4ZTNA

Irak4-inhibitor co-structure
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
286
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Discovery and Structure Enabled Synthesis of 2,6-Diaminopyrimidin-4-one IRAK4 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 286
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ztnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ztnA01
3R7VA 2J0KA 5B0XA 3HX4A 2F57A 4FTTA 4C4IA 2QD9A 2YERA 3DGKA 2Y6MA 1M7NA 4P5QA 2BR1A 3UO6A 3KMUA 4F6WA 2PUIA 2O8YA 2RFSA 3QQUA 3W2SA 4FA2A 4G3DA 5LMKA 3FMHA 4OTQA 4QYEA 3WF6A 1U5QA 2WMUA 3RHKA 3UQCA 2B53A 2QOQA 4RZVA 3W8QA 2PE2A 4DH5A 2OXYA 3NLBA 4LV5A 4NYEA 4GUBA 4MCVA 2UZOA 1W7HA 1WBTA 2BFXA 3AD6A 4AZTA 4U6RA 3VBYA 1YI4A 3TWJA 5EYKA 3ODYX 1J91A 4I5PA 4TWCA 4I24A 4BDIA 1P4FA 2E9UA 3SOCA 4RWKA 4F0IA 5JQ5A 5IH4A 4DT8A 4RC4A 2VX0A 2R7BA 3R8MA 3GNIB 2Y4PA 1YDSE 3GU7A 4QMUA 3RP9A 3C51A 3R9RA 3QD3A 4IWOA 4DCEA 3CC6A 3KXNA 2HK5A 3LVPA 3R28A 4RWJA 4AN2A 3BQRA 1J7UA 3R22A 2VWIA 2QOBA 1KSWA 3H9FA 3FLQA 5CVFA 5C4KA 3DU8A 4MQ2A 4V05A 3QA0A 2OJFE 4L67A 4CZYB 3DOGA 4IB0A 4FZDB 2JC6A 4NIFA 2PMNX 3V5QA 4A4LA 2UZTA 2YJRA 3PXFA 4J1RA 4OAVB 2J90A 3VUIA 3WARA 3MH1A 1MP8A 5GHVA 3KQ7A 3KVXA 4O6EA 4AX8A 1PMEA 4QTAA 4EH2A 3LKMA 4U40A 4JDHA 2VGOA 5BUIA 4X2JA 4Z7GA 3HA8A 3TKIA 3LOKA 2FSMX 3ULIA 1J1CA 3L9NA 5LWNA 4EBVA 3NNVA 3P78A 2CGWA 2C5NA 2GS7A 4RRVA 2CHLA 5F9EA 2OBJA 3DNEA 3VS6A 3BGPA 1WAKA 1XH5A 1UWJA 2UVYA 4CRLA 4GCJA 2BDJA 2WQNA 2EWAA 2R3FA 2BFYA 4HYSA 5H3QA 1B6CB 3BBWA 4NW6A 3SRVB 2GHLA 5DT0A 3LXNA 2OIBA 3BHUA 1VR2A 4D1SA 3R8VA 3P7CA 4BCFA 2R3GA 5J7BA 4PMTA 2UZDA 4NK9A 4UZHA 2W1IA 5LMAA 2BZKB 1ZYJA 2X6EA 5C9CA 3WILA 4IBMA 5IPJA 3Q6UA 4KKHA 4EK4A 5J9LA 1Q99A 2OJIA 1BKXA 3JVRA 4UWCA 3WI6A 4EH8A 3AT4A 3CGOA 4RWIA 3WF9A 2ITTA 2O0UA 3LLTA 3NYXA 3R1YA 3PPJA 4QOXA 3QYWA 2X81A 5ETIA 4FEVA 3S3IA 3WZUA 1Y8YA 2I0EA 3QTWA 1IRKA 2PVYA 4R5YA 4H3QA 5ITAA 1WMKA 4GH2A 3G90X 5CZHA 1U54B 4BCJA 2XH5A 1XKKA 4FKJA 3BKBA 4B7TA 2PY3A 3E8NA 3ZU7A 3F82A 3PJ2A 4L6QA 2O2UA 5DE2A 4EEVA 3C13A 3PJ3A 2J2IB 5AR5A 5HE2A 1CSNA 3OT3A 3MB7A 2R3QA 3OBGA 4XV1A 1OKWA 4AT4A 4DTAA 3O96A 5HBHA 5AAFA 4XNEA 4XG4A 1PMUA 5CEKA 1OBDA 5EKNA 3WYYA 4C8BA 4AZEA 3EYGA 1MRVA 2CKPA 2PVJA 4DG3E 4I20A 5CU4A 4Z55A 3NCZA 2PU8A 3DDQA 3R1SA 1ZYLA 4QYYA 4GK2A 2QOHA 3QUEA 2H8HA 4ARKA 4EK5A 1OBGA 3ALNA 3DQXA 4BC6A 4XRJA 4PTGA 2DS1A 4BCPA 3IS5A 4HNFA 4BZNA 3MTFA 4G31A 4CFXA 2JIUA 2QI8A 4EH5A 3QZIA 5HORA 4QP7A 5KMJA 2UUEA 4LG4A 5AIRA 4FMQA 5HIDA 4J8NA 2I1MA 4ZTNA 1YW2A 1G3NA 2BTSA 2WQOA 2ITWA 1UV5A 3IGGA 3VWAA 1ZWSA 3RPOA 4BWXA 3NNUA 3BQCA 4DINA 2C3LA 1SYKA 4JIKA 4R8QA 3ZRMA 5KMMA 1IAHA 2WPAA 4C57A 3BYMA 3VS3A 3R63A 4FZAB 3QHRA 2UVXA 3C50A 4DCAA 5HZNA 3CD3A 3CTJA 5HTIA 4XJ0A 5K0XA 3O8UA 2XNPA 4IZAA 4ZTQA 1O9UA 4FUYA 4QP4A 4D4RA 5TKDA 2QHNA 5E9EA 3NEWA 1V0BA 1QPEA 2XYNA 2XIKA 4UALA 3H9RA 2PVHA 4BCKA 4E20A 5FDPA 2HY0A 5D7VA 4BR3A 3FMDA 3VIDA 2I7QA 4PDOA 3MVMA 4O7RA 5ANOA 4FVQA 1U46A 4R7HA 3ROYA 4JBOA 3SA0A 3KN6A 3F2RA 1HCKA 1SZMA 4XG9A 3N4UA 3PWYA 1LR4A 3A60A 3UP7A 5AV2A 4AT3A 5CNOA 4IX6A 3V04A 3EB0A 4UN0C 4XG7A 2PMOX 1R1WA 1PXOA 2UW3A 5FLFA 1Q24A 3UGCA 4RX5A 4FTOA 5BX0A 5CAVA 2UW8A 3NZ0A 4JG8A 4V0GA 4AFJA 4EYMA 3O17A 2BZJA 4GMYA 5AV0A 4X2NA 4Q5HA 3QRIA 3C4WA 1WVYA 5I9WA 4FE2A 2VWXA 4BDHA 4V01A 5J95A 4FBXA 4JDJA 1YOMA 1R78A 3OW3A 4GG5A 3W32A 1YXUA 5HD4A 4MWIA 3Q53A 5H2UA 4Z7HA 2QOKA 2X4FA 2PZRA 3Q52A 4RIYA 4EKLA 2CGUA 3I5ZA 4F7NA 4WNKA 5EW9A 4IAKA 3RM7A 4XH6A 3TTJA 2ETMA 3WZEA 1DI9A 3LJ0A 4FK6A 5AM6A 3CIKA 3P5KA 5IDPA 1U5RA 1PJKA 1KV2A 2PVKA 2ITXA 3O51A 4C3PA 3A4OX 1WVXA 2GFSA 4BBFA 5C8NA 2VX1A 3QWKA 3ORIA 4PL3A 3T9TA 4OTPA 5A9UA 4YJTA 3ORLA 4RVLA 4FKIA 4FTUA 4WO5A 4O7YA 4FZ7A 3JY0A 4PL4A 5LWMA 3ZC5A 4RA4A 4EQCA 3CE3A 3BWFA 3VUGA 4QMOA 5FQDC 3I4BA 1OIRA 4M14A 1OKZA 3NUYA 3ZLXA 5KO1A 2WQMA 4GS6A 1M17A 3MSSA 4MAOA 4DH7A 4AW0A 4X2KA 4BBEA 4GIHA 3IW6A 4D5KA 2NNWB 5LVOA 5JZNA 5D11A 3FY2A 1UKIA 5GZ8A 3IONA 3R7UA 1YWVA 2AUHA 4FZ6A 3V8SA 4H39A 4QYHA 4KKGA 2B7AA 2GFCA 4BDEA 2W0JA 2B9FA 4HVIA 3H9OA 5LVPA 2Y4IC 4EH9A 5A4EA 1GZ8A 2PYWA 4IAAA 3DK3A 3MVJA 1JKLA 1KOAA 1MRYA 5DNRA 5E1EA 3TZ9A 2V55A 4RJ5A 3FV8A 2CGXA 5IQHA 1ZARA 2JKMA 4ORKA 5LVLA 1P2AA 1MUOA 3F9NA 3F66A 3HUCA 2R9SA 5FRIA 3ZLYA 3F3ZA 4I5CA 3GC7A 4GG7A 4D4YA 5KHXA 3VS2A 1OPJA 2RG5A 5CEQA 3EYHA 5AUXA 3QTZA 3UC3A 5T68A 5A6OA 3GU5A 3MFSA 4FKTA 3VUMA 2V7AA 3TACA 4L42A 4FT7A 1TQPA 4L7FA 4PWNA 2A0CX 4JLCA 3QCXA 4TN6A 2VTOA 2Y6OA 2OJ9A 2C0IA 3BWJA 3UPZA 4FG7A 4R3RA 4AGUA 3FDNA 4Y72A 1H1SA 2VTMA 4G1WA 4X0MA 4AZFA 2G2HA 3IDBA 4JI9A 4FR4A 3ZFYA 4A7CA 4BDFA 1JBPE 3EN7A 4LL0A 5J5TA 3SAYA 4RJ6A 5DH3A 2IW8A 5BQ0A 4ACGA 3EIDA 4Y46A 4FKSA 2P2HA 3RK9A 2BDWA 4FL2A 5CI6A 3PXQA 3ZH8A 5CVHA 5EM8A 4I6FA 2OW3A 4FKPA 3NS9A 1E1XA 4K0YA 4QTBA 3NUXA 3WE8A 4X3FC 4OAUC 4HOKA 2G2IA 4RJ4A 1Q8YA 3D83A 5M07A 4B8MA 2BRBA 4D2RA 3UZTA 5BVFA 2OZAA 2WTWA 4FV7A 2OZAB 2C69A 2QOIA 4FSMA 3GP0A 4DH1A 4TPTA 3BX5A 3DLZA 5LMBA 3O8TA 3HAVA 3HV7A 1Z5MA 3GQLA 3VVHA 5HO7A 1GAGA 5DR9A 3O0GA 2PMLX 1FQ1B 