4I93A

Structure of the bsk8 kinase domain (semet labeled)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
289
Chain Sequence
QFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase At5g41260
publication title Structural Characterization of the RLCK Family Member BSK8: A Pseudokinase with an Unprecedented Architecture
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 83
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i93A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i93A01
4V01A 3UIXA 4ASXA 1KE8A 2XJ0A 5L6WL 4RIXB 1E1VA 5DA3A 2VTJA 1BMKA 5CT0A 2XIYA 5M4IA 5JRSA 2XRUA 3KXNA 4E6DA 3RZFA 4KB8A 2VU3A 4WSQA 3DTCA 3TV4A 3A7JA 3OWKA 4BCIA 5M44A 4DFNA 3UO6A 2IPXA 1W98A 5CVGA 4RIWA 3G33A 3WYYA 3L9NA 4AP7A 4JRNA 2WZJA 4MXZA 3EN5A 2C3JA 4JVGA 4FR4A 4TWNA 3T8OA 3DKCA 2XBAA 1A9UA 2BDWA 3LXKA 3V6RA 4UWYA 4WNPA 4J99A 5ETIA 4YTHA 2XM9A 4PQNA 4C4JA 4M66A 4U80A 4R6VA 4R8QA 3IS5A 4UXLA 3UYTA 4AFJA 5CI7A 4O2PA 3QLGA 4FYOA 5IQGA 2BZHB 3A7FA 4PV0A 4Y85A 2QOKA 5K5NA 3QA8A 3TACA 5AP1A 3VVHA 2QONA 2YM3A 2BALA 1GZ8A 3F3VA 5B7VA 3PJCA 4OTPA 4RG0A 5CEOA 4I5HA 5DT3A 3KCFA 3H9RA 4O2ZA 4K2RA 2XIKA 3JXWA 5KMLA 2XNBA 3HA6A 2VN9A 3O2MA 3F82A 3P7AA 4F9BA 2CKOA 4BKYA 1B6CB 3F88A 5CI6A 4WRGA 4NM3A 4YJTA 3HMOA 4GK4A 4BVUA 4DH5A 3F2NA 5AUTA 2VTQA 2XM8A 3V8TA 2OJGA 4D4VA 2VZ6A 4FC0A 5DEYA 2Z60A 4JR3A 5A3XA 4TWOA 3RPOA 3KMMA 3UNZA 3QTXA 4FV7A 5GZ8A 3GU4A 1OIYA 2CMWA 1TVOA 2PVYA 3MW1A 2R64A 5DHJA 3OTUA 4IACA 3SRVB 3A8XA 4FTJA 4BR3A 4A06A 3BELA 4QYFA 4D2VA 3HUCA 3PXZA 1ZMUA 3C13A 4BDFA 3TTIA 1YOJA 2R0UA 4ZTSA 4PPBA 1W84A 2JDOA 4ALWA 4EOLA 4AGCA 4F7JA 5HOAA 3FI3A 5LOHA 3TCPA 3NUPA 5K0KA 1BL7A 2I1MA 2QOCA 3ZEPA 4E26A 3FLQA 3QTIA 5CF8A 4FZFB 2YJRA 3GFEA 3U8WA 4ARKA 4FV0A 3WIGA 3QQHA 1XHAA 3AD6A 4QPSA 2WMQA 4XHKB 5J7BA 4C59A 3ODZX 2EB3A 2ETKA 4DGNA 2GHGA 4F09A 3H10A 4IWPA 3C5UA 5AM7A 4C3PA 2PHKA 3NRMA 5AP4A 3LXNA 2J0JA 4OBPA 2J90A 3Q9YA 3R8LA 4USEA 4KKHA 2XKDA 5AM6A 2ZJWA 4IX5A 2IZUA 5D11A 2O64A 4EJNA 4RMZA 4AN2A 1GOLA 4K18A 1GIHA 3TG1A 4EUUA 2SRCA 4RA4A 4WG5A 3FZTA 4M97A 3UYSA 2F2UA 3RPSA 4F0IA 1OITA 3DQXA 4FVPA 5IU2A 5K9IA 3NX8A 3FPMA 1O6LA 2VNWA 1O9UA 2R3MA 3NGAA 5TF9A 2W4OA 3R73A 4D4SA 3BQRA 2HIWA 1VZOA 3ZRLA 4E5BA 5FDPA 2ZM1A 4KSPA 3D5WA 4J1RA 3AT2A 4DFUA 1ND4A 2UZVA 4G1WA 4D1XA 3UO5A 2PUIA 2JKMA 2NNWB 2WAJA 2YN8A 3UZPA 3HYHA 3CS9A 4LGGA 3FDNA 4CV9A 3DZQA 1OIQA 3WZDA 4IX6A 5FBOA 4YU2A 4QP2A 5IA0A 2YZAA 3QZGA 4GUEA 4GVAA 3EQHA 3SKCA 2V7AA 2AYPA 5CS6A 4F7LA 3DFAA 1PKDA 2JAMA 4DBNA 3SG9A 2WTCA 2J9MA 3FLSA 3DK3A 2UZEA 2W05A 4X3FC 4ZTRA 3NVKI 4TN6A 5GNKA 1XH8A 3U9CA 4FF8A 1OGUA 5E90A 5A6NA 4X6RA 3AC5A 1IA9A 3WF9A 5IA2A 4FG8A 5LXMA 4MNEB 2B0QA 5L2QA 2BCJA 3KA0A 4FNXA 4RQKA 4B8LA 2CNQA 4EI4A 3FXZA 4BCGA 3KRWA 4MWHA 4FSRA 3MB6A 3MVHA 4I0TA 3QXOA 3OCSA 4QQCA 1PXJA 2XZSA 5CAUA 2UZWE 5KX8A 3W55A 2WQEA 2QU6A 2ZV2A 1I09A 4BYJA 3L1SA 3QAME 1JSVA 5J95A 4JRVA 5BMMA 3RVGA 5JZNA 1Q97A 1RW8A 4ZLOA 2C3KA 4I4FA 2PVLA 2CSNA 4CT1A 3V51A 4UMRA 5LVLA 4DGMA 4DFYA 3UOJA 3UDBA 4EHVA 3I4BA 2OBJA 5CVFA 4MD7E 4I94A 2CJMA 4L68A 5DRDA 3R9NA 4ASEA 5HNIX 4EH7A 5FUTA 3R21A 3NW6A 2JC6A 1ZYJA 4DG0E 1OKWA 4OW8A 2YM4A 1H01A 1YXVA 2F2CB 4Z3VA 4GKIA 2F57A 3CGFA 5AAGA 2R3NA 4I3ZA 1IRKA 3CGOA 4J8NA 3JS2A 2VTOA 4C4HA 3MH3A 3KN6A 4UMTA 5HO7A 2WIHA 1YWVA 3PFQA 4QP8A 4RLKA 2VNYA 5CENA 2XEYA 4TT7A 4ZLYA 5M53A 3ZDIA 4XG7A 4XX9A 4IC8A 1H1QA 2BDFA 4R7IA 4JQ7A 4BDGA 2VWZA 2X2MA 3QQJA 4EJ7A 4LRJA 4NK9A 3IOPA 5CSXA 3HV6A 4IAAA 3NAYA 1GIIA 3NYVA 4WBOA 1PYEA 3MVJA 3QALE 4EONA 4G16A 3PLSA 4I21A 2R9SA 2QU5A 2XNGA 1IR3A 2C68A 3A4PA 4GV1A 5ANJA 3NZ0A 4TXCA 3UOKA 5I9XA 3D4QA 3UP7A 4GCJA 4AOJA 2GFSA 3LIJA 2PPQA 4WIHA 1Q5KA 1PYXA 1TQIA 4HOKA 2ITUA 3S95A 4D5HA 3FKLA 3D2IA 3DQWA 3B2WA 3ROCA 3WZKA 4CZUA 5DRBA 4PDOA 2B7AA 3AC1A 3TIYA 3UO4A 1M2QA 3T9TA 3IGGA 4ZZOA 4AT4A 4FZDB 3D83A 4HGTA 2W1CA 4IBMA 3MBLA 4ZOGA 4V05A 5M4FA 2QD9A 4FL1A 3QKLA 4KKEA 3MVLA 2ZMCA 3KULA 4FKQA 4WOVA 4L8MA 3RALA 3Q53A 3ZLYA 2W1GA 4CRLA 5J9ZA 4D2PA 3DKFA 4QP6A 4QTEA 3RAIA 3LW0A 3IW8A 4XS2A 1XH7A 5LQFA 3JUHA 4GK3A 5D41A 2CN5A 2BZJA 4E93A 5I9YA 4JR7A 2WTKB 3U4WA 2UZLA 4MXAA 5HORA 3BX5A 4YHTA 4AGUA 2OFVA 2W9FB 4B8MA 2WMUA 3PZHA 3SW4A 4RQVA 3A8WA 3BU5A 3EQDA 3FPQA 5GIPE 2ERKA 3BYVA 3UOLA 4UMQA 3VWAA 2Y6OA 3LQ8A 4DFLA 2PL0A 4D4YA 1P2AA 2PMIA 2Q0NA 3F61A 3I7CA 4Z55A 1CKPA 1H28A 3ID6C 3C9WA 3IK3A 4KAOA 4FT3A 3CKWA 4B9DA 3FSFA 4RC3A 4DAWA 2WTKC 2XBJA 4OTFA 4S32A 3TL8A 5DOSA 3NUSA 2GNIA 3NSZA 5IUHA 4EOQA 3AT3A 1YDTE 3D15A 1YOMA 3VRYA 5L2IA 4NJDA 4G5PA 4B4LA 4Y83A 3R30A 3SXSA 1UU7A 1Y8YA 2QHMA 3HV5A 3C0HA 4FTMA 4BZDA 4AF3A 2C0OA 4P5ZA 2WQNA 4AW2A 3TUCA 5D7AA 3IG7A 3ULIA 2GNJA 4C34A 2C6KA 3FXXA 4FKJA 4CVAA 3GU5A 3AMBA 1UA2A 1FPUA 5GINE 2G2HA 4QQ5A 1PXKA 1RDQE 1I44A 2EB2A 2HZ0A 3ZBXA 4UXQA 1LP4A 3BHTA 1JWHA 2OJ9A 2DS1A 3BPRA 4XP0A 2FSTX 5DLSA 3ZO2A 4JBOA 5HU9A 1QMZA 3QRTA 4CFVA 1OECA 3IW7A 2HWPA 4FSNA 5HCXA 3R22A 4BCPA 4ZZMA 3FLNC 2GQRA 3P0MA 5LVMA 1M14A 3B8RA 4QMUA 4O7TA 5DYJA 3EJ1A 4HGEA 3POZA 4F99A 4O84A 4NT4A 2ZM3A 5CQWA 1KV2A 3O8UA 3ZEWA 