4ZTNA

Irak4-inhibitor co-structure
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
286
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Discovery and Structure Enabled Synthesis of 2,6-Diaminopyrimidin-4-one IRAK4 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 286
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ztnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ztnA01
2F49A 4HYUA 2XCKA 1IRKA 3RPOA 3RZBA 1KWPA 5AA9A 4I6FA 3GCVA 2WMAA 3CQWA 3F6XA 3O0GA 2BDWA 3VS4A 4XX9A 4EOJA 1V0PA 4MF1A 5A3XA 5CTPA 4D1XA 2ESMA 1XBAA 4PV0A 5DH3A 4JAJA 3FY2A 3DXQA 4DCAA 5T3QA 2JLDA 3QRTA 4IW0A 2W5HA 4Y72A 3ETAA 2W1ZA 3D7TA 4XV2A 5E92A 5HG5A 3HAVA 1TQMA 4MNEA 2ZVAA 3OUNB 2C68A 1GIJA 1V1KA 4IZ7A 3HUCA 2Z60A 2JDOA 3FHRA 3FZ1A 4FV1A 2R3LA 3PE1A 4GK2A 4CVAA 2VO6A 5BVFA 2YCRA 1W7HA 4O1PA 4AS0A 2YERA 3EFLA 4N70A 4UZDA 3DPKA 3RWQA 5LVOA 1PMNA 3IW5A 1GOLA 2AYPA 3NW6A 4RIOA 1Y91A 4APCA 3HAMA 3E7OA 3F3TA 4USDA 4CXAA 3P08A 3D5XA 4JQ7A 2YIWA 3BU5A 4J8MA 1YRPA 4EJNA 3OF0A 2QU5A 4O7NA 2R3FA 3MA6A 3VO3A 1M2PA 2R3JA 4HYIA 5BQ0A 5HE1A 2X1NA 3JVRA 3PY3A 4L3JA 1JSUA 5AUZA 4B0GA 4DLJA 4ZTHA 5DLSA 2XK4A 4IACA 4HJOA 4FL2A 3ZHPC 3ZLWA 5M57A 5T68A 3PTGA 5CU4A 4M0ZA 3DT1A 5EHYA 4KB8A 4WG3A 4MXOA 2HELA 4PUZA 2C5NA 2HZIA 4X2KA 4D58A 4R1YA 2VWXA 4C38A 4HCTA 3UIXA 1G8SA 5AUYA 2VO3A 4YC3A 4MBJA 4QMQA 3QCQA 5HICA 4B8LA 1I44A 4KBCA 4B6LA 5JN2A 2VNWA 3DAJA 4JT3A 5EHOA 2BFXA 3DBQA 3SXSA 2BKKA 5HNIX 4BDIA 5JKGA 4IM3A 4XYFA 5HNBA 4LMUA 5EYCA 2GS2A 4YTHA 2VGPA 4FZ7A 4E5WA 4U40A 3CQEA 4M3QA 5KHWA 4YJNA 3NNXA 3CQUA 3QQUA 3T8OA 4ASZA 2ZB0A 1BUHA 3FSKA 3QRUA 3UG1A 3MB6A 4PDPA 4RSSA 3K3JA 1YWVA 5HE2A 4AG8A 4O91A 3B2WA 4C2VA 5CAUA 3A7IA 5CVHA 2ERZE 2J6MA 3AXWA 1DI9A 3P1AA 5FTQA 4DEBA 5FXSA 5L8KA 3QX4A 4JR7A 3N4TA 2JDVA 4GUBA 3CJFA 3MFSA 1H0VA 4AZWA 4NKSA 3V5TA 4DEGA 5L4QA 4F7SA 3PXKA 3VBVA 2WTJA 3EQIA 3RI1A 3JUHA 1FMKA 1YOMA 2P2HA 4TTHB 4CEGA 3FHIA 3AQVA 4ZTQA 3F2RA 2YCQA 5AIKA 5JMSA 2ZOQA 3KXMA 2YDIA 5EM8A 2V7AA 3I4BA 4U80A 4EUUA 3SV0A 2EXCX 2YCFA 4JG7A 3QCSA 4QMTA 3TUDA 3PP0A 3WE8A 1LEZA 3RAIA 3OWPA 3OUKA 3FI4A 4G6OA 4G3CA 1OKYA 2WMTA 3KKVA 1CM8A 2NPQA 4M69A 2YM8A 5KE0A 5LMKA 2OF4A 2H96A 2XUUA 1M14A 1OECA 4D4SA 2CSNA 3JYAA 4FUYA 2UW3A 4O21A 4RC3A 3CIKA 2BVAA 1PHKA 3BE9A 3FKLA 4YBJA 1Q3WA 1PF8A 3HV6A 1H00A 3EZVA 4QMZA 3AGMA 4C7TA 3G5DA 5ANKA 2QODA 2JAMA 3ZSHA 2X2KA 3G0FA 4CRSA 3OP5A 2HYYA 2PU8A 3ZSIA 4E7WA 3HP2A 4FIJA 3PSCA 4ZOGA 1XR1A 2YM6A 3F3ZA 3LOKA 5E8ZA 3W2RA 4FEXA 4GJ2A 2REIA 3NNWA 4MYGA 4XS2A 4EWHA 3IKAA 4P5ZA 4EORA 2XMYA 2I1MA 2C6MA 5J5TA 3Q2JA 2VO7A 4HCUA 3NW5A 5GIOE 1LP4A 4FODA 4R78A 2X4ZA 3FKOA 4FTCA 1JSTA 4L00A 5FP6A 3CTJA 5FM2A 4FOBA 4LV5A 4FIEA 1VYZA 4XH6A 2HZ4A 1KE7A 2OH4A 4FSTA 5DPVA 4AFJA 3DBCA 5AUVA 2PULA 4EH4A 4GFMA 2ZYBA 3HMIA 5FQDC 5ACKA 3UIMA 4IJ9A 2WNTA 3LFCA 4K18A 1JKKA 1V0OA 3FMEA 3NWWA 3RP9A 5CAPA 4D55A 5FWKK 4A9TA 1U5QA 3D2KA 1BKXA 2W1CA 2XH5A 4ENYA 1OIRA 4Q9ZA 2C5OA 4FICA 1PMUA 4PPBA 4W9WA 3QBNA 3CGFA 3OD6X 2E9NA 3WIKA 4B9DA 2OJ9A 4AT4A 4EL9A 4CFUA 1YWRA 3TIZA 3ZYAA 3QGWA 2CMWA 4MQ1A 3R1YA 4CRLA 5KHXA 4IX4A 4IWPA 5BVWA 4FNZA 4ZK5A 3UOLA 2R3OA 2UZNA 5C26A 3DY7A 4J8NA 1Y8YA 3L8XA 3DAEA 4S33A 4HVHA 4G3EA 4IIRA 2OW3A 5JH6A 1KE5A 3HUBA 4Z7HA 2VTMA 3DQXA 3QC9A 3N9XA 5EH0A 4DGNA 5A4TA 1CSNA 1R3CA 2R7BA 2NO3A 2WTKC 4DGOA 3BYSA 3LM5A 4BKZA 4CG9A 4G31A 3Q53A 3QCXA 4IEBA 4MXAA 4YBKA 3VBQA 2VN9A 1H08A 2VV9A 2XJ2A 2IVVA 5BX0A 5AADA 5CEMA 3A7HA 1BLXA 5AP1A 5HU9A 3DV3A 3Q9ZA 1SNUA 4XBUA 3RK5A 2YM4A 3QZGA 3T9IA 3I7BA 4OTDA 3N4UA 4DT8A 1ZMUA 2VTTA 3TZ9A 3R01A 1L3RE 2E9PA 3PWYA 1UNLA 3PG3A 5DVRA 3UVQA 2CN5A 1MRUA 4BVUA 4FSQA 1WCCA 3LJ1A 3ANRA 2GU8A 3C50A 2OLCA 4HNIA 3R22A 2FO0A 4L6QA 4YZBA 3WZEA 4FMQA 2P55A 1H1WA 4FZFB 5DEWA 5DHJA 3NAYA 4ALUA 2E9OA 4EOSA 4HVSA 3U6IA 5EOBA 3VHEA 2ETMA 4CV8A 3ATTA 2P2IA 3PXFA 4RC2A 2RSVA 2R3NA 3WE4A 5HD7A 3L9PA 3MH2A 3BX5A 3R6XA 3MVMA 2OI4X 4IB1A 3NYXA 2YN8A 3Q9XA 4QMPA 4QT1A 4FEUA 3QTXA 1BI8A 5IH6A 4XRLA 4NCTC 3MBLA 4BTMA 4EOQA 4GT4A 4R5SA 3R1NA 4L46A 4LFIA 4PY1A 3PXZA 3OWKA 3LZBA 4BYJA 4GSBA 4XP0A 2AC5A 2CGUA 3A7JA 3PA5A 3QALE 4II5A 3DFCB 4U43A 4FGBA 3QCYA 4BHNA 4EOMA 4ZSAA 3E8EA 1VZOA 3HL7A 5ANIA 5M08A 3MJ2A 3VS7A 4EH6A 5E8XA 1YQJA 1QCFA 4QQCA 5HD4A 2GQGA 4FZAB 1YXUA 4QTCA 4YURA 3WZDA 3O8PA 2ZDUA 3RPYA 5AUWA 3TKHA 4E4MA 5HO6A 5L6WL 1XHAA 1XH7A 4ZP5A 2FYSA 2G2FA 2UZDA 3BQRA 4IB0A 4K77A 3MV5A 5AR2A 1REJA 4WUAA 2QKWB 4NW6A 4DBXA 4BDHA 4AZTA 2WTVA 4FTNA 4HZRA 5M07A 2OXDA 3A60A 3BBWA 4LMNA 4NIFB 4PTEA 5AP2A 5L8JA 5JSMA 2R3KA 2OSCA 3CEKA 3L8SA 4WBOA 4YPSA 3U9CA 3ZM4A 2QC6A 4W4VA 4PNKA 4X7QA 4ZTSA 4ZSGA 4R1VA 2HY0A 3EIDA 4A4XA 3C51A 3R7YA 4LRKA 2W99B 4YTCA 4PL5A 3C5IA 1REKA 3ZZEA 3TZ8A 1QPDA 3CY3A 4EZ5A 3ZXZA 3NIZA 5FBOA 3FAAA 3NZ0A 3K5UA 4FTOA 2PVFA 4RIXA 5DI1A 3EN9A 4F70A 1Y6AA 1R0EA 3ORMA 1WVYA 4KS8A 5J1VA 3D9VA 4GUEA 2QOKA 2WTKB 4AGDA 1OL5A 3CP9A 5JK3A 4L67A 3EFKA 3VW8A 4DH5A 2P0CA 4IX6A 4D0XA 3MPMA 2WMSA 1E1XA 2BRHA 5I5ZA 2C6KA 3QHRA 3AD5A 3W16A 4A4OA 5K5NA 3RZFA 3AC5A 4ZZOA 4EEVA 2ITVA 2ONLA 4FEQA 