3D0EA

Crystal structure of human akt2 in complex with gsk690693
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
335
structure length
322
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITIPPDQRTHFPQFDYSASIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase inhibitor
molecule keywords RAC-beta serine/threonine-protein kinase
publication title Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 322
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d0eA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d0eA01
5LQFA 4X2NA 3W2CA 2WMTA 3HA8A 4U45A 5I4NA 3LFBA 4BYJA 2X4ZA 3QZHA 2QKWB 4DF3A 2SRCA 4PTGA 1MRVA 4KBAA 4RWLA 5G6VA 4X3FC 2GHLA 3C5UA 4S34A 2VWYA 4ZMEA 3QCXA 3VVHA 5CVGA 5TO8A 3V3VA 3AOXA 4QMNA 3IKAA 3UYTA 4TT7A 3DQWA 5BVOA 5EKOA 3ZUUA 3I6UA 3KN6A 4IX6A 3RZBA 3UTOA 4EUTA 2XIRA 4KIOA 1NY3A 5C8KA 1J1BA 2XNMA 4RC3A 5D7AA 4W8EA 2R7BA 5HD7A 4K1BA 3VNTA 4N6ZA 4U44A 3MB6A 4ZTHA 4GUEA 4FKWA 2YERA 1ZYCA 5DNRA 2W4JA 4MKCA 4MF0A 1DAWA 1CTPE 4H3QA 2E9NA 2P4IA 2UW6A 4LOQA 3G2FA 1FOTA 2VTPA 4N6YA 3P5KA 4E93A 4UBAA 1F5QA 2QVSE 3NW7A 3TV6A 3BLQA 5D9HA 1XQZA 4ANOA 1Q61A 1Q8TA 3W33A 4FT5A 4X7QA 3CIKA 4XCUA 1LEWA 5CVFA 3H9OA 4AAAA 5D10A 4AU8A 4P5QA 3ZO1A 2JIVA 4NW6A 4CNHA 4JLCA 2HYYA 5I0BA 3RINA 1K9AA 2I40A 4A06A 4CT2A 3KULA 4BTJA 4JVGA 2W5HA 3WF6A 2ITQA 4J96A 1W83A 3FMHA 4IM3A 4FTMA 5IQHA 1IG1A 1YI4A 3M1SA 3I81A 4OW8A 2QOFA 2R3GA 4L45A 4BHNA 2IW9A 2CNQA 2KTYA 2ACXA 5J95A 3ANRA 4FBXA 1H26A 1M17A 4U43A 1XKKA 5EHLA 5EYKA 3UO4A 5HLWA 4AACA 3ORKA 4C02A 5HTIA 2QOCA 4IFCA 3NAYA 2YIYA 4ZTQA 4PDSA 4ZLYA 3U9NA 4DCAA 1DAYA 2ZM1A 4AA4A 5A4LA 2BRHA 2J0KA 5HLPA 3OW4A 3QTXA 4TTHB 4FMQA 2ZJWA 3F3WA 4MXXA 4QMZA 4U0IA 4FKVA 1UNHA 4PY1A 3MJ2A 4MYGA 4IW0A 2ETMA 3R8ZA 1LP4A 4E5WA 1I44A 3HMNA 4GK4A 5HU3A 3KMWA 3WE4A 4AOJA 2BAKA 2YIXA 4I4EA 1YKRA 3F5PA 3I5ZA 4X2KA 4IAFA 3EKKA 5EDPA 4FEXA 2QLQA 3BPRA 4WG4A 4CV9A 5DMZA 4FSRA 1ZYLA 3RMFA 4GFGA 4PF4A 2RFEA 3G5DA 3H30A 3JVSA 4F7LA 2OU7A 1GIHA 3EYHA 3F5GA 3PG3A 3R21A 3DLZA 3ENMA 3PXFA 3EL8A 1MQBA 3MH1A 4KIKA 1IASA 2PZIA 1M52A 3E87A 1H1QA 4PPBA 5IA3A 2C4GA 4GU9A 3KK9A 4I6BA 1GY3A 4OGRA 1MQ4A 4G3GA 4HGEA 3WBLA 2XCKA 4ZLZA 2B9FA 3AMBA 2JBOA 2RF9A 1NW1A 3FQHA 5KMNA 3IW4A 3F3UA 3MVLA 4BDDA 3FYKX 3A7GA 1YXUA 3EZVA 4PMTA 5EI2A 2GHMA 4JX7A 5A4TA 4O1PA 2C6IA 4J97A 4ORKA 1J91A 5L8JA 3TV7A 4M84A 