBGA 4L43A 1GIHA 4USFA 4YTIA 4QPAA 4D9TA 5H8EA 2HZ4A 3P0MA 2VAGA 2V55A 4LYNA 3WF7A 5EQPA 3BWJA 3CTQA 4QMMA 1YHSA 2C6EA 4JRVA 3UDBA 2Y4IC 3NYOA 2Z7SA 3QYWA 4OLIA 4B99A 4GYIA 4E20A 5C26A 4UWBA 4EYMA 3QL8A 4O96A 4OTQA 1PHKA 3IGOA 3GNIB 1VEBA 3LE6A 4IMYA 4E3CA 5HORA 3NGAA 1X8BA 3MJ2A 4BCQA 2BDFA 2XJ0A 4FSYA 2YCRA 5IA1A 3QCXA 3HUCA 4LL5A 3MVLA 4GEOA 4BIBA 4FEUA 3KQ7A 3ZZWA 4JMQA 4EH2A 5JN2A 4YJOA 3OWLA 3OXTA 4EOQA 1JAMA 3R7EA 2J5EA 2OBJA 4FTJA 3AC5A 1Q8TA 5EH0A 5F4NA 2QOHA 3DTCA 4QYFA 1RJBA 5CSHA 4NIFA 3WARA 1YHWA 4F9CA 3NFFB 3GEQA 4DDGA 4XX9A 3O51A 4FL3A 3VF8A 4MEDA 4WSYA 5D7VA 1W2FA 4KIKA 4L53A 2BAQA 4D2SA 3VUHA 4CVAA 3ZUTA 2IG7A 2JITA 4CKRA 3VUGA 2PE1A 4JNWA 1TQPA 5DR9A 2VWBA 2VO7A 2XF0A 4XP3A 1UNHA 4LL0A 5M07A 2QHMA 2XVDA 4R1YA 2GMXA 5E8ZA 4CZUA 1KE5A 1EH4A 2WMXA 3OOMA 2YLFA 3R6XA 5HI2A 4A4OA 5IF1A 3E93A 4RMZA 3W2PA 3CLYA 4PP7A 4B0GA 2JD5A 3G2FA 4CFXA 4CZYB 2IN6A 3AGMA 1ZMWA 2XK8A 2WMQA 4TKSA 5A4LA 3HRCA 3CGOA 4AGCA 4IWQA 4XG7A 4MF1A 4AWIA 4AAAA 5KHWA 4AFEA 2EB3A 3WF5A 4GT5A 1K9AA 1JBPE 4FZAB 2PTKA 3OZ6A 4FZ6A 3UIXA 5DLSA 5FBOA 3CSVA 2ETRA 5CF6A 5A4TA 3C4FA 3VHEA 3PY1A 3D7TA 5JEBA 5I9UA 3VONA 5GIPE 3DAJA 1H25A 4W9XA 2BAJA 2VTNA 2KTYA 3KFAA 3R63A 3PFYA 5C8NA 4MUQA 4TWPA 5ACBC 1UVRA 2XP2A 2JAVA 5AAGA 3A4PA 1OBDA 1BMKA 4AXAA 4FGRA 5LMBA 3ZMMA 1XBAA 3HMOA 3FBVA 4ZS4A 2REIA 4XHKB 4CKJA 1XBBA 2VTOA 3ANRA 4QPSA 4BCMA 4YHFA 1WVXA 5DNRA 4ANMA 2C3IB 1OUYA 2RFDA 2W17A 4APPA 3G0EA 4L42A 3I0OA 4DFXE 1ZYCA 4O7YA 4FTQA 1IAJA 3GXLA 4IH8A 4IAYA 3VBXA 4O4DA 5JFXA 4FTAA 1P5EA 3BZ3A 5AV0A 2R3OA 3MS9A 4PV0A 4RT7A 1OL2A 3R7YA 4EI4A 2PZRA 4F09A 3AOXA 4I5CA 2HYYA 3Q4UA 2OZOA 2W5HA 2Z7LA 5E8WA 4ZY4A 5I9ZA 4TRLA 2RF9A 3F2RA 4ZSGA 2W05A 2E2BA 3V3VA 5FTGA 4A4LA 3CXWA 3SOCA 4YU2A 4IC8A 2WOUA 4E5AX 4JJRA 4TYHA 4EEVA 1YXUA 3C4ZA 4FK6A 3DXPA 3EL7A 3A7FA 2VD5A 2VV9A 3GUBA 2YDKA 3OCBA 1OGYA 3PSBA 4O7LA 4FIIA 4QT1A 1QL6A 3Q4TA 5J87A 3V04A 3ID6C 4I5PA 3H9FA 3ZDUA 4ENXA 5IQDA 5DR2A 4WRGA 3E3BX 4NIFB 3U6IA 4BC6A 5D12A 4C4FA 3NLBA 