3AMBA 2YAAA 3LVPA 4LL5A 2PWLA 3H0ZA 3HRFA 3D14A 4JDHA 1H24A 2QOCA 3ODZX 2E9UA 5EM6A 4TWOA 2GMXA 4NJDA 4AX8A 5M56A 3EYGA 2YWVA 4RX9A 5BPYA 2A0CX 3C13A 4OTWA 4QP4A 3GI3A 5CQUA 3FPMA 3O23A 3TNQB 3GU4A 4R3PA 5E90A 4IZ5A 3PY1A 2GNFA 3TNPC 3FLZA 5AWMA 1J7UA 2C5XA 3KMUA 1JSVA 3AC1A 3GQIA 3L8VA 4DFZE 2J0MB 5BVOA 1ERKA 3FPQA 4FV5A 3LFAA 3KCFA 3DDQA 5AX3A 2C3LA 3E64A 4X3FA 2CGXA 5L2TA 4FNYA 2X8IA 4U8ZA 2R9SA 2QLQA 3LFSA 4JDIA 1DAYA 4YJQA 5CSWA 2JAVA 4X2FA 2KULA 2QO7A 4LM5A 3ZCLA 5HQ0A 5IG1A 5JFSA 4F9YA 2XIKA 2CKPA 1HCKA 1Q3DA 2JIUA 3QC4A 3SXRA 2ITOA 2GCDA 5IF1A 3DJ6A 3AC3A 4RJ4A 5L2WA 2HWOA 2XNBA 1APME 3BHTA 5K3YA 4OGRA 2VGOA 3A62A 3VBTA 5A9UA 1AD5A 4HGEA 5IQIA 2O0UA 2R3QA 4TWPA 1I09A 4C02A 3S2PA 2IZSA 2VX0A 3FZSA 1ZZLA 4HCVA 2OJIA 3OCSA 4YO4A 4DINA 2BFYA 2J9MA 3P9JA 4IVAA 5HCXA 5CASA 4D2VA 1Q8UA 3NIEA 4YJSA 2QOHA 3PSDA 4FV7A 4S30A 3LCKA 3LLTA 1OIUA 5JFXA 4X6RA 4JVGA 1S9JA 5JRQA 3A4OX 4FVPA 1ZARA 1FVRA 2WQMA 1RJBA 4GU9A 3FMDA 4KBAA 4MKCA 5AR3A 4ERKA 3PVUA 2YIXA 3R9DA 3LCDA 1HOWA 3RCDA 3CTHA 3VS2A 4Y46A 3WF7A 1JPAA 2GS7A 5DOSA 4IZAA 2C0OA 3ZTXA 3ZC6A 4YLJA 4ALVA 5LVNA 4QQ5A 4U97A 4AA4A 3WF9A 4O7ZA 4DH3A 4CV9A 2VTHA 4S2ZA 5K5XA 3OC1A 4EOIA 1ZMVA 3DOGA 3EQHA 4KIOA 3O17A 3LXPA 5TE0A 4BI1A 3LKMA 3PVWA 4FTUA 4FK3A 3UC3A 5IQGA 4UMPA 4CT1A 3A8XA 2V55A 4OTQA 3A61A 4EK4A 5F9EA 3VS6A 3WI6A 4HPTE 3RNYA 3R02A 4ZTRA 5EW3A 5E1EA 4BCFA 4GVAA 3QTSA 4WNKA 1WAKA 4OUCA 5DR2A 4ZJIA 3WOWA 4AGCA 4BCHA 3DXPA 2YWPA 3FEGA 2R3GA 2W1HA 5H8BA 4G2FA 2OJFE 2XRWA 4DH1A 3AT3A 4HZSA 5LOHA 2QURA 2O8YA 4RX8A 4EBVA 2XNOA 2Z2WA 1Q24A 1RQQA 3CD3A 4UEUA 4DF3A 2JDRA 4ANSA 1QPJA 5HCZA 2YCSA 4FNXA 4C33A 4FKGA 4D2WA 5JQ8A 3K5VA 3IDBA 3QXOA 4I3ZA 4TXCA 4JG8A 3R7VA 1FQ1B 5AUTA 4BZOA 3FC1X 3KU2A 3PY0A 4FIHA 3VQHA 4UZHA 2ZDTA 3ZS5A 3QAME 4NTSA 5D7AA 2IN6A 2NP8A 3DA6A 3G90X 2PVHA 3LFFA 1GZOA 3EKNA 3N4VA 4BY9E 3R21A 4NFNA 4ZJVA 4YHFA 3HZTA 3O51A 2OZAA 2J5FA 5L2SA 3PXQA 4IC8A 1SM2A 2CLQA 2IVSA 2Q0NA 3R2YA 4XCUA 3MIYA 5CXHA 4R3RA 3G15A 4XG3A 2YLFA 4F1OA 3KRXA 3NYNA 4GIIA 1ZYSA 2ERKA 3OCGA 4K9YA 2BTRA 3VF8A 3BV3A 2GQRA 2UW9A 3GFWA 3DZQA 4L9IA 1OKWA 1GNGA 2IVTA 2OXXA 2YIQA 4V0GA 3Q4TA 4LGGA 2QKRA 3ULIA 3V5WA 4M7IA 4BIDA 1URCA 3DLSA 2QG7A 2F9GA 2E2BA 5CSXA 5K4IA 3ZDIA 2ITQA 4PWNA 4QTEA 2IW9A 2Y4IC 3SRVA 1O6YA 2JIIA 4LG4A 5I9VA 3IDPA 2A4LA 1KOBA 4QYFA 3I5NA 2BZHB 2C30A 4TW9A 4IFCA 4LRJA 4YJVA 2X9EA 5HBHA 3UO5A 1J3HA 3HMNA 3FC2A 3V5PA 2GHLA 4J98A 5CEKA 2XK7A 4ZIMA 4FV4A 3PFQA 1PXKA 4HGLA 5IA2A 3BU6A 4P5QA 2ZMDA 5LWNA 3NUUA 2PUIA 3LJ2A 5H8EA 4KUJA 4UXQA 5J9YA 4ACCA 5A46A 3CKWA 4NYEA 2Z7QA 3EJ1A 5BUIA 4EHVA 1FMOE 3JVSA 4BDAA 3AT2A 2C6TA 3MY0A 3NUYA 4RT7A 1OUYA 1ND4A 2X7FA 2R7IA 4G5JA 3KULB 3EL7A 2BIYA 2UW6A 5H3QA 2X4FA 4RJ3A 1OIYA 4NEUA 3EYHA 4TN6A 1GIIA 2C5VA 2XF0A 4P7EA 4RGJA 3TNHA 3SD0A 2ZM3A 4O7WA 2WEVA 3DNEA 4BB4A 2PVKA 3ZOSA 4D0WA 1OVEA 1ZMWA 2BR1A 5HCYA 3U9NA 4FIIA 3TZ7A 4ZLYA 3Q2MA 2FB8A 5DEYA 4U7ZA 1WBOA 1ZZ2A 3EN5A 3NNUA 3HNGA 4V05A 2YZAA 3UO6A 4XP3A 1XH4A 3QXPA 4BCMA 1OL7A 4ITIA 2WOUA 2JKMA 4PQNA 4DFNA 3ENMA 3Q32A 4JS8A 4M14A 4WSQA 3ZEWA 4EQMA 1J7LA 2ITPA 5HTIA 5FDPA 5L3AA 3KEXA 3B2TA 4GFOA 4H39A 1ZYDA 4BDEA 4FL1A 4CTCA 2W1DA 4ARKA 1YVJA 3F88A 4JBVA 3KGAA 4M67A 5EYKA 5A4CA 4H3BA 4QOXA 4KKGA 3HV3A 3VBXA 3QF9A 3BWFA 4R7IA 1P2AA 3HX4A 4IVDA 3IOKA 3RAKA 5J5SA 4A9SA 2X8EA 2W1FA 3CBLA 3UMWA 2GHGA 2OO8X 2UZLA 3OOMA 4TY1A 4Z16A 1W82A 4GL9A 3KK9A 4PDOA 4ZAUA 3E88A 1OM1A 4JG6A 2VZ6A 3I0OA 5KCVA 5EK7A 5IUIA 4A7CA 4N6ZA 3QRJA 4ZY6A 4MWIA 5IA0A 3G0EA 3ATSA 1NVSA 3JXWA 1ZXEA 3L8PA 4UYNA 3UP7A 4FGRA 3B8RA 4BCNA 4DG3E 5J87A 4Z9LA 3THBA 3SGCA 1OBDA 1U54B 3RAWA 4ANMA 3GOPA 3W1FA 4O2ZA 2B7AA 4U79A 3UNZA 3KRLA 3ORPA 3SW4A 4D4RA 2PMLX 5IEVA 5AM7A 4DHFA 2GNGA 4GS6A 4IAIA 2Y4IB 4C4FA 3QLFA 4EYMA 3CC6A 3R7EA 4AP7A 4PL3A 4A4LA 3TCPA 2BILB 5JQ5A 4D5HA 3TDWA 2J0LA 5GINE 3GCSA 3RHKA 3HDMA 1WBSA 1JKSA 3R7OA 4XG8A 4EKLA 1IG1A 2WMVA 1DS5A 2YJSA 4UV0A 4V01A 4ZS0A 1JWHA 4RC4A 2XZSA 1WVWA 1NA7A 1Q41A 3C0GA 3ORLA 4YPDA 3OFMA 5HOAA 3BBTB 5IQBA 4F09A 5EG3A 3IQ7A 3PJCA 3FLSA 4P2KA 1H4LA 1U59A 4DEDA 5CEIA 5HU3A 1MUOA 3FUPA 4I6HA 2CKQA 5DT4A 3FI2A 1PYXA 4CFMA 3FZOA 5C8KA 4D1SA 4FKVA 5EKOA 4O81A 1JAMA 3NVKI 4D9UA 1EH4A 3LXKA 4QP6A 4M68A 4FBXA 4BDCA 4N0SA 4OAVB 2WU7A 3UZRA 3PLAE 3K3IA 4MEDA 2BZJA 3FI3A 5E8YA 5I9UA 3PJ1A 4BZDA 3OXZA 4FG9A 4EK6A 2UZUE 2BRBA 4FSWA 3IGGA 3NAXA 3R8UA 3RK9A 3PXYA 4BWPA 4BR3A 3KQ7A 3LMIA 3EFJA 3FMLA 4JDJA 2PMIA 4NH1A 4AA0A 5GZAA 3NVMB 3BEAA 3POOA 4AAAA 3IO7A 3VBYA 4BHZA 5IDPA 5M4FA 5B2MA 5BVKA 3TM0A 3VULA 2VWUA 3PP1A 1S9IA 5AAGA 3MH0A 2F7XE 5FTGA 4GH2A 3U6HA 2VTLA 1MQ4A 2XNNA 3A4PA 2B9IA 4DEAA 4F65A 1YDSE 2P4IA 2R3MA 3L9LA 2XM8A 3H30A 1MRVA 3P5KA 4XLVA 4GK4A 1UU9A 3A8WA 3CPBA 4QPAA 3I0QA 5BYZA 1YXSA 4WOVA 3QZFA 4Q9SA 2R0UA 5DBXA 5E7RA 4BWXA 3MIAA 4C3RA 2C47A 3QYZA 3OMVA 4JR3A 5AJQA 2B1PA 4EK3A 4EK8A 4YSMA 4GEOA 2PVRA 4FEWA 2QOBA 2W05A 4AW2A 2C6DA 4M0YA 4NWMA 4RPVA 5M4UA 4DFBA 4OBOA 3Q6UA 4AT5A 4KSQA 3ZO3A 4XUFA 4Y73A 3NUSA 3U55A 2PVMA 3D5WA 3PZEA 1ZY4A 2EXEA 4ZZNA 1PY5A 1ZOEA 