3TNIA 3G51A 2J5EA 4CKJA 4BY9E 3R1SA 4FTQA 4XG8A 4BDBA 3OG7A 5IA1A 1Q8WA 3QTWA 3OC1A 4C59A 4H39A 3ERKA 3RCJA 3LQ3A 3G0EA 4I6QA 3KXNA 4NIFA 3FMNA 3SRVB 3MY5A 2IW8A 4XP0A 4YZNA 4WHZA 4ACMA 5M06A 5FXRA 2R3MA 3H9RA 2XNPA 4RIYB 2ZV9A 1UU9A 5AJQA 5FWKK 3TIZA 4RZVA 4NW5A 3EHAA 4YO4A 3LFEA 2VTTA 4FKJA 3CBLA 1OZ1A 3LCKA 3UODA 4PTEA 3PVWA 3MN3A 4RVMA 3MWUA 4TRLA 2YJRA 3FJQE 4MXAA 5DN3A 5HBEA 4D58A 4AFJA 2X0GA 3BV2A 3LFAA 4QMPA 3A7JA 3OCTA 3TL8A 4D0XA 3QTRA 1FVTA 2VX0A 4RFZA 4NZWB 3HP5A 3POZA 2P2IA 3VUDA 3GENA 4DFZE 4QMUA 5CANA 4DT8A 3O96A 5GNKA 4MNEB 5E8XA 4L3JA 3PXYA 3SXFA 4MVFA 1OMWA 4IVCA 1WMKA 4N70A 4RGJA 5BYYA 2EXEA 4FL1A 3QTQA 3BWFA 4ASXA 4QMMA 2X8IA 4L01A 3RAWA 4QMTA 4CZTA 2BRGA 2X39A 3SD0A 5HX6A 5JZNA 1FVRA 3ZDUA 5JSMA 5HO7A 4MWIA 3CXWA 2CGWA 3MBLA 3MB7A 1REJA 1OIRA 2QHMA 3MI9A 4YJNA 3TJCA 4DH7A 5HNIX 5LMKC 2Z2WA 4I93A 5EW3A 5FBOA 2GFCA 1AD5A 3IS5A 4IWPA 2ZYBA 4U80A 5IA2A 3HV4A 3FHRA 4WNPA 3VRYA 1AQ1A 3PZEA 4BFMA 4EHZA 4NCTA 3BE2A 3REPA 5IF1A 2FSOX 4IZYA 2B0QA 4QQJA 2V55A 5CF6A 4DEGA 3RPRA 5IQGA 5FM2A 2C1BA 2IZUA 1PW2A 2UZWE 1YWRA 3KF4A 5CF8A 1HCKA 3IQ7A 3Q4UA 2W7XA 1UNGA 1XO2B 3A7HA 3FWQA 4EZ7A 2AC3A 4HCTA 4LUDA 1IA8A 3Q96A 5AIRA 1Q3WA 4FIIA 5D12A 3QRJA 3ETAA 4XLVA 5A4EA 2LAVA 1V1KA 4KIQA 5KHXA 3ZYAA 4G1WA 1JOWB 2RFNA 3C4EA 5LWNA 3RALA 5AADA 2VWVA 2WEIA 4XG4A 4RX7A 3NLBA 3Q04A 4XH6A 2F7EE 3DNDA 3SV0A 1IAJA 2XIXA 4JBPA 2JKOA 3F2NA 3GC0A 5JKGA 2PMLX 1FPUA 5ACKA 4R8QA 4NYEA 2Y7JA 3ZH8A 4OTPA 4O7WA 2HZ4A 3QD2B 3W32A 3WZUA 4IJ9A 3ODZX 3CCNA 3QCQA 4WSYA 5H8BA 4E4LA 1YW2A 2ZMCA 5DFPA 4M68A 2QR7A 1OKWA 1IR3A 5FGKA 3THBA 2PSQA 4TWOA 2R7IA 1LR4A 2VTSA 3DB8A 2J5FA 1XWSA 3F3TA 3GCUA 4XLIA 5BPYA 4PMMA 4AX8A 4A4XA 3E64A 4JNWA 3Q5ZA 3QWKA 3TWJA 4OLIA 2VU3A 3NSZA 4FT0A 2QOKA 4DTBA 2UZDA 1SZMA 2XZSA 2OXXA 2PU8A 2WEVA 1ZY4A 5IQBA 5DLSA 4O22A 4BF2A 5HBHA 3DTWA 3QWJA 4FKGA 4I0RA 3ZRMA 5KMKA 2IZRA 4QMQA 1PMUA 2BZKB 5A9UA 5CAQA 2GNGA 4PNKA 3FAAA 1UU8A 4M13A 4FL3A 4ANSA 4BCMA 2I0VA 2FYSA 4Y72A 2ZDUA 4B8LA 5AIKA 4NK9A 4K18A 1KE5A 1URCA 1CKJA 3PRIA 3RTPA 4CQGA 3Q32A 2G01A 4LM5A 3SQQA 4O0UA 4DHFA 1ZY5A 3WF5A 3DBEA 2A1AB 4BB4A 4WA9A 3BHYA 5AWMA 3DOGA 1G8AA 4IZAA 3U4WA 3GU5A 4P4CA 3U51A 1B38A 3WF7A 4JDJA 3VS5A 2JDRA 4FZDB 5HVYA 4EHVA 2OWBA 2C1AA 3D7ZA 5HCYA 1WBTA 5JK3A 3PXKA 4RFMA 4GUBA 3Q4TA 1KV2A 3SAYA 3BEGA 3VUTA 4ZXTA 3E8EA 4QT1A 4GL9A 