3D0EA

Crystal structure of human akt2 in complex with gsk690693
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
322
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITIPPDQRTHFPQFDYSASIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase inhibitor
molecule keywords RAC-beta serine/threonine-protein kinase
total genus 103
structure length 322
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d0eA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d0eA01
5HLPA 4ANNA 2B9IA 4XG7A 2YJSA 2QO2A 5HORA 4FTOA 4JDIA 4HNIA 2BR1A 4IH8A 3DLSA 4CCBA 2YIXA 3PZHA 4FR4A 3DK3A 3PIZA 4E5AX 1OL1A 1H08A 5FTOA 2OZAB 3QHWA 5G6VA 4IEBA 3OG7A 4U3YA 4YTFA 4ZSJA 1A48A 1PXIA 3W2QA 3UOKA 1ZOGA 3FMJA 4I22A 4S32A 4NW6A 5IKWA 4ANLA 3PRFA 4EHEA 3F5GA 3MJ1A 2XJ1A 3T9TA 3MIAA 3NYXA 4I1ZA 2V7AA 4BWPA 3L8VA 3MS9A 3GQLA 4PWNA 4O1PA 4GH2A 3ZEPA 1V0BA 2WU6A 4XG4A 4EOSA 3C5UA 4FG7A 3Q6WA 4FSQA 1BLXA 4FVQA 4NM7A 3UG1A 5LVPA 5E8XA 4W4XA 4LOPA 4IMYA 3IG7A 4X2FA 3Q4CA 4F64A 2R3GA 3MESA 2YJRA 3UZRA 2QOFA 4NJ3A 2ITYA 3FZPA 3ACKA 3U9NA 3GFWA 5KMLA 3C1XA 4NCTC 4JBOA 3WZEA 4BBEA 4XNEA 2ETRA 5J1WA 1OM1A 2PE0A 2PVLA 1MQ4A 4RX5A 2EWAA 3R7OA 3ZDUA 3MJ2A 4IWOA 4FSZA 4BYJA 3CXWA 3WZDA 2X81A 5KHWA 4AGDA 5JZJA 1LP4A 2UVYA 4RA5A 2GNGA 5ANOA 3LMHA 2AC3A 3WARA 2W5HA 4EH8A 4RSSA 2WOTA 5I9XA 5AP7A 2GCDA 2G9XA 3O7LD 4TYJA 4C2WA 4XG8A 4FG9A 4WO5A 3FKNA 3BHUA 2NP8A 2XBAA 4TYEA 5BYLA 2IG7A 3GP0A 3EQIA 4RWLA 1I44A 3OT3A 5CSHA 1MRVA 2VO6A 1VYZA 2PUUA 2QOKA 4A4OA 1YDTE 4CZYB 3EQPA 1GZOA 1CDKA 2XYUA 3GI3A 4G3CA 2PMLX 5HG8A 4BCHA 2FSLX 2C5XA 4EH4A 1Q8UA 3EQBA 4YUQA 5CF5A 5F9EA 5CSPA 4OR5A 2YHVA 3OROA 2BDFA 2ITQA 4OTHA 4O7VA 2HENA 2WELA 3EN9A 2QOQA 2X8EA 5EW9A 4IJPA 2B54A 4H3QA 3NAXA 5HOAA 3LXNA 4OTRA 2C5NA 3VBWA 4QYYA 3ZSHA 4FTQA 5CU0A 1PJKA 4ANQA 2BALA 3COMA 3RWQA 1XH4A 4U7ZA 3MH2A 4I20A 4JDKA 1AD5A 5IA4A 4CMOA 4EOQA 2I7QA 5CAOA 2OLCA 4O7RA 2PVHA 4QNYA 3LM0A 2PVYA 4TZRA 4V05A 2Z7RA 1WBVA 2C5VA 5L2IA 1Q3DA 3LFQA 3UQGA 1Q97A 2OBJA 3G0EA 1OI9A 4YLKA 5DE2A 5JQ5A 3NGAA 5CQUA 3LAUA 3DNEA 1PMNA 1H1WA 3OEFX 2W5AA 4KRDA 3BRBA 3RPSA 5HBJA 3KA0A 5I3RA 3SD0A 5J79A 2C3IB 3HYHA 4JOAA 3E64A 4M69A 5AP0A 5KUPA 3U4UA 1CKPA 1ZOEA 5A14A 2B9HA 3N4VA 3ELJA 4BZOA 4H1JA 1LR4A 2JDTA 3F5UA 1YOLA 3PP1A 4FTIA 4YGAA 4I6BA 5HVYA 4FUYA 5ANJA 3AOXA 4MD8E 5HI2A 2X4FA 3FZ1A 3PA4A 5IU2A 4X7QA 3GCUA 2ITOA 4B7TA 5LOHA 4HVDA 4B8MA 4BL1A 2XIXA 4R8QA 5CEPA 1U54A 3HRFA 4LRMA 4JRNA 3NNUA 4RIXA 2VTSA 4YJUA 3FQHA 3FC1X 4O0VA 5HCXA 3G9LX 3CTHA 2JDRA 5HO7A 5FD2A 5J7BA 2P2IA 2BRHA 2RG5A 3C0IA 4ZIMA 3F61A 4PMPA 5B2MA 2H8HA 4EONA 2P0CA 3IQ7A 5BVEA 1GZ8A 3ZM9A 4XOYA 3D5UA 1YVJA 3KN6A 4AA4A 2JDVA 4EH5A 2QG7A 3VJNA 3P5KA 4FT3A 4U5JA 2VTNA 4L3JA 2R3FA 4FEUA 4N57A 2BHEA 3PSBA 3MPAA 3PXRA 4QYFA 2O0UA 2WKMA 5H3QA 3UO6A 5JN2A 2QI8A 5IH6A 4JI9A 4U40A 4EOKA 4V04A 4EWHA 4O0XA 1XBBA 3UPXA 2C6OA 2XK6A 3RALA 4E6AA 2J0KA 4U81A 3V5LA 4ASZA 2YM5A 3QKLA 4HYSA 3D7ZA 3TV6A 4L45A 4PX6A 4XV9A 3VBXA 4DHFA 4F08A 1FBNA 3BGPA 4ZZOA 1TQPA 3OC1A 3PVBA 5IQEA 2EU9A 1Z5MA 4NEUA 5DN3A 4QPAA 3GXLA 3WF6A 4D1SA 5M08A 3ZUTA 3BX5A 4DF3A 4ITIA 4K1BA 1RDQE 4QOXA 4G5PA 4B9DA 4X0MA 3O71A 5HIDA 4CTCA 2GU8A 5HICA 4XP0A 2XKFA 4EWQA 3QCSA 4G6NA 2UW9A 5CASA 4RMZA 5AFVA 1GY3A 4H3PA 4ZZNA 4TYHB 1XBCA 4V01A 4D2RA 3V8TA 4GU9A 2WO6A 3JPVA 2QOBA 3TNQB 3WE4A 3SC1A 3BQCA 3F69A 4O86A 1SVGA 3KN5A 2ZJWA 4IM3A 4W8DA 4DH8A 4RX7A 3QXOA 1OL5A 2BRMA 4LL5A 4QTEA 2OU7A 1IASA 3Q04A 4ZY6A 4F7NA 1FVRA 5I9WA 4R6VA 3BEGA 2GSFA 5A4LA 3KXHA 5IG1A 1MP8A 5IQDA 5IEXA 2R7BA 4AZSA 2I0VA 3MY0A 5E8VA 5M56A 3DB8A 4FV1A 1Q61A 3G2FA 3I81A 3KULA 3QGWA 5EDQA 5AX3A 4EI4A 3U6JA 3C0HA 3PVGA 5A4CA 4O6EA 2GHLA 4FEXA 4X3FA 4BTKA 3U6IA 4PNIA 2R0UA 2XK4A 5DPVA 4F9BA 1WVXA 4CQGA 4EHVA 1ZYDA 3F66A 3VJOA 4WBBB 2F57A 3NUXA 4FKSA 3BKBA 2H9VA 4ZJIA 3ZRKA 4J71A 4IM2A 4HVSA 3GCSA 5DA3A 3SW4A 4EEVA 1GZNA 3DQWA 4RIXB 3ZRLA 2XKDA 2XYNA 3WIGA 4NTSA 3ETAA 2FVDA 5DBXA 3QUEA 5AR4A 4GEOA 3TG1A 4ZY5A 3O2MA 5CEQA 1NY3A 2PUNA 4DFUA 4YHTA 4XJ0A 1YRPA 4GVJA 3BI6A 1ZZ2A 4CRLA 2VWXA 1PXJA 3N9XA 5ANEA 4L00A 5JQ8A 2PHKA 2Y6MA 3LJ2A 3ET7A 2BRNA 3PLSA 3RHKA 3D5XA 4G17A 2RL5A 3RP9A 2YDKA 4QYGA 3NAYA 3R30A 1JKTA 4JR7A 2R3LA 4YLLA 3BU6A 2BFXA 3MTFA 2W9ZB 4RIWA 5E7RA 4N4SA 4Z55A 1YHVA 3OUNB 4BR3A 3GT8A 1DI9A 2PZ5A 4EH2A 4D2TA 3PJ3A 5BVOA 2VTLA 2JD5A 3DKCA 2R3IA 5A9UA 1SYKA 3NW5A 2R5TA 3DOGA 3D2KA 4PDOA 5D10A 2WIPA 3ZC5A 3ZFYA 4TPTA 3RZBA 4BCJA 3PJ1A 5EYDA 4EORA 4F1TA 3KXZA 4NYEA 5AR2A 2BKKA 2YITA 5AR7A 2JDOA 3R02A 4FV7A 3RKBA 1FVVA 5AV4A 4R78A 2VRXA 4WNPA 4BTMA 3DTCA 5TO8A 3AXWA 5CF4A 1YHWA 3BE2A 3JVSA 3LCSA 4YO4A 2VWIA 2X4ZA 3HX4A 2YN8A 3R7GA 4QMMA 2RIOA 3BBTB 4OW8A 5AP4A 4BKZA 4RJ3A 4I24A 1IAHA 2GTMA 2I0YA 3TKIA 5KMOA 4IDVA 3H9RA 3VUHA 2J51A 2X7GA 2XKEA 1XWSA 2B9FA 4IAFA 4IB0A 4KIKB 4ACGA 3EQFA 4BDCA 3FY2A 4UXLA 3QRUA 2WTVA 5K5XA 4FKQA 3FJQE 4PP7A 5JGBA 3UNZA 4EQUA 4QMTA 3KMWA 4ZJVA 2A2AA 1UNGA 4O7TA 2DUVA 3O8UA 4II5A 4KABA 2B7AA 4E4NA 4DG3E 4EUTA 4FIJA 5LVMA 1PYXA 2XUUA 3DTWA 1WMKA 5BUIA 4MBLA 4BKYA 4ZTMA 2H34A 3SG9A 4JT3A 4RX8A 