2WO6A 5BYYA 5HG8A 4FTQA 4FV3A 4EK4A 3GT8A 3B8QA 3TV7A 3D2KA 3UP2A 3VS6A 1BI8A 2XS0A 3COIA 4PL4A 4CRSA 4D0WA 1LR4A 2I6LA 3KF4A 1AGWA 4O27B 2RF9A 2R3FA 4H3BA 3DFCB 1ZMWA 3CD3A 2UZBA 5BX0A 3GOKA 4IQ6A 3QBNA 4N6YA 4D28A 5AP3A 5EQPA 3I5NA 2FSMX 2QOIA 4GL9A 3R00A 3NNUA 3WYXA 4USFA 1MP8A 2LGCA 4FK3A 3EFLA 5JN2A 3KXHA 4F64A 1Y57A 1JOWB 1JLUE 1KSWA 4YJOA 4E6QA 3V5PA 4RFYA 4TYIA 1T45A 1CKIA 4TYHA 3THBA 2W99B 3HA8A 4FMQA 4EH9A 2E9OA 3LKMA 2Z7RA 3BHUA 3RHXA 5BVOA 1AQ1A 1NXKA 3V3VA 3OW4A 1V0BA 1ZYDA 3H4JA 3PZEA 2KULA 3ZRKA 4K77A 3E63A 4GSBA 2X39A 1OKVA 2WMTA 1CSNA 4CG9A 2UZDA 2YLFA 2CGUA 2QOFA 4BB4A 1ZZ2A 2P4IA 2OXDA 5AUXA 3OFMA 4X3JA 2X9FA 4GMYA 4I24A 4OTIA 1F5QA 3WF6A 4NSTA 1H1RA 4Y95A 4PDSA 1WFCA 2IW6A 3RPRA 2QOOA 1DS5A 3K54A 4UYAA 4GJ2A 4LV5A 4EH8A 5HCZA 3RM7A 2C3LA 5IH4A 4JG7A 5M08A 3OD6X 2C5YA 4QT1A 3R7GA 5HE0A 3BU3A 3C0GA 4DH7A 5AR7A 4EBWA 1SNXA 2XCHA 3GU6A 4IFCA 1FQ1B 3V8SA 4M3QA 3ZSIA 5CXHA 3EKKA 3WARA 2I0VA 4EOOA 4FODA 5D1JA 4FIEA 4YGAA 4HNFA 3R1NA 1YI6A 5HQ0A 2JDTA 1SVGA 4PMPA 3EHAA 2V55A 2VWIA 4MCVA 5BUJA 5HO8A 3F5GA 3EN6A 4JX3A 2O0UA 5CU2A 4O7VA 3ZO3A 2RFEA 2RG6A 2GPHA 2XKEA 5HZNA 4JDHA 4IZ7A 3FZ1A 4BGHA 4NW6A 5HG7A 4R3PA 5HNBA 2GNGA 1NVRA 4F9YA 3H0YA 2PVKA 2BKZA 4L53A 2QO7A 3IQ7A 3MPAA 4HYUA 4U7ZA 3RZBA 5KMNA 4GFGA 3PVWA 4QPMA 2FVDA 4RGJA 5HBHA 5IF1A 1XH9A 4P2KA 5E1EA 4R3CA 4QTCA 4YLLA 5FDXA 3U6IA 3W32A 4DH3A 4G2FA 1U46A 3DBCA 5HI2A 3QZIA 5KZ0A 3UBDA 3G6HA 3QWJA 4GJ3A 1OPKA 5M55A 3V04A 4IVCA 3TKHA 3R1SA 3BEAA 4J96A 2CLXA 2IZSA 2R5TA 4XRJA 2W1DA 4G3DA 3MFUA 4H05A 2YHVA 3O8PA 4U6RA 3VHEA 5ETCA 3L9LA 4QMXA 1OB3A 2QKWB 1W0XC 1CKJA 3MJ2A 4BYIA 4YSMA 3EQIA 1NY3A 3VBXA 3K2LA 3G9NA 3OOGA 3H9OA 4E1ZA 3HDNA 3O23A 4J53A 4NU1A 4OTHA 4PNIA 3FXWA 4IZYA 4AZEA 3VC4A 4M7IA 5TOZA 4R7BA 1VR2A 3UVRA 3ANQA 3BI6A 3MA3A 2XIXA 4BKJA 3E88A 5HBEA 4IVBA 4RJ6A 1BUHA 1UKHA 2X2LA 3OUKA 5E9EA 1F0QA 4O83A 4X0MA 4TYJA 2YDKA 1ZWSA 5BQ0A 3KY2A 1VYZA 2XNNA 5GZ9A 5L3AA 4BC6A 4R78A 1YI3A 4Z16A 4DFXE 3ZLXA 1OZ1A 4I5CA 3E93A 2E9PA 3LPBA 5DR9A 5AP5A 2BMCA 1OM1A 5AUYA 1Q8YA 4DEDA 5A9UA 5FD2A 4N4SA 2UW7A 3A2CA 4AAAA 4DEGA 2XF0A 3DCVA 4WD5A 4D1SA 4IADA 1MQBA 3RK9A 2BKKA 4JLCA 3RM6A 4IWDA 3R7YA 4A9UA 4JX7A 2ZDTA 4CCUA 4O81A 3MS9A 3A7IA 4M15A 4XG6A 4BDIA 3FLZA 4IM3A 5GJFA 4GIIA 2VX0A 4ZSJA 2PVMA 1A06A 3KCKA 1J3HA 4LQMA 4NH1A 5FG8A 4BIBA 5BVFA 5IQHA 3PSBA 3I1AA 4U42A 2CGVA 4BTMA 4QMYA 1MQ4A 3FZRA 2XJ2A 3OF0A 3CIKA 3NPCA 4ITHA 4AT3A 5ACKA 5KMJA 1RQQA 3O17A 4PTCA 3D9VA 3TZ8A 1JVPP 3D94A 3FMLA 2WMAA 4JOAA 2VD5A 3G9LX 2OH0E 2W1ZA 2XH5A 3EFJA 4FG9A 1WMKA 3C4FA 2FGIA 3AGMA 3Q5IA 3SQQA 4BI0A 3ORZA 4FG7A 2Y0AA 1UNHA 2VO3A 5CEPA 2PE2A 4RIXA 3BLHA 4HGSA 3DAEA 4MD9E 2CPKE 3AG9A 3CE3A 3FUPA 2PMOX 3EQPA 2WMVA 1DI9A 3ZONA 1ZAOA 2NPQA 2HCKA 1PKGA 3ZC6A 4FGRA 4DEIA 2IJMA 2PZRA 2Y4IC 2Y4PA 4JG8A 4O1PA 4YJNA 3DJ5A 4BCNA 4RA5A 4O7SA 2RSVA 2RIOA 5FTGA 5AIRA 4AZTA 4RSSA 1UNGA 1YDSE 5T68A 5IPJA 2IN6A 2OGVA 2XNMA 3QFVA 3QX2A 3R8UA 5J79A 1E9HA 4S31A 2BVAA 5HGIA 4WNMA 4YJVA 1FMKA 1SM2A 3NWWA 4GYGA 2W5HA 5I9VA 5G6VA 4M69B 3ZXTA 5L2SA 3G15A 5HU3A 5CU0A 3AMYA 4MHAA 5AJQA 3VUIA 3UMXA 5H9BA 3ACJA 2RL5A 3PXRA 4NM5A 2W96B 2XKCA 5JGBA 4U3ZA 5AR5A 4WO5A 3PIZA 4ZZNA 1URWA 3ORLA 5IISA 3FMDA 3C50A 5KMIA 1ZMVA 5DT4A 4FZ6A 3EN4A 4I5PA 4JG6A 5BVNA 3ZZWA 5FRIA 3GB2A 2P0CA 4NM7A 3PVBA 3LM5A 5AR4A 4A07A 4FK6A 4YJUA 2VTIA 4KBKA 3R7IA 2GHLA 3EFKA 4NM0A 1O6YA 1OPLA 3RNIA 4UZDA 3IPHA 2GFCA 4MK0A 4ERWA 1PMVA 5IA1A 2QC6A 4DFZE 4HVIA 3P7BA 5LMKC 4YC3A 3PRIA 4Y72A 3TI1A 2R3OA 5L2WA 5DGZA 4IAKA 1JSTA 3UC4A 1OPJA 5DPVA 5DWRA 5AAFA 4R5YA 3CD8A 3LFCA 4P90A 4ZSGA 2QG7A 4QMLA 3BGZA 3EQFA 3D7ZA 3OBJA 1FBNA 2VO0A 2BHHA 3WILA 1Z9XA 1IAJA 3KVWA 1P14A 4WBBB 1YXSA 3QCQA 5EI8A 5JEBA 5HICA 3T9IA 3KC3A 3M1SA 4EOSA 1YWNA 5ANOA 4O0YA 2OJJA 3HRFA 3VN9A 4C4EA 2OZAB 2PE0A 4FTAA 3QA0A 2O2UA 2NO3A 1J1BA 2XMYA 4ZTHA 2P3GX 1QPCA 1UU9A 4EH4A 4IDVA 2CLQA 4FIGA 2PVRA 2QOLA 3PP0A 3VRZA 1HCLA 4W9XA 4ZK5A 3RP9A 4MBIA 4ZS4A 3GOPA 1ZOHA 2C6OA 3FY2A 2QQ7A 5M07A 5HVYA 2QVSE 1QPDA 1IASA 2J4ZA 3HV4A 3IW6A 4X3FA 4F1MA 3R1YA 5E8VA 2XK8A 4GS6A 4BL1A 5CEIA 2E9NA 2OSCA 3R9RA 1HCKA 4RLLA 4FSUA 5EM8A 5IEYA 1OUKA 2JD5A 4YZBA 3UPXA 4ALVA 3AD4A 4ZTQA 2HYYA 2ITQA 2VTAA 3FKOA 3OY3A 4FZAB 1KE9A 1M52A 3KEXA 3GCQA 4DC2A 5JH6A 3PY1A 4XCUA 1OIRA 1WBNA 4EC8A 3TNHA 1U54A 3K5UA 3WE4A 2VUWA 3E87A 4FV6A 5IQEA 3KVXA 3PPZA 3V5QA 4IX4A 4MX9A 3DAJA 4FTOA 4ZSEA 2ITOA 2XKFA 3U4UA 4EOIA 4L44A 4ITIA 5A4QA 2BFYA 3LMGA 4CMUA 2J5FA 3HEGA 5CEQA 2X6EA 4BWKA 5HBJA 3QCXA 3I0QA 4GFOA 4PP9A 3D0EA 3W2PA 3E8NA 4F6UA 3G5DA 2W9ZB 3EN7A 3F7ZA 3PWYA 3OMVA 3QKMA 4C2WA 3ORTA 4CFFA 4R3RA 5CSHA 2W0JA 1GZOA 3EH9A 3OG7A 3BCEA 3SD0A 2WKMA 1W8CA 4RIYB 2GS2A 3CXWA 4G31A 3N9XA 3Q6WA 4XJ0A 1WVYA 2FUMA 4BDKA 2G2FA 4Z7HA 4IHPA 4JDIA 1DAWA 3OC1A 4BWPA 5AX9A 1PMNA 5D12A 5JFWA 3MA6A 2HW7A 1LEWA 3KK8A 3MYGA 2QURA 4F0GA 5BVDA 4CKJA 3CSVA 3M11A 2ZYBA 1QL6A 3BYSA 3RCJA 4KABA 4ZXTA 2YM7A 4IM2A 2BILB 5FEEA 3S3IA 4F08A 4AN3A 3EZVA 4D9TA 4AZWA 4U41A 1YHVA 5I5ZA 3D14A 4AXAA 3GQLA 5AP2A 4LV8A 2R3GA 1XH5A 3Q32A 2X8IA 