5BVWA 5TE0A 1WBVA 2WTCA 5CVHA 2OXYA 4Z55A 3RNIA 2YAAA 3AD4A 4FKOA 3KMUA 3MTLA 4JAJA 3M2WA 2QKRA 5I9YA 3ZC6A 3HKOA 3RWPA 2JKMA 3PXQA 4PWNA 4S31A 3D5VA 4EOSA 4QTBA 2A4LA 3T3VA 5EQPA 5IZFA 2GS2A 3IGOA 4LFIA 4N4SA 2E9OA 5I3RA 3OUKA 3R8MA 5F20A 4C3FA 5DYJA 3E3PA 3MVMA 4RVKA 3VUMA 3JS2A 1KOAA 4XV2A 2WIHA 1V0OA 5A6NA 4GKIA 1J7UA 3C1XA 2W5BA 4OTIA 4PDOA 1ERKA 4EEVA 4ERWA 3F9NA 5FEDA 1NVQA 4PNIA 5ANKA 4DE4A 5L2SA 2XNNA 2YDJA 3BE9A 5E1EA 2XH5A 2FSTX 2OK1A 4KKGA 4O91A 2VWZA 3FKLA 3GU7A 3ULZA 3KN5A 4X2FA 5CYIA 3UQCA 3FKOA 3UPXA 2E2BA 4IWOA 3ZEPA 2WIPA 2YZAA 3D15A 1BLXA 3HX4A 5H8EA 4UMUA 3V8SA 2VNYA 5A3XA 1XBAA 2PZRA 3DXPA 2OSCA 3V6RA 4E6CA 4KIPA 3MS9A 1Q3DA 3BEAA 3FI4A 4GYGA 3OW3A 5CXHA 3UQFA 4IAYA 4WOVA 3SRVA 1H8FA 5C4LA 2J2IB 2IVUA 5HE0A 3FC2A 5E1SA 5D7VA 1WBSA 2P0CA 2XEZA 3VAPA 2RSVA 4RIYA 2WTWA 3QA0A 5AP3A 3TN8A 2B4SB 1PXKA 2VWBA 1H25A 2VO3A 3JYAA 4IFGA 4NJDA 3R8PA 1M2PA 2Y8OA 4RIOA 3P1AA 4BN1A 1YHSA 3CJGA 4EWQA 3O0GA 4QYGA 1Y91A 5AM6A 5AM7A 4BVUA 4ZJIA 3C4ZA 1ATPE 4FSQA 5BUEA 5I9VA 1FGIA 3QQKA 3ORNA 1OM1A 2XS0A 3QRUA 3PY3A 1OPJA 5DT4A 2Y4PA 4YZ9A 3ZTXA 3F6XA 2PVFA 3POOA 3FLNC 1YI6A 2XRUA 4MNEA 4NL0A 3UQGA 2I6LA 4BCJA 1YQJA 1R39A 2OG8A 4JQ8A 4E20A 4MQ1A 1M14A 3P7BA 5A46A 3ANQA 5JMSA 1IRKA 3KMMA 1CMKE 4D5KA 2VTMA 2JDSA 2JBPA 3I7BA 4TNDA 5JFXA 3KXHA 5AR5A 2DYLA 5IMEA 4I3ZA 1UWJA 3LCSA 3B8RA 4FT7A 3RK5A 4CKIA 3UPZA 1K3AA 4PDYA 5TKDA 3UIMA 1HCLA 3IG7A 1XR1A 1Z9XA 4F7NA 4ZS0A 3MPMA 5CEOA 4WUNA 2R3PA 2XRWA 3C4WA 4FG9A 4FEQA 3Q2MA 4JJRA 2O64A 3ALOA 3DAJA 3DB6A 3EMGA 3W1FA 3HV7A 4ARKA 2WKMA 3PY1A 4O2PA 3Q60A 4AZWA 4FTJA 1KWPA 3NNVA 2OF2A 4X6QC 3D5UA 3MH2A 3QCYA 2LGCA 3R73A 4Q2AA 3UO6A 4V05A 3M42A 3IDCA 4IB0A 5HO8A 4HGTA 4NKSA 4M3QA 5FDXA 3QLFA 2A19B 3PA4A 3KXMA 3D9VA 3FSFA 2W5AA 1PMNA 3PJ3A 4UXLA 1JSVA 2BZIB 1WBPA 2EU9A 2XA4A 3EB0A 3Q5IA 3GFEA 5CAOA 4ASZA 5AA8A 2W17A 2WOTA 3N51A 4X3FB 4O7NA 1GZ8A 1XH4A 2EWAA 3L8VA 4NM3A 4WIHA 4ALVA 2F4JA 3RM6A 3OTUA 3VUHA 1FMOE 3T9IA 4FTTA 3AGMA 4BWXA 3BYSA 2UW0A 5C9CA 3QZFA 3FBVA 5T68A 4ALWA 4UWCA 2BDJA 2CGUA 3P23A 5JFVA 1SNXA 2HXQA 4AZFA 4BBMA 3MPTA 3JXWA 4WO5A 5BVDA 4RX5A 4CGAA 3AC4A 3KRRA 1B39A 3OOMA 4RWJA 3K5UA 4FIHA 2IJMA 4A9UA 2AC5A 2ITPA 4F0IA 4D4SA 3GFWA 2YACA 5LVNA 3CEKA 4RMZA 2W9FB 4Y95A 1CSNA 5AP6A 5E8SA 3UO5A 2R3HA 4H1MA 2VV9A 4RJ3A 3TZMA 3QX2A 1J7IA 2BHEA 2YLEA 4U9AA 4EORA 2W1HA 