2CKEA 5H8EA 2C0OA 4CRSA 2C6KA 2QR7A 3MH1A 3MPTA 3QYZA 4D9TA 3C4ZA 3OTVA 3H3CA 5EM8A 5KHXA 3FQEA 1WBOA 3IKAA 2C3LA 1IR3A 3IS5A 3WI6A 4D5KA 5CENA 3R9NA 1Q4LA 5CZIA 2VNYA 4K9YA 3QCXA 4DYMA 5CAUA 1A06A 3S4QA 4AZFA 1ZLTA 4ZSAA 5L2WA 2AC5A 1BL6A 3OT8A 4HYIA 3VC4A 4BHZA 1YDSE 3G0FA 3KRJA 4FSNA 3SKCA 2PK9A 5AV1A 3LHJA 3HA6A 3QQHA 1G5SA 2CJMA 4HOKA 3DK6A 4L42A 5AUWA 5HG7A 1PYEA 4RWKA 4BC6A 3IDPA 3UOJA 5CAPA 2HXQA 3NW6A 3GOPA 2VZ6A 2ZM1A 2J5FA 4EYMA 2JIVA 4K0YA 1OBGA 1ZMWA 1OIRA 3U8WA 4E4XA 4C58A 5AAFA 4KIKA 4NSTA 4XHKB 3VUDA 3W10A 2XNEA 4FZFB 5EM7A 5J1VA 3DKFA 4EOIA 1H01A 1XHAA 4AAAA 2C68A 3V5WA 2ZVAA 3OFMA 4NU1A 3R8UA 3ZUUA 4DC2A 2YIYA 2Z7SA 4F9CA 5I9YA 4EKLA 2PVNA 5C4LA 2PVJA 1ND4A 4V0GA 2ONLA 1SVHA 2BRBA 4GT4A 4RWIA 4AZTA 5JRQA 2RFEA 2GQGA 5J9LA 3OWKA 3IPHA 4DAWA 2ITUA 4L9IA 3RHXA 3ZO2A 3H10A 4MD7E 1GIJA 3B2TA 4O22A 3PY0A 5CALA 2CNQA 4YJTA 3K5VA 3TKUA 4JBPA 2J4ZA 1U59A 3HV3A 3F3VA 4EQMA 5JGAA 1XBAA 4D4RA 3OHTA 3QCQA 3FMMA 2XA4A 5KMKA 2OXDA 4WD5A 4WHZA 2YM6A 1G8AA 5DRBA 4PQNA 3NNWA 3HECA 4Y83A 4EH7A 4DA5A 2R3RA 4M68A 3V01A 4ASEA 4HGLA 3HAVA 3PSCA 3ZO3A 4QMOA 4ENXA 3UYTA 3GC9A 4S31A 4EH9A 1JOWB 4DH1A 4IJ9A 5E4HA 4L53A 5JRSA 4DEBA 3E92A 2GNIA 1IRKA 5DOSA 5LMBA 4LMNA 1WVYA 2G2HA 3OWLA 3PXFA 4C3PA 5ANGA 4DEAA 3OEZA 2JFLA 4L52A 5AIKA 4NIFA 4RBLA 4PMTA 2GQRA 3D15A 4QMUA 3T9IA 4F1MA 1Z9XA 4MX9A 4JNWA 5CXHA 3KY2A 4QMNA 4X2KA 3T3UA 4FKOA 4N70A 4R5SA 4YZMA 3VUKA 4J98A 3OVVA 1WZYA 3HL7A 4IAIA 3R8LA 2IPXA 4WRGA 4CFUA 2QHMA 4Z7HA 1JSVA 4EOJA 3KRRA 4ZLOA 5K9IA 2VAGA 4CT2A 3NUSA 1JLUE 3I7CA 5HBHA 1W8CA 2HZ0A 5FXQA 4R3PA 4RVKA 4ZS4A 1K2PA 3AD5A 3LJ1A 2WOUA 2W96B 3TKHA 1K3AA 3BBWA 3HAMA 3VUGA 1L8TA 3L9PA 4K18A 3O0GA 4MVFA 4AG8A 1E1VA 3LPBA 2YAKA 5EOLA 4F70A 1P4FA 2BTRA 4AXAA 4YJVA 3NLBA 4EH6A 5J9ZA 4E1ZA 1H00A 4C4EA 4B6LA 3MFRA 5D12A 2CLQA 4QP3A 4XRJA 3SOCA 2XH5A 5T6KA 1Y6BA 3TUDA 3PRIA 4CFXA 3CJGA 4CFWA 3FLSA 2C6DA 2JAVA 4YZBA 3VF8A 1H27A 1R39A 3D5VA 4QTCA 4PDSA 5AM7A 4IBMA 3UMWA 2VU3A 3ITZA 4Z3VA 4G34A 3QD2B 2X39A 3GU8A 3Q5ZA 5KCVA 4M84A 4MNFA 3H9OA 3BV3A 4DEIA 3IW4A 2JKMA 4I0SA 2GNLA 1FMKA 4W4WA 4ZSEA 2OIQA 3RBWA 1WBPA 2OJGA 4O96A 4F65A 4FKTA 4JS8A 4DTBA 2Q0BA 1H1PA 5HQ0A 3GOKA 4O82A 4MTAA 3BYOA 4C36A 1YWNA 4ZJJA 4DINA 5ANIA 3KB7A 3OCTA 4H3BA 4JBVA 5BMMA 4FX3A 4DT8A 4RFMA 4IWDA 3GCVA 2HZIA 2XNGA 2HY0A 3ENMA 4O91A 5DHJA 2W4OA 5A4TA 5LMKA 1IEPA 4I3ZA 2XK7A 2ZMDA 4KINA 1UNLA 3EZRA 4GIIA 5EKOA 5L6PA 5M57A 4DT9A 1Q24A 5LMAA 4IAAA 4IAKA 4EBVA 2HXLA 3I6UA 3BYVA 4ACDA 5AADA 2J0MB 3EFJA 4U80A 2ZB0A 4G9RA 2Y6OA 3LM5A 4LGGA 3BELA 1W83A 3FMLA 1YHSA 1Q41A 2W99B 4LUDA 3P08A 1NA7A 3GFEA 4QYHA 2B53A 2Z2WA 4UBAA 5I9UA 4BCKA 4BGGA 3U54A 4QTAA 1W7HA 2G15A 1NVRA 4LV8A 5CEOA 5AP5A 3UO5A 3DJ5A 4FV6A 4QQ5A 4FGBA 4QRCA 4A06A 4ANSA 2F7ZE 2OGVA 5ANKA 4R1VA 4E5BA 4CV8A 4FSUA 3W2SA 1YXVA 5E1SA 4C4HA 1S9JA 4DFXE 2REIA 4OTIA 3NUYA 4NM3A 1U46A 2OSCA 2OW3A 5BUEA 4O7YA 2G1TA 3W8LA 3IW8A 2UZOA 3C4XA 4ZSLA 5LVLA 1YKRA 4JX7A 3KCFA 5EDPA 5I0BA 3ALOA 3LZBA 3CBLA 4ZTNA 4AUAA 3FMEA 4APPA 4ANBA 2ETMA 3LVPA 4A9SA 3S00A 1F3MC 5BVFA 3R7UA 2BZJA 3A7JA 5IQIA 2Y4PA 5JFSA 4QMPA 4TN6A 5CSXA 5IH5A 4PMSA 4BI0A 4WNOA 3R7IA 2IJMA 4D5HA 3PLAE 2JC6A 2WMUA 2YIQA 2VWWA 5B7VA 4J96A 4WUNA 4DFLA 3LQ5A 4IHPA 4XLIA 1GIHA 4BIBA 3R9HA 4IAYA 3UC4A 2C30A 4UMRA 3I5ZA 4B8LA 4MWHA 3P4KA 1Q62A 1G3NA 1F0QA 1H4LA 2JDSA 4FZDB 4XBUA 3S3IA 4CTBA 5M51A 3P23A 3BYMA 3R9RA 3EWHA 4XP3A 3JY0A 4QMLA 4Y5QA 3UP7A 3O51A 5M4IA 1Q3WA 2C6LA 5IQBA 5CEKA 5EFQA 1YI3A 5AUXA 1JSTA 2JEDA 2PVFA 3EN4A 4AZEA 5EG3A 1OUYA 4FV9A 4V0GB 5KX8A 5CAVA 3UZPA 3KGAA 3CIKA 3W33A 4YSJA 3PUPA 4K33A 3R22A 4W9WA 2HCKA 5LQFA 4JDJA 4F6SA 4FV4A 3B2WA 4TWCA 5BPYA 3FI2A 1OIYA 5M4UA 3TIZA 4CFFA 5FTGA 1BI7A 3QLFA 3QCYA 4OT6A 4U3ZA 2XZSA 3THBA 4R7IA 4W8EA 3UNJA 4FI1A 4WG3A 4IB1A 3QTXA 5KNJA 3NSZA 3L9NA 4KBAA 2Z8CA 1QPCA 4IX6A 4RIOA 3O8PA 4U44A 3OOGA 1P4OA 4LOQA 5AUUA 4IDTA 2VTTA 2YISA 3NDMA 4JBQA 4R7HA 2Y7JA 4CG9A 3FZSA 5CX9A 4ERKA 3POOA 5L2TA 4DFYA 3S0OA 3DBDA 3DKGA 3C13A 2J7TA 4F0FA 1KSWA 1UU7A 4BDGA 5IEYA 2A4LA 4FUXA 4I21A 5FP5A 2ITTA 3BHYA 3Q9YA 2R3MA 3ZM4A 2RFNA 4EHZA 2WTIA 3BLQA 4EYJA 3A7GA 2R2PA 2OF2A 4RLLA 4NUSA 3MVJA 2F7XE 4LYNA 3L9LA 4I23A 1ZOHA 4GG7A 2QG5A 2X1NA 2W1HA 4G9CA 1O6KA 2A27A 3A8WA 2BPMA 3JS2A 4A4LA 2BROA 2ITVA 4YJSA 3MB6A 5AR5A 3D7TB 3DS6A 5EM5A 4U8ZA 4PV0A 1KV1A 4GYGA 2VTAA 5AA8A 2GFSA 5GZ9A 2ZV9A 5ANDA 2VTHA 5CNOA 2IZSA 4AGUA 2VX0A 1KOAA 1AQ1A 4UMUA 4IVAA 3EMGA 2O64A 4FTUA 1OBDA 3QQLA 5BQ0A 4FNYA 3UIXA 3DBEA 3E88A 2JBOA 1KOBA 2QKRA 4U97A 4AOIA 1L3RE 2HZ4A 4YJPA 5AJQA 3PPZA 5ETIA 1GIIA 4KNBA 2PL0A 3QTSA 5G1XA 5A3XA 4FOCA 1YOMA 4KS7A 3UOHA 4AT4A 4G6LA 1Q8ZA 4XP2A 3OWPA 3P7AA 3TNIA 4L68A 5DR9A 4EK5A 4USDA 4I6HA 3RNIA 3TIYA 3ZSGA 3VUIA 4CKJA 3HEGA 2WQEA 3AMYA 3G6HA 3TZ9A 2QHNA 1Y8GA 2ONLC 2X6DA 4AU8A 3FE3A 4FV3A 4C37A 3MVMA 1X8BA 2OO8X 3E7OA 3HMNA 4IVDA 2X2LA 3QTZA 3UDBA 1QL6A 4D4VA 4CVAA 1J91A 4JRVA 3DNDA 3QKMA 5HO6A 5L6WL 3CKWA 2ACXA 1BKXA 2P2HA 4RFZA 1CSNA 3DV3A 1U54B 2CN5A 3DJ6A 4C0TA 1ZZLA 4QTBA 2R7IA 4GFOA 4Y8DA 2HYYA 3ZO4A 4MF0A 