2W4JA 2X7OA 3HP5A 3PUPA 2VTTA 3QCYA 4CLIA 5TT7A 2F9GA 2C6LA 3QQKA 4WA9A 4XG2A 3HP2A 1ZRZA 4HGLA 1OUYA 5LMAA 3VNTA 3FMNA 3I6WA 4KRDA 4NFMA 3PE1A 4TW9A 4O7WA 3K5VA 4FNWA 4JDJA 3W8QA 2ZDUA 2R2PA 5CZIA 2A1AB 5ACBC 3I81A 4IAZA 4RWJA 3S2PA 2UW6A 1J1CA 4RJ5A 4YC8A 1OI9A 4CFXA 3H30A 4EYMA 5HEZA 3CTHA 1XO2B 4ITJA 4G9CA 5LWNA 2QO2A 3R9DA 2Q0BA 3NUNA 4C02A 3TNQB 3ZDUA 4J8MA 1ZY4A 3KF7A 1YRPA 5JSMA 2FB8A 5LJJA 4L42A 2ITXA 5GJGA 4GVJA 2X7FA 4E5AX 3LQ5A 4YJSA 2BZIB 3E3PA 3IO7A 3I60A 5FQDC 4JBVA 4YTCA 2YCQA 1JBPE 2CN8A 2XP2A 4UV0A 3GC8A 4ALUA 5B2KA 5BUIA 3FYJX 3BYUA 3AC2A 3SLSA 1H1SA 4QOXA 4MBJA 4OTWA 4IH8A 1BYGA 3AGLA 5HE3A 5EW8A 2GS6A 2R3IA 2VV9A 2C5VA 5EQYA 3PJ3A 2YITA 1SMHA 2KTYA 4ANBA 3T3VA 3KU2A 2F7ZE 3P08A 3PWDA 3L8SA 3LFBA 3BRBA 4ZP5A 4J98A 3V8WA 3ZLSA 5CEKA 1PXPA 1ZOEA 2OJFE 5CY3A 5D9HA 3F7WA 2CHLA 1QPJA 3VBYA 4CEGA 4NTTA 2YIYA 3MFSA 2HK5A 3VW8A 4W8EA 5HX8A 3R7VA 2FA2A 3FJQE 3MH2A 4FEQA 5AV1A 3VS0A 2C1AA 4EWHA 4K6ZA 2VRXA 5BVKA 5C01A 1UVRA 3OEZA 5CTPA 4O7ZA 1U5QA 4BF2A 2CDZA 4FIHA 2WTWA 3VS1A 4EH5A 1YOLA 3CC6A 2BTRA 3HV3A 4QYHA 4BTKA 3ZXZA 3BLQA 2IVUA 4F7SA 4J52A 3FQHA 2XRWA 2J6MA 4EZ5A 2BR1A 1BX6A 3ZZEA 1YI4A 2IVSA 3HL7A 3HNGA 3SOAA 5CEMA 2VWVA 2PYWA 3MY5A 3BBWA 3PA5A 3F6XA 4I6HA 2O8YA 5L6PA 4K1BA 1XWSA 2OLCA 4ANQA 5DBXA 4AQCA 3I7BA 2YIRA 4AW0A 5EQEA 3WZUA 1M2RA 4UEUA 3FMJA 3ZCLA 4IX3A 2JEDA 4PDPA 4FIJA 4O0WA 4Q5EA 3TT0A 2ITNA 4FNZA 2OIDA 5AWMA 3DBFA 4C0TA 3EQGA 3ALNA 2GQSA 1JPAA 2XK7A 4FEXA 2CGWA 5E8ZA 4TKSA 2EXCX 4I4EA 4YURA 2VO6A 4O0TA 4TNDA 2GDOA 4JQ8A 2RG5A 1YDRE 3JYAA 3LVPA 3NYXA 2OIBA 3LFDA 1Y6BA 2C6TA 2PZYA 4WG4A 3VF8A 2REIA 3W8LA 3ZMMA 4FUYA 1U4DA 5EDRA 3FI4A 1XJDA 3R71A 2HZNA 4M13A 4EC9A 5I9WA 4E4LA 2JFLA 4D9UA 3VQUA 4KUJA 4G3GA 5J7HA 1WBVA 3REPA 3Q04A 2ITTA 4FKWA 5J87A 1J7LA 3RCDA 1OBDA 1H00A 4O86A 3DNDA 2RFSA 2UZNA 4IWQA 1LUFA 4BCQA 5HLNA 3ZS5A 4D2RA 5KKRB 2IZTA 3ODYX 2VTNA 1U5RA 4BGQA 1LPUA 1M2PA 4QMSA 3G2FA 4YZDA 4BIEA 3TKUA 4AA4A 4KNBA 4ZMFA 3UC3A 2B53A 3E7OA 3E5AA 1H0WA 5JFXA 2AUHA 4QMZA 5HX6A 3V6SA 3SOCA 2QOHA 2BRGA 5LARA 4PMTA 4PMSA 3R0TA 3ORMA 3QTZA 4ID7A 5KKRC 2WMRA 3BBTB 3Q4ZA 2QLQA 3GCPA 4QP9A 5IG1A 2C3IB 1Q24A 3UE4A 3Q2MA 5HVKA 5IUGA 4DT9A 5FGKA 4IVAA 5EW3A 4LOQA 3WF8A 2PWLA 3NIEA 4AE6A 3RKBA 2UW9A 4DHFA 4EQCA 4NYEA 4ZLZA 4I92A 2B9JA 2OO8X 1OL5A 3FWQA 5JRQA 4J7BA 1H08A 2PE1A 4ZTNA 5IUIA 2BDJA 3BEGA 4IZ5A 5CX9A 3NNVA 5IQBA 3GU8A 2O63A 4YLKA 4MBLA 4CNHA 5IEXA 4FOBA 2WOUA 4PL3A 4O7RA 4QYGA 4XOYA 3HMMA 5E8UA 3V01A 1B38A 2BRBA 4GIHA 3QKKA 4O0SA 2VTRA 4RJ3A 5EYMA 4MVFA 2YM8A 1R0EA 2YLEA 3I5ZA 3LFNA 3Q60A 3CEKA 1Q4LA 3U6HA 2X8EA 4FBXA 5EYDA 4DA5A 5H2UA 3OCTA 4G3CA 4EK8A 4UALA 1PW2A 3GP0A 2XB7A 2YEXA 3ERKA 4OTQA 5EM6A 3GCUA 5J9LA 2UZTA 4MH7A 2G01A 2PVFA 2VGPA 4GH2A 4PY1A 4Q9SA 3GEQA 3WF7A 4U97A 4F9WA 2RGPA 4ZTMA 3MFTA 3QC4A 4QMOA 3R8PA 4F1OA 3RINA 4NTSA 4GU6A 3M42A 2NRUA 4S33A 4RVKA 3CQUA 1G3NA 2V22A 3F3TA 2IG7A 3EB0A 2Z7LA 5BMSA 3TKIA 3LFQA 1Q8WA 1XH6A 5T6KA 3VUMA 4APPA 4EK6A 3QGWA 4D2SA 4FGBA 2VWYA 3PXKA 3Q9XA 5C9CA 3SG8A 4DTBA 3BHYA 5CLPA 3VS4A 4YHFA 1F3MC 2WTJA 4J95A 3DLSA 5CQUA 4XH6A 4KIOA 4DLIA 4PDYA 2OG8A 2PZPA 3II5A 2GS7A 4CCBA 4RVLA 4O7NA 3GVUA 3TTJA 3OROA 3F69A 4BBFA 2Q83A 4C4IA 3VW6A 4FVQA 4L52A 5F9EA 3TUDA 2F49A 3VUHA 4Q2AA 4IAFA 2EXMA 3IOKA 4KWPA 4BDEA 2HAKA 5KBRA 4FSTA 4FTNA 4BTFA 2YAAA 4E3CA 3NYOA 4RC2A 4BDCA 3VIDA 5I9UA 4YNEA 5J8IA 3PDTA 3EYGA 3ORNA 1KE5A 3QQLA 4RX5A 2A27A 3LOKA 1IG1A 3OEFX 1UWHA 3AD5A 3P5KA 4LGHA 5IQFA 2OF4A 2OXXA 5KE0A 4AWIA 4RVTA 5KCVA 2GNHA 3D5UA 2I0EA 4HZRA 4IMYA 4KRCA 5AV0A 2YIWA 4EQUA 1OKZA 1NW1A 2BZKB 3HLLA 4TWCA 4L01A 2HOGA 2R3QA 3EQRA 4L00A 3KFAA 4EEVA 1LEZA 2B1PA 3MDYA 4FSZA 4FKTA 3F5UA 4CYJA 5M57A 4HYHA 4FKLA 3S0OA 3HECA 5LWMA 3QTWA 4G9RA 3QUEA 3DJ7A 4L6QA 3U55A 4BZNA 2XYNA 4UYNA 5BYZA 4DEAA 4BCOA 1S9IA 4L7FA 2JIIA 5DR2A 1OMWA 3UTOA 4CFNA 4UMUA 1URCA 4CQEA 5AUVA 4AGWA 3QD3A 3PIYA 3KRLA 1GY3A 4FZ7A 4W4VA 4CD0A 4XV2A 2YM6A 3MJ1A 3ZFMA 4UMPA 3FI8A 4L45A 2HZ4A 3RNYA 2XA4A 4HPTE 4XG4A 2C0TA 4KS8A 3OWJA 5CT7A 3VS3A 4ACGA 4BHZA 1YXUA 2C6EA 2YDJA 4G34A 3TZMA 3FQSA 1V0PA 4C58A 2P33A 5BPYA 3ATTA 5EDQA 3O96A 4PPCA 2OW3A 3C4ZA 2J7TA 4YPSA 2HWOA 3DNEA 1YHSA 3IECA 3G51A 2X2KA 3KULB 4FKVA 4LRMA 1VYWA 2BTSA 3FSKA 3Q3BA 3W18A 5JT2A 3ENMA 1YXTA 5KHWA 4IC7A 3NMUF 3A99A 2ZV8A 3H9FA 2QR7A 3CLYA 4RPVA 4RZVA 5LVOA 2VTMA 5LCJA 3CY2A 3BWFA 2Z2WA 4DEEA 2WTIA 4JJRA 4PPAA 4FKOA 3OCGA 2B9FA 3GUBA 3PG1A 3MY0A 3OWLA 2HXLA 4UY9A 4CZTA 5FXSA 2H9VA 3QYWA 4YLJA 4F65A 5CF4A 5HG5A 5GZAA 5EHOA 2WTDA 5C8NA 3FMEA 2R3RA 4PF4A 4DTKA 4XBUA 5EM5A 3FZSA 1WBSA 4FNYA 3IKAA 3EZRA 5HKMA 3FHRA 4FKIA 4M69A 4YZ9A 2JIUA 4A4XA 3LJ0A 5CF5A 5LMBA 4I0RA 3D7TB 4ZIMA 5DE2A 3ORKA 4BCMA 3C7QA 3KRJA 5ANIA 4IW0A 4RWLA 4TWPA 2FSLX 5KZIA 4C3FA 3ET7A 4KINA 2V0DA 3HGKA 4OTDA 5HTCA 3DXPA 4BN1A 4RFZA 2C6IA 4QYYA 5KUPA 5E4HA 2WB8A 2OI4X 5BUEA 3MTFA 5LMKA 2HENA 4F7NA 1YQJA 3P1AA 4OBQA 5HESA 5AFVA 3G90X 4WUAA 4K9YA 4CTCA 4WRSA 2O3PA 3LHJA 2OWBA 5GJDA 5CU4A 4MXYA 4W4XA 4L46A 5CZHA 5CANA 4M0ZA 5DT0A 5LVNA 4QNYA 4XLIA 4ZS0A 2QI8A 2QOBA 