4CYJA 1W82A 3BX5A 4ANNA 2VWIA 3PPKA 2W06A 2PK9A 3AC2A 3LOKA 3VUKA 1YHWA 1PRYA 2HY0A 2UW3A 3MIAA 4ZP5A 2YCFA 3FI2A 4D9TA 4DBNA 3FXZA 5HG8A 4J8NA 5F4NA 3EFWA 2I0EA 1SVEA 5CSHA 2CKPA 3UNJA 5HE2A 5J7BA 1A06A 2C6MA 4XHKB 3TZ7A 5JGDA 2Y0AA 3BGPA 4FSUA 5M53A 1PMVA 4CCUA 3LFDA 4O21A 4RRVA 2ONLA 3QU0A 5TR6A 3D83A 2Y9QA 5AUVA 4L46A 3SG8A 3EN9A 2DUVA 2GTMA 5EYDA 4UMTA 3K3IA 1MUOA 1VYWA 3NUPA 4I6FA 2AUHA 2C5OA 4IADA 5CAPA 3FZPA 4AZSA 3KCKA 3KEXA 2VTRA 4QP3A 5AA9A 4HW7A 1AGWA 3ZU7A 2NO3A 5FP6A 3BBTB 2FO0A 5JZJA 3WYXA 4FK6A 2VTAA 4GIIA 4JDKA 4CZUA 5IPJA 1ZLTA 2J0MB 3V8WA 3QFVA 3B2TA 2Z7RA 4RG0A 1QPEA 4F0GA 4GT3A 3O50A 3F69A 3W8LA 4EK6A 3O71A 3NEWA 3UNKA 3BYUA 3COKA 2VTHA 4EC8A 3LXPA 4LMNA 2BZHB 2BIYA 3BGQA 3RK7A 5CASA 1PF8A 3QKLA 3D7TB 4IXPA 4B0GA 4CMTA 3BYVA 4ZOGA 3ZFYA 3Q9WA 5IG1A 5AUXA 1IA9A 4ZJJA 4P7EA 1PY5A 3AQVA 3OEFX 2W1GA 1H27A 3WF8A 4EQUA 2O0UA 3QTZA 2BFXA 2DWBA 3OTVA 4BYIA 3KREA 4ZZMA 5CQUA 4RX8A 3G15A 3ALNA 4H58A 3WILA 4EQCA 3NDMA 2ITZA 1OKZA 4QPMA 4KNBA 4K8AA 3RM7A 3O23A 4AS0A 3OCSA 2NRYA 4BCFA 3MA3A 4F9WA 2ETRA 4GYIA 3VHEA 3PPJA 4F9YA 5I9WA 3D0EA 4NEUA 4UV0A 3CQUA 5ANIA 2GU8A 4EOQA 3VQHA 3DS6A 4R78A 5B0XA 3V5PA 4YNEA 4XEYA 2X9EA 1OPLA 2QU6A 4GVAA 3FMLA 1GAGA 4GH2A 4TY1A 4YJUA 4D4VA 2GSFA 2QC6A 1OUYA 3SW7A 2GNJA 3OWJA 1PMEA 1DS5A 3HEGA 5EQYA 4AZTA 3S1HA 3C13A 2HWOA 2VX1A 5DR2A 3KU2A 2BILB 3O2MA 3QD4A 5CF4A 5JQ8A 3EQHA 3W2QA 3UC3A 3ZM4A 4EZ5A 1ZAOA 5HO6A 4CRSA 3C5IA 3ITZA 4JL9A 5AP1A 5LARA 3NPCA 4Y73A 4BCGA 5EOBA 4X21A 3UZTA 4NM7A 3DJ6A 1OKVA 3FMMA 3KA0A 1GNGA 1REKA 4RJ7A 3K3JA 5L8KA 3P9JA 5CWZA 4QOXA 4JIAA 4FG7A 4M7IA 5IEYA 4QMXA 1Q24A 2RFSA 3V6SA 5JRQA 1GZNA 2YM5A 1ND4A 4CFXA 4AUAA 4FKIA 2E9VA 3OWPA 4G3CA 3BLRA 3MYGA 4C35A 2G2IA 5DRBA 1P14A 4CT1A 4GT5A 2R3QA 3JY0A 4O0WA 5CEPA 3BI6A 4QP4A 5E4HA 1WFCA 1BX6A 3P78A 5HEZA 3UOLA 3EFJA 4FODA 4EWHA 2YCRA 3B2WA 3OP5A 3NMUF 3DK6A 4M15A 4F9CA 3HMMA 2R0IA 3FL4A 4KD1A 1Q4LA 2YIRA 3UGCA 1OIYA 5DEWA 3EQIA 5BVEA 5AR4A 4AQCA 3R02A 4U97A 3GOKA 2PTKA 4ZZNA 2HZIA 4RQKA 3QYWA 4FOCA 4RWIA 4NM5A 3FI3A 3ZO4A 3COHA 4BHZA 3UG2A 2ITXA 2QR8A 4D5HA 3BU6A 3LAUA 4E6QA 2EXCX 2JDVA 5FXSA 5KZIA 4R5SA 4CMOA 2I7QA 2OJIA 5DOSA 1VJYA 4YJQA 4PMPA 5GINE 3JUHA 1P4FA 4H3BA 5LVMA 4FTCA 3TACA 2CKQA 5KBRA 3NRMA 2XNBA 3GT8A 4RPVA 2CGXA 2ITWA 2ZVAA 3AC1A 4MH7A 3P4KA 5EM6A 1APME 4EK8A 3H0YA 3HYHA 3VWAA 4CXAA 