5FEQA 5FBNC 3I0QA 2WTDA 4WOVA 1ZXEA 5JT2A 2YM3A 4BIDA 4H39A 3VBVA 3HUCA 3PJ2A 4FT7A 5HX8A 1H25A 3CQEA 3OXTA 4XX9A 5KBQA 4TNBA 3HNGA 4LQMA 2PSQA 4UYAA 5HIBA 5IEVA 3DDPA 2Z7QA 4BFMA 4I4EA 4NM5A 2UW4A 2H6DA 3GU4A 3V5TA 5DRDA 3VBYA 2R9SA 4ZS0A 3OUKA 1HCLA 1PXNA 5LARA 3R9OA 2ZOQA 3QBNA 4K8AA 3C4FA 2QC6A 3WZUA 4ALWA 4M67A 3QUPA 4USFA 3ORKA 4DFNA 4EH3A 2XJ2A 3DCVA 3OW4A 3I60A 1Y6AA 2JKKA 5K0KA 1VEBA 4CMUA 4AQCA 3U87A 3FUPA 4BVUA 1QCFA 2KTYA 5DG5A 4L7SA 4GK2A 5D11A 5GIPE 1U5QA 3BHVA 3SXRA 5J5SA 5HCZA 3PVUA 4IACA 5B2KA 4ALUA 4D55A 4G2FA 3H9FA 4FZ7A 4PF4A 4PTGA 2PMIA 3DDQA 2Z7LA 4QP4A 4X2GA 5BVKA 3EHAA 4TWPA 3BHTA 4CYJA 1OKVA 5C26A 3BYSA 4MCVA 4JXFA 2W7XA 4WKQA 3GU6A 2OFVA 2PWLA 2QOCA 2IN6A 5A6OA 5IMEA 2KULA 3DAEA 5TOZA 1M2RA 3QWJA 4KBCA 2R3OA 2FSMX 3MPMA 3ZBFA 3SHEA 3E7VA 4YSMA 3MSSA 2W9FB 2A19B 2WQOA 4I5PA 5DEWA 3AC5A 5F20A 3AGLA 5AX9A 3NYOA 2BZHB 4UYNA 4X6RA 3RK9A 4CLIA 3L8XA 4MNEB 3ZLSA 3HP2A 3HMPA 4NT4A 3S2PA 3UODA 4DFBA 1OKWA 3WF8A 4Q2AA 4QQCA 3CCNA 3N51A 4PL4A 4D2VA 2IVVA 1Q99A 4K6ZA 3F3ZA 5BVDA 5M53A 1YWVA 2X2MA 4ZY4A 4NZWB 4KUJA 2GHGA 2VN9A 4GT3A 4AFJA 3SG8A 3LJ0A 4JIAA 2V55A 3VULA 4TYHA 4X2JA 5M55A 3R01A 4FZ6A 2J0LA 4TY1A 2BILB 2E2BA 2VTMA 4Z9LA 5EYKA 3R7EA 3VS6A 2XVDA 3ORLA 2W1FA 2B1PA 3CPBA 2YCQA 2YLEA 3QHRA 5E8ZA 3QLGA 4HGTA 4C4FA 4QPMA 2ESMA 3UE4A 2IO6A 3OP5A 2YWVA 4PTEA 1QPDA 2W17A 2IW6A 4PMMA 4RIYB 4OUCA 4DGMA 3MH0A 3NZ0A 3R2YA 4CEGA 2CCIA 4EK6A 2VV9A 3TUCA 4KKGA 4DEHA 2YM8A 5K3YA 3ZOSA 4O7NA 2VWBA 4IZYA 1T45A 1UU9A 2OIDA 5AWMA 3BEAA 3HRCA 3PPKA 3DBCA 3KXGA 3W8QA 3NVMB 5IQCA 2C6EA 3FY0A 3R1YA 3RAWA 4F7SA 5J9YA 4OAUC 4ASDA 4ZLZA 3F5PA 5GZ8A 3GCPA 3ZFXA 3DBQA 2ERKA 3F7WA 4NM0A 2UV2A 5ETFA 3S95A 4C3RA 4PL3A 5IDPA 4QMQA 5CSVA 5AUYA 3MA3A 4LI5A 1ZY4A 2UZDA 5EW8A 4YR8A 4ZAUA 2V62A 3UG2A 2W05A 3UMXA 1OKZA 4LGHA 4IWPA 4EOMA 2XS0A 2AYPA 2VUWA 2JGZA 3KQ7A 4FMQA 4RT7A 3KXMA 5IUGA 3DAJA 3GU5A 4FF8A 4PPBA 4PY1A 3VRZA 3RPOA 2GFCA 2YIWA 3HDMA 1UA2A 2ZV2A 4O7SA 5HE2A 2EXEA 2R3PA 3ACJA 4MHAA 4E3CA 4GJ3A 3VS4A 4R5YA 4C35A 3EZVA 4F9YA 4BGQA 4J97A 2XCHA 4KIPA 4U9AA 2Z60A 3QQKA 5ETAA 2CPKE 1YI4A 3NPCA 3TN8A 5M07A 4CKIA 2F9GA 4FTLA 3ORNA 5C27A 4CZTA 4C38A 1ZAOA 3W2PA 4IFGA 3ZSIA 4BN1A 3R1SA 3WF7A 4MH7A 5M06A 3MFTA 2V0DA 2B0QA 1LEWA 4WNKA 4F9WA 2BKZA 2BVAA 2QONA 2J2IB 2C4GA 4BCQA 1WAKA 3W32A 5LCKA 5J8IA 5A54A 3QXPA 5C8NA 1RW8A 3ZLWA 4TWNA 3COIA 5H8BA 1OMWA 3G6GA 3QZGA 2FSTX 4DBNA 5KO1A 3EKKA 2BIYA 4RQVA 5EYMA 3SGCA 1J1BA 2X2KA 4J8NA 4J99A 1A9UA 3ZTXA 3NWWA 2XIZA 4FTNA 3DFCB 2JLDA 3HP5A 4XOZA 5CVHA 3C4EA 3DXNA 2R0IA 3LLTA 4G3EA 3A61A 3QX2A 1FINA 3A8XA 3RGFA 2F2UA 4GK3A 4BZDA 3BYUA 3AT4A 1HOWA 2BFYA 2ETKA 5IH4A 2CNUA 3FYKX 1TVOA 4U45A 3M42A 2BCJA 1O6YA 3CE3A 4JJRA 4NKSA 4OBQA 3Q53A 4RJ4A 5C01A 2W1CA 5IA2A 1SNXA 1TKIA 4H1MA 4D1XA 4EOPA 2OG8A 4GUEA 3F3TA 4KKEA 3EQRA 1M2PA 2VWUA 5DR6A 2BHHA 2WEVA 4E6QA 3FPMA 2E9OA 3QA0A 2VTRA 4FTTA 1E1XA 2FB8A 4YC6A 1YQJA 3ORPA 2BDJA 4GK4A 4ITHA 4EC8A 2FO0A 4BCFA 4DG0E 1PKGA 3LLAA 4R3CA 2UZWE 3EOCA 1LUFA 4PPCA 3EQDA 2GMXA 2W1IA 4AW5A 2C3JA 2NNWB 2HY81 2JFMA 3R71A 2JBPA 4S30A 5D7AA 2UVXA 2QODA 3DGKA 1R1WA 3VS0A 4K77A 2C6IA 5HVKA 4IW0A 3DAKA 4ZTLA 3FHIA 4DTKA 1KE8A 3JY9A 2XB7A 3FI3A 1KV2A 2QNJA 4AOTA 3N4TA 3V6RA 2YERA 3CKXA 1RQQA 4UMTA 4UY9A 4D4YA 2IW8A 2OICA 1ERKA 2HZNA 5E91A 4U43A 4FODA 4FYNA 4BDFA 4BTFA 4U42A 4KIQA 3GC0A 1FGKA 2VD5A 5DFPA 5HE0A 3SLSA 2XNOA 4RLKA 2YAAA 2UZNA 4XG3A 4UX9A 4QMWA 4CFVA 4D2PA 5L8KA 4DTAA 5JK3A 2PPQA 3Q52A 5AUTA 1P5EA 1O6LA 1UWJA 5H9BA 4M15A 3QRIA 4MD9E 5F1ZA 4FK6A 4I0RA 3R0TA 3FBVA 2EXMA 5E1EA 3V5QA 3BCEA 4E7WA 2WHBA 4CKRA 3WILA 1H1RA 2CGWA 2UW6A 3HV4A 3QQFA 2H96A 2E9UA 3EKNA 3VO3A 4XS2A 4HVIA 3O7LB 2WMQA 4JG6A 5IF1A 2ZDTA 4A4XA 5CU6A 5KMNA 4YMJA 3I1AA 1V0OA 4HVGA 3AD6A 4UWBA 5HEZA 5JMSA 5E8WA 3L8SA 5DIAA 4MBJA 1W0XC 4N6ZA 2XIRA 4L43A 3F2RA 4UZHA 3Q60A 1DAYA 3C4WA 1UU8A 1VR2A 3OCSA 4FSYA 3DA6A 1BYGA 1V1KA 3RAIA 4D9UA 2O2UA 3GEQA 4UALA 3K3IA 4UEUA 1BMKA 3FKLA 5LVNA 3DJ7A 4BTJA 4Y72A 2BAQA 3PA5A 3QAME 5KKRC 4P7EA 2YLFA 4DE4A 2HELA 5EM6A 4AGCA 3SAYA 4N6YA 1ZYSA 5EOBA 1KE6A 2J90A 2CKPA 4YZDA 3SA0A 2C1BA 3L8PA 3NVKI 5K4IA 2QR8A 3COKA 2WMSA 2R64A 4RIWB 3NYVA 5IQFA 1JQHA 3Q6UA 4NIFB 3RPVA 3OWJA 4A9YA 4PP9A 4QMSA 2XEZA 4RC2A 2RF9A 3Q32A 3ULZA 4CYIA 3PTGA 1H28A 2UZVA 4FL3A 3TCPA 2G01A 3G90X 4ONAA 5EK7A 3W16A 4E5WA 3KFAA 4HCTA 3EQHA 3VBQA 5FXSA 2XK8A 3AQVA 5HG9A 1KE7A 1TQIA 3NRMA 3DXPA 3E8DA 4ZTHA 2ZMCA 3VNTA 4IAZA 4D0WA 5CXZA 4C7TA 4BCNA 2W5BA 4QP9A 5FGKA 4DEEA 3LFEA 3RCDA 5TKDA 3ZMMA 3NEWA 2HW6A 4NFNA 5DT4A 3LKMA 2RGPA 4H36A 5J7HA 1U4DA 4C02A 2JKOA 4KBKA 3A99A 4CFNA 4UN0C 3D2IA 2VO7A 3BU5A 3QD4A 4O0YA 2E9PA 3DK7A 3IONA 4RRVA 3A7HA 3HGKA 3IW6A 3FL5A 3Q9ZA 5H2UA 3A4OX 3IDCA 4FSWA 5HESA 1JPAA 3I79A 3S1HA 5GIOE 4GFGA 4M7IA 1OPLA 2YCFA 2W1DA 4N0SA 4WG4A 3JUHA 3NIZA 1FQ1B 4M66A 3BLHA 4MXXA 3VUMA 3VHKA 1YDRE 3MI9A 3QQJA 4X3JA 3LXLA 3R04A 1IG1A 4NKAA 4OTGA 3PJCA 4C4IA 3OY3A 2X8IA 4AN2A 4QYEA 4D4SA 2ZM3A 4ZSGA 5C03A 1REJA 4JX3A 3GBZA 5DR2A 4BCOA 4BWXA 3BHHA 4HVHA 3A7FA 3E93A 4IX3A 2NPQA 