2UW3A 4JIAA 1J7UA 2DYLA 5KO1A 4BDDA 3E8CA 3OXIA 1KE6A 2VTHA 2X0GA 4BI2A 3W16A 3F5PA 3DAKA 3NCGA 4DN5A 3O8TA 3NNXA 4N6ZA 2HZIA 5FXQA 4WG3A 4QMVA 3LLTA 4QO9A 3C0IA 2WPAA 4E7WA 2FH9A 2OF2A 4NIFA 3QTUA 4QQJA 1WBWA 3MGYA 1BI7A 3QGYA 1PXOA 4YJRA 3TXOA 5AP0A 5IDNA 4V0GB 2ONLC 5HE2A 2WHBA 3R2YA 3T3UA 3V5TA 4LL0A 2J2IB 3LCTA 5HIBA 1UWJA 4MXXA 2QNJA 4QP4A 5HD7A 1JKTA 2WELA 3BGQA 4OBOA 1IAHA 3D5VA 4CSVA 3EFWA 4W9WA 3CBLA 3FYKX 4TYEA 5CNNA 4R5SA 2V5QA 2GNFA 1FVVA 4NUSA 4QPAA 3POOA 4A9SA 1JQHA 4OLIA 2W1FA 3F3WA 2OZAA 2UVXA 4JT3A 4O22A 3VF9A 3RWQA 3MESA 5EHLA 4IM0A 4RBLA 4YP8A 3UGCA 2JFMA 4B0GA 3QQFA 4JDKA 3GNIB 2BFXA 2VTLA 3I0OA 4TYHB 3UIBA 3ITZA 5F1ZA 3GQIA 4RX8A 3QLFA 1XBBA 2PZ5A 4IB5A 4JNWA 4AUAA 4EQMA 3KXMA 2G9XA 4KSQA 4ORKA 4EUTA 4RX7A 4J97A 1FINA 3TNWA 4FE2A 1PHKA 3C4EA 4CFWA 3ZM9A 3U54A 2A2AA 2WEIA 2X9EA 5HIDA 5E1SA 3OXTA 5CXZA 2ZB0A 3WZJA 4OTGA 5AA9A 2WNTA 5EH0A 4BZOA 3ORIA 3SC1A 1ERKA 3VBTA 2JBPA 4N70A 4E4NA 5ETAA 1H1WA 3VS7A 3MV5A 2WFYA 3OT3A 4I0SA 3OUNB 4MQ2A 2GTNA 2HW6A 2I0HA 2IZRA 4P7EA 5D7VA 4FI1A 3HRCA 4RZWA 4FTLA 1OVEA 1PXIA 1R1WA 3QC9A 4G6LA 4U9AA 4RC4A 5AR8A 4DLJA 2PY3A 3DZOA 1BKXA 3OBGA 3MVMA 3JY0A 3QF9A 4JQEA 4TPTA 3LM0A 4GU9A 4BIDA 3PSDA 3EQBA 3F2AA 3OP5A 4FV2A 4ANLA 3FLYA 3QU0A 5KBQA 3W1FA 3DDQA 3JY9A 1G8SA 2H34A 3PP1A 3LFSA 2JDRA 4FV9A 5AUWA 2YWVA 5TO8A 5EDPA 3VBWA 3MIAA 5TR6A 2OICA 3HMPA 4WNOA 2PSQA 3RK7A 4GUBA 1FGIA 4DF3A 4KBCA 1JKKA 3SDJA 5L6OA 3QRUA 3I79A 4ONAA 4EHGA 4FV8A 4ANSA 4X2GA 3VUGA 3MH0A 5EFQA 3QYZA 1WCCA 1XQZA 4GK2A 4U40A 2C5OA 3DDPA 4QTAA 4HYIA 3HMNA 3TEIA 3WI6A 2B55A 4IB1A 2C4GA 4FKUA 3NS9A 3P78A 4EYJA 3VHKA 4QQTA 5IDPA 1GZNA 1XH4A 3R63A 3ZLWA 3Q4TA 1PXNA 3KMUA 3G0FA 4A9RA 3UODA 4L3LA 4EORA 5AAEA 4MTAA 2IVVA 4O0RA 1SVHA 3PA4A 5A54A 4IAYA 5H8GA 3RTPA 1Z57A 3BV3A 3GC7A 2XK9A 5E8XA 3BE9A 3PRFA 5ANGA 4BWXA 4EH6A 3SRVA 4XV3A 3IW5A 3Q52A 3QD0A 4FT5A 4IWOA 4XP3A 1XBCA 3UQCA 4ZJIA 3QXPA 4UB7A 3ZOSA 4PL5A 1UKIA 2BUJA 4DH8A 4IANA 5J1WA 2R0IA 2BIYA 4BY9E 4YR8A 2ITYA 5IMEA 1DM2A 3AC4A 2IVTA 4XBRA 4AX8A 4BCHA 4FSYA 4LGDA 3OW3A 2F4JA 4LL5A 1FVTA 3A60A 3FMMA 3PXFA 4GT4A 4FUXA 3LFFA 5EK7A 2B9IA 2ITVA 5GHVA 4BCJA 3F66A 3WZEA 4B99A 2X7GA 1H27A 3FE3A 4BHNA 2YERA 3DS6A 5JQ8A 4FTUA 2PK9A 4IXPA 3C4WA 1KOBA 2JITA 4ERKA 4WSYA 3PYYA 4YC6A 5IEVA 4XUFA 1RJBA 2JLDA 5E92A 3HAVA 4DGLC 5DVRA 2UZOA 5C03A 5C26A 4C4GA 4WT6A 5FM3A 3RPYA 4GW8A 2X1NA 4UZHA 4FX3A 4EH2A 4F9CA 5KMMA 3PY3A 2VAGA 4EOPA 4EOJA 4PNKA 1DAYA 3NUUA 4EHEA 4O0UA 1P4FA 1Y6AA 4D5KA 4M67A 3GXLA 3ZTXA 2CCHA 4U45A 2EUFB 3G6GA 1MRUA 2JGZA 3TN8A 2OFUA 2Y8OA 1H25A 1UV5A 4L67A 2XNOA 3DJ6A 2WXVA 4ZY4A 5J5SA 4TTHB 2H96A 3TJCA 3QZHA 5A46A 4I22A 2BAQA 2YCSA 3DB8A 3LZBA 4OR5A 4FKGA 4I6FA 4M14A 4YMJA 5CAQA 4DT8A 1JNKA 3DT1A 5EOLA 4G3FA 3CQEA 4D55A 5F95A 3R8ZA 3L8VA 5B0XA 4NCTC 4AS0A 4R77A 3FKNA 3UG1A 4FSQA 2ETRA 4ZMEA 1V1KA 2BHEA 2X4ZA 3AOXA 3R9OA 3AMAA 4LG4A 1JKLA 4AU8A 4DINA 4EK5A 1SZMA 1K9AA 2W1EA 4A7CA 3UNKA 4AW1A 4CT2A 5HCYA 3IW4A 2E2BA 4CFMA 3LMIA 3LCDA 5AUZA 3SXRA 2BAJA 4HVDA 3LJ1A 3R1QA 4YTFA 2WTVA 1SVEA 3GENA 4R1YA 5BVEA 3DLZA 3LCKA 4MNEA 4NFNA 2CGXA 4ANOA 3A7GA 2BRNA 3FAAA 4EHZA 5DNRA 3NUYA 3QWKA 4Z9LA 4KIKB 3UVQA 5CSPA 4FL3A 4L9IA 3CPCA 1A48A 3Q5ZA 4A9TA 4M0YA 4I5MA 3PVGA 3PE2A 4UWBA 2A4LA 4QNAA 3FLWA 3ZSHA 2UVZA 1PRYA 4ZEGA 3VJOA 1L3RE 4GRBA 3WBLA 4YZCA 4E4MA 2VTPA 4W4WA 4C37A 3DPKA 3JVRA 5DI1A 1KWPA 2YM5A 5HLWA 3OWPA 2CKPA 3NR9A 2WOTA 4JS8A 4GT5A 1CDKA 4C8BA 3C5IA 1Z5MA 2J51A 2ITPA 5M4CA 4Y73A 4I6QA 3RGFA 4HVHA 1R3CA 3KK9A 5T3QA 4EKLA 1PMUA 3Q2JA 3SVVA 5D10A 3KXXA 5DN3A 2QG5A 3KKVA 4H3PA 2JDVA 4GG7A 3DBEA 4JXFA 4YZMA 3A4OX 3RBWA 4ZY5A 4CKIA 4YO6A 3NEWA 5I4NA 3W2QA 2OU7A 1PXLA 2ZV7A 4J71A 5JGAA 1PY5A 3NNWA 4KKGA 4D1ZA 3GFWA 4H58A 2NP8A 2A0CX 1UNLA 5CSVA 4X7QA 4ASDA 1MRVA 1R39A 4C7TA 1VJYA 4AFEA 2RFDA 5ANEA 1OL2A 2B52A 3VBQA 4O96A 2QHNA 2JBOA 3WE8A 2V62A 3QTSA 4RJ7A 3ZM4A 2PTKA 4TL0A 5AADA 4YTIA 4NWMA 4RWIA 3KRXA 3HUBA 4GYIA 4JBQA 3F3UA 5B2MA 4RWKA 1GJOA 4TZRA 2W4KA 3EKNA 5CSWA 2C6DA 1YXXA 2QO9A 2Y7JA 3QZFA 3FBVA 4FICA 2F7XE 4WKQA 4Y5HA 3SXFA 1P5EA 3AC8A 3HZTA 4QP7A 4QP3A 4F6SA 5AP7A 4FVRA 1H24A 4UN0C 4JBPA 4Q9ZA 4IB0A 2I0YA 3DTWA 2QR8A 1CMKE 3EQCA 3FV8A 3RK5A 4AG8A 3VULA 4CQGA 4CG8A 4PUZA 2PVHA 4A9YA 4QD6A 5IH6A 4HZSA 4OT6A 3FY0A 3QTQA 3PLAE 5EM7A 5H3QA 3VUDA 5EOBA 2X81A 3RJCA 4ACMA 4QMPA 2WD1A 1OBGA 2XVDA 4PMMA 5AV3A 3PIXA 3ZFYA 3BHHA 3TWJA 3VUKA 3ZFXA 4YJQA 2RFNA 2B9HA 4XV9A 4K11A 4C3RA 5HTBA 2JKQA 2IWIA 4G3EA 5EI2A 4F9AA 2Z7SA 2UW0A 4YBJA 1OL6A 2XJ1A 1WBTA 1STCE 4X2NA 5EKOA 1CTPE 4I20A 4X3FB 3R7EA 3DK7A 4O6LA 4KIPA 3FL5A 4B6LA 4XRLA 4FEWA 1BLXA 3GCVA 4X2FA 4FYNA 4W8DA 2C6MA 3LLAA 2I40A 2VWWA 3PJ2A 5A14A 4CKRA 5HD4A 4BI1A 3NYNA 5EI6A 5KMOA 4CGAA 5L4QA 4A4OA 3EMGA 4O21A 3GCSA 4MXOA 3TIZA 3BQCA 4FTRA 3EIDA 1U54B 3TNPC 4E8AA 2JKKA 2UVYA 5AMNA 4L43A 2O5KA 5E8WA 4NEUA 4RIWB 3R83A 4E73A 2CNUA 3HRBA 3O7LB 4G6OA 1O6KA 3C4XA 3KB7A 4EZ3A 2IW8A 3V5WA 5JGDA 3IDBA 4CTBA 2BRMA 4FTCA 3UZTA 4XMOA 5EYKA 4EK3A 1TKIA 5F4NA 4PTGA 5K5XA 5IA3A 2QODA 1JKSA 1V0OA 3DU8A 3VS2A 3F9NA 