2B55A 4R7BA 2Y6OA 1BI7A 4IJPA 3F61A 3EQGA 3FMJA 2O64A 4WNMA 4F9BA 3I7CA 2ITZA 1OI9A 4FV6A 4GK3A 4FF8A 4FKPA 3QTUA 4OBQA 3JS2A 3QQLA 4TRLA 3QQHA 5AV0A 5CZHA 4DG0E 3UQCA 4H1MA 2Y0AA 3KK8A 1WBWA 2QO2A 4RMZA 3RJCA 4BTKA 3ZDUA 5EQPA 3H0YA 1UVRA 1WFCA 2BIKB 5D9HA 2VX3A 5C9CA 3UP2A 4F6WA 2Z8CA 3BCEA 4C36A 4C62A 4X3JA 4GKIA 4FVQA 3NRMA 4O0RA 5HVYA 2C3KA 1ZYCA 3FXXA 4IQ6A 5AV3A 5I9XA 4IDTA 3HLLA 2RKUA 3MJ1A 4L42A 3ZONA 1M52A 2FVDA 4TWNA 3GNIB 2WQOA 5IMEA 4AZEA 5HIBA 4XG4A 3QQJA 2XJ0A 3DB8A 3DBFA 3ENHA 4JOAA 1GY3A 4MQ2A 4QMVA 5B0XA 5KX8A 2IZUA 4QMXA 4ID7A 1H1SA 2F2CB 3PUPA 3GC0A 3UDBA 4AW5A 2JDSA 2ZJWA 3V5LA 4W4YA 4G5PA 4KIPA 4HW7A 2HXQA 5TO8A 5CNNA 2I0HA 2XB7A 1CMKE 2RFSA 2UZWE 2ZMCA 4NT4A 4O0XA 1UV5A 4FL3A 5FRIA 4LRMA 4CNHA 3GCUA 5HZNA 2OBJA 3NDMA 2ITWA 2JKOA 4HOKA 4DTKA 1IAHA 5L2QA 5BYYA 5J7BA 4R77A 3F5PA 3DK6A 3W8LA 4L7FA 2OZOA 3PYYA 5E8TA 5K0XA 1WBPA 2WTWA 3TIYA 4ZZMA 4C34A 1KOAA 4CTBA 2Q0BA 2R3RA 3FV8A 4GFGA 4EC8A 5IU2A 1SYKA 3UZPA 4AE9A 3TKIA 2R2PA 3G6GA 3KN6A 2V22A 3GU5A 3IDCA 4TYGA 2PSQA 3FQSA 3R8ZA 5K0KA 3NS9A 2GFCA 3QUEA 2VWVA 3FL5A 1WBTA 3V3VA 3NUNA 4IB3A 3PWDA 4F6UA 2G01A 4EQCA 4USEA 2GFSA 4O0VA 5GZ8A 4LOQA 3OCBA 4EHZA 4O84A 2BRMA 3FMNA 3OZ6A 3QD3A 4J7BA 2PL0A 1XWSA 3O71A 3HRCA 2VTAA 1F5QA 3ORZA 4XG6A 4X2GA 4EK5A 5B2KA 4QQTA 3CS9A 4RQVA 4F7NA 3U4UA 3VRYA 3O8UA 4BKYA 4YUQA 4FSNA 4EBWA 4D2TA 4BI2A 2IPXA 5EW8A 3IPHA 3RALA 5JFVA 2FGIA 4FKLA 4CCUA 4FT7A 4F0IA 2V5QA 3QD0A 3CGOA 4GIHA 3NYOA 3ORNA 3GCPA 5M44A 4ZTNA 1CDKA 3R1QA 3H4JA 4YSJA 2QOFA 5J1WA 3IOPA 2WTCA 5CU2A 3BI6A 4IAKA 3GVUA 2EB3A 3M2WA 4ZLZA 5CALA 4V04A 5C4LA 3ZRKA 3KL8A 5AMNA 4A9YA 3UO4A 4BICA 3GU8A 2FUMA 4IAFA 5AFVA 3D4QA 4JNWA 3KXZA 2CGVA 3TXOA 3VUMA 5B7VA 3RPRA 4DYMA 4L44A 3DTCA 1K2PA 3AGLA 4CFXA 4DN5A 4ZLOA 5CZIA 4QRCA 2XEYA 3ZZWA 3QUDA 1DI8A 5CI6A 4E6AA 4NUSA 2QQ7A 4MAOA 4RIWA 3SAYA 2UW8A 4YGAA 4QPSA 5J8IA 2G9XA 1PXNA 3PRIA 4MH7A 4YJRA 1UU8A 3R9RA 5IUHA 4KRDA 1G8AA 4BTFA 5FD2A 1OITA 1BX6A 3SOCA 4IHPA 5AR5A 3VF9A 5KBRA 2RFDA 3MFRA 2H6DA 3KMWA 4A07A 5I4NA 4IBMA 3W18A 4JBQA 4IM2A 1K3AA 4FTRA 2BTSA 4I6QA 5AM6A 4YU2A 5A6NA 1M7NA 1YXXA 3NX8A 1TQPA 4U0IA 3KB7A 5FDXA 4L43A 4LGHA 4BC6A 4D1ZA 2VWBA 4QTAA 4F7LA 4CKRA 1IAJA 1FVTA 2QOQA 3GT8A 2VX1A 4W9XA 4F99A 4K6ZA 1B38A 5D12A 3OBGA 4BN1A 4WD5A 2YM5A 2VTQA 4S34A 3IGOA 2W17A 4U41A 5J7HA 4BIBA 3CCNA 3KN5A 4OT5A 5EQEA 2HOGA 4AN9A 4GT3A 5BUEA 3ZRMA 5DNRA 4Y5HA 3OW4A 3I60A 4CYIA 1GZ8A 3ODYX 4O0WA 4PRJA 3ZXTA 4CT2A 2XNMA 4OW8A 4XJ0A 4AUAA 5B2LA 3VS3A 3EN7A 3RMFA 3F9NA 1BL6A 1PW2A 2KTYA 2WD1A 4DAWA 1STCE 3UMXA 3FY0A 4FKJA 5EYMA 5CAQA 1FGIA 2QONA 3BLQA 3PIYA 3K2LA 1WZYA 2C5YA 5AP6A 3T9TA 4CCBA 2BRGA 4FV2A 4K0YA 4EH5A 5GJDA 1PRYA 3UC4A 3MPAA 4EC9A 2YACA 3OHTA 4YHTA 5CSPA 4RJ8A 3U4WA 4TWCA 3MTLA 4RWIA 3LJ0A 5IQDA 2BPMA 2Z7LA 4YLKA 4JQEA 2GNLA 2J2IB 4AXAA 3W55A 3JY9A 5HIEA 4F1TA 5HLWA 2CCIA 4E4XA 4GV1A 4XLIA 2P3GX 4O0TA 3WYYA 4ZY5A 4AOJA 3DK7A 2HWPA 3H9FA 3MN3A 4H36A 5D10A 4WNPA 1XQZA 1ZYJA 3DFAA 3FMMA 3Q6WA 4XG9A 3EL8A 4F9AA 2J7TA 5HVJA 5LWMA 4D4VA 1PMEA 3V6RA 5DR6A 4HYSA 3UOJA 5BVDA 5H8GA 3CXWA 3RAHA 4PDYA 2PZ5A 3E3BX 3RVGA 3VUHA 1A48A 5AEPA 2YIRA 3GGFA 5J79A 2AUHA 2X81A 2WHBA 3UGCA 3WBLA 1Q61A 4G34A 3DJ7A 3DAKA 5LXMA 4E8AA 4TYHA 4BTJA 4Y95A 3DDPA 4WHZA 3PPKA 5ANJA 2OIBA 4RBLA 5IA4A 1FPUA 3GFEA 2QVSE 2UW7A 4FTIA 2PUPA 1UNHA 4BCIA 4YZMA 4CD0A 4BFMA 4M13A 3FLYA 1E9HA 3E87A 3SHEA 4QQJA 3PVGA 2JD5A 4WT6A 2I40A 3FSFA 2O2UA 4JX7A 5M55A 3ZBXA 3Q9WA 5GIPE 5KMMA 1FVVA 4O27B 5KO1A 2QOOA 3MGYA 4I1ZA 4PMSA 1NVRA 2XIZA 3F7ZA 5IZFA 1PKDA 4J99A 3H3CA 1P4OA 4OAUC 2C69A 1AQ1A 4I0RA 4N4SA 4PMMA 5EM7A 4I5MA 4DFLA 4GVJA 3QTZA 4RZVA 1RE8A 2W5BA 4CMTA 1Z9XA 4G6LA 4UMRA 2OIDA 4EZ3A 3P7AA 3TTJA 2I0EA 5C01A 1OPKA 4WSYA 1OIQA 4KIKB 3BHUA 1IR3A 4CMUA 2ZV7A 3AG9A 3FQEA 4QTBA 2JIVA 2JDTA 3MVLA 2CN8A 3VUIA 2B53A 4PF4A 4I93A 4HVIA 2GQSA 2WEIA 3ZO4A 5DMZA 2IW6A 4KS7A 3HA6A 4ACGA 2ITXA 3D7TB 4FSYA 4C4JA 3QTWA 3R04A 3V01A 3KXNA 2IO6A 3ZUVA 2J90A 2C0IA 4YJUA 5CVFA 3TJCA 2JBOA 2FH9A 3O96A 3CTQA 2J4ZA 4UMQA 5D7VA 5BMMA 3C5UA 5A4QA 1GZNA 5LMKC 1OB3A 2C3IB 2UZEA 2H9VA 5ANOA 1F0QA 2FSLX 2RL5A 2XK6A 2YLEA 3PXRA 5HNGA 2OICA 2Y8OA 3F3VA 1XH8A 5M09A 3O50A 3C4ZA 1OL2A 2G2IA 3POZA 3Q96A 4BCKA 2WPAA 3EQFA 4QYHA 4WUNA 4UBAA 1NY3A 2ZM4A 4O22A 3CSVA 3NLBA 3C1XA 3LXLA 3NUXA 3HV5A 2FSOX 4QP2A 4IH8A 5FBNC 5CF8A 1SZMA 1OPJA 1E1VA 3E62A 4FKSA 4DBNA 4JRNA 2PE1A 4G9RA 3UE4A 3W2CA 4J96A 3R7GA 4PX6A 3COKA 2H8HA 3Q4CA 4R8QA 3HMOA 4WRGA 4LQMA 1CTPE 1YHSA 2HIWA 2QD9A 3QX2A 4FSZA 3QHWA 4YJOA 5CYIA 3UG2A 3SW7A 1QPEA 5ANGA 1YI4A 3W8QA 4FT0A 4GG5A 4W4XA 4C4EA 4QMNA 4U6RA 1G3NA 3CD8A 3I6UA 3RKBA 4KIQA 5HG7A 2Y4PA 3MH1A 3LAUA 5KKRC 5CLPA 1X8BA 4FK6A 4A9RA 2HW7A 5IQEA 2VUWA 4OTRA 4O83A 4MXCA 4ACHA 1UU7A 3PJ2A 5AX9A 2FSMX 4XBRA 4YJPA 5TT7A 4F6SA 1GJOA 4H58A 4L3PA 5FEQA 3U8WA 3COHA 3L9MA 2R4BA 2GS6A 3PPZA 3F3WA 2CPKE 3TACA 2O63A 3QQFA 4BF2A 2CJMA 4MVFA 4O2PA 2PE0A 4RFZA 3Q4UA 2PYWA 2WQEA 3GC9A 4BCOA 1UA2A 2OG8A 2YITA 2X8DA 3LE6A 3RWPA 5AV4A 4LYNA 4Y85A 4KKHA 2OF2A 4U3ZA 3SXFA 4QYEA 