1URCA 4IZ7A 4ZTSA 3EJ1A 3ODYX 3ZLYA 2YZAA 1K9AA 2J5EA 2BMCA 2WMXA 2OFUA 2ITZA 3UTOA 3LFCA 1B6CB 3UJGA 3ROYA 4EK4A 5AV3A 1OB3A 2Y4IB 3NUUA 1M7QA 3IK3A 3QX4A 3ZCLA 1JSUA 4XLVA 3OCBA 5DNRA 5EHOA 5HG5A 4ARKA 1I09A 3OMVA 4IE9A 4O0UA 4BIEA 2B9JA 3TDWA 4C3FA 4XCUA 3MVHA 2YCRA 4YJNA 3DPKA 3RI1A 4DGNA 3AT2A 2PVRA 4XRLA 3IW5A 3LFSA 3NCGA 4L67A 5IA5A 2OXXA 5C8KA 3MW1A 4EZ5A 4IB5A 2XNBA 2IW9A 4FNZA 5IQGA 2WQBA 4FNXA 4S33A 4P5QA 4JQ7A 3U6HA 4QMXA 5HGIA 5KZIA 4XEYA 4QQTA 3NUAA 4L3PA 3UIUA 3QD3A 4A9TA 2UUEA 3F9NA 5L2QA 3LXKA 5HX6A 2QURA 3Q96A 3H30A 4XV3A 2X7FA 1UKIA 4R3RA 3F7ZA 3QTUA 4CQEA 2C5YA 4AW1A 4LFIA 4RVTA 5CF8A 3ZS5A 5IZFA 3GC8A 1R3CA 4CGAA 1URWA 2IVTA 3W2CA 5EQPA 3DBFA 3CJFA 2JKQA 4MNEA 4C59A 2P4IA 4WNMA 5HIEA 4IVBA 5TT7A 3ZZEA 2HAKA 5ITAA 3P7BA 2O5KA 4LOOA 3PJ8A 5CU3A 4TT7A 1M17A 2A0CX 3NR9A 1PY5A 3PIXA 1MRUA 4IANA 1Q8WA 1VJYA 4I6FA 4LMUA 2EB2A 2VWYA 4B4LA 3CEKA 3KVXA 4L6QA 4OTQA 2WFYA 1GNGA 2F7EE 5E8YA 4XV1A 4FKRA 3HMMA 2ZV8A 4QO9A 1PXLA 4RJ6A 3HV7A 1PF8A 4NTTA 2YZLA 2X8DA 1QMZA 3TNWA 4JR3A 2B55A 5HHWA 4CCUA 3E63A 3LQ3A 3SQQA 5BNJA 3BZ3A 4NW5A 1BI8A 4FIEA 4MXZA 3VHEA 5EQYA 3OXIA 1KE5A 4FTKA 4GCJA 4I0TA 3ERKA 1FGIA 4XG9A 3T3VA 3ORIA 3VS5A 2YACA 1PXPA 4FNWA 1FVTA 4U0IA 4S34A 2PTKA 3PG1A 3QALE 1PMUA 4YHJA 3SX9A 3V3VA 3I7BA 5C4KA 3QKKA 2OWBA 2R3HA 3RM6A 3FSKA 4C4GA 1QPJA 3VAPA 3I4BA 5EHLA 2WTWA 2C6MA 4P4CA 4P2KA 3TZ7A 4QP2A 2X0GA 5BYZA 4XUFA 4OLIA 4GW8A 4GRBA 2WMAA 4C62A 3HUBA 4AT3A 4HZRA 3TUBA 5JFVA 3H0ZA 4M69B 3ZH8A 3ZO1A 4OAVB 4TYIA 2GPHA 4YJOA 4PDYA 3RPYA 2RFDA 1SNUA 5AAEA 4EBWA 4DEGA 3RM7A 3VIDA 5CU4A 4AACA 3MA6A 3PA3A 1H07A 4BB4A 4IADA 2XK9A 5B2LA 4FT5A 4GSBA 3U9CA 4I41A 3AC3A 2V7OA 3CGOA 2NRUA 3V8SA 2O3PA 4C57A 3G9NA 3HDNA 2XIYA 4HYHA 4JQ8A 3FDNA 3JR1A 2WB8A 2WMBA 2Y9QA 4PL5A 4TYGA 3H4JA 5IA1A 3O17A 3R6XA 3CC6A 2Y0AA 4FL2A 2CDZA 4TRLA 4A9UA 1OL6A 3QUDA 4WA9A 4EK8A 5JH6A 5AEPA 1BUHA 3FMHA 4IFCA 4MXOA 4X6QC 4L8MA 5AP2A 4TKSA 3KU2A 4ASXA 3D9VA 2J6MA 5IPJA 4IX4A 3MGYA 3KULB 5IA3A 4EJNA 4QD6A 1YXUA 3KREA 2UZLA 3D94A 3LCDA 4YZ9A 1UU3A 3VS1A 4WUAA 1E9HA 4FTMA 3M2WA 3CPCA 4W4VA 4O6LA 1EH4A 4UMQA 4Y95A 1XKKA 3CLYA 1H0WA 3GVUA 3PY1A 4J7BA 4KWPA 3PY3A 4RJ7A 2GS2A 3PXZA 2WNTA 3LE6A 4RIYA 2PULA 4EZ7A 3EQGA 3AC4A 3ALNA 2O65A 2CLXA 5ETCA 4APCA 2CGVA 3SVVA 3ORMA 2Q83A 2XM9A 3GNIB 5CVFA 4NJDA 4ZTQA 5HD4A 3ZXZA 1M7NA 3DFAA 3F6XA 4M0YA 4XG6A 3TNHA 2J0JA 2BAKA 4JG7A 4BDAA 1QPEA 2VGOA 4M8TA 1OPKA 3WZJA 4ANMA 4AWIA 3ZUVA 3C50A 4RZWA 1W84A 2EVAA 3DQXA 2CN8A 4E4MA 2PU8A 1GAGA 1WBNA 3QL8A 4ZK5A 2QD9A 1PKDA 5L8JA 3F3WA 2WTCA 3NW7A 4L44A 4FOBA 2WU7A 5H8GA 4YU2A 5AUZA 3EFLA 4FK3A 4YPSA 2OZOA 3ORTA 3ORXA 4FZAB 2CSNA 3BGQA 4UB7A 4Z16A 5L2SA 3U55A 3E3PA 3QC9A 1LPUA 3G51A 2YM7A 4F1OA 5D1JA 3VN9A 4F9AA 1ZMVA 3UO4A 3BIZA 3R00A 5M4FA 3CTJA 3FV8A 3VS2A 4TL0A 2ITPA 2FUMA 4FTAA 4DGOA 2PUIA 4R1YA 4OTPA 4IVCA 3ZHPC 3E8NA 2Y4IC 4MWIA 4PRJA 3FZOA 4DGGA 5E9EA 5CEIA 4CV9A 1FMOE 5FDXA 3TXOA 4DH5A 3KL8A 3HA8A 4FSRA 3TTIA 3ZXTA 5K0XA 3R73A 3TTJA 3SRVB 3QA8A 5BVNA 2XNNA 1YWRA 3MDYA 4BI1A 3Q3BA 3KXXA 3W18A 1NT2A 3VS3A 2CKQA 4IWQA 2QQ7A 5DGZA 1UNHA 2I1MA 3W2OA 4GYIA 1SVEA 2WQMA 4EQCA 3LCOA 5TF9A 4TW9A 3FEGA 5BMSA 4CSVA 5KMJA 3ZLXA 2XRUA 3MV5A 5M09A 2C47A 1J7IA 3E8CA 3EN5A 2Y8OA 1U5RA 3EYHA 3OW3A 3PP0A 4HPTE 2DYLA 3NNVA 4YC3A 3H0YA 4IZ5A 4MXAA 3MIYA 3VW6A 3CSVA 4O0RA 2QO9A 3DXQA 2WMWA 5L6OA 4W9XA 3VW8A 5LVOA 3ODZX 3SW7A 2FA2A 4TNDA 3M11A 3Q2JA 4LRJA 4MK0A 2OJ9A 1XH6A 4DH7A 5TE0A 3ID6C 3AGMA 2CGUA 2QVSE 3MY1A 4O0WA 5IDNA 4YJRA 2G2IA 2GTNA 5CF6A 4QNAA 4CMTA 4QMYA 1OL7A 2LGCA 3IDBA 3NUNA 4FEVA 3PWDA 2UZUE 2UW3A 4YP8A 2JIUA 4F0IA 3MWUA 2BDWA 5FTQA 2J9MA 3V04A 4ACMA 1YXXA 5LCJA 4BBMA 2WXVA 3PSDA 3IW7A 2QKWB 1J3HA 4FVPA 1M2QA 1O9UA 4O2PA 4RVLA 1B39A 5AP3A 3UC3A 1MRYA 2RKUA 4A9RA 4AW0A 4MQ2A 5CANA 1H24A 4C33A 1AGWA 1R0EA 4ZOGA 5T3QA 2QLUA 3KMMA 2VTIA 5A4EA 5CT0A 5F94A 5CEMA 4FT9A 3K54A 1H0VA 2C1AA 4BHNA 4NL0A 3FLYA 4ID7A 4X3FB 2GDOA 4MF1A 3LMGA 4E8AA 2OI4X 3FMKA 4HCVA 4FIGA 3QTIA 4ORKA 1Y57A 3OBGA 2OKRA 3PG3A 1UWHA 3OTUA 2R3NA 2VNWA 2RFSA 3FQSA 4FEQA 3TWJA 3F5XA 1NW1A 3KXNA 4JL9A 3MY5A 4BDBA 4DH3A 1SM2A 3UNKA 4L01A 3BQRA 5AR8A 4YTCA 3QGYA 1RJBA 5IUHA 3G5DA 1DM2A 4R77A 4QP8A 2WTKB 4BDEA 3F82A 3VF9A 4M97A 3D0EA 4JDHA 2W06A 4YHFA 3HLLA 5GJDA 3RCJA 5HTCA 3DT1A 2VTQA 4J53A 3UP2A 3KRXA 3WOWA 3FAAA 4ZP5A 5A6NA 4AP7A 5CS6A 3WF5A 3QTRA 3KMUA 2CHLA 4FKIA 4TXCA 2UZEA 5L4QA 3R1QA 1PW2A 3E62A 5FG8A 1V0PA 3R9DA 5M44A 4DCAA 4DFZE 3DLZA 1S9IA 2CGXA 3OOMA 1RE8A 4OBPA 4YJQA 4CD0A 1PMVA 2JITA 4FC0A 3EQCA 4KIOA 1OKYA 5CNNA 2ERZE 5A4QA 4DN5A 2PVMA 2IZRA 2OK1A 1UKHA 2F49A 2W1ZA 2YDIA 3TACA 3TI1A 4A07A 2VGPA 2Z02A 4FIFA 3FLQA 4Q5EA 5CY3A 4AE9A 5FDPA 2UVZA 3FZRA 1CKIA 3L1SA 5EI2A 4ITJA 5DH3A 4E6CA 3KRWA 3EIDA 3U4WA 3MBLA 5CLPA 4BCPA 2JAMA 2RG6A 2IVUA 3F3UA 4AZWA 4O21A 1H8FA 4P90A 3R7YA 3ENHA 3HMOA 4HCUA 3FL4A 5JFWA 2X9FA 3UZTA 4F63A 5AMNA 3AD4A 4FKUA 2CKOA 4FKVA 2IVSA 3UIMA 4OT5A 3RVGA 4GV1A 5JKGA 4WG5A 4B0GA 3WF9A 3ATTA 5DT0A 2I0EA 4I5CA 2X9EA 5IQHA 4MXCA 3VRYA 4QMVA 5HKMA 3R21A 1FOTA 5BVWA 