2YWPA 2J0MB 2ZOQA 5ANDA 3ULZA 1YW2A 4BICA 5CAVA 4BDBA 5EYCA 4RJ4A 2ESMA 4YZNA 4YPDA 4QMQA 2WMSA 4C2VA 4GKHA 5HTIA 2OIQA 2OJIA 3V5LA 4M84A 1Q8UA 3O51A 2X4FA 5AR2A 3IDPA 3ZO4A 4DGOA 1M17A 4F4PA 4G5JA 4RJ8A 1S9JA 2WQMA 4JI9A 2IO6A 4H36A 3P23A 4MNFA 3SAYA 4UX9A 4NZWB 3R2BA 3NLBA 4ACHA 2EU9A 4N57A 3QCSA 5ANKA 3ZYAA 5FBNC 3OT8A 4DFBA 3GU7A 3PY0A 3COHA 5KMKA 1EH4A 4AA5A 4X2KA 3L8XA 3CKXA 4YO4A 4O7YA 4F63A 1APME 1UU3A 4O6EA 3OOMA 5IQCA 4QMTA 1Q41A 4WUNA 4H3QA 3H0ZA 4IB3A 3FZPA 3R8VA 3NUAA 2HY0A 3KQ7A 2BIKB 3TZ7A 4LUEA 4O38A 4OAUC 4DGGA 3KMWA 4IVDA 4DEHA 3MN3A 2YACA 4WNKA 3LXLA 4FSMA 3PTGA 3R8MA 5B2LA 3TV6A 3CTJA 3DA6A 4E6CA 4QMNA 4U3YA 3EL8A 4FKRA 3DXNA 3QHWA 4CLJA 1WBPA 2FYSA 3ATSA 2XYUA 5IH5A 5A4EA 5IQIA 5L8LA 2GCDA 4HW7A 4NKSA 4LRKA 2EWAA 5TE0A 4BKZA 3KRRA 3OS3A 5C1QB 4FTIA 3TNIA 1Q62A 4LUDA 4BBMA 4PX6A 3PJ1A 2B4SB 3RPVA 1YKRA 4L3JA 3DB6A 4FT9A 5L2TA 1BL6A 4XOZA 5FLFA 4S30A 4AE9A 3W2CA 3FZOA 1PF8A 2R7IA 3GGFA 3BV2A 4AOTA 4FV5A 2VWXA 4O1OA 3WIKA 3QHRA 4FTTA 5F20A 4ASZA 4EH3A 1R0PA 2Z02A 4U81A 2XNEA 3Q9WA 2G15A 2RKUA 2W7XA 3ORPA 4U44A 3DV3A 3UNJA 2YCRA 3DK6A 3E92A 3OHTA 4XYFA 4Y8DA 2QOQA 2CCIA 3D5XA 1VEBA 2R3KA 4NJ3A 3R7UA 2J0IA 4CXAA 1R78A 2QLUA 2UZUE 3FEGA 4K0YA 3ZSGA 5BYLA 3FC2A 4E6AA 3LCSA 3PG3A 5KHXA 3BU6A 3HVCA 4YNOA 3R9HA 5K0XA 3ZC5A 2OXYA 2WU7A 2FSOX 5AX3A 1J91A 3MPTA 1P4OA 2WGJA 1YVJA 3O71A 4IJPA 5IA5A 4S2ZA 2G2IA 5K3YA 2XNPA 4HPUE 4HJOA 4RX9A 4DG2E 3K3IA 3VJNA 1WAKA 3GC0A 4OTRA 1KOAA 4ANNA 2A19B 5K4IA 3D7TA 3OXZA 3MIYA 1T46A 3CR0A 2UUEA 4U8ZA 4LOOA 2H8HA 1K3AA 4M8TA 5AA8A 4EZ7A 2W06A 5FEDA 4QMWA 3COKA 3ZUUA 3SX9A 4Z7GA 1W83A 2VO7A 3OCBA 2ZM4A 5M4UA 4HVGA 1PXMA 2B54A 4MAOA 3E7VA 4QTBA 5FTOA 4R7HA 4BBEA 4OUCA 2VX1A 1JAMA 4Q5HA 2ONLA 4U0IA 3PA3A 5IQAA 5HG9A 4OGRA 4AZVA 5J9YA 2W17A 4CFUA 1QCFA 5A4TA 3QD4A 4M12A 3MSSA 3ZHPC 4K33A 2Y6MA 2XK4A 3IGOA 4D2WA 2VWUA 4JL9A 3LE6A 2UW5A 5E8YA 3DBQA 2Z8CA 2C30A 2XUUA 4O7LA 2VWBA 4CMTA 2GNLA 1ZYSA 4C35A 5M56A 2ZB1A 3VQHA 4F6WA 4W4YA 1FVRA 3CP9A 4PWNA 4DCAA 3C1XA 3NW5A 2W5AA 3UJGA 5CYIA 3BGPA 5FM2A 2WQBA 3MB7A 1XR1A 4V0GA 4BDHA 5AUUA 3S1HA 4ZSLA 2CKEA 4IIRA 2WU6A 3KREA 3U9NA 2ITWA 5JFVA 4FT0A 1X8BA 2VX3A 4C57A 2UW4A 4O0XA 4MD8E 3O7LD 3CY3A 3VBVA 4D2TA 3L9MA 4CYIA 3AXWA 4P5QA 4GT3A 4AZSA 2UW8A 5AEPA 1WZYA 4FA2A 2GTMA 1REKA 1HOWA 4FKPA 3MI9A 1Q8TA 5AV4A 3QRIA 3ZUVA 3DGKA 5DMZA 3HDMA 2E9UA 4MXCA 1SYKA 5EW9A 1GIJA 5IKWA 5AV2A 3EOCA 4FKSA 3I6UA 4ACDA 3TDVA 4AZFA 5H8BA 1YWRA 5HNGA 3LFEA 2WEVA 5F94A 2YAKA 5E8TA 1MUOA 5J5TA 1L8TA 5HVJA 4P4CA 2R4BA 2YIXA 2DUVA 1Q3DA 3UG2A 2O65A 3W33A 2JKOA 4C33A 1FOTA 3BIZA 5H8EA 3ZBFA 3AT4A 3Q9ZA 3AQVA 2YISA 1NVQA 3QUDA 1PJKA 3NUXA 3KGAA 3PPKA 2YABA 5JMSA 1H0VA 2OK1A 2C5NA 2VTSA 4IAIA 4AT5A 4QRCA 4LMUA 3R02A 3Q6UA 4YBKA 3SW7A 5LVPA 3UPZA 4E20A 4II5A 4MF1A 4XG3A 5FXRA 5M09A 1H26A 4YUQA 3QD2B 1OIUA 4R1VA 1W82A 1U59A 4IDTA 3RI1A 4BDJA 5JK3A 1ZOGA 1KV1A 2OH4A 3E8EA 4NKAA 3RAKA 3QRJA 1Y8GA 2WQOA 5HO6A 1RE8A 3O50A 4ANMA 4QP1A 4A4LA 1WVWA 1GZKA 2PUNA 5DG5A 3RAHA 2PMNX 4AOIA 2PVJA 3PXQA 4D0XA 2PVNA 2XK6A 1B39A 2AC3A 2VGOA 3EYHA 4JIKA 4XV1A 5KNJA 3PVUA 4L3PA 1Q61A 3OZ6A 4U43A 2R3PA 5DR6A 3HAMA 4DG3E 2GQGA 2XK3A 2E9VA 4ACCA 3GI3A 4FEUA 4NW5A 4ZSAA 3DKOA 2QKRA 1IA8A 1PMEA 4CMOA 4CV8A 3L9PA 4I1ZA 4MF0A 4O91A 1H1PA 2BRHA 4FTKA 5E7RA 3ROYA 2J0LA 3BLRA 3V5JA 2PULA 4DCEA 1WBOA 3VO3A 4H1MA 4DTAA 1MRYA 3R7OA 5AP6A 2BPMA 2P2IA 3UQFA 3WF5A 3QL8A 4H39A 1Q99A 4EL9A 2ZAZA 2ETMA 5A6OA 4GG5A 3ORXA 3C51A 4RFMA 3E64A 3LMHA 2DWBA 2CKQA 3RAWA 4EKKA 2W1IA 3NAXA 2EXEA 1FGKA 1REJA 5JKGA 3UVPA 3MPMA 5CVHA 5C27A 5HIEA 5I9ZA 1GNGA 2C47A 4XG9A 4XG8A 3VUTA 1OL7A 2W1HA 2CNVA 5A4CA 2PZIA 4IE9A 2JAVA 1NA7A 2X6DA 3JVSA 1TQMA 4LM5A 4X2JA 4F0FA 3U6JA 5M06A 3Q4UA 3QUPA 5I3OA 5I3RA 3WOWA 4ZJJA 4BCFA 4ZTLA 2R3LA 3F3ZA 2I7QA 4HYSA 3LAUA 2PUPA 4QMMA 3G0EA 5ICPA 4QTDA 5CASA 3UOHA 4O82A 2AC5A 3BYOA 4TRLA 4USDA 2ZV9A 5C4LA 1M7NA 1OKYA 3FQEA 3BE2A 4WHZA 3VAPA 5EHYA 2PMLX 3COMA 1H8FA 2GMXA 3NW7A 3P7CA 2F7EE 5ETFA 2YIQA 2R3JA 4RVMA 4MWIA 2ERZE 3UIUA 3TDWA 3N4VA 3BZ3A 3OTVA 3DXQA 4QYEA 2XCKA 3N51A 3F2RA 2YA9A 5C8MA 3ZUTA 3SV0A 4U5JA 1NVSA 1SNUA 3LFAA 4K8AA 4BFMA 2PU8A 3IDCA 2G1TA 3R28A 4XEYA 3U87A 4C62A 3B2TA 2GSFA 3MH1A 3UMWA 3ZH8A 4AA0A 1ZLTA 3W2OA 3O0GA 1ZYLA 3CQWA 3CTQA 4KS7A 3ZO1A 1ZZLA 3K3JA 4NL0A 1H07A 3PJ8A 2YCFA 4NCTA 3ETAA 3FI2A 4ZAUA 2PUUA 4FV1A 3QQGA 2R7BA 4PRJA 4B7TA 5CAOA 5HE1A 1QPEA 2GHMA 2V7OA 3ENHA 3ELJA 3QQUA 3EN9A 3L8PA 3UIMA 5JFSA 5HLPA 3JR1A 4U79A 3BKBA 3A61A 2ACXA 3P4KA 3GC9A 5FTQA 3M2WA 4TY1A 3Q96A 1GAGA 4HCVA 3U51A 4BRXA 4EOKA 5I0BA 1CM8A 3ALOA 5J1VA 3NDMA 3QTRA 5AR3A 4JAJA 5FEQA 4C36A 4FSWA 2WIPA 1ZARA 1TQPA 5M51A 4L7SA 4G17A 2P2HA 3HV7A 4LYNA 4I41A 5L8JA 5K4JA 1E1XA 2Y4IB 4HCTA 3LJ2A 3IONA 2LAVA 1KUTA 3N4TA 4PP7A 3NIZA 3VS5A 3NVMB 3A62A 4H1JA 2JDSA 3KXZA 3CCNA 4AGDA 2C0IA 3DY7A 4DEBA 4FL2A 4MKCA 4Y46A 3FMKA 4IZAA 4LFIA 5LCKA 3ZU7A 2YZLA 2XEZA 2ITZA 1J7IA 3LQ3A 5DEWA 5CU3A 4KA3A 2HELA 4OT5A 3DOGA 4I93A 4F70A 1Q3WA 4KIKA 3HKOA 5CF6A 3QX4A 3DBDA 3RMFA 2ZMDA 3ANRA 3C4CA 4MYGA 5C8KA 4DH1A 