3ZUUA 1IASA 3Q5ZA 4PMMA 3PY0A 5KNJA 3H0YA 2W1CA 5KUPA 2ZMCA 2UZNA 2PVFA 4TWNA 1OKVA 4RJ3A 4QQTA 4GT4A 3V6RA 3KGAA 4OTIA 2W05A 3LHJA 3BHVA 5M4CA 3OD6X 1B38A 2Q83A 5FEEA 2ZB0A 3LXLA 4XBRA 1PY5A 5JGBA 3R7YA 2I0YA 3IW5A 1A9UA 4WNOA 5CSVA 3R83A 4BTFA 3DJ5A 4C4HA 3R1NA 3R8LA 2XP2A 3F5XA 3NX8A 2F49A 5CNNA 3FWQA 4XCUA 5CEMA 4BI1A 3IW7A 4YU2A 2OH0E 3HDNA 4MVFA 2VZ6A 4YLLA 1BLXA 3DV3A 4C7TA 3WBLA 4X6QC 2ITOA 4EOMA 5JFWA 5C27A 2X6DA 2XUUA 5ANGA 4AE6A 3BE9A 4I21A 2J9MA 3BCEA 3VN9A 4ZTSA 2XM8A 3I79A 2C68A 2PUUA 2X2MA 4GU6A 4WSQA 3AGMA 4DBXA 3HMIA 4FOBA 4ASZA 1ATPE 4E7WA 2CNQA 4TYGA 2VV9A 3NIEA 2BALA 4AU8A 1QL6A 3GXLA 3IW4A 3BHHA 4K1BA 4O21A 1XH9A 2YITA 2JKQA 2IO6A 5CF5A 3KF4A 4ZMEA 2F9GA 4M12A 2A19B 3DCVA 5FM2A 1OVEA 3BYUA 4GFGA 4XEYA 5AEPA 5AP3A 4IC8A 4FV9A 4X21A 4E93A 2JAVA 1J1BA 5K5NA 2JITA 5HBJA 1XH7A 3UNJA 4AN3A 2C3JA 3FMNA 3FLYA 4Q9ZA 3VAPA 4JBPA 4FKWA 2IVVA 2JEDA 3DKGA 3ITZA 3ORNA 4F9WA 1ZOGA 4YJQA 3CSVA 3EWHA 3NVMB 5IQCA 3UQFA 1PYXA 4KSPA 2BAKA 3KL8A 5L6OA 3BE2A 3N4VA 4JDIA 2Q0BA 4HW7A 4LUDA 3OEZA 2X1NA 4O7NA 4A4OA 3RK7A 4C3RA 4TTHB 3VNTA 2W99B 4FIHA 3G5DA 5CWZA 4EOKA 3FPMA 1UNLA 3G0EA 3QALE 4L52A 3TUCA 2XJ1A 3PVGA 4PQNA 3LMGA 4UYAA 4C02A 4KABA 2UW5A 5M57A 4JBQA 5EOLA 2YIXA 3KA0A 4YZDA 4ENXA 5GIPE 2YFXA 3EQFA 5D7AA 5CX9A 4XRLA 2JFMA 1YWRA 1GJOA 4IJ9A 3OVVA 1PMVA 4O0WA 3LFDA 4QTDA 2C6IA 5HNBA 4O7SA 5FEDA 3ZO2A 3CEKA 3GU4A 4RBLA 3ZC6A 1URWA 3OG7A 3W10A 4YZ9A 4EJNA 5EKOA 5CEPA 1DAYA 2FVDA 2IZUA 4L43A 4GUEA 4E4XA 1W82A 5BMMA 2CKQA 3AT2A 4W4VA 4BWKA 5IQGA 3HMNA 3ATTA 2ZV7A 3LAUA 3GCUA 5D9HA 3LFEA 4WRGA 2QO9A 4EHGA 4KIOA 2JFLA 4L8MA 2F7XE 4GFMA 3OUNB 1PW2A 3FEGA 4ZSLA 3FZ1A 3SOAA 1ZMWA 4DGOA 3TG1A 2GNFA 2WAJA 2HELA 4U8ZA 1H1RA 3DKCA 4XLIA 1BL7A 3LCKA 3VBXA 4EOLA 3RGFA 4J7BA 3JUHA 2RG6A 4WBBB 3TJDA 3BLRA 1A06A 3FZTA 3KFAA 5LCJA 4C59A 4YZNA 5AIKA 4CVAA 2B54A 4WA9A 2OU7A 5E4HA 5C1QB 4IACA 3RCDA 3FXXA 4FKLA 3DY7A 3ZDIA 2VUWA 3IO7A 3NWWA 3GCPA 5HNGA 1V0PA 3ZUVA 1M2PA 1DI8A 3NUNA 5AJQA 4R1VA 4EWQA 4W8EA 3NUSA 4F7SA 3CKWA 4EOIA 2XS0A 1YXXA 3PSCA 4OTFA 4WD5A 5HI2A 1H8FA 4J96A 4ONAA 3DZQA 2O63A 3BI6A 4EK3A 5GIOE 2PULA 4DFUA 5AV4A 4FUXA 3NIZA 3AOXA 2BRNA 3ZM4A 2QODA 3GVUA 2I6LA 2XBAA 3TZ8A 3EFWA 4BHNA 4ZY5A 4QD6A 5KMLA 4ZOGA 4A06A 2NP8A 4QRCA 3R8ZA 1OL5A 5IKWA 2XIYA 4DE4A 4I0SA 5G6VA 5AUUA 5HCXA 5FTGA 3TIZA 5KZ0A 5M06A 2JDSA 4G6NA 3E87A 4ANSA 2E2BA 5IISA 2WQEA 4JR7A 1H0WA 4RFYA 4AT5A 4O0VA 4O1OA 2ZAZA 3OY1A 4FNZA 4YZBA 2CN5A 4G34A 3E8CA 3QQGA 4O0YA 2ERKA 4RIXA 2F2UA 2VWVA 2P3GX 5HU3A 4C0TA 3EMGA 3GQIA 5HTCA 1PF8A 1W0XC 4EKKA 1H00A 3A7GA 4EOOA 3MJ2A 3QWJA 3DBCA 3R01A 4FSTA 4E4MA 4F9AA 4TRLA 3UBDA 4HVGA 2R3MA 4ITHA 5KE0A 3VS1A 4PMSA 4WG4A 2VTTA 3I6UA 4ZLOA 2Z2WA 3Q9XA 4XP3A 3KK9A 4YR8A 2UZLA 4Q5EA 2PE0A 5KZIA 4QMLA 3FQSA 4LUEA 3LFBA 3KREA 1PHKA 4GV1A 1GIIA 4JL9A 3QZGA 3QU0A 4R3PA 2QCSA 4Z9LA 3OP5A 3NW6A 1YHWA 4X3JA 5B7VA 3HMOA 5BMSA 4L53A 2X2KA 3ZXTA 5A54A 3LCDA 3ULZA 5HESA 5JFVA 3IPHA 4J97A 1CKPA 1NA7A 1H1QA 2JBOA 3OF0A 3K54A 3NCGA 5KHWA 3QTUA 3A62A 1Y91A 2WEVA 4TW9A 1OI9A 4FV0A 4D2SA 3NDMA 5I9ZA 3SDJA 4A4XA 1V0OA 3A8WA 2IPXA 4FEXA 1BMKA 2I40A 1CMKE 3HUBA 1GIJA 3BU6A 3QCYA 4U5JA 2G2FA 2PUPA 4OR5A 5DIAA 3KB7A 2QR8A 3KCFA 2OIDA 4DFLA 4RZWA 4FGBA 4GEOA 4K18A 3R8UA 3VBVA 3W2RA 3QKMA 2B1PA 4F4PA 2YWPA 3OFMA 2ZM1A 2C5OA 2G01A 4JS8A 4NFNA 4IADA 3OCSA 4IAYA 4Y8DA 4ASXA 3PZHA 4QPAA 4DFYA 3DXNA 4NTTA 3ZM9A 3VQUA 3DBQA 4IFCA 5E8WA 3C0HA 2J0MB 3GC8A 5CZIA 3HV6A 3MN3A 2RIOA 3F5PA 4M3QA 5EI2A 1YOLA 3QA8A 4NZWB 5HCYA 3D15A 5I9VA 3LXKA 4FSUA 5EYMA 4FIJA 5J87A 4D9TA 1O6YA 1WBWA 4HVDA 4IQ6A 5AUWA 3ZDUA 4KIPA 4X3FA 2JDTA 4X3FB 1B39A 3DK6A 3PVBA 3QFVA 4MNEA 4F7LA 2OWBA 3LM0A 3FXWA 4FTRA 5CF6A 4FT5A 4K2RA 3AQVA 3F61A 4RWLA 3EKNA 3UIBA 3R04A 2BHEA 1CTPE 3S1HA 5KMNA 3L8XA 3ODZX 4QMQA 4JAIA 3SGCA 1PKGA 4U0IA 4UWBA 5HLNA 2C30A 3F7ZA 2GU8A 3QQHA 1NVQA 3UOHA 4CFNA 4R6VA 4IZ5A 5E8TA 4U79A 2VTSA 3UTOA 1G5SA 3GU6A 2BTRA 4GIIA 2IZTA 3HVCA 1Q97A 4BDAA 5JT2A 5CSXA 3FI8A 5CSWA 4EHZA 3QAME 3OBJA 2QG5A 4WNPA 4CGAA 2PVRA 2YHVA 1XBBA 5FWKK 3ZO1A 1OIUA 2W96B 2G15A 5AADA 3P79A 4Y85A 4H58A 1RDQE 2OKRA 2YA9A 2UZEA 4ZS0A 4QMYA 3RBWA 3RK5A 2ZYBA 5B2MA 4C4EA 5DYJA 4U3YA 5J9YA 4PPCA 4YZMA 1F5QA 2JD5A 1FVTA 4W4XA 3FY0A 5D1JA 4FV3A 2VGPA 1TQMA 4IWQA 4KBAA 2FH9A 5A4TA 5KBQA 2XCHA 4A9RA 2ERZE 3D94A 4CMTA 2BRGA 1K3AA 2JIVA 4MYGA 3TZ7A 4MD9E 4ZY6A 4D2PA 5JFXA 4LRMA 2YLFA 2BPMA 2WB8A 3AD4A 3L1SA 3MB6A 2JAMA 3A7FA 2B52A 3QRTA 1WBPA 2X8EA 3PIXA 4UWYA 5EDQA 3TKUA 2HAKA 3NSZA 5IUHA 3NGAA 4U9AA 4JR3A 4M68A 3SX9A 2OH4A 1PXMA 2YIRA 4M0ZA 2J5FA 1YWNA 3C0IA 3FC1X 1M2RA 3U4UA 1SNXA 4DFZE 1GZNA 2HZ4A 3UOKA 1H0VA 3FQEA 4JJRA 3EN4A 3P7AA 5EYDA 5L6PA 3KMMA 3M42A 5IQEA 4ZTMA 2J7TA 3Q4ZA 4QO9A 2C0OA 3ZSIA 4O84A 5JMSA 3P86A 4Y95A 5CY3A 3DKFA 2OXDA 3UO4A 2AYPA 2IWIA 3DB8A 4D0WA 1JOWB 3UQGA 2Y8OA 4O38A 3D0EA 3I60A 4C38A 5A3XA 2GNLA 3QD2B 2YJSA 1QCFA 4CKRA 5EW8A 4FGRA 3CCNA 4K77A 3LFSA 5EK7A 5AR2A 3DBDA 5KKRB 4GRBA 2YCFA 3TNPC 3WIGA 3P0MA 3V5JA 3U4WA 4NIFB 3TCPA 2EVAA 4I4FA 4W4WA 2VWZA 4HGEA 4CQGA 