2YWPA 3OXZA 2W1EA 3KK8A 3GC7A 1Y8YA 4FSTA 4AW2A 3DY7A 2FSOX 3UGCA 3KF7A 2R3KA 3KRLA 3GENA 3PFQA 4LM5A 1DI8A 3FXXA 1JKKA 3QZFA 3R8PA 4KB8A 4BY9E 4G1WA 3L9MA 3R8ZA 5EI6A 1STCE 3NYNA 4G31A 3TEIA 4UV0A 4C34A 2RSVA 4J1RA 2XK3A 3VQUA 4FKWA 4RC4A 5FLFA 5F4NA 3UBDA 4DITA 4FA2A 2P55A 3AMAA 1KE9A 3OCGA 4R7BA 5FWKK 2WD1A 3P0MA 5HO8A 2QU6A 3RJCA 3QRKA 4I6QA 4WSQA 4C2VA 4CLJA 1ZY5A 3ZYAA 4FV8A 5CZHA 4JAIA 3FPQA 2X7OA 2HK5A 3Q2MA 3QQUA 4PTCA 5BYYA 2CNVA 2HWOA 2O8YA 4MAOA 3C9WA 2C6TA 2QU5A 3ZONA 3G15A 4FVRA 4FTCA 2C69A 2QOHA 5I4NA 2G2FA 3C7QA 1XQZA 1P14A 2I40A 4GT5A 4RG0A 5HNIX 3BGZA 3CD3A 4TWOA 4E4LA 4Y5HA 2R3QA 2PVKA 3IGOA 5HBEA 5JEBA 4RX9A 5BX0A 4HGSA 3NNXA 3SXSA 2A1AB 4BDHA 3EL8A 1CKJA 3OS3A 3MB7A 4UWCA 2I6LA 3SV0A 3QZHA 3UIBA 3FMNA 4QP6A 4G5JA 5FBOA 4CG8A 2WMTA 4OGRA 3O96A 3PIYA 3V5PA 1YI6A 4AF3A 3ZFMA 3C0GA 1YW2A 3FLNC 5LJJA 5HU3A 4AT5A 4G6OA 4BCMA 3CP9A 3AC1A 4WSYA 5E92A 5A46A 3UQFA 2YA9A 5ACBC 2EXCX 3CY2A 4Y46A 3D83A 5HTIA 4FSMA 5E8UA 4YC8A 2WZJA 4HPUE 2UZTA 2CCHA 3A60A 3CGFA 3QD0A 4BF2A 4BDJA 3W55A 1OGUA 4F09A 1ZYLA 2HWPA 2WIHA 4HJOA 4IXPA 5E8SA 5HE3A 5JZNA 2OH4A 5L3AA 2XJ0A 3QTQA 3C51A 4IC8A 3SXFA 4RJ5A 3D14A 5CT7A 4BDDA 3C5IA 4HW7A 3Q4UA 3O8TA 3KC3A 3LFFA 3AC8A 3KEXA 3D7TA 4GIHA 4I93A 3BV2A 2QO7A 4FV0A 4IX5A 1OIQA 3AMBA 3BWJA 3B8QA 4ACCA 4U79A 4ACHA 3EN6A 1FPUA 1MQBA 2XRWA 3FWQA 3GQIA 4KRCA 4PDPA 1ATPE 2W4JA 4O83A 1UV5A 3PE1A 4D2SA 5EHYA 4MQ1A 2YEXA 2PMNX 1XH8A 3C4CA 4XMOA 4GVAA 5CYIA 2OJIA 5E8TA 3TZ8A 4C8BA 3IOPA 4ZMFA 3EH9A 4F6UA 5GJGA 3EFKA 5AP1A 3E5AA 4J8MA 5DMZA 5HZNA 3ZEWA 3EFWA 4NCTA 4BRXA 4ZMEA 3R8MA 2VTOA 2VO0A 3RK7A 3Q9WA 5AIRA 1OUKA 1SMHA 1TQMA 3F88A 4FT0A 4EOOA 5AM6A 5K5NA 4ERWA 1M14A 3P9JA 4YNEA 2F2CB 2HW7A 4O0SA 4LL0A 2YABA 2QLQA 4O0TA 4G3GA 4D28A 2HIWA 2VWZA 2WTKC 5D41A 5CAQA 1Q8YA 2VWVA 2ZDUA 1NVSA 5JGDA 1BX6A 4E20A 1J7UA 1PXOA 4YTIA 5FXRA 1H26A 5E90A 3ZDIA 2WMVA 3FLWA 3WYYA 3RK5A 3LCTA 4AOJA 2J0IA 3RZFA 4DEDA 1KWPA 2VX3A 4QT1A 4F7LA 1PRYA 4A7CA 5CQWA 4UXQA 3LW0A 2DQ7X 3MFUA 3R2BA 4MBIA 5JFXA 3ROCA 5K4JA 4E73A 3Q5IA 4ZXTA 5B0XA 4DLIA 3O23A 4FKGA 3QZIA 3BLRA 3E87A 3HZTA 4FG8A 3POZA 2GHMA 3IECA 5DEYA 4BZNA 3VQHA 3BWFA 3OY1A 4GFMA 2ITNA 3QC4A 4MYGA 2GS7A 3P79A 2BAJA 4FBXA 4JLCA 1WFCA 4LRKA 2P3GX 4UZDA 1ZRZA 2EB3A 3NMUF 3LOKA 3RMFA 1Q8TA 3CQWA 5HD7A 3I0OA 4BKJA 5HNGA 2O63A 2BIKB 3KF4A 3OBJA 4UWYA 3WYXA 4WT6A 5KMIA 3JXWA 1W82A 3LFDA 4DG2E 4RA4A 4QMZA 3V6SA 2I0HA 4KSPA 3ZZWA 3E8EA 4L7FA 4BCGA 4FL1A 3U51A 2ITWA 1GZKA 3CTQA 3TV4A 2YCSA 1R78A 3UVPA 3GCQA 4C61A 4RVMA 5KZ0A 4D0XA 4RWJA 3UVQA 2B52A 2E9VA 4CFMA 4EKKA 5JSMA 2VTPA 3TDVA 2QCSA 3OZ6A 1WBSA 4EL9A 3CS9A 2YDJA 3A4PA 3QTWA 1Y91A 4FYOA 4KA3A 4K2RA 4B99A 4KAOA 3LFBA 4KD1A 4QQJA 5AA9A 3FC2A 3MYGA 3SOAA 4D58A 3PPJA 3PE2A 3TJCA 2YM4A 3ANQA 5T68A 5GZAA 5IMXA 1NVQA 1APME 3BU3A 2XM8A 3KVWA 5KE0A 2ZYBA 4JQEA 5EDRA 2C5OA 3R28A 5TR6A 3R7VA 3R1NA 4RFYA 4XYFA 4ZTRA 3EYGA 2GNFA 4KKHA 3LMIA 4G3FA 3FI4A 4AX8A 4FIIA 2FGIA 3LQ8A 2XNPA 2QOLA 5CI6A 4RZVA 1PHKA 5DI1A 3PZEA 4RQKA 3ZBXA 4GKIA 5AR3A 3E3BX 4ALVA 2NO3A 4FE2A 3SDJA 1ZYJA 4O7WA 1JNKA 4CT1A 3P86A 2HOGA 4U6RA 3RAKA 3TM0A 4Y85A 4OBOA 5M4CA 3M1SA 1DAWA 3AG9A 4PPAA 1JWHA 3NIEA 5GNKA 4D2WA 5J5TA 3ZU7A 4DCEA 3QRJA 3QQGA 3UYSA 4AGWA 2WEIA 3GGFA 2VTJA 3ORZA 4GL9A 4F0GA 4ZEGA 1F5QA 1YOJA 5EI8A 5EW3A 4QTDA 5FP6A 3EL7A 3I6WA 5C1QB 2V5QA 4AA5A 3TJDA 2PUPA 1VYWA 4X2NA 5I9VA 4FTJA 4HZSA 4GUBA 3W1FA 4M0ZA 1T46A 5F95A 4ENYA 5LWNA 3P1AA 5HCYA 3II5A 3PYYA 4AA0A 3R63A 3LFNA 2XP2A 4S2ZA 2WTJA 4Q9ZA 4BDIA 4O27B 3RPRA 3R83A 1J7LA 3KCKA 2VO3A 4DGLC 5IISA 2XNMA 2BZIB 4M12A 5EYCA 1LEZA 4FKPA 1PXKA 4GJ2A 5CWZA 3T8OA 3Q4TA 5FEDA 2PZYA 2XIKA 5J95A 5CTPA 2EUFB 2P33A 5HLNA 2V22A 3PWYA 5L8LA 3CD8A 3GU7A 1YXSA 2UW0A 3VBTA 1YXTA 5EH0A 4AZVA 4ZLYA 4HGEA 4Y73A 3HVCA 5IA0A 1SZMA 2ZAZA 3R8VA 1CM8A 2XBJA 3KKVA 2X6EA 5IQAA 5CI7A 3FZTA 2SRCA 1W98A 3V8WA 2WMRA 3FSFA 5HE1A 3TT0A 2Q0NA 5HNBA 3I5NA 4NK9A 1ZMUA 2W0JA 4Q5HA 2XCKA 3FXWA 4KS8A 5AV0A 2ZV7A 3FLZA 2WGJA 2BZKB 1ZWSA 2PE2A 4FIHA 3NS9A 3QFVA 4G16A 4K11A 2ZB1A 4O84A 5FRIA 4C4JA 3ATSA 2LAVA 3TV7A 4JG8A 3RWPA 4AE6A 4WIHA 5KBRA 2GNHA 1J1CA 4M3QA 3VVHA 1WBWA 4JAJA 1VZOA 4H05A 1ZYCA 1Z57A 5J87A 4I4FA 4IIRA 3VWAA 4O7LA 3O50A 1OZ1A 2PE1A 3PXQA 4LG4A 3ZRMA 5CVGA 4YO6A 5BUJA 2PZIA 1OITA 3REPA 4BYIA 1OL2A 2ITXA 3MH3A 4F4PA 3QU0A 4AN9A 4ANOA 4EOLA 3MN3A 5IUIA 4NWMA 5HVJA 4L3LA 3PXKA 4F6WA 4OTFA 4JVGA 3QWKA 3IO7A 3FMDA 4L46A 2OJJA 5CU2A 1R0PA 4H58A 4IQ6A 4GMYA 4HNFA 4ZZMA 5FM3A 3EB0A 4MKCA 3P78A 4O2ZA 3ZC6A 3FI8A 2C3KA 3OF0A 2UW5A 1XH9A 3FKOA 4XV2A 4DLJA 2QOOA 3BPRA 3Q4ZA 1BL7A 4Q9SA 2XKCA 3G33A 4WRSA 4M13A 1G8SA 1XH5A 2OIBA 2W4KA 3TZMA 3RNYA 4MXYA 4YBKA 1CMKE 3SRVA 3FXZA 4USEA 3CY3A 5FM2A 3DZQA 3RAHA 4F99A 4YURA 4GG5A 1JKSA 3P7CA 5DYJA 4OTWA 4EJ7A 5AUVA 5KKRB 1IA8A 4PUZA 2PZRA 2XEYA 5ICPA 3FYJX 3K5UA 4BI2A 3D5WA 2BUJA 4FKLA 1JBPE 1WCCA 2NRYA 2ZM4A 1OPJA 3K2LA 3AC2A 3HV6A 4FV5A 3B8RA 4I5MA 5GHVA 3WE8A 1OECA 4E93A 4FEWA 3W2RA 4IB3A 3DB6A 3DKOA 2WAJA 3CR0A 3OD6X 1GOLA 3MFSA 2GNJA 5LXMA 2F4JA 5GINE 3ANRA 4BWKA 1DS5A 2PMOX 