4AW5A 4BGGA 4RIYA 4DITA 4F1TA 2WMWA 3H3CA 4RRVA 5CU6A 4GFMA 2XIZA 4YJPA 2J50A 1G8AA 5CWZA 3EL7A 3S4QA 5JQ5A 2C1BA 4ZJVA 4X21A 3BHVA 2YJSA 4ZY6A 4UWCA 1XBAA 4PTEA 3RWPA 2QCSA 4ENYA 1NT2A 3PPJA 1OL1A 1WVXA 4AACA 4EWQA 1KE7A 3OVVA 3W2RA 5IQDA 2FO0A 5TKDA 3MFRA 3SA0A 4FV4A 5DIAA 5CALA 3TUBA 2R3HA 2YFXA 4IFGA 2DQ7X 3UZRA 5E8SA 4OAVB 1Y91A 3W10A 4DBXA 4LMNA 4HCUA 4S34A 1ZY5A 3CPBA 3KN5A 1H4LA 5FWKK 3E3BX 4IJ9A 4FOCA 5EKNA 3P79A 5CNOA 4AN9A 2C69A 3CJGA 1ZYCA 4C38A 4LI5A 3RHKA 4N0SA 4FEVA 4C61A 3Q4CA 4CZYB 4YSJA 3QRKA 2C5XA 3GBZA 4O0VA 2P55A 3TM0A 5FP5A 4C4FA 1YHWA 5A4LA 3R6XA 2X8DA 3F5XA 1M7QA 4FIFA 3TZ9A 3CJFA 3A7HA 3DKGA 2HY81 2BROA 4IEBA 3MY1A 1W7HA 2BAKA 3EWHA 5JZJA 4MQ1A 4ENXA 5BNJA 2J5EA 3KL8A 4I6BA 3AC3A 3PXYA 2XIRA 5IZFA 2WMBA 4DYMA 4NIFB 5FP6A 1Q8ZA 2HXQA 1JSUA 3SHEA 4GEOA 2H6DA 5EG3A 3MWUA 2WMXA 5DH3A 3PSCA 5L8KA 3S00A 4TNBA 4HNIA 4Y5QA 4TYGA 4G6NA 4KBAA 5C4KA 4XP2A 1K2PA 5DFPA 3UQGA 2JIVA 3FMHA 4I23A 5AIKA 5IMXA 4EBVA 3SGCA 4EOMA 2UV2A 2YDIA 3HX4A 3E62A 4RIOA 4DE4A 4D4RA 3P9JA 4RT7A 2OZOA 5BVWA 5IA4A 2Y9QA 4XNEA 3BYMA 4HVSA 1ZXEA 3LXPA 4V04A 4FT7A 5CAPA 4X6QC 4XLVA 2IW9A 2NRYA 2OKRA 2W5BA 5E91A 4APCA 3BWJA 3JPVA 4M68A 3OY1A 4LOPA 4BDAA 1UU8A 3LCOA 4BCKA 2ZVAA 3TJDA 5HHWA 4UBAA 3N4UA 4MEDA 4D58A 5ITAA 4E4XA 1FMOE 1DI8A 3FC1X 3FL4A 1AD5A 3KXGA 4KD1A 4JAIA 1XKKA 2EVAA 2GU8A 3NCZA 3W2SA 3ZRMA 4E5WA 1ATPE 4FIIA 2J0KA 3MTLA 5G1XA 3R01A 4YHJA 3ACKA 4KIQA 4BTJA 1G5SA 3R04A 3P86A 3FHIA 3HMIA 2Z7QA 5GIOE 1IEPA 3E8DA
chains in the Genus database with same CATH superfamily
4V01A 3UIXA 4ASXA 1KE8A 2XJ0A 5L6WL 4RIXB 1E1VA 5DA3A 2VTJA 1BMKA 5CT0A 2XIYA 5M4IA 5JRSA 2XRUA 3KXNA 4E6DA 3RZFA 4KB8A 2VU3A 4WSQA 3DTCA 3TV4A 3A7JA 3OWKA 4BCIA 5M44A 4DFNA 3UO6A 2IPXA 1W98A 5CVGA 4RIWA 3G33A 3WYYA 3L9NA 4AP7A 4JRNA 2WZJA 4MXZA 3EN5A 2C3JA 4JVGA 4FR4A 4TWNA 3T8OA 3DKCA 2XBAA 1A9UA 2BDWA 3LXKA 3V6RA 4UWYA 4WNPA 4J99A 5ETIA 4YTHA 2XM9A 4PQNA 4C4JA 4M66A 4U80A 4R6VA 4R8QA 3IS5A 4UXLA 3UYTA 4AFJA 5CI7A 4O2PA 3QLGA 4FYOA 5IQGA 2BZHB 3A7FA 4PV0A 4Y85A 2QOKA 5K5NA 3QA8A 3TACA 5AP1A 3VVHA 2QONA 2YM3A 2BALA 1GZ8A 3F3VA 5B7VA 3PJCA 4OTPA 4RG0A 5CEOA 3ML1A 4I5HA 5DT3A 3KCFA 3W0NA 3H9RA 4O2ZA 4K2RA 2XIKA 3JXWA 5KMLA 2XNBA 3HA6A 2VN9A 3O2MA 3F82A 3P7AA 4F9BA 2CKOA 4BKYA 1B6CB 3F88A 5CI6A 4WRGA 4NM3A 4YJTA 3HMOA 4GK4A 4BVUA 4DH5A 3F2NA 5AUTA 2VTQA 2XM8A 3V8TA 2OJGA 4D4VA 2VZ6A 4FC0A 5DEYA 2Z60A 4JR3A 5A3XA 4TWOA 3RPOA 3KMMA 3UNZA 3QTXA 4FV7A 5GZ8A 3GU4A 1OIYA 2CMWA 1TVOA 2PVYA 3MW1A 2R64A 5DHJA 3OTUA 4IACA 3SRVB 3A8XA 4FTJA 4BR3A 4A06A 3BELA 4QYFA 4D2VA 3HUCA 3PXZA 1ZMUA 3C13A 4BDFA 3TTIA 1YOJA 2R0UA 4ZTSA 4PPBA 1W84A 2JDOA 4ALWA 4EOLA 4AGCA 4F7JA 5HOAA 3FI3A 5LOHA 3TCPA 3NUPA 5K0KA 3UDZA 1BL7A 2I1MA 2QOCA 3ZEPA 4E26A 4QEBA 3FLQA 3QTIA 5CF8A 4FZFB 2YJRA 3GFEA 3U8WA 4ARKA 4FV0A 3WIGA 3QQHA 1XHAA 3AD6A 4QPSA 2WMQA 4XHKB 5J7BA 4C59A 3ODZX 2EB3A 2ETKA 4DGNA 2GHGA 4F09A 3H10A 4IWPA 3C5UA 5AM7A 4C3PA 2PHKA 3NRMA 5AP4A 3LXNA 2J0JA 4OBPA 2J90A 3Q9YA 3R8LA 4USEA 3W0OA 4KKHA 2XKDA 5AM6A 2ZJWA 4IX5A 2IZUA 5D11A 2O64A 4EJNA 4RMZA 4AN2A 1GOLA 4K18A 1GIHA 3TG1A 4EUUA 2SRCA 4RA4A 4WG5A 3FZTA 4M97A 3UYSA 2F2UA 3RPSA 4F0IA 1OITA 3DQXA 4FVPA 5IU2A 5K9IA 3NX8A 3FPMA 1O6LA 2VNWA 1O9UA 2R3MA 3NGAA 5TF9A 2W4OA 3R73A 4D4SA 4LDTA 3BQRA 2HIWA 1VZOA 3ZRLA 4E5BA 5FDPA 2ZM1A 4KSPA 3D5WA 4J1RA 3AT2A 4DFUA 1ND4A 2UZVA 4G1WA 4D1XA 3UO5A 2PUIA 2JKMA 2NNWB 2WAJA 2YN8A 3UZPA 3HYHA 3CS9A 4LGGA 3FDNA 4CV9A 3KIOC 3DZQA 1OIQA 3WZDA 4IX6A 5FBOA 4YU2A 4QP2A 5IA0A 2YZAA 3QZGA 4GUEA 4GVAA 3EQHA 3SKCA 2V7AA 2AYPA 5CS6A 4F7LA 3DFAA 1PKDA 2JAMA 4DBNA 3SG9A 2WTCA 2J9MA 3FLSA 3DK3A 2UZEA 2W05A 4X3FC 4ZTRA 3NVKI 4TN6A 5GNKA 1XH8A 3U9CA 4FF8A 1OGUA 5E90A 5A6NA 4X6RA 3AC5A 1IA9A 3WF9A 5IA2A 4FG8A 5LXMA 4MNEB 2B0QA 5L2QA 2BCJA 3KA0A 4FNXA 4RQKA 4B8LA 2CNQA 4EI4A 3FXZA 4BCGA 3KRWA 4MWHA 4FSRA 3MB6A 3MVHA 4I0TA 3QXOA 3OCSA 4QQCA 1PXJA 2XZSA 5CAUA 2UZWE 5KX8A 3W55A 2WQEA 2QU6A 2ZV2A 1I09A 4BYJA 3L1SA 3QAME 1JSVA 5J95A 4JRVA 5BMMA 3RVGA 5JZNA 1Q97A 1RW8A 4ZLOA 2C3KA 4AXCA 4I4FA 2PVLA 2CSNA 4CT1A 3V51A 4UMRA 5LVLA 4DGMA 4DFYA 3UOJA 3UDBA 4EHVA 3I4BA 2OBJA 5CVFA 4MD7E 4I94A 2CJMA 4L68A 5DRDA 3R9NA 4ASEA 5HNIX 4EH7A 5FUTA 3R21A 3NW6A 2JC6A 1ZYJA 4DG0E 1OKWA 4OW8A 2YM4A 1H01A 1YXVA 2F2CB 4Z3VA 4GKIA 2F57A 3CGFA 5AAGA 2R3NA 4I3ZA 1IRKA 3CGOA 4J8NA 3JS2A 2VTOA 4C4HA 3MH3A 3KN6A 4UMTA 5HO7A 2WIHA 1YWVA 3PFQA 4QP8A 4RLKA 2VNYA 5CENA 2XEYA 4TT7A 4ZLYA 5M53A 3ZDIA 4XG7A 4XX9A 4IC8A 1H1QA 2BDFA 4R7IA 4JQ7A 4BDGA 2VWZA 2X2MA 3QQJA 4EJ7A 4JMQA 4LRJA 4NK9A 3IOPA 5CSXA 3HV6A 4IAAA 3NAYA 1GIIA 3NYVA 4WBOA 1PYEA 3MVJA 3QALE 4EONA 4G16A 3PLSA 4I21A 2R9SA 2QU5A 2XNGA 1IR3A 2C68A 3A4PA 4GV1A 5ANJA 3NZ0A 4TXCA 3UOKA 5I9XA 3D4QA 3UP7A 4GCJA 4AOJA 2GFSA 3LIJA 2PPQA 4WIHA 1Q5KA 1PYXA 1TQIA 4HOKA 2ITUA 3S95A 4D5HA 3FKLA 3D2IA 3DQWA 3B2WA 3ROCA 3WZKA 4CZUA 5DRBA 4PDOA 2B7AA 3AC1A 3TIYA 3UO4A 1M2QA 3T9TA 1W2DA 3IGGA 4ZZOA 4AT4A 4FZDB 3D83A 4HGTA 2W1CA 4IBMA 3MBLA 4ZOGA 4V05A 5M4FA 2QD9A 4FL1A 3QKLA 4KKEA 3MVLA 2ZMCA 3KULA 4FKQA 4WOVA 