3DCVA 3KF7A 4YO6A 4CLIA 4FI1A 5IH4A 3GUBA 3R8MA 4UXLA 2XA4A 3PJ8A 4CSVA 2QOIA 3F82A 5E8UA 4EOPA 1Q62A 4BDBA 2X2LA 1H1RA 3E8DA 3GENA 4KA3A 3VAPA 1XKKA 2VWWA 3ZLYA 1OPLA 2I0VA 3GXLA 4WA9A 3SVVA 2XK3A 3MA3A 2HK5A 1IA9A 3A7FA 5E8SA 3QQGA 2CLXA 3ZSGA 5KNJA 3ZBFA 4ZTMA 5AV2A 3KXGA 3E3PA 2PZRA 3IK3A 5LCJA 4FNWA 2J0JA 4H1JA 1DAWA 3EN4A 1T45A 5IMXA 2J51A 4FG8A 1U5RA 5DT0A 2VWIA 1YW2A 5AP4A 1TQIA 3DU8A 2HXLA 2SRCA 3E8NA 3SDJA 4G3GA 4I4FA 2VWYA 3EWHA 4FTQA 2ITUA 3BE2A 3ULZA 5HHWA 3OROA 4FR4A 3FZPA 2VTIA 3TV6A 3OY3A 4IWDA 4F4PA 3GBZA 5KMOA 3TUCA 4ZMFA 3FMKA 4RRVA 2XIXA 3ZLXA 2BALA 4ANOA 2ACXA 3C0IA 4JXFA 4K33A 5CAVA 3MTFA 1Q97A 2WMUA 4NK9A 4J71A 5EDQA 5AUUA 4HPUE 3LM0A 5IEXA 4RQKA 2YISA 3A7GA 3VUGA 2QOLA 2YFXA 3QYWA 3KXHA 2C6LA 2GSFA 3CY2A 3ALNA 1UNGA 2WIHA 3DLZA 4U44A 4NSTA 1YXTA 4YR8A 5JGAA 2XYNA 1NW1A 2VTNA 3C4XA 3KRWA 5I9ZA 4J53A 5CT7A 4G1WA 4IAZA 3Q3BA 3QZIA 2PMNX 2WB8A 5CAOA 4A9UA 4QMSA 4WKQA 1DM2A 1M2RA 2ZV9A 5CF6A 2WOTA 4JLCA 4YZDA 4R5YA 3TL8A 5AAFA 4HNFA 4U5JA 5CWZA 4JX3A 3W32A 1PXMA 4IADA 5IQHA 3SLSA 2WTDA 1H01A 4OTPA 5C8MA 4E4NA 3HEGA 1R1WA 3P4KA 5CU0A 1W0XC 3WF6A 3R9NA 4FZDB 4H3PA 3IS5A 4CKJA 4GKHA 3AMAA 3ORXA 3KY2A 2YZLA 4WIHA 5E91A 4BCGA 5JGDA 1FBNA 1URWA 3DK3A 5CSVA 3Q60A 4HVGA 2LGCA 1OGUA 3RPSA 3SX9A 3UBDA 4X2NA 4I20A 2PZYA 4EOOA 5HO8A 1QL6A 2VTPA 4M84A 4OT6A 2F2UA 3QGYA 5F94A 3REPA 3TN8A 5EKNA 1NVQA 4X0MA 4E5BA 2R3IA 3BEGA 2OGVA 2XK8A 4Q5HA 4JRVA 1KV1A 4BBMA 5LVMA 3G9LX 3DBDA 3NPCA 3EQRA 5BVNA 4RWLA 5JZNA 4FKIA 4BKJA 2WXVA 3SQQA 4EKKA 3EOCA 3ZUTA 1AGWA 3Q52A 3V5JA 1A9UA 2BDJA 3BHHA 3QD2B 4Y83A 4AF3A 4IAAA 5A14A 4AWIA 4O7TA 3MY5A 2ZAZA 2ONLC 3BGZA 4NKAA 5CU3A 3MPTA 4FYNA 3UQFA 4X21A 3FDNA 2QU6A 4PTCA 3ZFXA 2UUEA 2GHMA 3R28A 2QO9A 3VN9A 4MD8E 2WIPA 3DZOA 5F4NA 2XKCA 3FZTA 3WF5A 4UMUA 1PXLA 3UPZA 3IONA 4EZ7A 2WMWA 4XHKB 4ALWA 3NNVA 4ZSEA 2J50A 4C57A 4DT9A 1UKIA 1ZY5A 5GJFA 1WBVA 1RW8A 1KE9A 3P86A 1FINA 3BLHA 4YTFA 4FKTA 2ZV8A 3EZRA 3KFAA 3QZHA 4I0TA 4K11A 1J1CA 1FOTA 3S4QA 5I3OA 1V0BA 3NGAA 5EOLA 4KSPA 4BCQA 3ZM9A 3V6SA 3RK7A 2X9FA 4QMYA 4X3FC 3FYJX 2O5KA 4Z55A 3VNTA 2GNIA 3BWJA 5ETFA 4AFEA 4IX3A 5FXRA 1M2QA 3HV7A 1LEWA 5AP5A 3FZRA 4O96A 5H9BA 3QKMA 5HX6A 1Q8ZA 5LMBA 3LCTA 3KC3A 1P5EA 4XRJA 4IXPA 4EJ7A 3LQ3A 4NIFA 2QR7A 3FLQA 5ETIA 4AW1A 3LIJA 2BROA 2CNVA 4YJTA 4C0TA 4FA2A 3CKXA 3UVRA 4CG8A 4F63A 3P0MA 1JBPE 4FE2A 3R8PA 4CFWA 4TNBA 4BDKA 4I0SA 3UZTA 5E8WA 4MD7E 2YM7A 3Q9YA 1KUTA 4ZS4A 4EH9A 5L2IA 3E8CA 3CR0A 3GU7A 5G6VA 5FGKA 2QI8A 2CNUA 2VTSA 4UX9A 1OKVA 3GU6A 4BBEA 4C3FA 2EUFB 4PL4A 3T3VA 4ASDA 5KMIA 4ANNA 2ZB1A 5JT2A 3G33A 3QWKA 2C1AA 2XRUA 5DRDA 3AC8A 3U54A 4PP7A 1YOLA 2IG7A 2RF9A 4AU8A 2GTMA 2W4JA 4WG5A 4KWPA 2YDJA 3BKBA 3CJGA 4M8TA 4YNEA 5HO7A 2PY3A 4O6LA 4XOYA 1SVHA 4FIGA 3FKNA 3AC4A 4L68A 3ZFYA 3C9WA 3FBVA 3NYVA 4NW5A 1GZKA 3OG7A 3FL4A 2XIYA 4GRBA 1Q8YA 4MCVA 5ETCA 4E6DA 4IM0A 4Q5EA 5EI6A 5HBEA 3R9HA 4ZMEA 2O3PA 3Q04A 5AV1A 4RIXB 2UVYA 4GYGA 5E8VA 4KNBA 3VJOA 4KIKA 4FKUA 3EQCA 2YHVA 2WU6A 4F9WA 4DH7A 1H1PA 3AD6A 3B8QA 4TPTA 5CU6A 2WO6A 5IA1A 4TL0A 3GQLA 3QA0A 3ZEPA 3KF4A 2G1TA 3P7CA 4D5KA 4FV0A 2E9VA 3RINA 5L8LA 2UV2A 4FUXA 1M7QA 4ENXA 2OFUA 4NCTA 2F7ZE 2YAKA 4BRXA 2PUUA 5TOZA 3UYTA 4C58A 3G9NA 4O6EA 4NM7A 4YZCA 3EFWA 5AUXA 4CZUA 2PZPA 3QTRA 5I9WA 4PP9A 2W9ZB 5HTBA 5EI2A 4FIFA 3TZMA 5A6OA 3TV7A 3BIZA 4D2SA 4QPMA 2B4SB 4O7RA 3P7BA 4IANA 5CF5A 3AMYA 5AAEA 3Q5IA 4TKSA 4UMTA 2AC3A 5KMNA 3KVWA 1OMWA 3R1SA 3RGFA 4OR5A 4JL9A 4X6QC 3UPXA 2ITNA 1ZYLA 3F69A 5A4EA 3TTIA 3ROYA 4MK0A 3VS5A 3FQHA 3BRBA 4X3FB 1JKLA 1MRYA 4FKWA 4KRCA 5AR4A 5GNKA 3V04A 5KUPA 5CANA 1W98A 4AOTA 2WTIA 3KRJA 2A2AA 4H05A 3IG7A 4ZSJA 1LUFA 4RVLA 4HGSA 3ZMMA 3W33A 4L8MA 4UWBA 3FYKX 1PXIA 5LCKA 5EW9A 5JZJA 3C4WA 5K4JA 4ASXA 2XKEA 2YM3A 5IUGA 1MP8A 4LV8A 3UOKA 4CGAA 4XV1A 2JFMA 3ORTA 1JVPP 5BYLA 2XNGA 4NU1A 3RPVA 3R2BA 1BMKA 3NSZA 4C59A 3ID6C 5GJGA 5ACBC 2XJ1A 4QTDA 3FLNC 4CQGA 4APPA 3EQBA 3Q5ZA 1JOWB 4WRSA 2QR8A 4FTAA 3E93A 4MXZA 1QPCA 3COIA 5HE3A 2OU7A 2PVNA 4QMMA 4RWKA 1SVEA 2GNHA 1YXVA 3BYMA 3ZH8A 2JITA 4LOOA 4RJ7A 4EONA 1R78A 4I23A 4E6QA 3NUAA 2I6LA 3SG9A 2J5EA 2VTRA 1JLUE 4QP8A 3LQ8A 3LPBA 5M06A 1Z5MA 2W1IA 3KVXA 2VRXA 4FT9A 2OFVA 1Q5KA 5CEQA 4O7SA 4QP7A 4USFA 3PVBA 5JEBA 3UNKA 1UKHA 2G2HA 1SNXA 2WMXA 4KBKA 4XEYA 4O0UA 5DT3A 4LUEA 4C4GA 4CLJA 5IQCA 2BRNA 4FTLA 4QO9A 4TNDA 3DB6A 2EB2A 2BAQA 2JGZA 1LPUA 3R71A 5CI7A 4AGWA 4S31A 3DQWA 3F66A 2VD5A 3TDVA 4QMWA 3NR9A 4OTIA 4FYOA 3DJ5A 4QMLA 2GPHA 3II5A 3LMGA 2X7OA 3MDYA 1FGKA 1R0PA 3MH3A 3WZKA 2I7QA 1Q99A 1TVOA 4GJ3A 1OZ1A 1HCLA 4M15A 5LQFA 3HRBA 3HVCA 3W2QA 3R8LA 2F57A 2C1BA 2HCKA 3D15A 3OXTA 3PG1A 3D83A 3TNIA 4EYJA 2X39A 3S1HA 5M4IA 3D94A 3F5UA 4I4EA 4JBOA 2IZRA 2X2MA 5TKDA 4B99A 5IQFA 1VR2A 2IW8A 2NNWB 4XP2A 4CFNA 5DRBA 4X2JA 1M17A 5J9LA 3GP0A 2LAVA 4CYJA 5C27A 5CVGA 5LVPA 2HZ0A 3HV4A 2OXYA 2PVLA 4YNOA 2CNQA 3UVPA 2V7OA 4GG7A 1ZRZA 2UZTA 2X6DA 2NRYA 3HA8A 1RDQE 3OS3A 2PK9A 3WILA 4XNEA 4YHJA 4HYHA 4XG7A 4RFMA 4BBFA 1B6CB 4MF0A 5H2UA 5C8NA 3TUBA 1PXJA 2OZAB 3PE2A 4QYYA 5DIAA 3HECA 2OKRA 