4YO6A 5DFPA 4CZUA 3NUUA 1XH8A 1W98A 1UU9A 1ZMVA 4QMNA 4RSSA 2IJMA 4YJUA 4BHZA 3F69A 4FKRA 4I0TA 2BRHA 4R1YA 5M08A 4FKGA 2X8DA 3DPKA 3R00A 3QGYA 4UZDA 2W17A 3CR0A 4E5AX 3U6IA 4RJ7A 4WOVA 1XQZA 3RI1A 5AR7A 3V51A 4JRNA 4O86A 2IW9A 1LP4A 5CT7A 4ANLA 1PXNA 2RF9A 4CFMA 3OZ6A 3RZFA 3MVLA 4NFMA 3UO5A 4LOQA 2XIZA 4XLVA 2R3OA 4BWPA 3MH0A 3KRRA 3QQLA 2JKKA 4GKHA 4TWOA 1OECA 4CG8A 3HMPA 4BRXA 5JRQA 4TWPA 2PWLA 2QONA 2J50A 4YNEA 5FXRA 5FUTA 4CMOA 2ITUA 3LQ8A 4BTKA 4U3ZA 5JN2A 3SG9A 2ZM4A 3TDVA 3TUBA 5ANKA 4LGHA 3BEAA 4WUAA 3R30A 3HLLA 2C5XA 5HOAA 2R3KA 1RE8A 1JSVA 3LM5A 1YI6A 3FJQE 3QL8A 3LIJA 4I4EA 4NUSA 1J7LA 2GNGA 3GB2A 2YDIA 3OS3A 5DRBA 4J52A 4EOJA 1H07A 2VTPA 4S32A 4RLLA 5LVMA 4IX5A 3S2PA 3TDWA 1WBSA 4G16A 1MQ4A 4FT9A 2YLEA 4PY1A 1EH4A 3EL7A 2EUFB 2OSCA 2VX3A 1LUFA 1E1VA 3PE1A 4F63A 4DHFA 4XX9A 5LOHA 2C0TA 4FTLA 5JRSA 3FZRA 3E63A 4UX9A 4YC6A 1MQBA 4N6YA 2W1GA 3QD4A 5HG7A 4FICA 4G9CA 4G3EA 3VBQA 3MY0A 4FG9A 4AOTA 3LXPA 2HXQA 3PRFA 4WT6A 5E8XA 4YTIA 4BYIA 4IB5A 4IB1A 4E5BA 5CTPA 2F4JA 3LJ2A 2OG8A 2IVUA 2R3HA 4FI1A 5CSHA 5KBRA 4U43A 4E4LA 5LXMA 2XIRA 3OTUA 3R9HA 5KCVA 2QVSE 3IOPA 2C6KA 3O8PA 2JKOA 1Y6AA 1OUYA 4UMUA 3IG7A 2W1EA 3D4QA 2OXXA 4M66A 4WHZA 5DEWA 4K9YA 3TKHA 4RC3A 5I5ZA 2PZYA 2WMWA 2R64A 4NW5A 5E8SA 5J1VA 1XBCA 4M69A 4IAIA 4IFGA 4M69B 4U81A 3WZDA 3UIMA 3GC9A 2NRYA 4FNWA 2VWBA 4Z3VA 5EQPA 2PMIA 2HENA 3ELJA 4B4LA 4XOYA 3VUDA 3Q60A 5DLSA 4HPTE 3I7BA 3VC4A 3C1XA 4RIOA 1Q8UA 3OWPA 5E91A 3NVKI 2LAVA 3R02A 3NUPA 3LPBA 5EHOA 3W55A 2FGIA 2W5BA 4CFWA 2WTKC 5HD7A 2VO0A 3EN9A 5HE3A 4C37A 5LQFA 2OO8X 5TO8A 4DGGA 2GQGA 4DITA 2GS2A 2XVDA 4KNBA 1BI7A 4AF3A 1ND4A 5I9XA 3KXHA 3WOWA 2PVNA 2R3JA 3TNQB 3DTWA 5IUGA 4YSJA 3MS9A 4BCMA 1ZRZA 3LLAA 4JX7A 1UA2A 4E1ZA 4KB8A 2QO2A 2UW4A 2WMBA 1JSUA 4UY9A 4V0GB 1SNUA 3OC1A 1F0QA 3KXGA 4LV8A 3HV3A 4L7SA 4C4FA 1LPUA 3UODA 3BV2A 2WMTA 4BKZA 4FF8A 3BYVA 3P4KA 5M55A 1ZZLA 4O91A 3E88A 4L44A 4UEUA 4FNYA 4AGWA 4M67A 4MBJA 2QR7A 2YIQA 4UMPA 2QOOA 3ZEWA 3Q2JA 2EB2A 1IG1A 2P2IA 3FAAA 3FL4A 3ENHA 3U87A 4FIEA 4D0XA 4CT2A 2PTKA 2CLQA 3ERKA 4UXLA 4DG0E 3R2BA 2YISA 3ZUTA 4UMRA 4PV0A 5EG3A 5F95A 3FUPA 3OWLA 4IXPA 4RFMA 3LFCA 3QQFA 3NRMA 1ZY4A 2R5TA 4RGJA 3RAHA 5KMKA 2YIYA 2V62A 4EH3A 4YTFA 4O7VA 3GCQA 3TV4A 4RX7A 4OTHA 2QLUA 3QHWA 5EYCA 5IEXA 1OGUA 2F7EE 3Q4UA 3QLFA 4CSVA 5BVKA 4ZK5A 4XG3A 4HVHA 4LI5A 4QYFA 4J99A 3DAEA 4ZEGA 3L8VA 5CASA 4AS0A 3P7BA 5TOZA 2WMAA 4ASDA 2RSVA 4QMXA 4PNIA 3ETAA 2DWBA 1H24A 4S34A 5KMIA 2FUMA 1GZOA 3SC1A 2WTVA 4U80A 2YCQA 5IF1A 3KN5A 3OEFX 4MWHA 3PIYA 4CT1A 3M2WA 5EOBA 1M52A 4FTNA 3I81A 3VUHA 1KV1A 3QQJA 3R1QA 4D4VA 1Y6BA 2F7ZE 4NH1A 5AAGA 5JZJA 2VNWA 3KRXA 4FV4A 1Q5KA 4RVMA 2YEXA 3ANRA 3KVWA 3O7LD 4ZS4A 2XKDA 4M15A 2GNHA 1S9IA 4GVJA 4BGGA 5ANIA 4QNYA 4DEHA 4YTHA 2X9EA 3POOA 3U8WA 2YWVA 3ACJA 5C4LA 4I1ZA 3C7QA 2J51A 3HGKA 1TKIA 3AC1A 4ACHA 2B9HA 1PKDA 2FSLX 1XH4A 2IVSA 3JY9A 3MJ1A 4QYGA 3HV4A 3A7JA 1Q62A 4TYIA 2XRUA 4E8AA 2ZB1A 1QPDA 4F65A 2PZIA 4RX8A 4XS2A 2RKUA 4FTQA 1IA8A 2OZOA 3FC2A 4C4JA 4Q9SA 4IC7A 4I0RA 5BYYA 5AP7A 4C36A 4BZOA 3AMYA 5CAOA 3OXIA 2YAKA 2R3NA 4QPSA 3N51A 3U51A 3C0GA 3E7OA 3PLSA 5AAEA 4D2TA 3D5VA 3WZKA 4RIWA 4L3LA 1YDTE 3N9XA 4RIWB 1DAWA 4D55A 4F9CA 3Q9WA 1ZOHA 2OGVA 3CY3A 2IN6A 2VWYA 3L8SA 4CV9A 2NO3A 4E6DA 4ZY4A 2XNMA 4CCBA 2XKFA 3WF5A 5JQ8A 4USDA 2GMXA 3K5UA 2J0LA 2QOCA 3CQEA 4IWDA 5AR4A 4KS7A 1WBNA 4QP6A 5CXZA 3ATSA 1RJBA 4GU9A 2WMQA 5AMNA 5J1WA 4DAWA 3HEGA 3P1AA 3TM0A 4IX4A 2YACA 3HRCA 3EFJA 1Q8WA 3SD0A 3UG1A 4AW2A 4BCOA 4CMUA 5CSPA 4DH3A 3ZFXA 2R3LA 3FL5A 4HYIA 2C47A 4DG2E 3EZVA 5C03A 4GK4A 5E1SA 1LEWA 2JDOA 1JKSA 4AZSA 4BICA 5JH6A 4NM3A 3DAJA 3QBNA 4FSNA 4YZCA 4E4NA 4EJ7A 4UMTA 2WMXA 5I3OA 4YMJA 5HLWA 4UXQA 2WMSA 3NAXA 1OL1A 4E26A 4BVUA 5J8IA 4XG8A 4F0GA 4I92A 5JEBA 3TV6A 1DS5A 2WZJA 4OTRA 2P0CA 4LRJA 4O1PA 5BUJA 4QMSA 4DLIA 2E9PA 4NM5A 1H28A 4KBCA 3OOMA 3R0TA 3OMVA 1JSTA 1YRPA 3NYNA 1W84A 3PYYA 4QQ5A 2VTLA 3CS9A 4PDYA 4ERKA 3PXKA 3I6WA 1Q61A 3ORKA 2RFDA 2BIKB 3EQRA 4IW0A 4ASEA 4ACDA 4F1OA 4O0TA 2JBPA 4QT1A 4G6OA 5FEQA 4O2ZA 5T6KA 2R2PA 1S9JA 4HYUA 1BYGA 5HVJA 3MPTA 5A4CA 5I3RA 2FSTX 3VRZA 5H8GA 4WIHA 4E3CA 3CXWA 2OLCA 4IMYA 2VO3A 2XNOA 3FMJA 4BZDA 3UP2A 2KTYA 3VBTA 5I0BA 4BGQA 4DYMA 5HIEA 5BPYA 3DKOA 1PRYA 2BAQA 3H30A 3R71A 3OWKA 3RVGA 4CKIA 3NYVA 1TQIA 5M4IA 4BDGA 5TE0A 4OTWA 2WKMA 3SXRA 4JG7A 1FVVA 2W06A 3C4CA 5DEYA 5DHJA 4OBPA 2VTRA 4FSQA 2WTCA 3FE3A 3ZOSA 5AUYA 1XR1A 5H9BA 3R9DA 1SMHA 4CEGA 5J79A 5LJJA 2JDRA 3IKAA 5EHLA 3PP1A 4GL9A 3AC8A 5E92A 3ZHPC 3PY1A 3QC9A 1R39A 5CALA 5HTBA 1AD5A 2QC6A 1ZAOA 3LCOA 3UC4A 4C3FA 3TTIA 4ZXTA 3ZONA 4B0GA 3UZRA 4ID7A 3RTPA 5AX3A 3MDYA 2Q0NA 3LCSA 4IM3A 4ENYA 4EOQA 3COKA 3M11A 2Z7QA 3ORPA 2VTAA 4J53A 4NJ3A 5DR2A 3VUKA 2GQSA 2C1AA 3D14A 3HKOA 5IQIA 4JIAA 3CBLA 3RPVA 3MFTA 3UVQA 4LFIA 5FBOA 3IDPA 4AGCA 4A07A 5EQEA 3FYKX 3UVPA 4BFMA 4YJSA 3OW4A 4MHAA 1APME 5TF9A 3SHEA 5C8KA 4GJ2A 4APCA 5KMOA 2CKEA 4I6BA 4M0YA 2Y9QA 4XG2A 4D58A 3RINA 3HP5A 1M2QA 3KY2A 3E5AA 3V6SA 3TUDA 2UV2A 4JDKA 4ITIA 2WIPA 4H05A 4HCTA 1H25A 1GY3A 