4L8MA 3RALA 3Q53A 3ZLYA 2W1GA 4CRLA 5J9ZA 4D2PA 3DKFA 4QP6A 4QTEA 3RAIA 3LW0A 3IW8A 4XS2A 1XH7A 5LQFA 3JUHA 4GK3A 5D41A 2CN5A 2BZJA 1VLRA 4E93A 5I9YA 4JR7A 2WTKB 3U4WA 2UZLA 4MXAA 5HORA 3BX5A 4YHTA 4AGUA 2OFVA 2W9FB 4B8MA 2WMUA 3PZHA 3SW4A 4RQVA 3A8WA 3BU5A 3EQDA 3FPQA 5GIPE 2ERKA 3BYVA 3UOLA 4UMQA 3VWAA 2Y6OA 3LQ8A 4DFLA 2PL0A 4D4YA 1P2AA 2PMIA 2Q0NA 3F61A 3I7CA 4Z55A 1CKPA 1H28A 3ID6C 3C9WA 3IK3A 4KAOA 4FT3A 3CKWA 4B9DA 3FSFA 4RC3A 4DAWA 2WTKC 2XBJA 4OTFA 4S32A 3TL8A 5DOSA 3NUSA 2GNIA 3NSZA 5IUHA 4EOQA 3AT3A 1YDTE 3D15A 1YOMA 3VRYA 5L2IA 4NJDA 4G5PA 4B4LA 4Y83A 3R30A 3SXSA 3TMOA 1UU7A 1Y8YA 2QHMA 3HV5A 3C0HA 4FTMA 4BZDA 4AF3A 2C0OA 4P5ZA 2WQNA 4AW2A 3TUCA 5D7AA 3IG7A 3ULIA 2GNJA 4C34A 2C6KA 3FXXA 4FKJA 4CVAA 3GU5A 3AMBA 1UA2A 1FPUA 5GINE 2G2HA 4QQ5A 1PXKA 1RDQE 1I44A 2EB2A 2HZ0A 3ZBXA 4UXQA 1LP4A 3BHTA 1JWHA 2OJ9A 2DS1A 3BPRA 4XP0A 2FSTX 5DLSA 3ZO2A 4JBOA 5HU9A 1QMZA 3QRTA 4CFVA 1OECA 3IW7A 2HWPA 4FSNA 5HCXA 3R22A 4BCPA 4ZZMA 3FLNC 2GQRA 3P0MA 5LVMA 1M14A 1TFFA 3B8RA 4QMUA 4O7TA 5DYJA 3EJ1A 4HGEA 3POZA 4F99A 4O84A 4NT4A 2ZM3A 5CQWA 1KV2A 3O8UA 3ZEWA 2WO6A 5BYYA 5HG8A 4FTQA 4FV3A 4EK4A 3GT8A 3B8QA 3TV7A 3D2KA 3UP2A 3VS6A 1BI8A 2XS0A 3COIA 4PL4A 4CRSA 4D0WA 1LR4A 2I6LA 3KF4A 1AGWA 4O27B 2RF9A 2R3FA 4H3BA 3DFCB 1ZMWA 3CD3A 2UZBA 5BX0A 3GOKA 4IQ6A 3QBNA 4N6YA 4D28A 5AP3A 5EQPA 3I5NA 2FSMX 2QOIA 4GL9A 3R00A 3NNUA 3WYXA 4USFA 1MP8A 2LGCA 4FK3A 3EFLA 5JN2A 3KXHA 4F64A 1Y57A 1JOWB 1JLUE 1KSWA 4YJOA 4E6QA 3V5PA 4RFYA 4TYIA 1T45A 1CKIA 4TYHA 3THBA 2W99B 3HA8A 4FMQA 4EH9A 2E9OA 3LKMA 2Z7RA 3BHUA 3RHXA 5BVOA 1AQ1A 1NXKA 3V3VA 3OW4A 1V0BA 1ZYDA 3H4JA 3PZEA 2KULA 3ZRKA 4K77A 3E63A 4GSBA 2X39A 1OKVA 2WMTA 1CSNA 4CG9A 2UZDA 2YLFA 2CGUA 2QOFA 4BB4A 1ZZ2A 2P4IA 2OXDA 5AUXA 3OFMA 4X3JA 2X9FA 4GMYA 4I24A 4OTIA 1F5QA 3WF6A 4NSTA 1H1RA 4Y95A 4PDSA 1WFCA 2IW6A 3RPRA 2QOOA 1DS5A 3K54A 4UYAA 4GJ2A 4LV5A 4EH8A 5HCZA 3RM7A 2C3LA 5IH4A 4JG7A 5M08A 3OD6X 2C5YA 4QT1A 3R7GA 5HE0A 3BU3A 3C0GA 4DH7A 5AR7A 4EBWA 1SNXA 2XCHA 3GU6A 4IFCA 1FQ1B 3V8SA 4M3QA 3ZSIA 5CXHA 3EKKA 3WARA 2I0VA 4EOOA 4FODA 5D1JA 4FIEA 4YGAA 4HNFA 3R1NA 1YI6A 5HQ0A 2JDTA 1SVGA 4PMPA 3EHAA 2V55A 2VWIA 4MCVA 5BUJA 5HO8A 3F5GA 3EN6A 4JX3A 2O0UA 5CU2A 4O7VA 3ZO3A 2RFEA 2RG6A 2GPHA 2XKEA 5HZNA 4JDHA 4IZ7A 3FZ1A 4BGHA 4NW6A 5HG7A 4R3PA 5HNBA 2GNGA 1NVRA 4F9YA 3H0YA 2PVKA 2BKZA 4L53A 2QO7A 3IQ7A 3MPAA 4HYUA 4U7ZA 3RZBA 5KMNA 4GFGA 3PVWA 4QPMA 2FVDA 4RGJA 5HBHA 5IF1A 1XH9A 4P2KA 5E1EA 4R3CA 4QTCA 4YLLA 5FDXA 3U6IA 3W32A 4DH3A 4G2FA 1U46A 3DBCA 4AXDA 5HI2A 3QZIA 5KZ0A 3UBDA 3G6HA 3QWJA 4GJ3A 1OPKA 5M55A 3V04A 4IVCA 3TKHA 3R1SA 3BEAA 4J96A 2CLXA 2IZSA 2R5TA 4XRJA 2W1DA 4G3DA 3MFUA 4H05A 2YHVA 3O8PA 4U6RA 3VHEA 5ETCA 3L9LA 4QMXA 1OB3A 2QKWB 1W0XC 1CKJA 3MJ2A 4BYIA 4YSMA 3EQIA 1NY3A 3VBXA 3K2LA 3G9NA 3OOGA 3H9OA 4E1ZA 3HDNA 3O23A 4J53A 4NU1A 4OTHA 4PNIA 3FXWA 4IZYA 4AZEA 3VC4A 4M7IA 2NYAA 2ZFYA 5TOZA 4R7BA 1VR2A 3UVRA 3ANQA 3BI6A 3MA3A 2XIXA 4BKJA 3E88A 5HBEA 4IVBA 4RJ6A 1BUHA 1UKHA 2X2LA 3OUKA 5E9EA 1F0QA 4O83A 4X0MA 4TYJA 2YDKA 1ZWSA 5BQ0A 3KY2A 1VYZA 2XNNA 5GZ9A 5L3AA 4BC6A 4R78A 1YI3A 4Z16A 4DFXE 3ZLXA 1OZ1A 4I5CA 3E93A 2E9PA 3LPBA 5DR9A 5AP5A 2BMCA 1OM1A 5AUYA 1Q8YA 4DEDA 5A9UA 5FD2A 4N4SA 2UW7A 3A2CA 4AAAA 4DEGA 2XF0A 3DCVA 4WD5A 4D1SA 4IADA 1MQBA 3RK9A 2BKKA 4JLCA 3RM6A 4IWDA 3R7YA 4A9UA 4JX7A 2ZDTA 4CCUA 4O81A 3MS9A 3A7IA 4M15A 4XG6A 4BDIA 3FLZA 4IM3A 5GJFA 4GIIA 2VX0A 4ZSJA 2PVMA 1A06A 3KCKA 1J3HA 4LQMA 4NH1A 5FG8A 4BIBA 5BVFA 4QDVA 5IQHA 3PSBA 3I1AA 4U42A 2CGVA 4BTMA 4QMYA 1MQ4A 3FZRA 2XJ2A 3OF0A 3CIKA 3NPCA 4ITHA 4AT3A 5ACKA 5KMJA 1RQQA 3O17A 4PTCA 3D9VA 3TZ8A 1JVPP 3D94A 3FMLA 2WMAA 4JOAA 2VD5A 3G9LX 2OH0E 2W1ZA 2XH5A 3EFJA 4FG9A 1WMKA 3C4FA 2FGIA 3AGMA 3Q5IA 3SQQA 4BI0A 3ORZA 4FG7A 2Y0AA 1UNHA 2VO3A 5CEPA 2PE2A 4RIXA 3BLHA 4HGSA 2X0QA 3DAEA 4MD9E 2CPKE 3AG9A 3CE3A 3FUPA 2PMOX 3EQPA 2WMVA 1DI9A 3ZONA 1ZAOA 2NPQA 2HCKA 1PKGA 3ZC6A 4FGRA 4DEIA 2IJMA 2PZRA 2Y4IC 2Y4PA 4JG8A 4O1PA 4YJNA 3DJ5A 4BCNA 4RA5A 4O7SA 2RSVA 2RIOA 5FTGA 5AIRA 4AZTA 4RSSA 1UNGA 1YDSE 5T68A 5IPJA 2IN6A 2OGVA 2XNMA 3QFVA 3QX2A 3R8UA 5J79A 1E9HA 4S31A 2BVAA 5HGIA 4WNMA 4YJVA 1FMKA 1SM2A 3NWWA 4GYGA 2W5HA 5I9VA 5G6VA 4M69B 3ZXTA 5L2SA 3G15A 5HU3A 5CU0A 3AMYA 4MHAA 5AJQA 3VUIA 3UMXA 5H9BA 3ACJA 2RL5A 3PXRA 4NM5A 2W96B 4O4DA 2XKCA 5JGBA 4U3ZA 5AR5A 4WO5A 3PIZA 4ZZNA 1URWA 3ORLA 5IISA 3FMDA 3C50A 5KMIA 1ZMVA 5DT4A 4FZ6A 3EN4A 4I5PA 4JG6A 5BVNA 3ZZWA 5FRIA 3GB2A 2P0CA 4NM7A 3PVBA 3LM5A 5AR4A 4A07A 4FK6A 4YJUA 2VTIA 4KBKA 3R7IA 2GHLA 3EFKA 4NM0A 1O6YA 1OPLA 3RNIA 4UZDA 3IPHA 2GFCA 4MK0A 4ERWA 1PMVA 5IA1A 2QC6A 4DFZE 4HVIA 3P7BA 5LMKC 4YC3A 3PRIA 4Y72A 3TI1A 2R3OA 5L2WA 5DGZA 4IAKA 1JSTA 3UC4A 1OPJA 5DPVA 5DWRA 5AAFA 4R5YA 3CD8A 3LFCA 4P90A 4ZSGA 2QG7A 4QMLA 3BGZA 3EQFA 3D7ZA 3OBJA 1FBNA 3BL9A 2VO0A 2BHHA 3WILA 1Z9XA 1IAJA 3KVWA 1P14A 4WBBB 1YXSA 3QCQA 5EI8A 5JEBA 5HICA 3T9IA 3KC3A 3M1SA 4EOSA 1YWNA 5ANOA 4O0YA 2OJJA 3HRFA 3VN9A 4C4EA 2OZAB 2PE0A 4FTAA 3QA0A 2O2UA 2NO3A 1J1BA 2XMYA 4ZTHA 2P3GX 1QPCA 1UU9A 4EH4A 4IDVA 2CLQA 