3LIJA 4RGJA 4F7JA 3NX8A 3IOKA 5D7VA 3RINA 4GKHA 3HRBA 4I5HA 4LGDA 4D1ZA 3GB2A 4UMPA 2R3JA 3A62A 3TL8A 3ULIA 4LUEA 3N4UA 2IZUA 4GU6A 2CMWA 3UOLA 3UVRA 5ACKA 1P2AA 2WPAA 4EC9A 3UQCA 3BE9A 4BCIA 4NFMA 3DU8A 3QRTA 4E26A 3NCZA 2JIIA 3NUPA 3WIKA 4CZUA 4FICA 1PXMA 3K3JA 4FV2A 3LXPA 5FUTA 4MEDA 2FYSA 5CSWA 3QYWA 3COHA 3VUTA 4EHGA 3PDTA 3A7IA 2YIRA 2E9NA 2GS6A 4IC7A 4O38A 5GJFA 5AAGA 3MVLA 5LMKC 4J95A 3V51A 5LWMA 4AN3A 4M14A 5I9ZA 4BBFA 3Q9XA 4O81A 2YFXA 4AFEA 4FGRA 4WBOA 2OJFE 5C9CA 4E6DA 4KSQA 1H1QA 2XMYA 5I5ZA 1Q5KA 4JIKA 1XR1A 2QOIA 4YNOA 5C8MA 1GJOA 1H1SA 3PVWA 3QF9A 1B38A 5DLSA 4BDKA 4EZ3A 1XO2B 2B4SB 3CQUA 2AUHA 2BTSA 2XF0A 5AV2A 2DS1A 4LV5A 3D4QA 4I92A 4EUUA 5FEEA 1KUTA 3JVRA 4FTRA 5HLWA 4O7ZA 2UZBA 1OVEA 4HYUA 5I3OA 2FH9A 4GS6A 4EK3A 1CTPE 4CXAA 5AP6A 4NH1A 4PNKA 2IZTA 5D9HA 2OZAA 4YTHA 1IA9A 4X21A 4O1OA 1JVPP 3HV5A 3HKOA 5KMMA 4AS0A 1IAJA 4XG2A 2OH0E 3KK9A 2C0TA 1REKA 3LFAA 2PYWA 1NXKA 3GUBA 4U41A 1HCKA 4X3FC 1JAMA 2J50A 3EN7A 4FKJA 5DVRA 1XJDA 4G3DA 2BRGA 3DZOA 1XH7A 3MTLA 2C0IA 4QP1A 4YZNA 3A2CA 2UW8A 1OIUA 1PMEA 5DWRA 5EKNA 4BGHA 2WQNA 2W1GA 4BICA 2GQSA 4XH6A 4YLJA 3HMIA 1JKLA 1WBTA 4QP7A 2VX1A 3F2AA 4RC3A 4YBJA 1MUOA 2DWBA 4CNHA 3JYAA 5EQEA 4YZCA 4Z7GA 3LCKA 4IZAA 3RTPA 4XBRA 2R4BA 4RPVA 3AT3A 4J52A 4TTHB 3UPZA 3FHRA 4RJ8A 4IM0A 3WZKA 4OTDA 4DBXA 5DT3A 2OXYA 2UW7A 4P5ZA 3VS7A 5HTBA 3PXYA 5HU9A 3V5JA 1WVWA 4YPDA 1UVRA 5FQDC 3IGGA 1M52A 2PZPA 2PY3A 4W4YA 4I94A 3F2NA 3TNPC 3WBLA 1ZARA 4QPSA 2OF4A 2IWIA
chains in the Genus database with same CATH superfamily
5HLPA 4ANNA 2B9IA 4XG7A 2YJSA 2QO2A 5HORA 4FTOA 4JDIA 4HNIA 2BR1A 4IH8A 3DLSA 4CCBA 2YIXA 3PZHA 4FR4A 3DK3A 3PIZA 4E5AX 1OL1A 1H08A 5FTOA 2OZAB 3QHWA 5G6VA 4IEBA 3OG7A 4U3YA 4YTFA 4ZSJA 1A48A 1PXIA 3W2QA 3UOKA 1ZOGA 3FMJA 4I22A 4S32A 4NW6A 5IKWA 4ANLA 3PRFA 4EHEA 3F5GA 3MJ1A 2XJ1A 3T9TA 3MIAA 3NYXA 4I1ZA 2V7AA 4BWPA 3L8VA 3MS9A 3GQLA 4PWNA 4O1PA 4GH2A 3ZEPA 1V0BA 2WU6A 4XG4A 4EOSA 3C5UA 4FG7A 3Q6WA 4FSQA 1BLXA 4FVQA 4NM7A 3UG1A 5LVPA 5E8XA 4W4XA 4LOPA 4IMYA 3IG7A 4X2FA 3Q4CA 4F64A 2R3GA 3MESA 2YJRA 3UZRA 2QOFA 4NJ3A 2ITYA 3FZPA 3ACKA 3U9NA 3GFWA 5KMLA 3C1XA 4NCTC 4JBOA 3WZEA 4BBEA 4XNEA 2ETRA 5J1WA 1OM1A 2PE0A 2PVLA 1MQ4A 4RX5A 2EWAA 3R7OA 3ZDUA 3MJ2A 4IWOA 4FSZA 4BYJA 3CXWA 3WZDA 2X81A 5KHWA 4AGDA 5JZJA 1LP4A 2UVYA 4RA5A 2GNGA 5ANOA 3LMHA 2AC3A 3WARA 2W5HA 4EH8A 4RSSA 2WOTA 5I9XA 5AP7A 2GCDA 2G9XA 3O7LD 4TYJA 4C2WA 4XG8A 4FG9A 4WO5A 1W2DA 3FKNA 3BHUA 2NP8A 2XBAA 4TYEA 5BYLA 2IG7A 3GP0A 3EQIA 4RWLA 1I44A 3OT3A 5CSHA 1MRVA 2VO6A 1VYZA 2PUUA 2QOKA 4A4OA 1YDTE 4CZYB 3EQPA 1GZOA 1CDKA 2XYUA 3GI3A 4G3CA 2PMLX 5HG8A 4BCHA 2FSLX 2C5XA 4EH4A 1Q8UA 3EQBA 4YUQA 5CF5A 5F9EA 5CSPA 4OR5A 2YHVA 3OROA 2BDFA 2ITQA 4OTHA 4O7VA 2HENA 2WELA 3EN9A 2QOQA 2X8EA 5EW9A 4IJPA 2B54A 4H3QA 3NAXA 5HOAA 3LXNA 4OTRA 2C5NA 3VBWA 4QYYA 3ZSHA 4FTQA 5CU0A 1PJKA 4ANQA 2BALA 3COMA 3RWQA 1XH4A 4U7ZA 3MH2A 4I20A 4JDKA 1AD5A 5IA4A 4CMOA 4EOQA 2I7QA 5CAOA 2OLCA 4O7RA 2PVHA 4QNYA 3LM0A 2PVYA 4TZRA 4V05A 2Z7RA 1WBVA 2C5VA 5L2IA 1Q3DA 3LFQA 3UQGA 1Q97A 2OBJA 3G0EA 1OI9A 4YLKA 5DE2A 5JQ5A 3NGAA 5CQUA 3LAUA 3DNEA 1PMNA 1H1WA 3OEFX 2W5AA 4KRDA 3BRBA 3RPSA 5HBJA 3KA0A 5I3RA 3SD0A 5J79A 2C3IB 3HYHA 4JOAA 3E64A 4M69A 5AP0A 5KUPA 3U4UA 1CKPA 1ZOEA 5A14A 2B9HA 3N4VA 3ELJA 4BZOA 4H1JA 1LR4A 2JDTA 3F5UA 1YOLA 3PP1A 4FTIA 4YGAA 4I6BA 5HVYA 4FUYA 5ANJA 3AOXA 4MD8E 5HI2A 2X4FA 3FZ1A 3PA4A 5IU2A 4X7QA 3GCUA 2ITOA 4B7TA 5LOHA 4HVDA 4B8MA 4BL1A 2XIXA 4R8QA 5CEPA 1U54A 3HRFA 4LRMA 4JRNA 3NNUA 4RIXA 2VTSA 4YJUA 3FQHA 3FC1X 4O0VA 4AAYA 5HCXA 3G9LX 3CTHA 2JDRA 5HO7A 5FD2A 5J7BA 2P2IA 2BRHA 2RG5A 3C0IA 4ZIMA 3F61A 4PMPA 5B2MA 2H8HA 4EONA 2P0CA 3IQ7A 5BVEA 1GZ8A 3ZM9A 4XOYA 3D5UA 1YVJA 3KN6A 4AA4A 2JDVA 4EH5A 2QG7A 3VJNA 3P5KA 4FT3A 2AQXA 4U5JA 2VTNA 4L3JA 2R3FA 4FEUA 4N57A 2BHEA 3PSBA 3MPAA 3PXRA 4QYFA 2O0UA 2WKMA 5H3QA 3UO6A 5JN2A 2QI8A 5IH6A 4JI9A 4U40A 4EOKA 4V04A 4EWHA 4O0XA 1XBBA 3UPXA 2C6OA 2XK6A 3RALA 1ST4A 4E6AA 2J0KA 4U81A 3V5LA 4ASZA 2YM5A 3QKLA 4HYSA 3D7ZA 3TV6A 4L45A 4PX6A 4XV9A 3VBXA 4DHFA 4F08A 1FBNA 3BGPA 4ZZOA 1TQPA 3OC1A 3PVBA 5IQEA 2EU9A 1Z5MA 4NEUA 5DN3A 4QPAA 3GXLA 3WF6A 4D1SA 5M08A 3ZUTA 1W2FA 3BX5A 4DF3A 4ITIA 4K1BA 1RDQE 4QOXA 4G5PA 4B9DA 4X0MA 3O71A 5HIDA 4CTCA 2GU8A 5HICA 4XP0A 2XKFA 4EWQA 3QCSA 4G6NA 2UW9A 5CASA 4RMZA 5AFVA 1GY3A 4H3PA 4ZZNA 4TYHB 1XBCA 4V01A 4D2RA 3V8TA 4GU9A 2WO6A 3JPVA 2QOBA 3TNQB 3WE4A 3SC1A 3BQCA 2XALA 3F69A 4O86A 1SVGA 3KN5A 2ZJWA 4IM3A 4W8DA 4DH8A 4RX7A 3QXOA 1OL5A 2BRMA 4LL5A 4QTEA 2OU7A 1IASA 3Q04A 4ZY6A 4F7NA 1FVRA 5I9WA 4R6VA 3BEGA 3VONA 2GSFA 5A4LA 3KXHA 5IG1A 1MP8A 5IQDA 5IEXA 2R7BA 4AZSA 2I0VA 3MY0A 5E8VA 5M56A 3DB8A 4FV1A 1Q61A 3G2FA 3I81A 3KULA 3QGWA 5EDQA 5AX3A 4EI4A 3U6JA 3C0HA 3PVGA 5A4CA 4F78A 4O6EA 2GHLA 4FEXA 4X3FA 4BTKA 3U6IA 4PNIA 2R0UA 2XK4A 5DPVA 4F9BA 1WVXA 4CQGA 2A98A 4EHVA 1ZYDA 3F66A 3VJOA 4WBBB 2F57A 3NUXA 4FKSA 3BKBA 2H9VA 4ZJIA 3ZRKA 4J71A 4IM2A 4HVSA 3GCSA 5DA3A 3SW4A 4EEVA 1GZNA 3DQWA 4RIXB 3ZRLA 2XKDA 3W0OA 2XYNA 3WIGA 4NTSA 3ETAA 2FVDA 5DBXA 