5AR7A 4BGGA 5AP0A 5DA3A 2BHHA 3R7IA 4AT3A 1KE6A 4ITHA 3ITZA 3ZRLA 3PDTA 4E5AX 3VRZA 3UODA 4U45A 2Z7RA 4R6VA 4V0GB 4IFGA 2ZM1A 3D2IA 2C4GA 4GYIA 3VJNA 4AA5A 3MVJA 1O6LA 1OL6A 3C4FA 4QYGA 5DFPA 2H34A 3ZLSA 4E73A 1H28A 3RHXA 4RWJA 2IVUA 4WNOA 3MB7A 1TKIA 3KULA 3SRVB 2YDKA 3BU3A 5ANDA 4BYIA 4BGHA 3O7LB 4ASEA 3H10A 1PXPA 3HP5A 5CNOA 5HLNA 4IWQA 3BPRA 4JIAA 4AE6A 2ETRA 4G17A 3DKCA 3LLAA 4GCJA 4L53A 3RCJA 1P14A 4IZYA 1H07A 2XKDA 4FSRA 4CZYB 2Z7SA 5HVKA 2QLUA 4R7HA 3QRKA 4JI9A 3ELJA 5A54A 2JFLA 1YDTE 3DBEA 3R63A 4U9AA 4C37A 4F0GA 1ATPE 1CKPA 2C6IA 4UY9A 4AGUA 2WQBA 4PPAA 3RM6A 4G3FA 5LARA 4NM0A 3GC7A 4MBIA 4AN2A 1WBNA 3QA8A 1ZOHA 4QNAA 3TWJA 2G15A 4IMYA 3VWAA 4E6CA 1GIHA 4AZVA 4F1MA 3BLRA 5HE0A 4O7YA 2WFYA 3V8WA 5CT0A 4XMOA 2B9FA 4EUTA 2VO0A 5C03A 1GAGA 2QHMA 4M66A 3W2SA 3JPVA 2EXMA 5IH5A 1OUKA 5M51A 3DKGA 3F2NA 3R7UA 3GOKA 4HVDA 2HZNA 3FLWA 3P78A 2BDFA 2GTNA 4RIYB 3OTVA 3TEIA 4DTAA 2X0GA 4AQCA 4J97A 2EWAA 4DLIA 4DGLC 2OJJA 1KSWA 2NRUA 4N6YA 1U4DA 4I41A 3M11A 3QFVA 1YOJA 3GB2A 5D11A 4QNYA 2CHLA 5LVLA 3VHKA 4AZSA 2IZTA 2CDZA 2PZIA 2BZIB 1U54A 3BGPA 3CE3A 3CLYA 3PZHA 4EHEA 4ZEGA 2QCSA 3ET7A 3H9RA 4FVRA 4FTTA 4IVCA 4LUDA 3ZC5A 4YP8A 4E1ZA 2BAKA 4MXYA 4WO5A 4I22A 4AOIA 4RA4A 2UZVA 4DCEA 4MHAA 5IDNA 2B0QA 4BI0A 3LFEA 1ZLTA 3ALOA 5TR6A 3D7ZA 4E3CA 5JFWA 2A1AB 3NCZA 2UZOA 4FOCA 2C6EA 3MSSA 2YA9A 3NCGA 3FE3A 4O38A 4DFUA 4EH7A 4QP9A 3MYGA 5I0BA 3VS0A 3FWQA 4O7LA 4ZSLA 2Q83A 2UZBA 3RTPA 1OKZA 1JQHA 3C0HA 3SG8A 3EN6A 4XV3A 4EI4A 3ANQA 5DE2A 4CMOA 4UN0C 4U3YA 4PMPA 1XH9A 3DTWA 1XH5A 4AN3A 3SC1A 4ACDA 1IA8A 3EQPA 1H8FA 4KKEA 2BCJA 3TV4A 1Q4LA 2HY81 3HDNA 5CX9A 2CGWA 3JY0A 4OLIA 2RFNA 4A06A 2DYLA 3BELA 4F08A 5G1XA 3WZUA 3ZO2A 5IISA 2J0KA 2R64A 2XEZA 3F7WA 3EH9A 2Y9QA 3KA0A 4YLLA 1MQBA 3R8VA 3TJDA 2DUVA 2DQ7X 4J95A 3VUKA 3HMMA 5E1SA 5HG8A 4JDKA 1XBBA 4O82A 2XVDA 5F1ZA 4WBBB 4YC6A 2XS0A 3EB0A 2VTOA 4S32A 4UB7A 5J95A 3ROCA 3Q4ZA 3TG1A 2WMBA 4QMUA 1L8TA 1UU3A 5BVEA 4TYIA 2W4OA 3PRFA 4IDVA 3FMHA 1H0WA 1PKGA 3QQKA 4O0SA 4EH3A 2UW0A 1H25A 3O8TA 4G16A 4FT3A 3WF8A 5DYJA 1YHWA 3WZJA 5L6OA 3EHAA 3OOGA 4MTAA 4F0FA 4TZRA 4XOZA 4EH8A 1A06A 3AC2A 5I9YA 3VIDA 3BHYA 3UYSA 4O7VA 4GT5A 2VTJA 3IW8A 5HKMA 4HGTA 4NM3A 3R9OA 2PVJA 1VEBA 1OBGA 1O6KA 3OTUA 3LFNA 5AIRA 4AZFA 2YEXA 1R39A 4IE9A 3BHVA 3GEQA 1NXKA 2ETKA 5CEOA 5KMJA 3UTOA 4G3DA 4FKOA 2UVXA 5AP3A 3F5GA 1Y6BA 4MNFA 3V5QA 4BDJA 4K2RA 2BAJA 3MFUA 1VYWA 5IKWA 3A2CA 5CQWA 4MNEB 1ZOGA 3DXNA 3ORKA 3BYUA 2W7XA 1P4FA 3ACKA 3IW4A 4U42A 1WVXA 3QWJA 4OTGA 5D41A 1XO2B 5AP7A 3W2OA 4AW0A 4DC2A 4FX3A 4DEIA 4DFYA 3VS1A 3QKKA 4GW8A 4EHGA 3F2AA 3D5UA 5EI8A 3VQUA 4ERWA 2XP2A 3I79A 3PLSA 1PMVA 3DKOA 2X7GA 1F3MC 3D0EA 5CS6A 4D2RA 3LHJA 4CQEA 4D2PA 3OEZA 3PIXA 2W06A 3FXWA 3ZO1A 1SMHA 2B9JA 2J0IA 2VNYA 3G2FA 4ANQA 1PYEA 2WMRA 3OWLA 4F7JA 3BYOA 5IA5A 2OH0E 5LMAA 4I5CA 4L7SA 2R3PA 4Y8DA 4KABA 5FEEA 3G51A 2HAKA 3OVVA 4DE4A 3OW3A 3NEWA 4Y5QA 2Y6MA 2JKKA 3C4EA 5FTOA 4L45A 3FXZA 4AACA 2FSTX 4B7TA 5IPJA 5DR9A 5HIDA 1NT2A 4GMYA 4F64A 3EKKA 4FV8A 4UALA 5FM3A 4CFVA 4RLLA 3MW1A 2OIQA 4IVBA 1G5SA 3W2PA 5HX8A 4NL0A 2W9FB 3H9OA 2C3JA 3SA0A 5EHLA 4DGMA 1B39A 1WMKA 1JKTA 1W83A 2OK1A 3M42A 4M12A 5KMKA 2B54A 3MESA 4EWQA 1H26A 4RJ5A 4MD9E 4I24A 1XH6A 3CPCA 1LR4A 5HTCA 4C35A 2RGPA 4BWKA 3BYVA 5BNJA 4OTHA 4CFFA 4IAYA 4JIKA 4JQ8A 1H27A 1YI3A 5KZIA 4J52A 1UWJA 2CKOA 4LGDA 4RG0A 5CY3A 4I21A 5DWRA 2UW4A 2FA2A 4FC0A 3R83A 3LQ5A 3TKUA 4EOLA 4UYAA 4JJRA 1YDRE 1CKIA 3LFDA 3BQCA 3PJ3A 5HGIA 2R3HA 3OWJA 3KRRA 1W84A 2VWZA 4J1RA 4KINA 4I5HA 2XBAA 3OY1A 4GU6A 5CSHA 4DITA 2Z02A 1IEPA 2WAJA 1Z57A 4L52A 2W1GA 5F20A 5HLPA 3EMGA 3QD4A 2ITYA 3T3UA 3QKLA 2V62A 2ZV2A 3N51A 4TT7A 3HKOA 2VAGA 5A4LA 4BDGA 4YZ9A 3I1AA 5TF9A 3P79A 2XNPA 4P90A 3OEFX 2WQNA 3KCKA 4IC7A 2F4JA 3MFTA 1BL7A 4YTIA 5HBJA 3M1SA 2YJRA 5IQAA 4LI5A 3OBJA 3LW0A 2JBPA 3QTQA 4D4YA 2WKMA 3L9NA 4FKRA 5IA3A 2CKEA 4W8DA 2UVZA 2BKZA 1BYGA 3BV2A 4FTMA 4C4HA 4OBPA 4B8MA 1Y8GA 1ZWSA 1Q8TA 3C4CA 3LCSA 5GHVA 5JRSA 3SOAA 4C61A 2XYUA 4BDFA 5JGBA 4XV9A 1W8CA 4EOKA 4NJ3A 5K9IA 4RZWA 3RNIA 4M69B 3U6JA 3AOXA 4C8BA 1PJKA 4RX7A 4PPCA 5I3RA 3NUPA 4UWYA 4FSMA 3RBWA 4O86A 3FJQE 2BMCA 5KZ0A 5M53A 4DA5A 5DN3A 3UOHA 4E4LA 2C0TA 3PA4A 4L01A 5EM5A 3MS9A 4DTBA 2XIRA 3VUDA 4FTJA 4YMJA 3E7VA 4M97A 4MXXA 3V51A 5E9EA 4ANBA 4WG4A 2BHEA 1VJYA 1YI6A 2PHKA 5AA8A 2A19B 5FUTA 5HEZA 1T46A 5CXZA 5HORA 2RIOA 1XBCA 3BGQA 4DEEA 3D5VA 1JNKA 2BUJA 3COMA 3R73A 1YHVA 2A27A 3LCOA 2GNJA 3GC8A 4BGQA 5ETAA 4FT5A 3A99A 2IJMA 3LXNA 2C6OA 2P33A 3F3UA 4Z3VA 4ZY4A 5DG5A 1J91A 3U87A 5FP5A 2PTKA 1OL1A 4L3LA 3QU0A 1J7IA 3RM7A 5EDPA 3ACJA 3AD4A 4ANLA 4IWOA 5KKRB 1ZAOA 4FTKA 5D1JA 2EU9A 3EQDA 2DWBA 3OT3A 5ANEA 4O1OA 3S95A 5L6PA 4DG2E 3P23A 4ZJJA 4YZNA 3S00A 3ERKA 4O0YA 4E93A 4DFXE 3VUTA 3JR1A 4RVKA 5AR8A 4RVTA 1YKRA 3DS6A 4PMTA 4ITJA 2WMQA 2JC6A 3K54A 2QNJA 3PA3A 4P4CA 2CCHA 4RJ6A 3F5XA 2F7EE 4N57A 4JAIA 2XNEA 2X6EA 3LFBA 4TYEA 2W1EA 2PPQA 4QP1A 3BZ3A 4NM5A 2I0YA 3ORIA 3QLGA 2QHNA 4NZWB 2B9HA 5EYDA 5FLFA 5CF4A 4FG7A 3S0OA 2BZKB 5HI2A 3O7LD 4PNIA 4ZTLA 1XJDA 