3D2KA 1YOJA 4II5A 2W5HA 2IZRA 4I41A 5AV1A 4IAFA 5B2LA 4CYIA 2A27A 1VEBA 3BLQA 3JXWA 4RX9A 5GINE 1X8BA 4U7ZA 5IU2A 2GTMA 2WTJA 4CFFA 2H9VA 3IW8A 4HGSA 4L01A 5GJFA 4RQVA 4D28A 2OJJA 3GOKA 4ZZMA 4NCTC 5FDXA 1ZY5A 2O64A 3CPBA 3Q9YA 5LVNA 2HWPA 3FI4A 1O6KA 5GZAA 1IEPA 1MRUA 1NVSA 2YM5A 2DQ7X 5L8LA 2VO7A 3ZRLA 1BL6A 5L4QA 2HW7A 4B8LA 2PSQA 4CD0A 2CCHA 3K5VA 4QP8A 2V0DA 3AT3A 5IEVA 2UW7A 3C4EA 2WTKB 5BVWA 1YXVA 4HZRA 5FG8A 4PTCA 4A9YA 2E9VA 4DEBA 4JQEA 1YQJA 5EW3A 3ENMA 3RM6A 3A4PA 3W2CA 2XK8A 1UWHA 3CTHA 3G51A 2WELA 4UB7A 3R2YA 2WO6A 4TYJA 2QLQA 3IECA 1RQQA 3MW1A 3TNIA 3AC3A 3I0OA 5ACBC 4FKOA 2AC5A 2YN8A 1FMOE 1H08A 3GCVA 1OITA 4OUCA 3MGYA 5JSMA 2XEZA 4FNXA 1FMKA 4IHPA 3ZO4A 4ZSGA 5LCKA 2H6DA 3FLWA 3CQUA 1KOBA 4IZYA 4AA5A 5CU2A 2CGVA 2OFVA 2VU3A 4C4GA 5K9IA 1GNGA 1NXKA 2BRMA 2HYYA 3A61A 2LGCA 3QKLA 4HCUA 4K6ZA 4MXYA 4WKQA 5CQWA 5TR6A 4JQ7A 3RKBA 3PE2A 4AG8A 4FTIA 4O6LA 3L9PA 2ZJWA 4DEGA 3EQDA 1UU7A 3EH9A 3V01A 2VTNA 4FVRA 3RALA 1ZOEA 4DTKA 3IGOA 4EWHA 2ITZA 2EU9A 3PWDA 3MFUA 4RIXB 4D1XA 5J7HA 1WFCA 2IW6A 2WXVA 4PPBA 1H4LA 4JQ8A 5F4NA 3W8LA 2CKOA 3FI3A 1R0PA 5EM7A 3CPCA 5HG8A 5I4NA 2XKCA 4OBQA 3FMMA 4IIRA 2C6OA 4BDBA 4O83A 3PSBA 2ONLC 3OCTA 5DA3A 5AR8A 3UVRA 4BCHA 1OIYA 3RPRA 4AFEA 3LFQA 5IMXA 3DTCA 2UZBA 5CAQA 1YKRA 4XP0A 3GENA 4FYNA 4NSTA 1ZLTA 2PL0A 2XRWA 3MBLA 4TT7A 2Y4IB 2P4IA 4K8AA 3UMXA 3GGFA 3QX2A 2C5YA 5A4QA 5AM7A 4O7LA 3Q2MA 3W2QA 4FL1A 4R7IA 4NM0A 2ACXA 2CPKE 2CSNA 4IVDA 5L6WL 3DLSA 5CLPA 4LGDA 3TNWA 3QYZA 3RJCA 5TT7A 3BU3A 1IAJA 2ZDUA 5BYZA 1SM2A 4BTMA 1XH6A 2J0IA 1REKA 4HJOA 1IR3A 3QX4A 2YZAA 4D2VA 4F1TA 1L8TA 1NT2A 3NMUF 1W8CA 1OKYA 2Z7RA 4O7ZA 5GNKA 5HCZA 2ETKA 4MF0A 5I9UA 3MI9A 1K9AA 3QLGA 1BX6A 4E73A 4YURA 4MF1A 4FV5A 4EK8A 4GSBA 1WVWA 4ZSJA 4BCGA 4CTBA 1Q3DA 4BCQA 4O7WA 3POZA 1U59A 4E6CA 3RHXA 3R9NA 4D4SA 3GC0A 4NL0A 2WTDA 3D7ZA 2VAGA 5CU3A 3KK8A 5HX6A 4DEEA 1Q41A 2YDKA 4ZSAA 3MIAA 4EQUA 4KD1A 4JOAA 4ZTRA 4QQJA 3HA6A 5BVEA 1JAMA 1UU3A 3NNWA 4DEDA 2QU6A 4XV9A 3CD8A 4DFNA 1KWPA 5M56A 4TYHA 3ACKA 4FV8A 4TYHB 4YJRA 4BTJA 1PXLA 4MNEB 2J6MA 3O2MA 3QUPA 5F20A 3VS5A 3C5UA 3MESA 4YHTA 3E92A 4G5PA 4JXFA 5T3QA 5EH0A 3U6HA 2ITPA 1M7QA 3NYOA 3OTVA 3EJ1A 2CJMA 3I7CA 4GYGA 2HZNA 2HOGA 3JPVA 3QRJA 4P2KA 5E90A 1AGWA 3PXZA 3DFCB 3TL8A 3TIYA 2VTQA 4CKJA 2C5VA 2OJGA 4QP1A 2X4ZA 2BHHA 4RJ8A 3R7OA 3ALOA 5HBEA 4L68A 4AQCA 4OTGA 4EUTA 3ZLWA 2IZSA 4BIBA 5CAUA 4P90A 2CNVA 4N0SA 4USEA 4U97A 4PNKA 4YLKA 4BY9E 3ZBFA 1JQHA 2H96A 5AA8A 5E8VA 4MXAA 3OXTA 5JK3A 5IQDA 1Z57A 4E6QA 3SW7A 1FOTA 1UNGA 1YHVA 5AFVA 4FX3A 4NU1A 4Y5HA 5E7RA 2ITQA 2YM6A 3LZBA 3GEQA 3SW4A 4EI4A 1KUTA 3G9NA 2B9JA 3C4FA 1YVJA 3AC2A 5FM3A 3NW5A 3TZMA 1OPKA 2PUNA 4BI2A 2RL5A 2FYSA 4FSWA 2BZIB 5CYIA 5FTQA 4BDKA 3RNIA 1YI3A 3S4QA 5L2WA 4AN9A 3LW0A 3NUAA 4IM0A 4KWPA 4YJNA 3EQIA 1H1WA 1UNHA 4A9UA 4BYJA 2OICA 4J8MA 2XNNA 3M1SA 4PDPA 4XHKB 3C5IA 1VJYA 4MX9A 4ALWA 3PDTA 2X0GA 4ZTLA 3MA3A 3TJCA 3ID6C 3ZEPA 4MKCA 3BRBA 3E62A 4FV1A 4F6SA 1ZZ2A 3MTLA 5IA3A 5ICPA 4FZFB 1HOWA 4YP8A 1Y57A 2BILB 4ACCA 2W4KA 3EL8A 4IVAA 1ZYDA 5IH5A 5HIBA 4DBNA 4TL0A 3F2NA 3KULA 5HQ0A 2XYUA 3KULB 3PXRA 3MA6A 4G17A 5HKMA 3RAIA 3UG2A 3B2TA 4ANNA 4ZAUA 4TXCA 2GHMA 4NJDA 4X2FA 4XV2A 3VULA 3HZTA 4P4CA 2ETRA 1OPLA 4LRKA 3R8PA 5CEOA 4BDCA 5CU6A 3DK7A 5KX8A 3BEGA 5J5SA 3R7IA 4CZTA 3B2WA 3QF9A 2EXMA 2Z02A 4EZ7A 3AC5A 3UZPA 4L46A 1OL7A 3BGZA 2HY81 3PJCA 4YC8A 3HV5A 4D5HA 4F99A 5AP1A 4C33A 4MNFA 5L2SA 4UBAA 2C6EA 5CXHA 1ZYSA 3BPRA 3E7VA 4KRDA 5GZ9A 2WU6A 1O6LA 5HEZA 4YPSA 4YJVA 5C01A 4DC2A 1J7IA 4O82A 4IAZA 1H01A 3R7EA 3QD0A 1WZYA 1QPCA 4KINA 4DA5A 3VW8A 4S31A 3W16A 4WRSA 2VWWA 1BUHA 1Y8GA 3UNZA 2C4GA 2QURA 4FKQA 4D9UA 3LMHA 2KULA 2X8IA 3AMAA 3G33A 2BCJA 5AUVA 3NAYA 1WBOA 4TY1A 4C35A 3VRYA 4B9DA 4ACMA 3R6XA 4EK6A 1TVOA 1V1KA 1U4DA 2BUJA 3D5UA 3JVSA 2YM7A 3E8EA 4QMPA 4HVSA 2R0UA 4B99A 3LQ3A 2HZ0A 1T45A 1P4OA 2UZUE 4I5MA 4JVGA 3SQQA 1JKKA 3WIKA 3Q96A 2RFNA 3RWPA 3WE4A 4EL9A 3MYGA 2ITVA 3SRVA 3ORXA 4MK0A 3ZSGA 5IA1A 4P7EA 4N4SA 3DXPA 3FQHA 3MH3A 4GFOA 4M97A 3FMEA 4QP3A 4DF3A 4QMVA 4ZJJA 4ANBA 2HCKA 3KRJA 1XO2B 5G1XA 3R73A 4JNWA 4NCTA 4DGNA 3L8PA 3QTIA 4FSRA 4GT5A 2W1DA 5BYLA 4E5WA 4ZZNA 3VW6A 1T46A 2GCDA 3AG9A 3V8WA 4U45A 4C61A 5DPVA 5HG5A 2FO0A 4F64A 4G3GA 3IQ7A 4APPA 3C9WA 2XEYA 3RWQA 3MPMA 3O23A 4FEWA 1U54A 3EQHA 3SVVA 1BI8A 3Q9ZA 3Q5IA 2W1ZA 5E8ZA 5EDPA 1UKHA 3RAKA 4Q2AA 3VJNA 1JVPP 4GK3A 2V22A 1M14A 3LFAA 4G2FA 4JG6A 2A2AA 3I0QA 4IEBA 4MXZA 4XUFA 3EN5A 1SVGA 3KC3A 4KSQA 4M8TA 3ZRKA 2OK1A 3QTXA 4H1MA 3DJ6A 5DT4A 4ZSEA 4TNDA 3UMWA 5L2TA 3U9NA 3LFFA 4LL5A 4CLIA 3KMWA 3CTQA 5CF8A 2WEIA 4IH8A 2XM9A 1Q3WA 4ANOA 3FXZA 1ZYCA 4PUZA 3AD5A 5EM5A 3UOJA 4USFA 4TYEA 3I5NA 4MD8E 2F2CB 3H10A 4WUNA 4ANMA 2GNIA 4IB3A 4U44A 5CT0A 2VO6A 3BBTB 3V5WA 4FV6A 2YM3A 4LOPA 4FYOA 4O96A 1Q4LA 3MY1A 4W9XA 4DH8A 3ZTXA 3HRBA 1I44A 3K2LA 4IDVA 3PVUA 2YAAA 2YM8A 4ZZOA 4NKAA 3F88A 3EZRA 4FOCA 4W9WA 4GVAA 3RMFA 3VQHA 3W2OA 4EYJA 4R7BA 3ANQA 3KCKA 5M09A 2W1HA 4M13A 4FTJA 1JWHA 3ZO3A 4C58A 4F6UA 2C6MA 5AX9A 3FHRA 2ZVAA 3DNDA 1W83A 4ITJA 