3QUEA 5AR4A 4GEOA 3TG1A 4ZY5A 3O2MA 5CEQA 1NY3A 2PUNA 4DFUA 4YHTA 4XJ0A 1YRPA 4GVJA 3BI6A 1ZZ2A 4CRLA 2VWXA 1PXJA 3N9XA 5ANEA 4L00A 5JQ8A 2PHKA 2Y6MA 3LJ2A 3ET7A 2BRNA 3PLSA 3RHKA 3D5XA 4G17A 2RL5A 3RP9A 2YDKA 4QYGA 3NAYA 3R30A 1JKTA 4JR7A 2R3LA 4YLLA 3BU6A 2BFXA 3MTFA 2W9ZB 4RIWA 5E7RA 4N4SA 4Z55A 1YHVA 3OUNB 4BR3A 3GT8A 1DI9A 2PZ5A 4EH2A 4D2TA 3PJ3A 5BVOA 2VTLA 2JD5A 3DKCA 2R3IA 5A9UA 1SYKA 3NW5A 2R5TA 3DOGA 3D2KA 4PDOA 5D10A 2WIPA 3ZC5A 3ZFYA 4TPTA 3RZBA 4BCJA 3PJ1A 5EYDA 4EORA 4F1TA 3KXZA 4NYEA 5AR2A 2BKKA 2YITA 5AR7A 2JDOA 3R02A 4FV7A 3RKBA 1FVVA 5AV4A 4R78A 2VRXA 4WNPA 4BTMA 3DTCA 5TO8A 3AXWA 5CF4A 1YHWA 3BE2A 3JVSA 3LCSA 4YO4A 2VWIA 2X4ZA 3HX4A 2YN8A 3R7GA 4QMMA 2RIOA 3BBTB 4OW8A 5AP4A 4BKZA 4RJ3A 4I24A 1IAHA 2GTMA 2I0YA 3TKIA 5KMOA 4IDVA 3H9RA 3VUHA 2J51A 2X7GA 2XKEA 1XWSA 2B9FA 4IAFA 4IB0A 4KIKB 4ACGA 3EQFA 4BDCA 3FY2A 4UXLA 3QRUA 2WTVA 5K5XA 4FKQA 3FJQE 4PP7A 5JGBA 3UNZA 4EQUA 4QMTA 3KMWA 4ZJVA 2A2AA 1UNGA 4O7TA 2DUVA 3O8UA 4II5A 4KABA 2B7AA 4E4NA 4DG3E 4EUTA 4FIJA 5LVMA 1PYXA 2XUUA 3DTWA 1WMKA 5BUIA 4MBLA 4BKYA 4ZTMA 2H34A 3SG9A 4JT3A 4RX8A 2CKEA 5H8EA 2C0OA 4CRSA 2C6KA 2QR7A 3MH1A 3MPTA 3QYZA 4D9TA 3C4ZA 3OTVA 3H3CA 5EM8A 5KHXA 3FQEA 1WBOA 3IKAA 2C3LA 1IR3A 3IS5A 3WI6A 4D5KA 5CENA 3R9NA 1Q4LA 5CZIA 2VNYA 4K9YA 3QCXA 4DYMA 5CAUA 1A06A 3S4QA 4AZFA 1ZLTA 4ZSAA 5L2WA 2AC5A 1BL6A 3OT8A 4HYIA 3VC4A 4BHZA 1YDSE 3G0FA 3KRJA 4FSNA 3SKCA 2PK9A 5AV1A 3LHJA 3HA6A 3QQHA 1G5SA 2CJMA 4HOKA 3DK6A 4L42A 5AUWA 5HG7A 1PYEA 4RWKA 4BC6A 3IDPA 3UOJA 5CAPA 2HXQA 3NW6A 3GOPA 2VZ6A 2ZM1A 2J5FA 4EYMA 2JIVA 4K0YA 1OBGA 1ZMWA 1OIRA 3U8WA 4E4XA 4C58A 5AAFA 4KIKA 4NSTA 4XHKB 3VUDA 3W10A 2XNEA 4FZFB 5EM7A 5J1VA 3DKFA 4EOIA 1H01A 1XHAA 4AAAA 2C68A 3V5WA 2ZVAA 3OFMA 4NU1A 3R8UA 3ZUUA 4DC2A 2YIYA 2Z7SA 4F9CA 5I9YA 4EKLA 2PVNA 5C4LA 2PVJA 1ND4A 4O4FA 4V0GA 2ONLA 1SVHA 2BRBA 4GT4A 4RWIA 4AZTA 5JRQA 2RFEA 2GQGA 5J9LA 3OWKA 3IPHA 4DAWA 2ITUA 4L9IA 3RHXA 3ZO2A 3H10A 4MD7E 1GIJA 3B2TA 4O22A 3PY0A 5CALA 2CNQA 4YJTA 3K5VA 3TKUA 4JBPA 2J4ZA 1U59A 3HV3A 3F3VA 4EQMA 5JGAA 1XBAA 4D4RA 3OHTA 3QCQA 3FMMA 2XA4A 5KMKA 2OXDA 4WD5A 4WHZA 2YM6A 1G8AA 5DRBA 4PQNA 3NNWA 3HECA 4Y83A 4EH7A 4DA5A 2R3RA 4M68A 4CYIA 3V01A 4ASEA 4HGLA 3HAVA 3PSCA 3ZO3A 4QMOA 4ENXA 3UYTA 3GC9A 4S31A 4EH9A 1JOWB 4DH1A 4IJ9A 5E4HA 4L53A 5JRSA 4DEBA 3E92A 2GNIA 1IRKA 5DOSA 5LMBA 4LMNA 1WVYA 2G2HA 3OWLA 3PXFA 4C3PA 5ANGA 4DEAA 3OEZA 2JFLA 4L52A 5AIKA 4NIFA 4RBLA 4PMTA 2GQRA 3D15A 4QMUA 3T9IA 4F1MA 1Z9XA 4MX9A 4JNWA 5CXHA 3KY2A 4QMNA 4X2KA 3T3UA 4FKOA 4N70A 4R5SA 4YZMA 3VUKA 4J98A 3OVVA 1WZYA 3HL7A 4IAIA 3R8LA 2IPXA 4WRGA 4CFUA 2QHMA 4Z7HA 1JSVA 4EOJA 3KRRA 4ZLOA 5K9IA 2VAGA 4CT2A 3NUSA 1JLUE 3I7CA 5HBHA 1W8CA 2HZ0A 5FXQA 4R3PA 4RVKA 4ZS4A 1K2PA 3AD5A 3LJ1A 2WOUA 2W96B 3TKHA 1K3AA 3BBWA 3HAMA 3VUGA 1L8TA 3L9PA 4K18A 3O0GA 4QEBA 4MVFA 4AG8A 1E1VA 3LPBA 2YAKA 5EOLA 4F70A 1P4FA 2BTRA 4AXAA 4YJVA 3NLBA 4EH6A 5J9ZA 4E1ZA 1H00A 4C4EA 4B6LA 3MFRA 5D12A 2CLQA 4QP3A 4XRJA 3SOCA 2XH5A 5T6KA 1Y6BA 3TUDA 3PRIA 4CFXA 3CJGA 4CFWA 3FLSA 2C6DA 2JAVA 4YZBA 3VF8A 1H27A 1R39A 3D5VA 4QTCA 4PDSA 5AM7A 4IBMA 3UMWA 2VU3A 3ITZA 4Z3VA 4G34A 3QD2B 2X39A 3GU8A 3Q5ZA 5KCVA 4M84A 4MNFA 3H9OA 3BV3A 4DEIA 3IW4A 2JKMA 4I0SA 2GNLA 1FMKA 4W4WA 4ZSEA 2OIQA 3RBWA 1WBPA 2OJGA 4O96A 4F65A 4FKTA 4JS8A 4DTBA 2Q0BA 1H1PA 5HQ0A 3GOKA 4O82A 4MTAA 3BYOA 4C36A 1YWNA 4ZJJA 4DINA 5ANIA 3KB7A 3OCTA 4H3BA 4JBVA 5BMMA 4FX3A 4DT8A 4RFMA 4IWDA 3GCVA 2HZIA 2XNGA 2HY0A 3ENMA 4O91A 5DHJA 2W4OA 5A4TA 5LMKA 1IEPA 4I3ZA 2XK7A 2ZMDA 4KINA 1UNLA 3EZRA 4GIIA 5EKOA 5L6PA 5M57A 4DT9A 1Q24A 5LMAA 4IAAA 4IAKA 4EBVA 2HXLA 3I6UA 3BYVA 4ACDA 5AADA 2J0MB 3EFJA 4U80A 2ZB0A 4G9RA 2Y6OA 3LM5A 4LGGA 3BELA 1W83A 3FMLA 1YHSA 1Q41A 2W99B 4LUDA 3P08A 1NA7A 3GFEA 4QYHA 2B53A 2Z2WA 4UBAA 5I9UA 4BCKA 4BGGA 2XAMA 3U54A 2X0PA 4QTAA 3P5JC 1W7HA 2G15A 1NVRA 4LV8A 5CEOA 5AP5A 3UO5A 3DJ5A 4FV6A 4QQ5A 4FGBA 4QRCA 4A06A 4ANSA 2F7ZE 2OGVA 5ANKA 4R1VA 4E5BA 4CV8A 4FSUA 3W2SA 1YXVA 5E1SA 4C4HA 1S9JA 4DFXE 2REIA 4OTIA 3NUYA 4NM3A 1U46A 2OSCA 2OW3A 5BUEA 4O7YA 2G1TA 3W8LA 3IW8A 2UZOA 3C4XA 4ZSLA 5LVLA 1YKRA 4JX7A 3KCFA 5EDPA 3NFFB 5I0BA 3ALOA 3LZBA 3CBLA 4ZTNA 4AUAA 3FMEA 4APPA 4ANBA 2ETMA 3LVPA 4A9SA 3S00A 1F3MC 5BVFA 3R7UA 4BJJB 2BZJA 3A7JA 5IQIA 2Y4PA 5JFSA 4QMPA 4TN6A 5CSXA 5IH5A 4PMSA 4BI0A 4WNOA 3R7IA 2IJMA 4D5HA 3PLAE 2JC6A 2WMUA 2YIQA 2VWWA 5B7VA 4J96A 4WUNA 4DFLA 3LQ5A 4IHPA 4XLIA 1GIHA 4BIBA 3R9HA 4IAYA 3UC4A 2C30A 4UMRA 3I5ZA 4B8LA 4MWHA 3P4KA 1Q62A 1G3NA 1F0QA 1H4LA 2JDSA 4FZDB 4XBUA 3S3IA 4CTBA 5M51A 3P23A 3BYMA 3R9RA 3EWHA 4XP3A 3JY0A 4QMLA 4Y5QA 3UP7A 3O51A 5M4IA 1Q3WA 2C6LA 5IQBA 5CEKA 2XAOA 5EFQA 1YI3A 5AUXA 1JSTA 2JEDA 2PVFA 3EN4A 4AZEA 5EG3A 1OUYA 4FV9A 4V0GB 5KX8A 5CAVA 3UZPA 3KGAA 3CIKA 3W33A 4YSJA 3PUPA 4K33A 3R22A 4W9WA 2HCKA 5LQFA 4JDJA 4F6SA 4FV4A 3B2WA 4TWCA 5BPYA 3FI2A 1OIYA 5M4UA 3TIZA 2X0QA 4CFFA 5FTGA 1BI7A 3QLFA 3QCYA 4OT6A 4U3ZA 2XZSA 3THBA 4R7IA 4W8EA 3UNJA 4FI1A 4WG3A 4IB1A 3QTXA 5KNJA 3NSZA 3L9NA 4KBAA 2Z8CA 1QPCA 4IX6A 4RIOA 3O8PA 4U44A 