4RLKA 2W1GA 1OL7A 3TUBA 5DN3A 3KXHA 3S1HA 2CMWA 4FMQA 5EKOA 4CT2A 5CYIA 3TIZA 3A7JA 2HCKA 3QX4A 4U0IA 4PNKA 4KIKB 5F1ZA 3SX9A 4L45A 1SNUA 2GNLA 3D5UA 3OT8A 4XG3A 4U41A 5TE0A 1H1RA 1WBPA 3TI1A 4CLIA 5I0BA 3F82A 4L52A 1U54A 2Y9QA 1M2QA 4AZFA 3NPCA 3HMNA 2A0CX 1BX6A 2ZDUA 1CDKA 2GCDA 2WELA 4CG8A 3JYAA 1CTPE 3NW6A 3OW4A 5LWNA 4BCOA 5GJDA 3VS3A 3RJCA 4BWPA 3K5UA 1YI6A 3JVSA 5DPVA 4WHZA 4X21A 5AUXA 4R78A 1URWA 3WF6A 3BU3A 3MB6A 4FSQA 2Q0BA 1ZOGA 3FZOA 3ACKA 3K3IA 4QP3A 1QMZA 4U3YA 5EYDA 3UQCA 3T3VA 3PG1A 3HZTA 2B4SB 4UYAA 4LMNA 2NP8A 3PP0A 4IX3A 1YRPA 5FGKA 4AZSA 3FLYA 4WG5A 5DYJA 3AT2A 1L8TA 4IM2A 4IB0A 1ZARA 5AEPA 3EL8A 1H8FA 3D7TB 3QTIA 5ACKA 3R71A 4EJ7A 4O4BB 4EOSA 4QQ5A 4I6LA 4QMTA 5KX8A 3BLQA 1V0OA 4E4NA 4UN0C 5J1VA 4I23A 3KXNA 4FSMA 5HBJA 3R9RA 4I5MA 3VC4A 5AR8A 3OCSA 2G2IA 4YBJA 2IW9A 4ZAUA 5BUEA 3TMOA 1JOWB 5AV2A 3TNIA 2C5XA 3DK7A 4DFLA 1REJA 4ZSJA 2XIZA 2I6LA 3QBNA 2VU3A 2C1BA 4BJJA 4ALUA 2WQEA 5HHWA 5CAPA 4QP4A 2O0UA 4ZLZA 4RJ7A 4R7BA 3QLGA 2GNIA 4EHGA 2BALA 4M7IA 3RCDA 4MCVA 2XALA 1H28A 1DS5A 1I44A 4RVKA 4FKIA 1OIUA 4YHJA 4XS2A 1B38A 4WO5A 3V8TA 3A4OX 4G6OA 4IVDA 4WIHA 4X7QA 5IQBA 3V5LA 4DLJA 4FI1A 3RK9A 2OIQA 3OWJA 4LRKA 4KS7A 3MVJA 3RTPA 4I92A 4YC8A 5EW9A 2XNGA 5EG3A 3WILA 5A4CA 3E88A 3BRBA 3SAYA 2PVMA 3U4UA 2QLQA 4FV5A 3CC6A 4QMSA 3Q6WA 1CM8A 5EI8A 4FG7A 4BCGA 3NUSA 4CMOA 3LFBA 3RHXA 4D2WA 2GQSA 3N4VA 3JY9A 3VBTA 3VS0A 1Q3WA 2WGJA 4R5SA 3PXKA 5EDPA 4X2GA 2IWIA 2QVSE 4R1VA 1NXKA 3TJCA 4L44A 5JGDA 4L46A 2FA2A 4FX3A 4IANA 4EBWA 3HL7A 1AQ1A 3DKOA 1U54B 3ALNA 3TNHA 4RWIA 3D2IA 5CSWA 1OIRA 5AP2A 4HGEA 3GC9A 3ROYA 2QQ7A 2WMVA 1GZ8A 4LOQA 4C38A 4CFWA 3P1AA 3PE2A 5IG1A 1KUTA 4KKGA 4RIOA 4PPBA 2OH0E 3R2BA 2W06A 2V22A 4FIFA 1KE7A 4GW8A 3P4KA 4RFYA 5CQWA 3HV4A 4FSWA 4ITJA 1ZZLA 4QP9A 4EK6A 3BE9A 3A7IA 4IADA 5LWMA 3HP2A 4PTCA 1U46A 4X3FC 3BYUA 3LJ2A 4E5WA 4YTFA 5B0XA 4DEEA 3CJFA 1H0VA 1Q8WA 3MVHA 4KBAA 3UE4A 2YM6A 4XYFA 4DN5A 4TW9A 5L8KA 4FKRA 4U9AA 4PL5A 2W4KA 3Q5IA 4ANNA 1KSWA 2YM5A 4UBAA 2GS2A 