1PYEA 1KE7A 2OF2A 4EZ3A 1JKTA 2ITYA 4PRJA 1REJA 3SV0A 5DMZA 2B0QA 4IANA 3MY5A 2XNEA 5FP6A 2PE1A 5EI6A 2C3KA 4DTBA 4V04A 1KE5A 2WTIA 4B6LA 3MIYA 5EQYA 2JLDA 2W7XA 4UYNA 2WNTA 4YHJA 3V5PA 2ONLA 4OTDA 4H1JA 4XP2A 4C2WA 2OF4A 3W33A 4DEIA 3PLAE 5HE0A 4E6AA 3F6XA 3MVHA 3B8QA 4KS8A 2FSOX 1P14A 1CKJA 1SVEA 2C1BA 3G6HA 3LE6A 4JRVA 4LGGA 1XHAA 4EORA 1IA9A 1PMNA 4QMMA 3KEXA 4CFVA 1H1PA 2UZWE 2PVMA 1OM1A 2WD1A 4YNOA 2ZDTA 2YIWA 2IVTA 3CGFA 4YSMA 1PXIA 2XKEA 5EM6A 4NT4A 1Q8ZA 5L3AA 3H4JA 3FMLA 1LEZA 3CJFA 2V7OA 3D9VA 5F94A 4CXAA 3E64A 3V8TA 1WBVA 3G9LX 3FKNA 3JYAA 5DBXA 2YM4A 4I94A 3EQPA 2QKWB 2HW6A 5C8MA 5CEIA 4RVKA 3TV7A 4XV3A 3WYXA 4ANQA 3P9JA 3ROCA 3GT8A 5E8UA 4XOZA 2BKKA 3VF8A 4Y5QA 4PF4A 3SG8A 2B55A 3C4ZA 3E3BX 4EC8A 5AP0A 4CRSA 2QOLA 2R4BA 2VD5A 2UW9A 2R3RA 3NNXA 3BHYA 4O22A 3PJ8A 4RIYB 5EDRA 3S95A 1G8AA 1STCE 3Q3BA 3TEIA 4FK3A 3Q04A 4ZMFA 2E9OA 2WMRA 3TT0A 5DGZA 4EH7A 4XMOA 3TXOA 4ZLYA 4IJPA 2QG7A 5HNIX 4F09A 3ZCLA 3EOCA 2PZPA 3DQWA 3QC4A 4I3ZA 5DR6A 3BIZA 4BKJA 3W1FA 3SKCA 1XWSA 5GJGA 3E8DA 3QTRA 4DEAA 3Q4CA 4YJPA 3B8RA 3CKXA 3D5WA 3N4TA 3UJGA 5F1ZA 4BDDA 4F70A 5ETFA 3A8XA 3O50A 4ZJVA 3WF8A 4CLJA 2C6TA 2CLXA 3QRKA 4O0SA 3F5UA 1NVRA 1UU8A 2B4SB 3PG1A 1PXPA 3F3TA 3RAWA 3VS0A 4EOPA 3LCTA 1JLUE 4PL5A 5AV3A 2W9FB 4BIDA 4Z16A 2PPQA 3GUBA 4YUQA 3FHIA 1VZOA 2P55A 5L2QA 5CVGA 5AUTA 2GHGA 5DT3A 3CY2A 4PDSA 5C26A 3QGWA 4R78A 1JPAA 3ZYAA 3MH2A 2QO7A 4AXAA 2EXEA 3MPAA 2ITNA 4XBUA 3G2FA 3LQ5A 3MFRA 4LOOA 2XK6A 4BB4A 4KUJA 2XK9A 4L3JA 1PXJA 3U9CA 2A4LA 2ZV2A 1AQ1A 2PVLA 4IX3A 4JX3A 3PSDA 5IQBA 3ZLSA 4M84A 2O5KA 4MXCA 4Y73A 5AP2A 4U42A 4EH4A 4TNBA 5M4UA 5BUEA 3RPSA 2J4ZA 3KKVA 4MBLA 3KRWA 4KIKA 3GFWA 4GJ3A 2W1FA 4KIKB 4F0FA 2Y7JA 3HP2A 5K4IA 5L2IA 3CQWA 4L45A 3FZOA 3QCSA 3QZFA 4FL3A 5CENA 4AACA 3AXWA 4KIQA 4RMZA 4YBKA 5JKGA 3REPA 3F3VA 2YABA 2B9IA 3HL7A 3EHAA 2Y0AA 2OI4X 3TNHA 5IG1A 2GPHA 3BELA 1FINA 2X39A 3OCGA 5L8JA 3D2IA 4AOJA 3KXZA 4FTCA 5HE1A 2GQRA 1YXSA 3DS6A 5HLPA 2CDZA 4O0UA 2GSFA 3JS2A 3UOLA 2ZV8A 4RT7A 3PIZA 5K4JA 1P5EA 2XMYA 4AWIA 4FEQA 2R0IA 2J0JA 3ZFMA 5BVOA 4G6LA 4QMZA 2WOUA 3PTGA 4FT3A 5IA4A 4GKIA 5H8BA 4AW5A 5ANDA 2NPQA 3OROA 2X7GA 3COMA 4S30A 4YC3A 4CCUA 2WGJA 2C6DA 4FSZA 5EFQA 3PFQA 3D5XA 4RA5A 4QPMA 5IDNA 1OUKA 3PA4A 2W5AA 2WU7A 4L3PA 3QXOA 4BIEA 5JFSA 1A48A 4RLKA 5J9ZA 3GCSA 3EQCA 3HNGA 4AE9A 3BGQA 4KAOA 4HYHA 4AZVA 3FPQA 4EOSA 4L00A 3OXZA 4GYIA 5DRDA 4FSYA 5FXSA 1G8SA 4XG6A 1ERKA 3DA6A 5ETCA 5HGIA 4OT5A 3OT8A 5CQUA 4I22A 4WG3A 2NRUA 2VTHA 5M53A 3HAMA 4DT9A 3OOGA 4WNMA 2DUVA 3UDBA 3OY3A 3VO3A 3D7TA 4J98A 3II5A 4AA0A 3D7TB 4CTCA 4IE9A 4ALUA 4BCNA 1GIHA 3FMKA 3PVWA 4F08A 5A4LA 3SXSA 4HZSA 4FKUA 3HECA 4IWPA 4HNIA 4AGDA 3O7LB 4HGTA 4O0XA 1CDKA 2OIQA 3BZ3A 5HHWA 3RCJA 5IH6A 3PRIA 1OL2A 3DBFA 2I0HA 4LQMA 5M44A 3FBVA 1OZ1A 2XNGA 2VWUA 5LARA 2O3PA 5HVKA 2XB7A 5LMKC 3KRLA 3VS7A 4OW8A 1YDRE 5IA5A 4MEDA 3PA3A 1QPJA 4LMNA 4OGRA 2YZLA 2JDVA 2XK4A 3PP0A 5ANJA 4RC2A 5IQAA 4KRCA 3DB6A 4N57A 2FB8A 4AP7A 2HZIA 2RFEA 2XJ0A 3PUPA 2EB3A 2DYLA 4C2VA 3ET7A 4GW8A 4WSYA 3W2PA 3ZXZA 3KXMA 1L3RE 4CV8A 1H27A 2W4JA 2QQ7A 1Z9XA 4RVTA 4MXXA 2XBJA 4AOIA 4R77A 4XYFA 4G3CA 1KE6A 4I23A 5HX8A 4X6RA 5AP5A 2GTNA 3PG3A 3QUDA 3UNKA 3OCBA 3T3VA 3Q6WA 2WMVA 3WF7A 1E9HA 2CNUA 2BROA 4L9IA 1RW8A 5CANA 5KKRC 5AP6A 4N6ZA 3C4XA 3SXFA 5D10A 2BZHB 3PXYA 4J71A 3V5TA 2VRXA 4NEUA 3AMBA 5AR3A 3S0OA 2GNJA 2I0VA 4HGLA 3VS4A 5ETAA 5FBNC 2R3PA 2XK3A 3HDMA 2Z7SA 4YBJA 3UE4A 5IMEA 2O65A 4FTMA 4KA3A 2XCKA 2VN9A 3QKKA 5CAPA 2PHKA 4O0RA 4FIFA 4LM5A 2PZ5A 3IOKA 3U55A 3VUTA 4BN1A 2VNYA 3I1AA 5HVYA 5DWRA 2X7FA 4X2GA 3T3UA 4CYJA 4ZIMA 4J95A 3QTQA 4FODA 3MWUA 3A7HA 2G1TA 2Z8CA 2JIIA 3VBWA 2ZM3A 4A9TA 3G0FA 3PPZA 4BF2A 5AP4A 2QOFA 4DN5A 4EUUA 4AUAA 1VYZA 4BCIA 3V3VA 3QQKA 3UYSA 4QP9A 3BHTA 1KE9A 3OUKA 3Q32A 4YO4A 4OBOA 5A46A 3H0ZA 4M7IA 3JR1A 3KF7A 4YHFA 3U54A 1CM8A 1GOLA 2ZMDA 1FPUA 3PPKA 3EQGA 4BI0A 3Q4TA 5A14A 4BKYA 2RGPA 3DAKA 5H8EA 2IG7A 3CLYA 1R0EA 3EKKA 3K3IA 2FA2A 5K3YA 5BVNA 4MTAA 4IVCA 3QXPA 1XBAA 3NPCA 2R3IA 4BL1A 3COHA 5IA0A 3QZHA 4QNAA 1NW1A 4I5HA 1DM2A 4DLJA 4X7QA 5D12A 4QMTA 2X7OA 5AA9A 3E93A 1WCCA 4FVPA 5L8KA 4CG9A 3KXXA 1Q8TA 3OWJA 4EH6A 3O71A 3IK3A 4UV0A 3ZS5A 2P33A 4CNHA 2BIYA 3DZOA 3DFAA 1OB3A 2YCRA 4FG8A 3PJ1A 5ACKA 4HPUE 1I09A 1H26A 2QHMA 3CP9A 3FKLA 5E8YA 3S00A 2Z7LA 5IEYA 3THBA 4NWMA 3FZPA 4D1ZA 3DXQA 4OT6A 3OHTA 3ZSHA 3AC4A 2XA4A 2XJ2A 4LYNA 3EN6A 4JAJA 2BVAA 3AGLA 2ZOQA 3BYOA 4NTSA 4UMQA 2YCSA 5FGKA 3UIUA 2G9XA 3K3JA 3GU8A 4QTCA 2SRCA 3VHEA 3GI3A 3P08A 4RQKA 3F3UA 1GZKA 5HO6A 4BBMA 4ZP5A 1XJDA 1YXTA 2BDFA 5FD2A 4RG0A 4RPVA 5EI8A 4IDTA 5HG9A 4QP2A 2UW0A 3PZEA 2WIHA 3E3PA 4H3BA 2C3IB 5AUZA 3RZBA 3V5LA 5DOSA 4FV2A 3DT1A 4O7TA 3HMMA 4G5JA 2XZSA 4MQ1A 3ZZEA 2CCIA 4I6HA 3COIA 3IDCA 2VTIA 4GT3A 1CKIA 5EHYA 5AWMA 4KKEA 4YGAA 4AW1A 2WHBA 5FTOA 2E9NA 2H34A 3FLNC 3FSKA 3F5GA 3RPYA 4LMUA 3W18A 1OL6A 3TI1A 1QMZA 4R5SA 2X2LA 4A9SA 2V5QA 2VTJA 4DGMA 2J5EA 2C6LA 1OMWA 1FGIA 4IZ7A 3ORTA 5IQFA 3TN8A 4G3FA 4F9BA 5HU9A 2BKZA 4AZWA 1R3CA 4I6QA 3FLSA 1YHSA 2Z60A 3ORZA 4IVBA 