3DKFA 2OJGA 3G6HA 2PVYA 3LFQA 1KV2A 4I92A 3MWUA 2HW6A 2YABA 3R00A 5GZ9A 3WARA 1IASA 3PIZA 4E26A 2GDOA 3E63A 2W0JA 3MY1A 4RIWB 4BL1A 4ZXTA 4C2WA 4ORKA 3MI9A 2ITTA 3AT4A 3O2MA 4RIYA 5EDRA 3PPJA 5FXQA 5LJJA 4QMOA 3PSBA 3V8TA 4PDSA 4RX5A 3UQGA 4I5PA 4DH8A 4CZTA 3KREA 3VVHA 2Y7JA 1KE8A 4RA5A 3R0TA 3WIGA 4ACMA 3QRIA 3QUPA 3DNDA 3VBWA 5C4KA 4RFYA 1PXOA 1CKJA 3UIBA 5J9ZA 3LMHA 2O65A 5ICPA 5EQYA 5T6KA 1K9AA 5EFQA 3ZFMA 1Y57A 5IEYA 4EQUA 2XK9A 4LL0A 5FG8A 2VU3A 3QTIA 4FZ6A 4YC8A 3E5AA 5CEPA 4R3CA 4FV9A 4QD6A 4E20A 3L1SA 3V8SA 4BCJA 3W10A 3E92A 5HG9A 4C4IA 2V0DA 4FSUA 2RG6A 4H3QA 4W8EA 3IW7A 2PE2A 4BIEA 4G9CA 4ONAA 4I6BA 4LOPA 3KXXA 4JBPA 3U51A 4Z7GA 4NFMA 4B4LA 3KMMA 4W4WA 3OXIA 2IWIA 4MX9A 4UWCA 5C1QB 4MWHA 2WELA 3TI1A 3ZUUA 2JKQA 2WZJA 5KBQA 1Q8WA 2R5TA 4I94A 1O9UA 1SVGA 4U81A 2XKFA 2QG5A 4KD1A 3ZU7A 3I5ZA 3UIUA 3UJGA 3HGKA 5HESA 3I81A 3C7QA 4RVMA 4EH2A 4IX5A 4K1BA 4OTFA 1UWHA 4IB5A 4D9TA 4KAOA 2DS1A 4FKQA 3GCQA 3S3IA 1YWNA 4MBLA 3FI8A 3R30A 3UNJA 4TYJA 3DGKA 5F95A 3IECA 3I6WA 2RG5A 1J1BA 3WYXA 5BMSA 2XBJA 2YIYA 4FV3A 5DGZA 4D28A 4DEHA 5CENA 3NMUF 4XG2A 2HENA 5FEDA 1QMZA 2W5AA 3VW6A 4BDDA 4F9CA 2W96B 2PUNA 3SKCA 4BZNA 3IW6A 3NW7A 4DGGA 3HMPA 4K8AA 4NTTA 2WGJA 4RLKA 5E4HA 2UW5A 4BCPA 1H1QA 3OCTA 3OT8A 2B52A 4Q2AA 2XM9A 5KMLA 2RFEA 4PTGA 2PMOX 2W4KA 2EVAA 2OWBA 2R0IA 3MVHA 3HYHA 3QL8A 3TT0A 3VC4A 4C3PA 4TYHB 2XCHA 5BUJA 4G6NA 5ITAA 5M4CA 2JEDA 4CKIA 1U46A 4QP3A 3TNWA 4FEVA
chains in the Genus database with same CATH superfamily
2F49A 4HYUA 2XCKA 1IRKA 3RPOA 3RZBA 1KWPA 5AA9A 4I6FA 3GCVA 2WMAA 3CQWA 3F6XA 3O0GA 2BDWA 3VS4A 4XX9A 4EOJA 4F78A 1V0PA 4MF1A 5A3XA 5CTPA 4D1XA 2ESMA 1XBAA 4PV0A 5DH3A 4JAJA 3FY2A 3DXQA 4DCAA 5T3QA 2JLDA 3QRTA 4IW0A 2W5HA 4Y72A 3ETAA 2W1ZA 3D7TA 4XV2A 5E92A 5HG5A 3HAVA 1TQMA 4MNEA 2ZVAA 3OUNB 2C68A 1GIJA 1V1KA 4IZ7A 3HUCA 2Z60A 2JDOA 3FHRA 3FZ1A 4FV1A 2R3LA 3PE1A 4GK2A 4CVAA 2VO6A 5BVFA 2YCRA 1W7HA 4O1PA 4AS0A 2YERA 3EFLA 4N70A 4UZDA 3DPKA 3RWQA 5LVOA 1PMNA 3IW5A 1GOLA 2AYPA 3NW6A 4RIOA 4O4EA 1Y91A 4APCA 3HAMA 3E7OA 3F3TA 4USDA 4CXAA 3P08A 3D5XA 4JQ7A 2YIWA 3BU5A 4J8MA 1YRPA 4EJNA 3OF0A 2QU5A 4O7NA 2R3FA 3MA6A 3VO3A 1M2PA 2R3JA 4HYIA 5BQ0A 5HE1A 2X1NA 3JVRA 3PY3A 4L3JA 1JSUA 5AUZA 4B0GA 4DLJA 4ZTHA 5DLSA 2XK4A 4IACA 4HJOA 4FL2A 3ZHPC 3ZLWA 5M57A 5T68A 3PTGA 5CU4A 4M0ZA 3DT1A 5EHYA 4KB8A 4WG3A 4MXOA 2HELA 4PUZA 2C5NA 2HZIA 4X2KA 4D58A 4R1YA 2VWXA 4C38A 4HCTA 3UIXA 1G8SA 5AUYA 2VO3A 4YC3A 4MBJA 4QMQA 3QCQA 5HICA 4B8LA 1I44A 4KBCA 4B6LA 5JN2A 2VNWA 3DAJA 4JT3A 5EHOA 2BFXA 3DBQA 3SXSA 2BKKA 5HNIX 4BDIA 5JKGA 4IM3A 4XYFA 5HNBA 4LMUA 5EYCA 2GS2A 4YTHA 2VGPA 4FZ7A 4E5WA 4U40A 3CQEA 4M3QA 5KHWA 4AQKA 4YJNA 3NNXA 3CQUA 3QQUA 3T8OA 4ASZA 2ZB0A 1BUHA 3FSKA 3QRUA 3UG1A 3MB6A 4PDPA 2X0OA 4RSSA 3K3JA 1YWVA 5HE2A 4AG8A 4O91A 3B2WA 4C2VA 5CAUA 3A7IA 5CVHA 2ERZE 2J6MA 3AXWA 1DI9A 3P1AA 5FTQA 4DEBA 5FXSA 5L8KA 3QX4A 4JR7A 3N4TA 2JDVA 4GUBA 3CJFA 3MFSA 1H0VA 4AZWA 4NKSA 3V5TA 4DEGA 5L4QA 4F7SA 3PXKA 3VBVA 2WTJA 3EQIA 3RI1A 3JUHA 1FMKA 1YOMA 2P2HA 4TTHB 4CEGA 3FHIA 3AQVA 4ZTQA 3F2RA 2YCQA 5AIKA 5JMSA 2ZOQA 3KXMA 2YDIA 5EM8A 2V7AA 3I4BA 4U80A 4EUUA 3SV0A 2EXCX 2YCFA 4JG7A 3QCSA 4QMTA 3TUDA 3PP0A 3WE8A 1LEZA 3RAIA 3OWPA 3OUKA 3FI4A 4G6OA 4G3CA 1OKYA 2WMTA 3KKVA 1CM8A 2NPQA 4M69A 2YM8A 5KE0A 5LMKA 2OF4A 2H96A 2XUUA 1M14A 1OECA 4D4SA 2CSNA 3JYAA 4FUYA 2UW3A 4O21A 4RC3A 3CIKA 2BVAA 1PHKA 3BE9A 3FKLA 4YBJA 1Q3WA 1PF8A 2AEGA 3HV6A 1H00A 3EZVA 4QMZA 3AGMA 4C7TA 3G5DA 5ANKA 2QODA 2JAMA 3ZSHA 2X2KA 3W0NA 3G0FA 4CRSA 3OP5A 2HYYA 2PU8A 3ZSIA 4E7WA 3HP2A 4FIJA 3PSCA 4ZOGA 1XR1A 2YM6A 3F3ZA 3LOKA 5E8ZA 3W2RA 4FEXA 4GJ2A 1OGYA 2REIA 3NNWA 4MYGA 4XS2A 4EWHA 3IKAA 4P5ZA 4EORA 2XMYA 2I1MA 2C6MA 5J5TA 3Q2JA 2VO7A 4HCUA 3NW5A 5GIOE 1LP4A 4FODA 4R78A 2X4ZA 3FKOA 4FTCA 1JSTA 4L00A 5FP6A 3CTJA 5FM2A 4FOBA 4LV5A 4FIEA 1VYZA 4XH6A 4O4FA 2HZ4A 1KE7A 1VLRA 2OH4A 4FSTA 5DPVA 4AFJA 3DBCA 5AUVA 2PULA 4EH4A 4GFMA 2ZYBA 3HMIA 5FQDC 5ACKA 3UIMA 4IJ9A 2WNTA 3LFCA 4K18A 1JKKA 1V0OA 3FMEA 3NWWA 3RP9A 5CAPA 4D55A 5FWKK 4A9TA 1U5QA 3D2KA 1BKXA 2W1CA 2XH5A 4ENYA 1OIRA 4Q9ZA 2C5OA 4FICA 1PMUA 4PPBA 4W9WA 1G8JA 3QBNA 3CGFA 3NFFB 3OD6X 2E9NA 3WIKA 4B9DA 2OJ9A 4AT4A 4EL9A 4CFUA 1YWRA 3TIZA 3ZYAA 3QGWA 2CMWA 4MQ1A 3R1YA 4CRLA 5KHXA 4IX4A 4IWPA 5BVWA 4FNZA 4ZK5A 3UOLA 2R3OA 2UZNA 5C26A 3DY7A 4AXCA 4J8NA 1Y8YA 3L8XA 3DAEA 4S33A 4HVHA 4G3EA 4IIRA 2OW3A 5JH6A 1KE5A 3HUBA 4Z7HA 2VTMA 3DQXA 3QC9A 3N9XA 5EH0A 4DGNA 5A4TA 1CSNA 1R3CA 2R7BA 2NO3A 2WTKC 4DGOA 3BYSA 3LM5A 4BKZA 4CG9A 4G31A 3Q53A 3QCXA 4IEBA 4MXAA 4YBKA 3VBQA 2VN9A 1H08A 2VV9A 2XJ2A 2IVVA 5BX0A 5AADA 5CEMA 3A7HA 1BLXA 5AP1A 5HU9A 3DV3A 3Q9ZA 1SNUA 4XBUA 3RK5A 2YM4A 3QZGA 3T9IA 3I7BA 4OTDA 3N4UA 4DT8A 1ZMUA 2VTTA 3TZ9A 3R01A 1L3RE 2E9PA 3PWYA 1UNLA 3PG3A 5DVRA 3UVQA 2CN5A 1MRUA 4BVUA 4FSQA 1WCCA 3LJ1A 3ANRA 2GU8A 3C50A 2OLCA 4HNIA 3R22A 2FO0A 4L6QA 4YZBA 3WZEA 4FMQA 2P55A 1H1WA 4FZFB 5DEWA 5DHJA 3NAYA 4ALUA 2E9OA 4EOSA 4HVSA 3U6IA 5EOBA 3VHEA 2ETMA 4CV8A 3ATTA 2P2IA 3PXFA 4RC2A 2RSVA 2R3NA 3WE4A 