1P5EA 3QKKA 4Z9LA 1QPDA 1WCCA 2XKDA 5CT7A 3I0QA 4X3FA 4EL9A 3UC4A 5EQEA 2WQBA 4QMVA 1YOMA 3HRBA 4FE2A 2CNUA 3QRIA 2ITNA 3B8QA 4U7ZA 5F95A 4AT5A 3CKWA 4AGCA 5DWRA 5KX8A 4D1SA 2CSNA 4EUUA 3CD3A 2VAGA 3CD8A 4KINA 5C27A 2BALA 3MVHA 3ODYX 2OH0E 3BHVA 4FA2A 1XBCA 3IDBA 3U54A 2WB8A 2ZB1A 4M12A 3VS2A 3MW1A 4AXAA 4EH3A 5BNJA 5E8VA 3ZBFA 1G5SA 3A61A 3R9OA 3ZZWA 2RKUA 3ORTA 4IB3A 4J7BA 3SC1A 1ZYDA 4CFMA 2BZJA 4ZJVA 4L9IA 2QO7A 4WRGA 3U55A 2PVLA 2R0UA 2R9SA 1OL1A 5L6OA 5BVFA 3IGGA 3DPKA 4C62A 1ZARA 3ENHA 2GTNA 5CS6A 5AP7A 4AN3A 4AT4A 4UMRA 4HYSA 4BGQA 4BTMA 4A9TA 5K9IA 4UY9A 4F1OA 2G9XA 2EVAA 1Y8GA 2B52A 4O2ZA 5DG5A 4M8TA 3ZDIA 4ERKA 5AUZA 3I79A 2XK3A 4HGSA 4OBOA 4YO6A 4DINA 4BDEA 4JXFA 3SW4A 4YJPA 4Y5QA 3PSBA 5IH6A 2YM6A 1XBBA 1OECA 1OL2A 4TWNA 3UVQA 2HENA 3G33A 2IVVA 4TPTA 3HNGA 2B54A 4GEOA 1XJDA 4FUYA 4CCBA 4FV6A 4IB1A 2R3JA 1E9HA 5L2QA 4GIHA 5KKRC 3VO3A 4OAUC 2UZLA 3CSVA 2VTJA 3AD5A 3CC6A 4GFOA 4BGGA 2GPHA 3TTIA 4R1VA 4IM0A 2YEXA 2FUMA 2WQOA 1OL5A 1UKIA 3V5LA 4QP7A 4KUJA 3DTCA 3OY3A 4IAZA 1Q97A 3IPHA 4G9RA 4PL3A 3DBCA 5E8ZA 1OBDA 5LVPA 4CTBA 5JH6A 5DGZA 4ITHA 1O6KA 1PHKA 2QODA 3AT4A 3MFTA 5HIBA 5E7RA 3Q9ZA 3QRTA 4PPAA 3A8XA 4ZTRA 4DYMA 1Q8YA 2OIBA 3TCPA 4L6QA 4G9CA 3GC9A 4M69B 4OUCA 3TI1A 3VJOA 5IU2A 2B9IA 1ZMUA 3D7TA 1ZMWA 3VS4A 4EQMA 4G17A 5ACBC 5J9ZA 5LOHA 1UU7A 3I5NA 3PDTA 4L67A 4YZDA 1A9UA 4O7LA 4LL0A 1R78A 3W16A 4II5A 3TT0A 4Z7HA 4KB8A 1TQPA 2UZBA 4ZEGA 3Q9YA 4G31A 2WMBA 4FT9A 2QOIA 4MHAA 2B55A 1H1WA 2WMXA 5CT0A 1Q41A 4CFFA 2PZPA 3EOCA 4IAIA 1SMHA 2PUUA 4FC0A 5JQ5A 5K4IA 3U8WA 1RE8A 3E88A 3NIZA 4M14A 4C34A 1LEZA 3KK8A 2CLQA 5FUTA 2G2FA 4AT3A 1BI8A 4E1ZA 5HIDA 4UMPA 3RAKA 3V5JA 3TNQB 1TQMA 3HRFA 4FV0A 4I23A 3L9MA 3R7UA 4G3EA 2EB3A 2Z02A 3HECA 2HAKA 4FTIA 5TT7A 3PIZA 4F7SA 4BL1A 5J5SA 3BCEA 1QPCA 3HV6A 4XBRA 4Y46A 5A54A 3U87A 4U5JA 3OT8A 5K5NA 3RKBA 1JPAA 4O6LA 2HY81 3L1SA 2BR1A 3PRFA 5EM7A 2YHVA 4FEWA 2XNOA 4IC7A 4F4PA 5HG7A 3ZM9A 1H1SA 4X6RA 2W9ZB 3ORZA 5DVRA 1SVGA 3GEQA 5C4KA 3I4BA 3ZLYA 4BCIA 4DEHA 5HORA 1YOLA 5K0KA 4BDKA 1Z57A 2AYPA 2OO8X 4DFXE 3PE1A 1WVYA 4E5AX 3CGFA 4CFWA 3TNHA 5JGBA 2W0JA 4F99A 4QTCA 4Q9ZA 4O1OA 5KMLA 4E8AA 4FSYA 3FXWA 4H36A 1PXPA 2XYNA 1OPKA 2FSMX 4PRJA 5AFVA 2QLUA 4WG3A 3NCZA 4QTAA 3A4OX 3RJCA 2OKRA 4YLLA 5HE3A 1YRPA 5IDNA 5AV4A 1O6LA 4QP8A 1ZRZA 4EHGA 2JIIA 2Q0BA 3AG9A 3FZRA 1O6YA 4YLKA 