4EZ5A 5M51A 4MD7E 2GDOA 4IM2A 3F2AA 4MH7A 4ZLZA 5D41A 1FVRA 4FT0A 3LJ1A 4JT3A 3EFKA 3ZBXA 4EQMA 4EHVA 3QRUA 1FBNA 3P23A 2W4OA 2XF0A 5CI7A 3FYJX 1UVRA 4MXOA 3KU2A 4JBVA 4O2PA 4DGLC 4K33A 4KBKA 4PMPA 4YJOA 3HYHA 4O27B 3G6GA 4H3PA 4QQCA 3WZJA 4C62A 4CFUA 4EONA 2BMCA 2ESMA 4F7JA 3BV3A 1ZMUA 2ZV9A 3PY3A 2OFUA 3DBEA 1HCLA 3UPXA 3L9MA 5FP5A 5BVDA 5IZFA 2HXLA 4NM7A 5CS6A 4FEUA 2W9ZB 1URCA 3F7WA 4EC9A 2QKRA 4FKVA 4FTKA 3T9IA 2WOTA 4PPAA 5GJDA 4BGHA 4YLJA 2REIA 4FC0A 2A1AB 4I93A 4WBOA 2YDJA 3PA5A 3BYSA 4Y83A 3VHKA 3EQBA 1SVHA 2QNJA 3FI2A 4OLIA 3VJOA 3QTSA 3LMIA 4DFBA 1K2PA 3FLZA 5DG5A 1FGKA 5DI1A 4FTAA 1OIQA 2CN8A 4S33A 3F3WA 3NR9A 4PP9A 5B2KA 4H36A 5JGDA 3LFNA 4O81A 2R7IA 3EFLA 5JGAA 4G9RA 5I9YA 4WG5A 4TKSA 4N70A 4ZTHA 2XK7A 3T8OA 4F1MA 2XNBA 5IUIA 3R21A 4AA4A 4MBIA 4ERWA 2XIXA 4F9YA 4W4YA 3SLSA 3GOPA 4BDJA 4YTCA 5DN3A 3ZMMA 3HRFA 3FZSA 3NW7A 4U41A 1F3MC 2BAJA 2UVZA 3DDPA 4RFZA 5IA2A 3DJ7A 4YPDA 3BLHA 4W8DA 5ANEA 3ZZWA 5CU0A 3GFEA 5DVRA 2UZVA 4K11A 5FXQA 2EXCX 3MV5A 2X9FA 4ALVA 5CF4A 3ORMA 3R7GA 4D2WA 3UYTA 4C34A 3U6JA 4AAAA 3UIXA 4P5ZA 4QTEA 4HCVA 4PP7A 3CJGA 2GS6A 1KE8A 1J3HA 1JNKA 4DFXE 4QMWA 1VYWA 5HICA 3A99A 3FSFA 5HO8A 5A6NA 3A2CA 3QCQA 4PX6A 4R3CA 2HIWA 4FIIA 4EBWA 5M4FA 3A7IA 4PTEA 2PK9A 3G15A 4FIGA 1ZXEA 2HWOA 4CQEA 1PXKA 3L9LA 2WQBA 3R9OA 3RNYA 3VF9A 3FKOA 5BNJA 2CMWA 5K5XA 2JGZA 3BU5A 3H3CA 4ZJIA 2WFYA 4NKSA 4EHEA 3GBZA 2AC3A 2UW6A 1NY3A 4S2ZA 5K0KA 4TZRA 2QU5A
chains in the Genus database with same CATH superfamily
3R7VA 2J0KA 5B0XA 3HX4A 2F57A 4FTTA 4C4IA 2QD9A 2YERA 3DGKA 2Y6MA 1M7NA 4P5QA 2BR1A 3UO6A 3KMUA 4F6WA 2PUIA 2O8YA 2RFSA 2IEWA 3QQUA 3W2SA 4FA2A 4G3DA 5LMKA 3FMHA 4OTQA 4QYEA 3WF6A 4AQKA 1U5QA 2WMUA 3RHKA 3UQCA 2B53A 2QOQA 4RZVA 3W8QA 2PE2A 4DH5A 2OXYA 3NLBA 4LV5A 4NYEA 4GUBA 4MCVA 2UZOA 1W7HA 1WBTA 2BFXA 3AD6A 4AZTA 4U6RA 3VBYA 1YI4A 3TWJA 5EYKA 3ODYX 1J91A 4I5PA 4TWCA 4I24A 4BDIA 1P4FA 2E9UA 3SOCA 4RWKA 4F0IA 5JQ5A 5IH4A 4DT8A 4RC4A 2VX0A 2R7BA 3R8MA 3GNIB 2Y4PA 1YDSE 3GU7A 4QMUA 3RP9A 3C51A 3R9RA 3QD3A 4IWOA 4DCEA 3CC6A 3KXNA 2HK5A 3LVPA 3R28A 4RWJA 4AN2A 3BQRA 1J7UA 2X0PA 2VWIA 3R22A 2QOBA 1KSWA 3H9FA 3FLQA 5CVFA 5C4KA 3DU8A 4MQ2A 4V05A 3QA0A 2OJFE 4L67A 4CZYB 3DOGA 4IB0A 4FZDB 2JC6A 4NIFA 2PMNX 3V5QA 4A4LA 2UZTA 2YJRA 3PXFA 4J1RA 4OAVB 2J90A 3VUIA 3WARA 3MH1A 1MP8A 5GHVA 3KQ7A 3KVXA 4O6EA 4AX8A 1PMEA 4QTAA 4EH2A 3LKMA 4U40A 4JDHA 2VGOA 5BUIA 4X2JA 4Z7GA 3HA8A 3TKIA 3LOKA 2FSMX 3ULIA 1J1CA 3L9NA 5LWNA 4EBVA 3NNVA 3P78A 2CGWA 2C5NA 2GS7A 4RRVA 2CHLA 5F9EA 2OBJA 3DNEA 3VS6A 3BGPA 1WAKA 1XH5A 1UWJA 2UVYA 4CRLA 4GCJA 2BDJA 2WQNA 2EWAA 2R3FA 2BFYA 4HYSA 5H3QA 1B6CB 3BBWA 4NW6A 3SRVB 2GHLA 5DT0A 3LXNA 2OIBA 3BHUA 1VR2A 4D1SA 3R8VA 3P7CA 4BCFA 2R3GA 5J7BA 4PMTA 2UZDA 4NK9A 4UZHA 2W1IA 5LMAA 2BZKB 1ZYJA 2X6EA 5C9CA 3WILA 4IBMA 5IPJA 3Q6UA 4KKHA 4EK4A 5J9LA 1Q99A 2OJIA 1BKXA 3JVRA 4UWCA 3WI6A 4EH8A 3AT4A 3CGOA 4RWIA 3WF9A 2ITTA 2XALA 2O0UA 3LLTA 3NYXA 3R1YA 3PPJA 4QOXA 3QYWA 2X81A 5ETIA 4FEVA 3S3IA 4O4CA 3WZUA 1Y8YA 2I0EA 3QTWA 1IRKA 2PVYA 4R5YA 4H3QA 5ITAA 1WMKA 4GH2A 3G90X 5CZHA 1U54B 4BCJA 2XH5A 1XKKA 4FKJA 3BKBA 4B7TA 2PY3A 3E8NA 3ZU7A 3F82A 3PJ2A 4L6QA 2O2UA 5DE2A 4EEVA 3C13A 3PJ3A 2J2IB 5AR5A 5HE2A 1CSNA 3AKKA 3OT3A 3MB7A 2R3QA 3OBGA 4XV1A 1OKWA 4AT4A 4DTAA 3O96A 5HBHA 5AAFA 4XNEA 4XG4A 1PMUA 5CEKA 1OBDA 5EKNA 3WYYA 4C8BA 4AZEA 3EYGA 1MRVA 2CKPA 2PVJA 4DG3E 3PUFC 4I20A 5CU4A 4Z55A 3NCZA 2PU8A 3DDQA 3R1SA 1ZYLA 4QYYA 4GK2A 2QOHA 3QUEA 2H8HA 4ARKA 4EK5A 1OBGA 3ALNA 3DQXA 4BC6A 4XRJA 4PTGA 2DS1A 4BCPA 3IS5A 4HNFA 4BZNA 3MTFA 4G31A 4CFXA 2JIUA 2QI8A 1TZDA 3QZIA 4EH5A 5HORA 4QP7A 5KMJA 2UUEA 4LG4A 5AIRA 4FMQA 5HIDA 4J8NA 2I1MA 4ZTNA 1YW2A 1G3NA 2BTSA 2WQOA 2ITWA 1UV5A 3IGGA 3VWAA 1ZWSA 3RPOA 4BWXA 3NNUA 3BQCA 4DINA 2C3LA 1SYKA 4JIKA 4R8QA 3ZRMA 5KMMA 1IAHA 2WPAA 2XARA 4C57A 3BYMA 3VS3A 3R63A 4FZAB 3QHRA 2UVXA 3C50A 4DCAA 5HZNA 3CD3A 3CTJA 5HTIA 4XJ0A 5K0XA 3O8UA 2XNPA 4IZAA 4ZTQA 1O9UA 4FUYA 4QP4A 4D4RA 5TKDA 2QHNA 5E9EA 3NEWA 1V0BA 1QPEA 2XYNA 2XIKA 4UALA 3H9RA 2PVHA 4BCKA 4E20A 5FDPA 3BL7A 2HY0A 5D7VA 4BR3A 3FMDA 3VIDA 2AEGA 2I7QA 4PDOA 3MVMA 4O7RA 5ANOA 4FVQA 1U46A 4R7HA 3ROYA 4JBOA 3SA0A 3KN6A 3F2RA 1HCKA 1SZMA 4XG9A 3N4UA 3PWYA 1LR4A 3A60A 3UP7A 5AV2A 4AT3A 5CNOA 4IX6A 3V04A 3EB0A 4UN0C 4XG7A 2PMOX 1R1WA 1PXOA 2UW3A 5FLFA 1Q24A 3UGCA 4RX5A 4FTOA 5BX0A 5CAVA 2UW8A 3NZ0A 4JG8A 4V0GA 4AFJA 4EYMA 3O17A 2BZJA 4GMYA 5AV0A 4LV7A 4X2NA 4Q5HA 3QRIA 3C4WA 1WVYA 5I9WA 4FE2A 2VWXA 4BDHA 4V01A 5J95A 4FBXA 4JDJA 1YOMA 1R78A 3OW3A 4GG5A 3W32A 1YXUA 5HD4A 4MWIA 3Q53A 5H2UA 4Z7HA 3AKLA 2QOKA 2X4FA 2PZRA 3Q52A 4RIYA 4EKLA 2CGUA 3I5ZA 4F7NA 4WNKA 5EW9A 4IAKA 3RM7A 4XH6A 3TTJA 2ETMA 3WZEA 1DI9A 3LJ0A 4FK6A 5AM6A 3CIKA 3P5KA 5IDPA 1U5RA 1PJKA 1KV2A 2PVKA 2ITXA 3O51A 4C3PA 3A4OX 1WVXA 2GFSA 4BBFA 5C8NA 2VX1A 3QWKA 3ORIA 4PL3A 3T9TA 4OTPA 5A9UA 4YJTA 3ORLA 4RVLA 4FKIA 4FTUA 4WO5A 4O7YA 4FZ7A 3JY0A 4PL4A 5LWMA 3ZC5A 4RA4A 4EQCA 3CE3A 3BWFA 3VUGA 4QMOA 5FQDC 3I4BA 3NFFB 1OIRA 4M14A 1OKZA 3NUYA 3ZLXA 5KO1A 2WQMA 