5HD7A 3L9PA 3MH2A 3BX5A 3R6XA 3MVMA 2OI4X 4IB1A 4LV7A 3NYXA 2YN8A 3Q9XA 4QMPA 4QT1A 4FEUA 3QTXA 1BI8A 5IH6A 4XRLA 4NCTC 3MBLA 4BTMA 4EOQA 4GT4A 4R5SA 3R1NA 4L46A 4LFIA 4PY1A 3PXZA 3OWKA 3LZBA 4BYJA 4GSBA 4XP0A 2AC5A 2CGUA 3A7JA 3PA5A 3QALE 4II5A 3DFCB 4U43A 4FGBA 3QCYA 4BHNA 4EOMA 4ZSAA 3E8EA 1VZOA 3HL7A 5ANIA 5M08A 3MJ2A 3VS7A 4EH6A 5E8XA 1YQJA 1QCFA 4QQCA 5HD4A 2GQGA 4FZAB 1YXUA 4QTCA 4YURA 3WZDA 3O8PA 2ZDUA 3RPYA 5AUWA 3TKHA 4E4MA 5HO6A 5L6WL 1XHAA 1XH7A 4ZP5A 2FYSA 2G2FA 2UZDA 3BQRA 4IB0A 4K77A 3MV5A 5AR2A 1REJA 4WUAA 2QKWB 4NW6A 4DBXA 4BDHA 4AZTA 2WTVA 4FTNA 4HZRA 4I6LA 5M07A 2OXDA 3A60A 3BBWA 4LMNA 4NIFB 4PTEA 5AP2A 5L8JA 1ST4A 5JSMA 2R3KA 2OSCA 3CEKA 3L8SA 4WBOA 4YPSA 3U9CA 3ZM4A 2QC6A 4W4VA 4PNKA 1G8KA 4X7QA 4ZTSA 4ZSGA 4R1VA 2HY0A 3EIDA 4A4XA 3C51A 3R7YA 4LRKA 2W99B 4YTCA 4PL5A 3C5IA 1REKA 3ZZEA 3TZ8A 1QPDA 3CY3A 4EZ5A 3ZXZA 3NIZA 5FBOA 3FAAA 3NZ0A 3K5UA 4FTOA 2PVFA 4RIXA 5DI1A 3EN9A 4F70A 1Y6AA 1R0EA 3ORMA 1WVYA 4KS8A 5J1VA 3D9VA 4GUEA 2QOKA 2WTKB 4AGDA 1OL5A 3CP9A 5JK3A 4L67A 3EFKA 3VW8A 4DH5A 2P0CA 4IX6A 4D0XA 3MPMA 2WMSA 1E1XA 2BRHA 5I5ZA 2C6KA 3QHRA 3AD5A 3W16A 4A4OA 5K5NA 3RZFA 3AC5A 4ZZOA 4EEVA 2ITVA 2ONLA 4FEQA 3AMBA 2YAAA 3LVPA 4LL5A 1TFFA 2PWLA 3H0ZA 3HRFA 3D14A 4JDHA 1H24A 2QOCA 3TMOA 3ODZX 2E9UA 5EM6A 4TWOA 2GMXA 4NJDA 4AX8A 5M56A 3EYGA 2YWVA 4RX9A 5BPYA 2A0CX 3C13A 4OTWA 4QP4A 3GI3A 5CQUA 3FPMA 3O23A 3TNQB 3GU4A 4R3PA 5E90A 4IZ5A 3PY1A 2GNFA 3TNPC 3FLZA 5AWMA 1J7UA 2C5XA 3KMUA 1JSVA 3AC1A 3GQIA 3L8VA 4DFZE 2J0MB 5BVOA 1ERKA 3FPQA 4FV5A 3LFAA 3KCFA 3DDQA 5AX3A 2C3LA 3E64A 4X3FA 2CGXA 5L2TA 4FNYA 2X8IA 4U8ZA 2R9SA 2QLQA 3LFSA 4JDIA 1DAYA 4YJQA 5CSWA 2JAVA 4X2FA 2KULA 2QO7A 4LM5A 3ZCLA 5HQ0A 5IG1A 5JFSA 4F9YA 2XIKA 2CKPA 1HCKA 1Q3DA 2JIUA 3QC4A 3SXRA 2ITOA 2GCDA 5IF1A 3DJ6A 4QDEA 3AC3A 4RJ4A 5L2WA 2HWOA 2XNBA 1APME 3BHTA 5K3YA 4OGRA 2VGOA 3A62A 3VBTA 5A9UA 1AD5A 4HGEA 5IQIA 2O0UA 2R3QA 4TWPA 1I09A 4C02A 3S2PA 2IZSA 2VX0A 3FZSA 4DHJA 1ZZLA 4HCVA 2OJIA 3OCSA 4YO4A 4DINA 2BFYA 2J9MA 3P9JA 4IVAA 5HCXA 5CASA 4D2VA 1Q8UA 3NIEA 4YJSA 2QOHA 3PSDA 4FV7A 4S30A 3LCKA 3LLTA 1OIUA 5JFXA 4X6RA 4JVGA 1S9JA 5JRQA 3A4OX 4FVPA 1ZARA 1FVRA 2WQMA 1RJBA 4GU9A 3FMDA 4KBAA 4MKCA 5AR3A 4ERKA 3PVUA 2YIXA 3R9DA 3LCDA 1HOWA 3RCDA 3CTHA 3VS2A 4Y46A 3WF7A 1JPAA 2GS7A 5DOSA 4IZAA 2C0OA 3ZTXA 3ZC6A 4YLJA 4ALVA 5LVNA 4QQ5A 4U97A 4AA4A 3WF9A 4FJVA 4O7ZA 4DH3A 4CV9A 2VTHA 4S2ZA 5K5XA 3OC1A 3NFGB 4EOIA 1ZMVA 3DOGA 3EQHA 4KIOA 3O17A 3LXPA 5TE0A 4BI1A 3LKMA 3PVWA 4FTUA 4FK3A 3UC3A 5IQGA 4UMPA 4CT1A 3A8XA 2V55A 4OTQA 3A61A 4EK4A 1ST0A 5F9EA 3VS6A 3WI6A 4HPTE 3RNYA 3R02A 4ZTRA 5EW3A 5E1EA 4BCFA 4GVAA 3QTSA 4WNKA 1WAKA 4OUCA 5DR2A 4ZJIA 3WOWA 4AGCA 4BCHA 3DXPA 2YWPA 3BL9A 3FEGA 2R3GA 2W1HA 5H8BA 4G2FA 2OJFE 2XRWA 4DH1A 3AT3A 4HZSA 5LOHA 2QURA 2O8YA 4RX8A 4EBVA 2XNOA 2Z2WA 1Q24A 1RQQA 3CD3A 4UEUA 4DF3A 2JDRA 4ANSA 1QPJA 5HCZA 2YCSA 4FNXA 4C33A 4FKGA 4D2WA 5JQ8A 3K5VA 3IDBA 3QXOA 4I3ZA 4TXCA 4JG8A 3R7VA 1FQ1B 5AUTA 4BZOA 3FC1X 3KU2A 3PY0A 4FIHA 3VQHA 4UZHA 2ZDTA 3ZS5A 3QAME 4NTSA 5D7AA 2IN6A 2NP8A 3DA6A 3G90X 2PVHA 3LFFA 1GZOA 3EKNA 3N4VA 4BY9E 3R21A 3TYKA 4NFNA 4ZJVA 4YHFA 3HZTA 3O51A 2OZAA 2J5FA 5L2SA 3PXQA 4IC8A 1SM2A 2CLQA 2IVSA 2Q0NA 3R2YA 4XCUA 3MIYA 5CXHA 4R3RA 3G15A 4XG3A 2YLFA 4F1OA 3KRXA 3NYNA 4GIIA 1ZYSA 2ERKA 3OCGA 4K9YA 2BTRA 3VF8A 3BV3A 2GQRA 2UW9A 3GFWA 3DZQA 4L9IA 1OKWA 1GNGA 2IVTA 2OXXA 2YIQA 4V0GA 3Q4TA 4LGGA 2QKRA 3ULIA 3V5WA 4M7IA 4BIDA 1URCA 3DLSA 2QG7A 2F9GA 2E2BA 5CSXA 5K4IA 3ZDIA 2ITQA 4PWNA 4QTEA 2IW9A 4DDIA 2Y4IC 3SRVA 1O6YA 2JIIA 4LG4A 5I9VA 4QDVA 3IDPA 2A4LA 1KOBA 4QYFA 3I5NA 2BZHB 2C30A 4TW9A 4IFCA 4LRJA 4YJVA 2X9EA 5HBHA 3UO5A 1J3HA 3HMNA 3FC2A 3V5PA 2GHLA 4J98A 5CEKA 2XK7A 4ZIMA 4FV4A 3PFQA 1PXKA 4HGLA 5IA2A 3W0RA 3BU6A 4P5QA 2ZMDA 5LWNA 3NUUA 2PUIA 3LJ2A 5H8EA 4KUJA 4UXQA 5J9YA 4ACCA 5A46A 3CKWA 4NYEA 2Z7QA 3EJ1A 5BUIA 4EHVA 1FMOE 3JVSA 4BDAA 3AT2A 2C6TA 3MY0A 3NUYA 3W0SA 4RT7A 1OUYA 1ND4A 2X7FA 2R7IA 4G5JA 3KULB 3EL7A 2BIYA 2UW6A 5H3QA 1W2FA 2X4FA 4RJ3A 1OIYA 4NEUA 3EYHA 4TN6A 1GIIA 2C5VA 2XF0A 4P7EA 4RGJA 3TNHA 3SD0A 2ZM3A 4O7WA 2WEVA 3DNEA 4BB4A 2PVKA 3ZOSA 4D0WA 1OVEA 1ZMWA 2BR1A 5HCYA 3U9NA 4FIIA 3TZ7A 4ZLYA 3Q2MA 2FB8A 5DEYA 4U7ZA 1WBOA 1ZZ2A 3EN5A 3NNUA 3HNGA 4V05A 2YZAA 3UO6A 4XP3A 1XH4A 3QXPA 4BCMA 1OL7A 4ITIA 2WOUA 2JKMA 4PQNA 4DFNA 3ENMA 3Q32A 4JS8A 4M14A 4WSQA 3ZEWA 4EQMA 1J7LA 2ITPA 5HTIA 5FDPA 5L3AA 3KEXA 3B2TA 4GFOA 4H39A 1ZYDA 4BDEA 4FL1A 4CTCA 2W1DA 4ARKA 1YVJA 3F88A 3W0MA 4JBVA 3KGAA 4M67A 2AQXA 5EYKA 4H3BA 4QOXA 4KKGA 3HV3A 3VBXA 5A4CA 3QF9A 3BWFA 4R7IA 1P2AA 3HX4A 4IVDA 3IOKA 3RAKA 5J5SA 4A9SA 2X8EA 2W1FA 3CBLA 3UMWA 2GHGA 2OO8X 2UZLA 3OOMA 4TY1A 4Z16A 1W82A 4GL9A 3KK9A 4PDOA 4ZAUA 3E88A 1OM1A 4JG6A 2VZ6A 3I0OA 5KCVA 5EK7A 5IUIA 4A7CA 4N6ZA 3QRJA 4ZY6A 4MWIA 5IA0A 3G0EA 3ATSA 1NVSA 3JXWA 1ZXEA 3L8PA 4UYNA 3UP7A 4FGRA 3B8RA 4BCNA 4DG3E 5J87A 4Z9LA 3THBA 3SGCA 1OBDA 1U54B 3RAWA 4ANMA 3GOPA 3W1FA 4O2ZA 2B7AA 4U79A 3UNZA 3KRLA 3ORPA 3SW4A 4D4RA 2PMLX 5IEVA 5AM7A 4DHFA 2GNGA 4GS6A 4IAIA 