4BDJA 3W8QA 2XYUA 4M67A 1S9IA 4XG2A 4DGOA 3PP1A 4AF3A 2R3KA 2IW6A 2W96B 3MY0A 4L68A 3WZDA 4PL4A 2JAVA 4BCHA 3JVRA 4O96A 4PDPA 3NUNA 4EOKA 3KRXA 4YHJA 3FEGA 1X8BA 2CN8A 3ZS5A 1U4DA 2WMQA 3ZO2A 4FZ6A 4LL5A 1SYKA 4Q5EA 4GK2A 1NT2A 2YWPA 2F2UA 2B9HA 3GC8A 3HP2A 4FZAB 5JN2A 2WQNA 5DIAA 2DQ7X 2YAKA 2C3IB 4ITIA 4RIXB 3HZTA 5LMKA 3HGKA 1KOBA 5FDPA 4IH8A 4OTGA 4NU1A 2ITUA 3QLGA 4EBWA 4NM0A 4O0SA 4BKZA 4XG3A 2ZV7A 3ACJA 4EOJA 1XH6A 3DDPA 2FH9A 4WNMA 4DN5A 4E26A 3BHTA 3NYOA 4PPCA 4LI5A 4BI2A 3CE3A 4XRJA 4M0YA 3ZC5A 4D2VA 3C4FA 5CX9A 5CU0A 3DBDA 5BVKA 3COMA 1UKHA 2C5VA 3EQFA 3NX8A 5HVJA 5HTCA 3DXQA 4WT6A 3UE4A 5KBQA 1RJBA 2W99B 4H3PA 4I94A 4GMYA 3KC3A 4USFA 4HYIA 3LFSA 4IANA 2V7AA 4A4OA 2OLCA 5DRDA 5HZNA 4FOBA 1GJOA 1MRYA 3ZFXA 4QQ5A 2Q0NA 5EG3A 3ZEWA 4QNAA 2VTOA 5L2TA 3C4XA 3ZFMA 4RSSA 5HX8A 4PUZA 4FICA 3UIBA 3ROYA 4MEDA 1ZOEA 4K11A 5B2KA 3WIKA 4FKPA 3BRBA 1ZWSA 5M07A 5BMSA 1XHAA 5IQDA 5CXZA 2FSLX 4FTLA 4K2RA 3NNUA 4NWMA 5EHYA 3SOCA 5KHWA 4XV9A 3UOJA 2OF4A 2H9VA 4ALUA 5HE1A 2WGJA 5BQ0A 2XJ1A 4O0YA 3G9NA 3RPOA 4TL0A 4I0SA 3FKNA 3KY2A 4FF8A 2PUNA 3R1YA 3PVBA 2WZJA 3BV3A 4LQMA 4KBKA 3FPQA 3RPVA 2OW3A 4ZSAA 4O7YA 5JFSA 1JQHA 3LPBA 4MXOA 1Q62A 2O3PA 2RG5A 3AT3A 3QQFA 4PX6A 4BCPA 3MVJA 5HGIA 4FKRA 2W1ZA 3FMKA 4FT3A 3TXOA 3GCVA 3W2RA 4AA5A 2C3KA 5M57A 4DFLA 2KULA 4UWYA 3GGFA 2UVZA 1YXTA 3RI1A 4DG0E 4L3LA 3T9TA 4FSZA 4F64A 2R4BA 5AP0A 4KABA 4FV1A 3PA5A 3QZGA 2C47A 3LCDA 3TTJA 5CNOA 4FV4A 4J95A 5DT3A 4ZTLA 3PA3A 4BWKA 4FTNA 3PJ8A 2CMWA 5GZAA 3QRKA 2YJSA 4FTRA 2C6EA 3IK3A 5AR7A 4E6DA 4QMWA 4IJPA 4K33A 3Q2JA 4QRCA 3H4JA 5IDPA 3TDVA 4MXZA 3QQLA 4RVLA 5GJFA 5CEQA 4FNWA 4V01A 3R2BA 4DH5A 3LXKA 2UW7A 1JVPP 3UP2A 3BYOA 3AGLA 2BVAA 2PMOX 3GQIA 4UZHA 1FMKA 2F7XE 3EWHA 4FTAA 4HVSA 2VN9A 5CF5A 2YWVA 2C5YA 3CKXA 3NW5A 3QGWA 3NVKI 5AEPA 2X81A 4XYFA 4EYJA 2BKKA 3K54A 4YJOA 2OJ9A 1Q99A 4EKKA 1SVHA 3D5WA 3F2AA 4IBMA 1IAHA 4CRLA 3LW0A 2WXVA 3MJ1A 2C0IA 3LFCA 4IWDA 4O7TA 4DGGA 3WARA 4M0ZA 3R1QA 2XCHA 2I1MA 4BBEA 1OB3A 4ENXA 2IWIA 2YN8A 3KXZA 4GFMA 5EW8A 3TKUA 5EKNA 2XF0A 4M69A 3Q6UA 3SOAA 4Y5HA 3CQEA 4QTDA 3EFKA 4JG8A 1WBOA 4OTRA 4R3RA 5EFQA 3FV8A 3NYXA 3R63A 4ANMA 4DEDA 5BMMA 2W4KA 2HZ0A 3UOKA 4CFNA 3LJ0A 2UW4A 1KUTA 3R2YA 2YFXA 3E8CA 3WI6A 3LFFA 1BKXA 4MCVA 4BI1A 5FM3A 2EB2A 2A2AA 3PVGA 4JIKA 4C4JA 4KKEA 4CTCA 1L8TA 4BR3A 2OJFE 3O51A 1CDKA 4LV5A 