4GS6A 1M17A 3MSSA 4MAOA 4DH7A 4AW0A 4X2KA 4BBEA 4GIHA 3IW6A 4D5KA 2NNWB 5LVOA 5JZNA 5D11A 1W2DA 3FY2A 1UKIA 5GZ8A 3IONA 3R7UA 1YWVA 2AUHA 4FZ6A 3V8SA 4H39A 4QYHA 4KKGA 2B7AA 2GFCA 4BDEA 2W0JA 2B9FA 4HVIA 3H9OA 5LVPA 2Y4IC 4EH9A 5A4EA 1GZ8A 2PYWA 4IAAA 3DK3A 3MVJA 1JKLA 1KOAA 1MRYA 5DNRA 5E1EA 3TZ9A 2V55A 4RJ5A 3FV8A 2CGXA 5IQHA 1ZARA 2JKMA 4ORKA 5LVLA 1P2AA 1MUOA 3F9NA 3F66A 3HUCA 2R9SA 5FRIA 3ZLYA 3F3ZA 4I5CA 3GC7A 4GG7A 4D4YA 5KHXA 3VS2A 1OPJA 2RG5A 5CEQA 3EYHA 5AUXA 3QTZA 3UC3A 5T68A 5A6OA 3GU5A 3MFSA 4FKTA 3VUMA 2V7AA 3TACA 4L42A 4FT7A 1TQPA 4L7FA 4PWNA 2A0CX 4JLCA 3QCXA 4TN6A 2VTOA 2Y6OA 2OJ9A 2C0IA 3BWJA 3UPZA 4FG7A 4R3RA 4AGUA 3FDNA 4Y72A 1H1SA 2VTMA 4G1WA 4X0MA 4AZFA 2G2HA 3IDBA 4JI9A 4FR4A 3ZFYA 4A7CA 4BDFA 1JBPE 3EN7A 4LL0A 5J5TA 3SAYA 4RJ6A 5DH3A 2IW8A 5BQ0A 4ACGA 3EIDA 4Y46A 4FKSA 2P2HA 3RK9A 2BDWA 4FL2A 5CI6A 3PXQA 3ZH8A 5CVHA 5EM8A 4I6FA 2OW3A 4FKPA 3NS9A 1E1XA 4K0YA 4QTBA 3NUXA 3WE8A 4X3FC 4OAUC 4HOKA 2G2IA 4RJ4A 1Q8YA 3D83A 5M07A 4B8MA 2BRBA 4D2RA 3UZTA 5BVFA 3O5AA 2OZAA 2WTWA 4FV7A 2OZAB 2C69A 2QOIA 4FSMA 3GP0A 4AXEA 4DH1A 4TPTA 3BX5A 3DLZA 5LMBA 3O8TA 3HAVA 3HV7A 1Z5MA 3GQLA 3VVHA 5HO7A 1GAGA 5DR9A 3O0GA 2PMLX 1FQ1B 3ZUUA 1IASA 3Q5ZA 4PMMA 3PY0A 5KNJA 3H0YA 2W1CA 5KUPA 2ZMCA 2UZNA 2PVFA 4TWNA 1OKVA 4RJ3A 4QQTA 4GT4A 3V6RA 3KGAA 4OTIA 2W05A 3LHJA 3BHVA 5M4CA 3OD6X 1B38A 2Q83A 5FEEA 2ZB0A 3LXLA 4XBRA 1PY5A 5JGBA 3R7YA 2I0YA 3IW5A 1A9UA 4WNOA 5CSVA 3R83A 4BTFA 3DJ5A 4C4HA 3R1NA 3R8LA 2XP2A 3F5XA 3NX8A 2F49A 5CNNA 1OGYA 3FWQA 4XCUA 5CEMA 4BI1A 3IW7A 4YU2A 2OH0E 3HDNA 4MVFA 2VZ6A 4YLLA 1BLXA 3DV3A 4C7TA 3WBLA 4X6QC 2ITOA 4EOMA 5JFWA 5C27A 2X6DA 2XUUA 5ANGA 4AE6A 3BE9A 4I21A 4QEBA 2J9MA 3BCEA 3VN9A 4ZTSA 2XM8A 3I79A 2C68A 2PUUA 2X2MA 4GU6A 4WSQA 3AGMA 4DBXA 3HMIA 4FOBA 4ASZA 1ATPE 4E7WA 2CNQA 4TYGA 2VV9A 3NIEA 2BALA 4AU8A 1QL6A 3GXLA 3IW4A 3BHHA 4K1BA 4O21A 1XH9A 2YITA 2JKQA 2IO6A 5CF5A 3KF4A 4ZMEA 2F9GA 4M12A 2A19B 3DCVA 5FM2A 1OVEA 3BYUA 4GFGA 4XEYA 4DDGA 5AEPA 5AP3A 4IC8A 4FV9A 4X21A 4E93A 2JAVA 1J1BA 5K5NA 2JITA 5HBJA 4JMQA 1XH7A 3UNJA 4AN3A 2C3JA 3FMNA 3FLYA 4Q9ZA 3VAPA 4JBPA 4FKWA 2IVVA 2JEDA 3DKGA 3ITZA 3ORNA 4F9WA 1ZOGA 4YJQA 3CSVA 3EWHA 3NVMB 5IQCA 3UQFA 1PYXA 4KSPA 2BAKA 3KL8A 5L6OA 3BE2A 3N4VA 4JDIA 2Q0BA 4HW7A 4LUDA 3OEZA 2X1NA 4O7NA 4A4OA 3RK7A 4C3RA 2A98A 4TTHB 3VNTA 2W99B 4FIHA 3G5DA 5CWZA 4EOKA 3FPMA 1UNLA 3G0EA 3QALE 4L52A 3TUCA 2XJ1A 3PVGA 4PQNA 3LMGA 4UYAA 4C02A 4KABA 2UW5A 5M57A 4JBQA 5EOLA 2YIXA 3KA0A 4YZDA 4ENXA 5GIPE 2YFXA 3EQFA 5D7AA 5CX9A 4XRLA 2JFMA 1YWRA 1GJOA 4IJ9A 3OVVA 1PMVA 4O0WA 3LFDA 4QTDA 2C6IA 5HNBA 4O7SA 5FEDA 3ZO2A 3CEKA 3GU4A 4RBLA 3ZC6A 1URWA 3OG7A 3W10A 3KIOC 4YZ9A 4EJNA 5EKOA 5CEPA 1DAYA 2FVDA 2IZUA 4L43A 4GUEA 4E4XA 1W82A 5BMMA 2CKQA 3AT2A 4W4VA 4BWKA 5IQGA 3HMNA 3ATTA 2ZV7A 3LAUA 3GCUA 5D9HA 3LFEA 4WRGA 2QO9A 4EHGA 4AAYA 4KIOA 2JFLA 4L8MA 2F7XE 4GFMA 3OUNB 1ST0A 1PW2A 3FEGA 4ZSLA 3FZ1A 3SOAA 1ZMWA 4DGOA 3TG1A 2GNFA 2WAJA 2HELA 4U8ZA 1H1RA 3DKCA 4XLIA 1BL7A 3LCKA 3VBXA 4EOLA 3RGFA 4J7BA 3JUHA 2RG6A 4WBBB 3TJDA 3BLRA 1A06A 3FZTA 3KFAA 5LCJA 4C59A 4YZNA 5AIKA 4CVAA 2B54A 4WA9A 2OU7A 5E4HA 5C1QB 4IACA 3RCDA 3FXXA 4FKLA 3DY7A 3ZDIA 2VUWA 3IO7A 3NWWA 3GCPA 5HNGA 1V0PA 3ZUVA 1M2PA 1DI8A 3NUNA 5AJQA 4R1VA 4EWQA 4W8EA 3NUSA 4F7SA 3CKWA 4EOIA 2X0OA 2XS0A 1YXXA 3PSCA 4OTFA 4WD5A 5HI2A 1H8FA 4J96A 4ONAA 3DZQA 2O63A 3BI6A 4EK3A 5GIOE 2PULA 4DFUA 5AV4A 4FUXA 3NIZA 3AOXA 2BRNA 3ZM4A 2QODA 3GVUA 2I6LA 2XBAA 3TZ8A 3EFWA 4BHNA 4ZY5A 4QD6A 5KMLA 4ZOGA 4A06A 2NP8A 4QRCA 3R8ZA 1OL5A 5IKWA 2XIYA 4DE4A 2X0QA 4I0SA 5G6VA 5AUUA 5HCXA 5FTGA 3TIZA 5KZ0A 5M06A 2JDSA 4G6NA 3E87A 4ANSA 2E2BA 5IISA 2WQEA 4JR7A 1H0WA 4RFYA 4AT5A 4BJJA 4O0VA 4O1OA 4BJJB 2ZAZA 3OY1A 4FNZA 4YZBA 2CN5A 4G34A 3E8CA 3QQGA 4O0YA 2ERKA 4RIXA 2F2UA 2VWVA 2P3GX 5HU3A 4C0TA 3EMGA 3GQIA 5HTCA 1PF8A 1W0XC 4EKKA 1H00A 3A7GA 4EOOA 3MJ2A 3QWJA 3DBCA 3R01A 4FSTA 4E4MA 4F9AA 4TRLA 3UBDA 4HVGA 2R3MA 4ITHA 5KE0A 3VS1A 4PMSA 4WG4A 2VTTA 3I6UA 4ZLOA 2Z2WA 3Q9XA 4XP3A 3KK9A 4YR8A 2UZLA 4Q5EA 2PE0A 5KZIA 4QMLA 3FQSA 4LUEA 3LFBA 3KREA 1PHKA 4GV1A 1GIIA 4JL9A 3QZGA 3QU0A 4R3PA 2QCSA 4Z9LA 3OP5A 3NW6A 1YHWA 4X3JA 5B7VA 3HMOA 5BMSA 4L53A 2X2KA 3ZXTA 5A54A 3LCDA 3ULZA 5HESA 5JFVA 3IPHA 4J97A 1CKPA 1NA7A 1H1QA 2JBOA 3OF0A 3K54A 3NCGA 5KHWA 3QTUA 3A62A 1Y91A 2WEVA 4TW9A 1OI9A 4FV0A 4D2SA 3NDMA 5I9ZA 3SDJA 4A4XA 1V0OA 3A8WA 2IPXA 4FEXA 1BMKA 2I40A 1CMKE 3HUBA 1GIJA 3BU6A 3QCYA 4U5JA 2G2FA 2PUPA 4OR5A 5DIAA 3KB7A 2QR8A 3KCFA 2OIDA 4DFLA 4RZWA 4FGBA 4GEOA 4K18A 3R8UA 3VBVA 3W2RA 3QKMA 2B1PA 4F4PA 2YWPA 3OFMA 2ZM1A 2C5OA 2G01A 4JS8A 4NFNA 4IADA 3OCSA 4IAYA 4Y8DA 4ASXA 3PZHA 4QPAA 4DFYA 3DXNA 4NTTA 3ZM9A 3VQUA 3DBQA 4IFCA 5E8WA 3C0HA 2J0MB 3GC8A 5CZIA 3HV6A 3MN3A 2RIOA 3F5PA 4M3QA 5EI2A 1YOLA 3QA8A 4NZWB 5HCYA 3D15A 5I9VA 3LXKA 4FSUA 5EYMA 4FIJA 5J87A 4D9TA 1O6YA 1WBWA 4HVDA 4IQ6A 5AUWA 3ZDUA 4KIPA 4X3FA 2JDTA 4X3FB 1B39A 3DK6A 3PVBA 3QFVA 4MNEA 4F7LA 2OWBA 3LM0A 3FXWA 4FTRA 5CF6A 4FT5A 4K2RA 3AQVA 3F61A 4RWLA 3EKNA 3UIBA 3R04A 2BHEA 1CTPE 