3OOGA 1P4OA 4LOQA 5AUUA 4IDTA 2VTTA 2YISA 3NDMA 4JBQA 4R7HA 2Y7JA 4CG9A 3FZSA 5CX9A 4ERKA 3POOA 5L2TA 4DFYA 3S0OA 3DBDA 3DKGA 3C13A 2J7TA 4F0FA 1KSWA 1UU7A 4BDGA 5IEYA 2A4LA 4FUXA 4I21A 5FP5A 2ITTA 3BHYA 3Q9YA 2R3MA 3ZM4A 2RFNA 4EHZA 2WTIA 3BLQA 4EYJA 3A7GA 2R2PA 2OF2A 4RLLA 4NUSA 3MVJA 2F7XE 4LYNA 3L9LA 4I23A 1ZOHA 4GG7A 2QG5A 2X1NA 2W1HA 4G9CA 1O6KA 2A27A 3A8WA 2BPMA 3JS2A 4A4LA 2BROA 2ITVA 4YJSA 3MB6A 5AR5A 4I6LA 3D7TB 3DS6A 5EM5A 4U8ZA 4PV0A 1KV1A 4GYGA 2VTAA 5AA8A 2GFSA 5GZ9A 2ZV9A 5ANDA 2VTHA 5CNOA 2IZSA 4AGUA 2VX0A 1KOAA 1AQ1A 4UMUA 4IVAA 3EMGA 2O64A 4FTUA 1OBDA 3QQLA 5BQ0A 4FNYA 3UIXA 3DBEA 3E88A 2JBOA 1KOBA 2QKRA 4U97A 4AOIA 1L3RE 2HZ4A 4YJPA 5AJQA 3PPZA 5ETIA 1GIIA 4KNBA 2PL0A 3QTSA 5G1XA 5A3XA 4FOCA 1YOMA 4KS7A 3UOHA 4AT4A 4G6LA 1Q8ZA 4XP2A 3OWPA 3P7AA 3TNIA 4L68A 5DR9A 4EK5A 4USDA 4I6HA 3RNIA 3TIYA 3ZSGA 3VUIA 4CKJA 3HEGA 2WQEA 3AMYA 3G6HA 3TZ9A 2QHNA 1Y8GA 2ONLC 2X6DA 4AU8A 3FE3A 4FV3A 4C37A 3MVMA 1X8BA 2OO8X 3E7OA 3HMNA 4IVDA 2X2LA 3QTZA 3UDBA 1QL6A 4D4VA 4CVAA 3UDZA 1J91A 4JRVA 3DNDA 3QKMA 5HO6A 5L6WL 3CKWA 2ACXA 1BKXA 4QDEA 2P2HA 4RFZA 1CSNA 3DV3A 1U54B 2CN5A 3DJ6A 4C0TA 1ZZLA 4QTBA 2R7IA 4GFOA 4Y8DA 2HYYA 3ZO4A 4FJVA 4MF0A 5FEQA 5FBNC 3I0QA 2WTDA 4WOVA 1ZXEA 5JT2A 2YM3A 4BIDA 4H39A 3VBVA 3HUCA 3PJ2A 4FT7A 5HX8A 1H25A 3CQEA 3OXTA 4XX9A 5KBQA 4TNBA 3HNGA 4LQMA 2PSQA 4UYAA 5HIBA 5IEVA 3DDPA 2Z7QA 4BFMA 4I4EA 4NM5A 2UW4A 2H6DA 3GU4A 3V5TA 5DRDA 3VBYA 4DDGA 2R9SA 4ZS0A 3OUKA 1HCLA 1PXNA 5LARA 3R9OA 2ZOQA 3QBNA 4K8AA 3C4FA 2QC6A 3WZUA 4ALWA 4M67A 3QUPA 4USFA 3ORKA 4DFNA 4EH3A 2XJ2A 3DCVA 3OW4A 3I60A 1Y6AA 2JKKA 5K0KA 1VEBA 4CMUA 4AQCA 3U87A 3FUPA 4BVUA 1QCFA 2KTYA 5DG5A 4L7SA 4GK2A 5D11A 5GIPE 1U5QA 3BHVA 3SXRA 5J5SA 5HCZA 3PVUA 4IACA 5B2KA 4ALUA 4D55A 4G2FA 3H9FA 4FZ7A 4PF4A 4PTGA 2PMIA 3DDQA 2Z7LA 4QP4A 4X2GA 5BVKA 3EHAA 4TWPA 3BHTA 4CYJA 1OKVA 5C26A 3BYSA 4MCVA 4JXFA 2W7XA 4WKQA 3GU6A 2OFVA 2PWLA 2QOCA 2IN6A 5A6OA 5IMEA 2KULA 3DAEA 5TOZA 1M2RA 3QWJA 4KBCA 2R3OA 2FSMX 3MPMA 3ZBFA 3SHEA 3E7VA 4YSMA 3MSSA 2W9FB 2A19B 2WQOA 4I5PA 5DEWA 3AC5A 5F20A 3AGLA 5AX9A 3NYOA 2BZHB 4UYNA 4X6RA 3RK9A 4CLIA 3L8XA 4MNEB 3ZLSA 3HP2A 3HMPA 4NT4A 3S2PA 3UODA 4DFBA 1OKWA 3WF8A 4Q2AA 4QQCA 3CCNA 3N51A 4PL4A 4AXFA 4D2VA 2IVVA 1Q99A 4K6ZA 3F3ZA 5BVDA 5M53A 1YWVA 2X2MA 4ZY4A 4NZWB 4KUJA 2GHGA 2VN9A 4GT3A 4AFJA 3SG8A 3LJ0A 4JIAA 2V55A 3VULA 4TYHA 4X2JA 5M55A 3R01A 4FZ6A 2J0LA 4TY1A 2BILB 2E2BA 2VTMA 4Z9LA 5EYKA 3R7EA 3VS6A 2XVDA 3ORLA 2W1FA 2B1PA 3CPBA 2YCQA 2YLEA 3QHRA 5E8ZA 3QLGA 4HGTA 4C4FA 4QPMA 2ESMA 3UE4A 2IO6A 3OP5A 2YWVA 4PTEA 1QPDA 2W17A 2IW6A 4PMMA 4RIYB 4OUCA 4DGMA 3MH0A 3NZ0A 3R2YA 4CEGA 2CCIA 4EK6A 2VV9A 3W0MA 3TUCA 4KKGA 4DEHA 2YM8A 5K3YA 3ZOSA 4O7NA 2VWBA 4IZYA 1T45A 1UU9A 2OIDA 5AWMA 3BEAA 3HRCA 3PPKA 3DBCA 3KXGA 3W8QA 3NVMB 5IQCA 2C6EA 3FY0A 3R1YA 3RAWA 4F7SA 5J9YA 4OAUC 4ASDA 4ZLZA 3F5PA 5GZ8A 3GCPA 3ZFXA 3DBQA 2ERKA 3F7WA 4NM0A 2UV2A 5ETFA 3S95A 4C3RA 4PL3A 5IDPA 4QMQA 5CSVA 5AUYA 3MA3A 4LI5A 1ZY4A 2UZDA 5EW8A 4YR8A 4ZAUA 2V62A 3UG2A 2W05A 3UMXA 1OKZA 4LGHA 4IWPA 4EOMA 2XS0A 2AYPA 2VUWA 2JGZA 3KQ7A 4FMQA 4RT7A 3KXMA 5IUGA 3DAJA 3GU5A 4FF8A 4PPBA 4PY1A 3VRZA 3RPOA 2GFCA 2YIWA 3HDMA 1UA2A 2ZV2A 4O7SA 5HE2A 2EXEA 2R3PA 3ACJA 4MHAA 4E3CA 4GJ3A 3VS4A 4R5YA 4C35A 3EZVA 4F9YA 4BGQA 4J97A 2XCHA 4KIPA 4U9AA 2Z60A 3QQKA 5ETAA 2CPKE 1YI4A 3NPCA 3TN8A 5M07A 4CKIA 2F9GA 3UDSA 4FTLA 3ORNA 5C27A 4CZTA 4C38A 1ZAOA 3W2PA 4IFGA 3ZSIA 4BN1A 3R1SA 3WF7A 4MH7A 5M06A 3MFTA 2V0DA 2B0QA 1LEWA 4WNKA 4F9WA 2BKZA 2BVAA 2QONA 2J2IB 2C4GA 4BCQA 1WAKA 3W32A 5LCKA 5J8IA 5A54A 3QXPA 5C8NA 1RW8A 3ZLWA 4TWNA 3COIA 5H8BA 1OMWA 3G6GA 3QZGA 2FSTX 4DBNA 5KO1A 3EKKA 2BIYA 4RQVA 5EYMA 3SGCA 1J1BA 2X2KA 4J8NA 4J99A 1A9UA 3NFGB 3ZTXA 3NWWA 2XIZA 4FTNA 3DFCB 2JLDA 3HP5A 4XOZA 5CVHA 3C4EA 3DXNA 2R0IA 3LLTA 4G3EA 3A61A 3QX2A 1FINA 3A8XA 3RGFA 2F2UA 4GK3A 4BZDA 3BYUA 3AT4A 1HOWA 2BFYA 2ETKA 5IH4A 2CNUA 3FYKX 1TVOA 4U45A 3M42A 2BCJA 1O6YA 3CE3A 4JJRA 4NKSA 4OBQA 3Q53A 4RJ4A 5C01A 2W1CA 5IA2A 1SNXA 1TKIA 4H1MA 4D1XA 4EOPA 2OG8A 4GUEA 3F3TA 4KKEA 3EQRA 1M2PA 2VWUA 5DR6A 2BHHA 2WEVA 4E6QA 3FPMA 2E9OA 3QA0A 2VTRA 4FTTA 1E1XA 2FB8A 4YC6A 1YQJA 3ORPA 2BDJA 4GK4A 4ITHA 4EC8A 2FO0A 4BCFA 4DG0E 1PKGA 3LLAA 4R3CA 2UZWE 3EOCA 1LUFA 4PPCA 3EQDA 2GMXA 2W1IA 4AW5A 2C3JA 2NNWB 2HY81 2JFMA 3R71A 2JBPA 4S30A 5D7AA 2UVXA 2QODA 3DGKA 1R1WA 3VS0A 4K77A 2C6IA 5HVKA 4IW0A 3DAKA 4ZTLA 3FHIA 4DTKA 1KE8A 3JY9A 2XB7A 3FI3A 1KV2A 2QNJA 4AOTA 3N4TA 3V6RA 2YERA 3CKXA 1RQQA 4UMTA 4UY9A 4D4YA 2IW8A 2OICA 1ERKA 2HZNA 5E91A 4U43A 1TZDA 4FODA 4FYNA 4BDFA 4U42A 4BTFA 4KIQA 3GC0A 1FGKA 2VD5A 5DFPA 5HE0A 3SLSA 2XNOA 4RLKA 2YAAA 2UZNA 4XG3A 4UX9A 4QMWA 4CFVA 4D2PA 5L8KA 4DTAA 5JK3A 2PPQA 3Q52A 5AUTA 1P5EA 1O6LA 1UWJA 5H9BA 4M15A 3QRIA 4MD9E 5F1ZA 4FK6A 4I0RA 3R0TA 3FBVA 2EXMA 5E1EA 3V5QA 3BCEA 4E7WA 2WHBA 4CKRA 3WILA 1H1RA 2CGWA 2UW6A 3HV4A 3QQFA 2H96A 2E9UA 3EKNA 3VO3A 4XS2A 4HVIA 3O7LB 2WMQA 4JG6A 5IF1A 2ZDTA 4A4XA 5CU6A 5KMNA 4YMJA 3I1AA 1V0OA 4HVGA 3AD6A 4UWBA 5HEZA 5JMSA 5E8WA 3L8SA 5DIAA