2GNHA 4ANQA 4DG2E 2ITTA 4R3CA 1GIIA 3ELJA 4YHFA 5EYCA 4NKAA 2BMCA 5JEBA 1O9UA 5DT0A 2FB8A 2PUPA 2CHLA 3F7WA 2PWLA 2UW9A 2X1NA 3FLQA 3KB7A 3MH0A 2JD5A 3JR1A 3KVXA 2H96A 2Z7QA 3AC8A 3ORXA 4OTWA 4QPSA 2VTQA 2XBAA 3PJ1A 4MX9A 4QMSA 5FD2A 3VC4A 2YABA 3VS7A 4HZSA 3LQ8A 3BWJA 3QQHA 1UV5A 2VNWA 2GQSA 2PL0A 3ORIA 4JS8A 3VS0A 1ZYSA 2PE1A 4GRBA 2BIKB 1VR2A 4QYEA 5BYZA 3RPYA 4KRDA 4EK4A 1KE7A 3P08A 4S2ZA 2QHNA 4A9RA 2W1IA 3NNXA 4A4LA 3KFAA 4XG9A 3W2OA 3TEIA 2ESMA 3BLHA 5AAGA 2CDZA 4EJNA 4OTQA 4G16A 4BIBA 4HVGA 4EH4A 3OROA 3SX9A 4FEVA 4EOOA 4I5PA 3BBWA 3P86A 3R7YA 5HU9A 5B7VA 3NWWA 5J9YA 3E7OA 4FK3A 4O27B 4IAAA 2R3FA 3ZXZA 4F7JA 5KZ0A 2H6DA 3A7FA 4DG3E 3VBQA 2V5QA 1TKIA 4DBXA 1YWNA 3GUBA 2X4FA 3IOKA 4OBQA 2Y6OA 4CLJA 4APCA 1XH9A 1SM2A 2XMYA 3I60A 5AX9A 5LWMA 2CGVA 2UV2A 3O8TA 2QONA 2XB7A 2JLDA 3FLWA 2F57A 3MFSA 4D0WA 5CENA 2GS6A 4FV7A 3R8VA 4O7SA 1PXIA 1JSUA 4DH8A 4DC2A 4RJ6A 3QF9A 4F08A 4I20A 3FE3A 5CU2A 2ZDTA 4E3CA 5LVLA 3FMJA 3MSSA 3P0MA 4RC2A 4RIXA 1U59A 4BZDA 1STCE 3R9RA 1JBPE 4IHPA 2GCDA 4O7RA 4D2PA 3E62A 1G8SA 4KKHA 3WYYA 2HWPA 4TYGA 4XOYA 4YSMA 3FLZA 5KMIA 3VF8A 1VZOA 3IO7A 3GXLA 5DA3A 3QBNA 2OFVA 2VTNA 5IA0A 4O0XA 1T46A 2PYWA 2QO9A 3KRJA 3W18A 5H2UA 5E8UA 1W8CA 4CZYB 1H00A 3LJ1A 4XP3A 3NUAA 4XMOA 2XIZA 4C4HA 4F65A 4O83A 3CLYA 3VBVA 3V5QA 4JR3A 3EIDA 1CM8A 3GU4A 1F0QA 2B9JA 2C5NA 3C7QA 5M4IA 3N4VA 3ZSIA 2WTIA 4DFYA 2VWWA 4WRSA 1E1XA 4P5ZA 3KVWA 4IWQA 1VEBA 3PLSA 4OTHA 3U9CA 2V62A 2VTLA 2XKEA 2UZUE 5B2MA 2Z7LA 3BHHA 2WMWA 4C38A 3CY2A 5J5TA 3DGKA 3R1NA 4XBUA 1A48A 5KO1A 4DGLC 2FGIA 4USDA 3UMXA 4B8MA 5LMAA 5C26A 4JDIA 4BDGA 4EC9A 5I9UA 1MP8A 5M56A 3DBQA 2PZYA 2HIWA 3DK7A 3QUDA 5DPVA 4O81A 3ORLA 4AOTA 3L8SA 5KE0A 5CALA 3QC4A 3S3IA 2QOBA 4QYFA 2PVMA 1PXNA 3RNYA 4HNIA 3KRLA 4QD6A 4JDHA 5D41A 5T3QA 4WSQA 3BQRA 3GQLA 4BBFA 4WNKA 4N57A 3MGYA 4RT7A 3OFMA 3TDWA 1PXOA 1YDRE 2UZOA 2ERZE 2WU6A 5E90A 3I1AA 5LCKA 5CNNA 4D2SA 3EQDA 3OS3A 2C6TA 4IX4A 5AR2A 1JKLA 3F66A 3PPZA 4S32A 4ACCA 4PTCA 1YHVA 5FLFA 1OIUA 4QMLA 2GQRA 3TM0A 2EUFB 2BRBA 2PMNX 2WPAA 5GJGA 3LQ5A 3HDNA 4C4EA 3R6XA 1M7QA 2UZNA 4RVTA 4GT4A 4FSWA 5E91A 3PXRA 4F9AA 4JOAA 2PMIA 3VS1A 4BKYA 2R3NA 3OD6X 3V5TA 3PYYA 5J1VA 3MTFA 3IW5A 4JQ7A 4U6RA 5KKRB 3KRWA 2O5KA 4J52A 1XH8A 2G2HA 5AUYA 5IQCA 2BTSA 4A7CA 3A60A 4FIEA 3KKVA 4Q9SA 3O7LD 4JR7A 3AMYA 3KF7A 4YPSA 4YHTA 2XVDA 3DQXA 