3S1HA 5KMNA 3L8XA 3ODZX 4QMQA 4JAIA 3SGCA 1PKGA 4U0IA 4UWBA 5HLNA 2C30A 3F7ZA 2GU8A 3QQHA 1NVQA 3UOHA 4CFNA 4R6VA 4IZ5A 5E8TA 4U79A 2VTSA 3UTOA 1G5SA 3GU6A 1VLRA 2BTRA 4GIIA 2IZTA 3HVCA 1Q97A 4BDAA 5JT2A 5CSXA 3FI8A 5CSWA 4EHZA 3QAME 3OBJA 2QG5A 4WNPA 4CGAA 2PVRA 2YHVA 1XBBA 5FWKK 3ZO1A 1OIUA 2W96B 2G15A 5AADA 3P79A 4Y85A 4H58A 1RDQE 2OKRA 2YA9A 2UZEA 4ZS0A 4QMYA 3RBWA 3RK5A 2ZYBA 5B2MA 4C4EA 5DYJA 4U3YA 5J9YA 4PPCA 4YZMA 1F5QA 2JD5A 1FVTA 4W4XA 3FY0A 5D1JA 4FV3A 2VGPA 1TQMA 4IWQA 4KBAA 2FH9A 5A4TA 5KBQA 2XCHA 4A9RA 2ERZE 3D94A 4CMTA 2BRGA 1K3AA 2JIVA 1W2FA 4MYGA 4MD9E 3TZ7A 4ZY6A 4D2PA 5JFXA 4LRMA 2YLFA 2BPMA 2WB8A 3AD4A 3L1SA 3MB6A 2JAMA 3A7FA 2B52A 3QRTA 1WBPA 2X8EA 3PIXA 4UWYA 5EDQA 3TKUA 2HAKA 3NSZA 5IUHA 3NGAA 4U9AA 4JR3A 4M68A 3SX9A 2OH4A 1PXMA 2YIRA 4M0ZA 2J5FA 1YWNA 3C0IA 3FC1X 1M2RA 3U4UA 1SNXA 4DFZE 1GZNA 2HZ4A 3UOKA 1H0VA 3FQEA 4JJRA 3EN4A 3P7AA 5EYDA 5L6PA 3KMMA 3M42A 5IQEA 4ZTMA 2J7TA 3Q4ZA 4QO9A 2C0OA 3ZSIA 4O84A 5JMSA 3P86A 4Y95A 5CY3A 3DKFA 2OXDA 3UO4A 2AYPA 2IWIA 3DB8A 4D0WA 1JOWB 3UQGA 2Y8OA 4O38A 3D0EA 3I60A 3W0QA 4C38A 5A3XA 2GNLA 3QD2B 2YJSA 1QCFA 4CKRA 5EW8A 4FGRA 3CCNA 4K77A 3LFSA 5EK7A 5AR2A 3DBDA 5KKRB 4GRBA 2YCFA 3TNPC 3WIGA 3P0MA 3V5JA 3U4WA 4NIFB 3TCPA 2EVAA 4I4FA 4W4WA 2VWZA 4HGEA 4CQGA 4YO6A 5DFPA 4CZUA 3NUUA 1XH8A 1W98A 1UU9A 1ZMVA 4QMNA 4RSSA 2IJMA 4YJUA 4BHZA 3F69A 4FKRA 4I0TA 2BRHA 4R1YA 5M08A 4FKGA 2X8DA 3DPKA 3R00A 3QGYA 4UZDA 2W17A 3CR0A 4E5AX 3U6IA 5BV3A 4RJ7A 4WOVA 1XQZA 3RI1A 5AR7A 3V51A 4JRNA 4O86A 2IW9A 1LP4A 5CT7A 4ANLA 1PXNA 2RF9A 4CFMA 3OZ6A 3RZFA 3MVLA 4NFMA 3UO5A 4LOQA 2XIZA 4XLVA 2R3OA 4BWPA 3MH0A 3KRRA 3QQLA 2JKKA 4GKHA 4TWOA 1OECA 4CG8A 3HMPA 4BRXA 5JRQA 4TWPA 2PWLA 2QONA 2J50A 4YNEA 5FXRA 5FUTA 4CMOA 2ITUA 3LQ8A 4BTKA 4U3ZA 5JN2A 3SG9A 2ZM4A 3TDVA 3TUBA 5ANKA 4LGHA 3BEAA 4WUAA 3R30A 3HLLA 2C5XA 5HOAA 2R3KA 3W0PA 1RE8A 1JSVA 3LM5A 1YI6A 3FJQE 3QL8A 3LIJA 4I4EA 4NUSA 1J7LA 2GNGA 3GB2A 2YDIA 3OS3A 5DRBA 4J52A 4EOJA 1XMLA 1H07A 2VTPA 4S32A 4RLLA 5LVMA 4IX5A 3S2PA 3TDWA 1WBSA 4G16A 1MQ4A 4FT9A 2YLEA 4PY1A 1EH4A 3EL7A 2EUFB 2OSCA 2VX3A 1LUFA 1E1VA 3PE1A 4F63A 4DHFA 4XX9A 5LOHA 2C0TA 4FTLA 5JRSA 3FZRA 3E63A 4UX9A 4YC6A 1MQBA 4N6YA 2W1GA 3QD4A 5HG7A 4FICA 4G9CA 1W2CA 4G3EA 3VBQA 3MY0A 4FG9A 4AOTA 3LXPA 2HXQA 3PRFA 4WT6A 5E8XA 4YTIA 4BYIA 4IB5A 4IB1A 4E5BA 5CTPA 2F4JA 3LJ2A 2OG8A 4I6LA 2IVUA 2R3HA 4FI1A 5CSHA 5KBRA 4U43A 4E4LA 5LXMA 2XIRA 3OTUA 3R9HA 5KCVA 2QVSE 3IOPA 2C6KA 3O8PA 2JKOA 1Y6AA 1OUYA 4UMUA 3IG7A 2W1EA 3D4QA 2OXXA 4M66A 4WHZA 5DEWA 4K9YA 3TKHA 4RC3A 5I5ZA 2PZYA 2WMWA 2R64A 4NW5A 5E8SA 5J1VA 1XBCA 4M69A 4IAIA 4IFGA 4M69B 4U81A 3WZDA 3UIMA 3GC9A 2NRYA 4FNWA 2VWBA 4Z3VA 5EQPA 2PMIA 2HENA 3ELJA 4B4LA 4XOYA 3VUDA 3Q60A 5DLSA 4HPTE 3I7BA 3VC4A 3C1XA 4RIOA 1Q8UA 3OWPA 5E91A 3NVKI 2LAVA 3R02A 3NUPA 3LPBA 5EHOA 3W55A 2FGIA 2W5BA 4CFWA 2WTKC 5HD7A 2VO0A 3EN9A 5HE3A 4C37A 5LQFA 2OO8X 5TO8A 4DGGA 2GQGA 4DITA 2GS2A 2XVDA 4KNBA 1BI7A 4AF3A 1ND4A 5I9XA 3KXHA 3WOWA 2PVNA 2R3JA 3TNQB 3DTWA 5IUGA 4YSJA 3MS9A 4BCMA 1ZRZA 4MUQA 3LLAA 4JX7A 1UA2A 4E1ZA 4KB8A 2QO2A 2UW4A 2WMBA 3VONA 1JSUA 4UY9A 4V0GB 1SNUA 3OC1A 1F0QA 3KXGA 4LV8A 3HV3A 4L7SA 4C4FA 1LPUA 3UODA 3BV2A 2WMTA 4BKZA 4FF8A 3BYVA 3P4KA 5M55A 1ZZLA 4O91A 3E88A 4L44A 4UEUA 4FNYA 4AGWA 4M67A 4MBJA 2QR7A 2YIQA 4UMPA 2QOOA 3ZEWA 3Q2JA 2EB2A 1IG1A 2P2IA 3FAAA 3FL4A 3ENHA 3U87A 4FIEA 4D0XA 4CT2A 2PTKA 2CLQA 3ERKA 4UXLA 4DG0E 3R2BA 2YISA 3ZUTA 4UMRA 4PV0A 5EG3A 5F95A 3FUPA 3OWLA 4IXPA 4RFMA 3LFCA 3QQFA 3NRMA 1ZY4A 2R5TA 4RGJA 3RAHA 5KMKA 2YIYA 2V62A 4EH3A 4YTFA 4O7VA 3GCQA 3TV4A 4RX7A 4OTHA 2QLUA 3QHWA 5EYCA 5IEXA 1OGUA 2F7EE 3Q4UA 3QLFA 4CSVA 5BVKA 4ZK5A 4XG3A 4HVHA 4LI5A 4QYFA 4J99A 3DAEA 4ZEGA 3L8VA 5CASA 4AS0A 3P7BA 5TOZA 2WMAA 4ASDA 2RSVA 4QMXA 4PNIA 3ETAA 2DWBA 1H24A 4S34A 5KMIA 2FUMA 1GZOA 3SC1A 2WTVA 4U80A 2YCQA 5IF1A 3KN5A 3OEFX 4MWHA 3PIYA 4CT1A 3M2WA 5EOBA 1M52A 4FTNA 3I81A 3VUHA 1KV1A 3QQJA 3R1QA 4D4VA 1Y6BA 2F7ZE 4NH1A 5AAGA 5JZJA 2VNWA 3KRXA 4FV4A 1Q5KA 4RVMA 2YEXA 3ANRA 3KVWA 3O7LD 4ZS4A 2XKDA 4M15A 2GNHA 1S9IA 4GVJA 4BGGA 5ANIA 4QNYA 4DEHA 4YTHA 2X9EA 3POOA 3U8WA 2YWVA 3ACJA 5C4LA 4I1ZA 3C7QA 2J51A 3HGKA 1TKIA 3AC1A 4ACHA 2B9HA 1PKDA 2FSLX 1XH4A 2IVSA 3JY9A 3MJ1A 4QYGA 3HV4A 3A7JA 1Q62A 4TYIA 2XRUA 4E8AA 2ZB1A 1QPDA 4F65A 2PZIA 4RX8A 4XS2A 2RKUA 4FTQA 1IA8A 2OZOA 3FC2A 4C4JA 4Q9SA 4IC7A 4I0RA 5BYYA 5AP7A 4C36A 4BZOA 3AMYA 5CAOA 3OXIA 2YAKA 2R3NA 4QPSA 3N51A 3U51A 3C0GA 3E7OA 3PLSA 5AAEA 4D2TA 3D5VA 3WZKA 4RIWA 4L3LA 1YDTE 3N9XA 4RIWB 1DAWA 4D55A 4F9CA 3Q9WA 1ZOHA 2OGVA 3CY3A 2IN6A 2VWYA 3L8SA 4CV9A 2NO3A 4E6DA 4ZY4A 2XNMA 4CCBA 2XKFA 3WF5A 5JQ8A 4USDA 2GMXA 3K5UA 2J0LA 2QOCA 3CQEA 4IWDA 5AR4A 4KS7A 1WBNA 4QP6A 5CXZA 3ATSA 1RJBA 4GU9A 2WMQA 5AMNA 5J1WA 4DAWA 3HEGA 3P1AA 3TM0A 4IX4A 2YACA 3HRCA 3EFJA 1Q8WA 3SD0A 3UG1A 4AW2A 4BCOA 4CMUA 5CSPA 4DH3A 3ZFXA 2R3LA 3FL5A 4HYIA 2C47A 4DG2E 3EZVA 5C03A 4GK4A 5E1SA 1LEWA 2JDOA 1JKSA 4AZSA 4BICA 5JH6A 4NM3A 3DAJA 3QBNA 4FSNA 4YZCA 4E4NA 4EJ7A 3UDSA 4UMTA 2WMXA 5I3OA