4FIGA 2PVRA 2QOLA 3PP0A 3VRZA 1HCLA 4W9XA 4ZK5A 3RP9A 4MBIA 4ZS4A 3GOPA 1ZOHA 2C6OA 3FY2A 2QQ7A 5M07A 5HVYA 2QVSE 1QPDA 1IASA 2J4ZA 3HV4A 3IW6A 4X3FA 4F1MA 3R1YA 5E8VA 2XK8A 4GS6A 4BL1A 5CEIA 2E9NA 2OSCA 3R9RA 1HCKA 4RLLA 4FSUA 5EM8A 5IEYA 1OUKA 2JD5A 4YZBA 3UPXA 4ALVA 3AD4A 4ZTQA 2HYYA 2ITQA 2VTAA 3FKOA 3OY3A 4FZAB 1ST4A 1KE9A 1M52A 3KEXA 3GCQA 4DC2A 5JH6A 3PY1A 4XCUA 1OIRA 1WBNA 4EC8A 3TNHA 1U54A 3K5UA 3WE4A 2VUWA 3E87A 4FV6A 5IQEA 3KVXA 3PPZA 3V5QA 4IX4A 4MX9A 3DAJA 4FTOA 4ZSEA 2ITOA 2XKFA 3U4UA 4EOIA 4L44A 4ITIA 5A4QA 2BFYA 3LMGA 4CMUA 2J5FA 3HEGA 5CEQA 2X6EA 2XAMA 4BWKA 5HBJA 3QCXA 3I0QA 4GFOA 4PP9A 3D0EA 3W2PA 3E8NA 4F6UA 3G5DA 2W9ZB 3EN7A 3F7ZA 3PWYA 3OMVA 2A98A 3QKMA 4C2WA 3ORTA 4CFFA 4R3RA 5CSHA 2W0JA 1GZOA 3EH9A 3OG7A 3BCEA 3SD0A 2WKMA 1W8CA 4RIYB 2GS2A 3CXWA 4G31A 3N9XA 3Q6WA 4XJ0A 1WVYA 2FUMA 4BDKA 2G2FA 4Z7HA 4IHPA 4JDIA 1DAWA 3OC1A 4BWPA 5AX9A 1PMNA 5D12A 5JFWA 4QDEA 3MA6A 2HW7A 1LEWA 3KK8A 3MYGA 2QURA 4F0GA 5BVDA 4CKJA 3CSVA 3M11A 2ZYBA 1QL6A 3BYSA 3RCJA 4KABA 4ZXTA 2YM7A 4IM2A 2BILB 5FEEA 3S3IA 4F08A 4AN3A 3EZVA 4D9TA 4AZWA 4U41A 1YHVA 5I5ZA 3D14A 4AXAA 3GQLA 5AP2A 4LV8A 2R3GA 1XH5A 3Q32A 2X8IA 2W4JA 2X7OA 3HP5A 3PUPA 2VTTA 3QCYA 4CLIA 5TT7A 2F9GA 2C6LA 3QQKA 4WA9A 4XG2A 3HP2A 1ZRZA 4HGLA 1OUYA 5LMAA 3VNTA 3FMNA 3I6WA 4KRDA 4NFMA 3PE1A 4TW9A 4O7WA 4DHZA 3K5VA 4FNWA 4JDJA 3W8QA 2ZDUA 2R2PA 5CZIA 2A1AB 5ACBC 3I81A 4IAZA 4RWJA 3S2PA 2UW6A 1J1CA 4RJ5A 4YC8A 1OI9A 4CFXA 3H30A 4EYMA 5HEZA 3CTHA 1XO2B 4ITJA 4G9CA 5LWNA 2QO2A 3R9DA 2Q0BA 3NUNA 4C02A 3TNQB 3ZDUA 4J8MA 1ZY4A 3KF7A 1YRPA 5JSMA 2FB8A 5LJJA 4L42A 2ITXA 5GJGA 4GVJA 2X7FA 4E5AX 3LQ5A 4YJSA 2BZIB 3E3PA 3IO7A 3I60A 5FQDC 4JBVA 4YTCA 4DDIA 2YCQA 1JBPE 2CN8A 2XP2A 4UV0A 4DHIB 3GC8A 4ALUA 5B2KA 4O4EA 5BUIA 3FYJX 3BYUA 3AC2A 3SLSA 1H1SA 4QOXA 4MBJA 4OTWA 4IH8A 1BYGA 3AGLA 5HE3A 5EW8A 2GS6A 2R3IA 2VV9A 2C5VA 5EQYA 3PJ3A 2YITA 1SMHA 2KTYA 4ANBA 3T3VA 3KU2A 2F7ZE 3P08A 3PWDA 3L8SA 3LFBA 3BRBA 4ZP5A 4J98A 3V8WA 3ZLSA 5CEKA 1PXPA 1ZOEA 2OJFE 5CY3A 5D9HA 3F7WA 2CHLA 1QPJA 3VBYA 4CEGA 4NTTA 2YIYA 3MFSA 2HK5A 3VW8A 4W8EA 5HX8A 3R7VA 2FA2A 3FJQE 3MH2A 4FEQA 5AV1A 3VS0A 2C1AA 4EWHA 4K6ZA 2VRXA 5BVKA 5C01A 1UVRA 1W2CA 3OEZA 5CTPA 1U5QA 4BF2A 2CDZA 4O7ZA 4FIHA 2WTWA 3VS1A 4EH5A 1YOLA 3CC6A 2BTRA 3HV3A 4QYHA 4BTKA 3ZXZA 3BLQA 2IVUA 4F7SA 4J52A 3FQHA 2XRWA 2J6MA 4EZ5A 2BR1A 1BX6A 3ZZEA 1YI4A 2IVSA 3HL7A 3HNGA 3SOAA 5CEMA 2VWVA 2PYWA 3MY5A 3BBWA 3PA5A 3F6XA 4FJVA 4I6HA 2O8YA 5L6PA 4K1BA 1XWSA 2OLCA 4ANQA 5DBXA 4AQCA 4O4BB 3W0PA 3I7BA 2YIRA 4AW0A 5EQEA 3WZUA 1M2RA 4UEUA 3FMJA 3ZCLA 4IX3A 2JEDA 4PDPA 4FIJA 4O0WA 4Q5EA 3TT0A 2ITNA 4FNZA 2OIDA 5AWMA 3DBFA 4C0TA 4DHJA 3EQGA 3ALNA 2GQSA 1JPAA 2XK7A 4FEXA 2CGWA 5E8ZA 4O4CA 2EXCX 4I4EA 4TKSA 2VO6A 4YURA 4O0TA 4TNDA 2GDOA 4JQ8A 2RG5A 1YDRE 3JYAA 3LVPA 3NYXA 2OIBA 3LFDA 1Y6BA 2C6TA 2PZYA 4WG4A 3VF8A 2REIA 3W8LA 3ZMMA 4FUYA 1U4DA 5EDRA 3FI4A 1XJDA 3R71A 2HZNA 4M13A 4EC9A 5I9WA 4E4LA 2JFLA 3O5AA 4D9UA 3VQUA 4KUJA 4G3GA 5J7HA 1WBVA 3REPA 3Q04A 2ITTA 4FKWA 5J87A 1J7LA 3RCDA 1OBDA 1H00A 4O86A 3DNDA 2RFSA 2UZNA 4IWQA 1LUFA 4BCQA 5HLNA 3ZS5A 4D2RA 5KKRB 2IZTA 3ODYX 2VTNA 1U5RA 4BGQA 1LPUA 1M2PA 4QMSA 3G2FA 4YZDA 4BIEA 3TKUA 4AA4A 4KNBA 4ZMFA 3UC3A 2B53A 3E7OA 3E5AA 1H0WA 5JFXA 2AUHA 4QMZA 5HX6A 3V6SA 3SOCA 2QOHA 2BRGA 5LARA 4PMTA 4PMSA 3R0TA 3ORMA 3QTZA 4ID7A 5KKRC 2WMRA 3BBTB 3Q4ZA 2QLQA 3GCPA 4QP9A 5IG1A 2C3IB 1Q24A 3UE4A 3Q2MA 5HVKA 5IUGA 4DT9A 5FGKA 4IVAA 5EW3A 4LOQA 3WF8A 2PWLA 3NIEA 4AE6A 3RKBA 2UW9A 4DHFA 4EQCA 4NYEA 4ZLZA 4I92A 2B9JA 2OO8X 1OL5A 3FWQA 5JRQA 4J7BA 1H08A 2PE1A 4ZTNA 5IUIA 2BDJA 3BEGA 4IZ5A 5CX9A 3NNVA 5IQBA 3GU8A 2O63A 4YLKA 4MBLA 4FRFA 4CNHA 5IEXA 4FOBA 3UDSA 2WOUA 4PL3A 4O7RA 4QYGA 4XOYA 3HMMA 5E8UA 3V01A 1B38A 2X0PA 2BRBA 4GIHA 1TZDA 3QKKA 4O0SA 2VTRA 4RJ3A 5EYMA 4MVFA 2YM8A 1R0EA 2YLEA 3I5ZA 3LFNA 3Q60A 3CEKA 1Q4LA 3U6HA 2X8EA 4FBXA 5EYDA 4DA5A 5H2UA 3OCTA 4G3CA 4EK8A 4UALA 1PW2A 3GP0A 2XB7A 2YEXA 3ERKA 4OTQA 5EM6A 3GCUA 5J9LA 2UZTA 4MH7A 2G01A 2PVFA 2VGPA 4GH2A 4PY1A 4Q9SA 3GEQA 3WF7A 4U97A 4F9WA 2RGPA 4ZTMA 3MFTA 3QC4A 4QMOA 3R8PA 4F1OA 3RINA 4NTSA 4GU6A 3M42A 2NRUA 4S33A 4RVKA 4I6LA 3CQUA 1G3NA 2V22A 3F3TA 2IG7A 3EB0A 2Z7LA 5BMSA 3TKIA 3LFQA 1Q8WA 1XH6A 5T6KA 3VUMA 4APPA 4EK6A 3QGWA 4D2SA 4FGBA 2VWYA 3PXKA 3Q9XA 5C9CA 3SG8A 4DTBA 3W0MA 3BHYA 5CLPA 3VS4A 4YHFA 1F3MC 2WTJA 4J95A 3DLSA 5CQUA 3P5JC 4XH6A 4KIOA 4DLIA 4PDYA 2OG8A 2PZPA 3II5A 2GS7A 4CCBA 4RVLA 4O7NA 3GVUA 3TTJA 3OROA 3F69A 4BBFA 2Q83A 4C4IA 3VW6A 4FVQA 4L52A 5F9EA 3TUDA 2F49A 3VUHA 4Q2AA 4IAFA 2EXMA 3IOKA 4KWPA 4BDEA 2HAKA 5KBRA 4FSTA 4FTNA 4BTFA 2YAAA 4E3CA 3NYOA 4RC2A 4BDCA 3VIDA 5I9UA 4YNEA 5J8IA 3PDTA 3EYGA 3ORNA 1KE5A 3QQLA 4RX5A 2A27A 3LOKA 1IG1A 3OEFX 1UWHA 3AD5A 3P5KA 4LGHA 5IQFA 2OF4A 2OXXA 5KE0A 4AWIA 4RVTA 5KCVA 2GNHA 3D5UA 2I0EA 4HZRA 4IMYA 4KRCA 5AV0A 2YIWA 4EQUA 4BJJA 1OKZA 1NW1A 2BZKB 3HLLA 4TWCA 4L01A 2HOGA 2R3QA 3EQRA 4L00A 3KFAA 4EEVA 1LEZA 2B1PA 3MDYA 4FSZA 4FKTA 3F5UA 4CYJA 5M57A 4HYHA 4FKLA 3S0OA 3HECA 5LWMA 3QTWA 4G9RA 3QUEA