2Y4IB 4C4FA 3QLFA 4EYMA 3CC6A 3R7EA 4AP7A 4PL3A 4A4LA 3TCPA 2BILB 5JQ5A 4D5HA 3TDWA 2J0LA 5GINE 3GCSA 3RHKA 3HDMA 1WBSA 1JKSA 3R7OA 4XG8A 4EKLA 1IG1A 2WMVA 1DS5A 2YJSA 4UV0A 4V01A 4ZS0A 1JWHA 4RC4A 2XZSA 3UDTA 1WVWA 1NA7A 1Q41A 3C0GA 3ORLA 4YPDA 3OFMA 5HOAA 3BBTB 5IQBA 4F09A 5EG3A 3IQ7A 3PJCA 3FLSA 4P2KA 1H4LA 1U59A 4DEDA 5CEIA 5HU3A 1MUOA 3FUPA 4I6HA 2CKQA 5DT4A 3FI2A 1PYXA 4CFMA 3FZOA 5C8KA 4D1SA 4FKVA 5EKOA 4O81A 1JAMA 3NVKI 4D9UA 1EH4A 3LXKA 4QP6A 4M68A 4FBXA 4BDCA 4N0SA 4OAVB 2WU7A 3AKLA 3UZRA 3PLAE 3K3IA 4MEDA 2BZJA 3FI3A 5E8YA 5I9UA 3PJ1A 4BZDA 3OXZA 4FG9A 4EK6A 2UZUE 2BRBA 4FSWA 3IGGA 3NAXA 3R8UA 3RK9A 3PXYA 4BWPA 4BR3A 3KQ7A 3LMIA 3EFJA 3FMLA 4JDJA 2PMIA 4NH1A 4AA0A 5GZAA 3NVMB 3BEAA 3POOA 4AAAA 3IO7A 3VBYA 4BHZA 5IDPA 5M4FA 5B2MA 5BVKA 3TM0A 3VULA 2VWUA 3PP1A 1S9IA 5AAGA 3MH0A 2F7XE 5FTGA 4GH2A 3U6HA 2VTLA 1MQ4A 2XNNA 3A4PA 2B9IA 4DEAA 4F65A 1YDSE 2P4IA 2R3MA 3L9LA 2XM8A 3H30A 1MRVA 3P5KA 4XLVA 4GK4A 1UU9A 1XMLA 3A8WA 3CPBA 4QPAA 3I0QA 5BYZA 1YXSA 4WOVA 3QZFA 4Q9SA 2R0UA 5DBXA 5E7RA 4BWXA 3MIAA 4C3RA 2C47A 3QYZA 3OMVA 4JR3A 5AJQA 2B1PA 4EK3A 4EK8A 4YSMA 4GEOA 2PVRA 4FEWA 2QOBA 2W05A 4AW2A 2C6DA 4M0YA 4NWMA 4RPVA 5M4UA 4DFBA 4OBOA 3Q6UA 4AT5A 4KSQA 3ZO3A 4XUFA 4Y73A 3NUSA 3U55A 2PVMA 3D5WA 3PZEA 1ZY4A 2EXEA 4ZZNA 1PY5A 1ZOEA 2B55A 4R7BA 2Y6OA 1BI7A 4IJPA 3F61A 3EQGA 3FMJA 2O64A 4WNMA 4F9BA 3I7CA 2ITZA 1OI9A 4FV6A 4GK3A 4FF8A 4FKPA 3QTUA 4OBQA 3JS2A 3QQLA 4TRLA 3QQHA 5AV0A 5CZHA 4DG0E 3UQCA 4H1MA 2Y0AA 3KK8A 1WBWA 2QO2A 4RMZA 3RJCA 4BTKA 3ZDUA 5EQPA 3H0YA 1UVRA 1WFCA 2BIKB 5D9HA 2VX3A 5C9CA 3UP2A 4F6WA 2Z8CA 3BCEA 4C36A 4C62A 4X3JA 4GKIA 4FVQA 3NRMA 4O0RA 5HVYA 2C3KA 1ZYCA 3FXXA 4IQ6A 5AV3A 5I9XA 4IDTA 3HLLA 2RKUA 3MJ1A 4L42A 3ZONA 1M52A 2FVDA 4TWNA 3GNIB 2WQOA 5IMEA 4AZEA 5HIBA 4XG4A 3QQJA 1XMMA 2XJ0A 2X0QA 3DB8A 3DBFA 3ENHA 1GY3A 4JOAA 4MQ2A 4QMVA 5B0XA 5KX8A 2IZUA 4QMXA 4ID7A 1H1SA 2F2CB 3PUPA 3GC0A 3UDBA 4AW5A 2JDSA 2ZJWA 3V5LA 2XAMA 4W4YA 4G5PA 4KIPA 4HW7A 2HXQA 5TO8A 5CNNA 2I0HA 2XB7A 1CMKE 2RFSA 2UZWE 2ZMCA 4NT4A 4O0XA 1UV5A 4FL3A 5FRIA 4LRMA 4CNHA 3GCUA 5HZNA 2OBJA 3NDMA 2ITWA 2JKOA 4HOKA 4DTKA 1IAHA 5L2QA 5BYYA 5J7BA 4R77A 3F5PA 3DK6A 3W8LA 4L7FA 2OZOA 3PYYA 5E8TA 5K0XA 1WBPA 2WTWA 3TIYA 4ZZMA 4C34A 1KOAA 4CTBA 2Q0BA 2R3RA 3FV8A 4GFGA 4EC8A 5IU2A 1SYKA 3UZPA 4AE9A 3TKIA 2R2PA 3G6GA 3KN6A 2XALA 2V22A 3GU5A 3IDCA 4TYGA 2PSQA 3FQSA 3R8ZA 5K0KA 3NS9A 2GFCA 3QUEA 2VWVA 3FL5A 1WBTA 3V3VA 3NUNA 4IB3A 3PWDA 4F6UA 2G01A 4EQCA 4USEA 2GFSA 1W2CA 4O0VA 5GZ8A 4LOQA 3OCBA 4EHZA 4JMQA 4O84A 2BRMA 3FMNA 3OZ6A 3QD3A 4J7BA 2PL0A 1XWSA 3O71A 3HRCA 2VTAA 1F5QA 3ORZA 4XG6A 4X2GA 4EK5A 5B2KA 4QQTA 3CS9A 4RQVA 4F7NA 3U4UA 3VRYA 3O8UA 4BKYA 4YUQA 4FSNA 4EBWA 4D2TA 4BI2A 2IPXA 5EW8A 3IPHA 3RALA 5JFVA 2FGIA 4FKLA 4CCUA 4FT7A 4F0IA 2V5QA 3QD0A 4AXDA 3CGOA 4GIHA 3NYOA 3ORNA 3GCPA 5M44A 4ZTNA 1CDKA 3R1QA 3H4JA 4YSJA 2QOFA 5J1WA 3IOPA 2WTCA 5CU2A 3BI6A 4IAKA 3GVUA 2EB3A 3M2WA 4ZLZA 5CALA 4V04A 5C4LA 3ZRKA 3KL8A 5AMNA 4A9YA 3UO4A 4BICA 3GU8A 2FUMA 4IAFA 5AFVA 3D4QA 4JNWA 3KXZA 2CGVA 3TXOA 3VUMA 5B7VA 3RPRA 4DYMA 4L44A 3DTCA 1K2PA 3AGLA 4CFXA 4DN5A 4ZLOA 5CZIA 4QRCA 2XEYA 3ZZWA 3QUDA 1DI8A 5CI6A 4E6AA 4NUSA 2QQ7A 4MAOA 4RIWA 3SAYA 2UW8A 4YGAA 4QPSA 5J8IA 2G9XA 1PXNA 3PRIA 4MH7A 4YJRA 1UU8A 3R9RA 5IUHA 4KRDA 1G8AA 4BTFA 5FD2A 1OITA 1BX6A 3SOCA 4IHPA 5AR5A 3VF9A 5KBRA 2RFDA 3MFRA 2H6DA 3KMWA 4A07A 5I4NA 4IBMA 3W18A 4JBQA 4IM2A 1K3AA 4FTRA 2BTSA 4I6QA 5AM6A 4YU2A 5A6NA 1M7NA 1YXXA 3NX8A 1TQPA 4U0IA 3KB7A 5FDXA 4L43A 4LGHA 4BC6A 4D1ZA 2VWBA 4QTAA 4F7LA 4CKRA 1IAJA 1FVTA 2QOQA 3GT8A 2VX1A 4W9XA 4F99A 4K6ZA 1B38A 5D12A 3OBGA 4BN1A 4WD5A 2YM5A 2VTQA 4S34A 3IGOA 2W17A 4U41A 5J7HA 4BIBA 3CCNA 3KN5A 4OT5A 5EQEA 2HOGA 4AN9A 4GT3A 5BUEA 3ZRMA 5DNRA 4Y5HA 3OW4A 3I60A 2XANA 4CYIA 1GZ8A 3ODYX 4O0WA 4PRJA 3ZXTA 4CT2A 2XNMA 4OW8A 4XJ0A 4AUAA 5B2LA 3VS3A 4BJJA 3EN7A 3RMFA 3F9NA 1BL6A 1PW2A 2KTYA 2WD1A 4DAWA 1STCE 3UMXA 3FY0A 4FKJA 5EYMA 5CAQA 1FGIA 2QONA 3BLQA 3PIYA 3K2LA 1WZYA 2C5YA 5AP6A 3T9TA 4CCBA 2BRGA 4FV2A 4K0YA 4EH5A 5GJDA 1PRYA 3UC4A 3MPAA 4EC9A 2YACA 3OHTA 4YHTA 5CSPA 4RJ8A 3U4WA 4TWCA 3MTLA 4RWIA 3LJ0A 5IQDA 2BPMA 2Z7LA 4YLKA 3BLAA 4JQEA 2GNLA 2J2IB 4AXAA 3W55A 3JY9A 5HIEA 4F1TA 5HLWA 2CCIA 4E4XA 4GV1A 4XLIA 2P3GX 4O0TA 3WYYA 4ZY5A 4AOJA 3DK7A 2HWPA 3H9FA 3MN3A 4H36A 5D10A 4WNPA 1XQZA 1ZYJA 3DFAA 3FMMA 3Q6WA 4XG9A 3EL8A 4F9AA 2J7TA 5HVJA 5LWMA 4D4VA 1PMEA 3V6RA 5DR6A 4HYSA 3UOJA 5BVDA 5H8GA 3CXWA 3RAHA 4PDYA 2PZ5A 3E3BX 3RVGA 3VUHA 1A48A 5AEPA 2YIRA 3GGFA 5J79A 2AUHA 2X81A 2WHBA 3UGCA 3WBLA 1Q61A 4G34A 3DJ7A 3DAKA 5LXMA 4E8AA 4TYHA 4BTJA 4Y95A 3DDPA 4WHZA 3PPKA 5ANJA 2OIBA 4RBLA 5IA4A 1FPUA 3GFEA 2QVSE 2UW7A 4FTIA 2PUPA 1UNHA 4BCIA 4YZMA 4CD0A 4BFMA 4M13A 3FLYA 1E9HA 3E87A 3SHEA 4QQJA 3PVGA 2JD5A 4WT6A 2I40A 3FSFA 2O2UA 4JX7A 5M55A 3ZBXA 3Q9WA 5GIPE 5KMMA 1FVVA 4O27B 5KO1A 2QOOA 3MGYA 4I1ZA 4PMSA 1NVRA 2XIZA 3F7ZA 5IZFA 1PKDA 4J99A 3H3CA 1P4OA 4OAUC 2C69A 1AQ1A 4I0RA 4N4SA 4PMMA 5EM7A 4I5MA 4DFLA 4GVJA 3QTZA 4RZVA 1RE8A 2W5BA