3QQFA 4EBVA 4M69B 2HZIA 4I94A 5DHJA 3A60A 4YLLA 4IZ7A 3F6XA 3E8DA 3KY2A 3ZCLA 2ZV8A 4FTMA 5M4IA 4BICA 3E8EA 4X2FA 5JSMA 5J95A 3LM5A 1SYKA 3CS9A 3QXPA 1JSTA 3W0OA 4DF3A 3GOPA 3PDTA 2YIYA 3OFMA 3QF9A 3Q52A 3K54A 4CRLA 5ETCA 4KUJA 4BJJB 5FG8A 3PPZA 4FRFA 3A2CA 5IA4A 4QMVA 1J3HA 5JT2A 4YJQA 4OGRA 4QQTA 2ZB1A 3RHKA 4I0RA 4QQJA 4O0WA 1FINA 5LQFA 5IH5A 2WMBA 5AUZA 4AW0A 3TDVA 4KBKA 4DYMA 3KF7A 1SZMA 5FUTA 4CTCA 3U87A 1XMMA 3R7VA 2XCHA 4B8MA 2PSQA 4BCKA 2BZJA 4FYNA 5BX0A 1QPJA 4L6QA 4BHZA 4JBVA 2JKMA 3NR9A 2AYPA 4QQCA 2FB8A 3FZRA 4WOVA 5EYMA 4BCFA 4R7HA 4U42A 4QMUA 4UXLA 2PE0A 4DEIA 4O7TA 4EQUA 2R3JA 4QRCA 3II5A 1ATPE 3UIMA 4QTAA 4RC2A 4YSMA 3MW1A 3A61A 2UW0A 5KZIA 4FTKA 3EQCA 4FKGA 2X81A 3BBWA 1GZNA 3QTZA 4GUEA 4P5QA 4ZSLA 4J53A 3BHUA 3QD2B 4RG0A 1Q3DA 3O8TA 2OSCA 3R1YA 1STCE 1URCA 3P86A 5JGAA 4JBQA 4S31A 4FNXA 3LMHA 5L6WL 3DZQA 4O83A 3BQCA 4K9YA 4D4RA 1IAHA 2YCQA 2NNWB 4ZTQA 3GU5A 5JMSA 2XIKA 1OKWA 4C59A 3LLTA 3R1SA 4S32A 1H1QA 4XV3A 4TNDA 1H27A 1V1KA 3E7VA 4EKKA 3KRWA 4I3ZA 2C3JA 4F9AA 3QFVA 5EQEA 3JS2A 5A4QA 2DS1A 4PPCA 5AP5A 2BKKA 3M2WA 3ZSIA 3COIA 3MJ1A 3I7CA 3MV5A 1WBNA 3P7AA 3ZONA 3HP5A 4ACDA 4BWXA 3ATTA 1G5SA 2WAJA 2UW4A 3EZVA 1BL7A 5A54A 3MDYA 2WNTA 5EW3A 3QD0A 2CSNA 2XNMA 2XRWA 5DT3A 2WMSA 2W9FB 4EH7A 2GNHA 4EQMA 5BYLA 5IQCA 4L3JA 4DHIB 4GJ3A 2IPXA 2Z7QA 1OIQA 1PXKA 3E8NA 5EM8A 5IQAA 5HCZA 3IGGA 3TV7A 1TQIA 3VS5A 2HAKA 3PXQA 4G16A 5HE0A 4EK3A 3DKCA 3ZOSA 2QD9A 1J91A 3IOKA 5AP7A 3QYZA 5CEQA 4I0SA 2R3NA 4D4YA 3OS3A 2BR1A 3DA6A 2XAOA 5HEZA 4D58A 1KWPA 5B2LA 4Q9SA 4DGOA 4M0YA 2V0DA 4MD7E 2WTIA 3P9JA 3VS2A 4EHVA 3OTVA 5CTPA 3I79A 5EYKA 3D94A 3TZMA 1IG1A 3NYXA 2UZBA 3LJ0A 3QA8A 5LVNA 5B7VA 4KNBA 5DT4A 2H96A 4E7WA 2CPKE 4ARKA 4JR3A 4DHFA 4NTTA 4QTBA 3RZFA 1PMVA 4NM5A 2CLXA 4G9RA 5HGIA 2B7AA 2XNNA 4O91A 3BQRA 4H1MA 4NKAA 5HLNA 1OI9A 2W5BA 2PVJA 4IAZA 4TWNA 2XARA 3DBQA 3IECA 3RVGA 4KA3A 2YIXA 4YMJA 2Y4PA 4ID7A 2RIOA 4HCTA 5IZFA 3LJ1A 5HE3A 4UALA 3ET7A 4BDHA 2BFXA 5BQ0A 4FUYA 4G3EA 2IZSA 3FY0A 3S00