3R22A 5CEIA 4ZAUA 5J1WA 3TUCA 3P79A 2JC6A 2XK8A 4QTEA 4IEBA 1J7LA 5CU4A 2J0IA 4QP2A 5FEQA 5F1ZA 2P55A 3LZBA 3CGOA 2PY3A 2UW8A 3A62A 3G90X 3D4QA 4RJ4A 3E8DA 5LJJA 3EZRA 3QCSA 4FIJA 5BUIA 1GZOA 4O7VA 3PE2A 2R3OA 3FYJX 4A9YA 4BICA 2OI4X 2WMVA 2QO2A 2IG7A 3R7IA 1GIJA 4FV8A 4KA3A 3FMDA 4AOIA 1UVRA 3DZQA 4NJ3A 4O0VA 4P90A 2YM4A 3SDJA 4AW0A 2QOLA 1PXMA 3LM5A 1PKDA 4BWPA 1R1WA 1DM2A 4RJ5A 4UZDA 1YXVA 2HELA 4QQCA 1R0EA 3QZIA 4YGAA 4AN2A 5M4CA 5ETCA 3C51A 3FL5A 3FQSA 3VUIA 3R9DA 4DLIA 3RVGA 4C2VA 4NSTA 4DEEA 2BHHA 3CPBA 2Y4IC 2QOQA 2C5XA 4HJOA 4QMYA 3HLLA 2XNGA 4YZMA 4EOLA 5CSXA 3HVCA 2WMAA 3ZBXA 5HTBA 4DT9A 3GNIB 5HCZA 5E92A 4RBLA 3ZCLA 5HKMA 3SG9A 4ZZOA 1P2AA 2BAQA 2R5TA 4A07A 2QQ7A 4AE6A 5J9LA 2YZLA 1CKPA 5HIEA 3CTQA 3P7CA 4FV3A 3BGZA 3EJ1A 3F5XA 1F3MC 3H9FA 3PJ2A 4KBCA 3LJ2A 3W55A 5K5XA 5KNJA 4S33A 2WD1A 4JG6A 3MDYA 4RZWA 2B53A 3HAVA 1QMZA 2F2CB 3EN6A 3DZOA 2X6DA 3ZLSA 1BMKA 1OGUA 2YITA 3OXIA 3FZSA 3R71A 4B6LA 3V04A 2HW7A 4AW5A 3UMWA 3PP0A 2PVJA 3ET7A 3QHRA 2C30A 4BIEA 4PV0A 3RBWA 5A6OA 1NVRA 3AXWA 3C0GA 2OXDA 5BX0A 2QU5A 2R2PA 5EI6A 4BTFA 2X2LA 1W7HA 5E8YA 4AE9A 3GU6A 3R7EA 2X2KA 1NVSA 3D2IA 2C6DA 3FXXA 5AR8A 3HRCA 4MD7E 3E8NA 5EHOA 2XP2A 1VYZA 3DA6A 4U3ZA 5EW9A 5F94A 4B9DA 4MD8E 5KMMA 5IQFA 4QP6A 5IUIA 4Q5HA 3UNZA 1PYEA 2VUWA 3D94A 2QOOA 3HMIA 2X9FA 4TWCA 4Y85A 5CU6A 3QD3A 4DCEA 4FV5A 2WMUA 4U42A 5IA5A 3NW6A 2C3LA 5EM8A 5EH0A 2WTKC 3E5AA 4HCUA 4RA4A 4D4YA 3DT1A 4X2GA 3RHXA 2XNEA 3FPMA 5K4JA 1ZYJA 2XKCA 3GOPA 3HV5A 3EYGA 4GVJA 3P7AA 2IO6A 2IZTA 2OH4A 4FKUA 5AV3A 5C03A 5IKWA 4YR8A 4G2FA 3VBWA 4I24A 4R6VA 4HGLA 2XEYA 4G6OA 4RIWB 3KXGA 3C4CA 4JBVA 4BC6A 4U3YA 2HXLA 4IQ6A 1JWHA 3A99A 3Q4CA 3OBGA 2HW6A 4Z16A 1RQQA 3UDBA 4LUEA 4C4GA 3R7GA 5AR3A 5L2IA 4PQNA 3NR9A 2VRXA 1I09A 3DAKA 2NRUA 3W2SA 4DTAA 5ANJA 4AZEA 2PZ5A 4I5HA 3DNEA 3DU8A 4YC6A 5CSWA 3VBYA 5GZ8A 2W1DA 4FTUA 4R7HA 4O86A 1FQ1B 3G6GA 3FQEA 3O8PA 2HOGA 5IUGA 5K0XA 2WTJA 4EI4A 2PVYA 2OBJA 1PKGA 3GCPA 1W0XC 2R64A 3QC9A 4GG7A 2NP8A 5HG9A 3ZOSA 2QNJA 4W4YA 4YTFA 5JT2A 4IDVA 5A4QA 4DEIA 3ZHPC 3DCVA 3QQJA 3UG1A 4PL5A 5FG8A 2IVSA 1DI9A 5HG5A 2GFSA 2ITOA 3G9LX 3TNWA 3V5WA 3U6JA 3LKMA 3CTHA 3IDPA 3UP7A 3DV3A 2BCJA 4F1TA 2OZAB 3BYMA 4V0GB 1QL6A 4W9XA 4C4FA 4AFEA 2QD9A 4G3FA 4ID7A 4D1XA 3ZXTA 5EYMA 3AC5A 3IW6A 4BCNA 4C0TA 3RK9A 4C3RA 3WZJA 3SHEA 1WAKA 4GU6A 1S9JA 1TQIA 4FX3A 4Y8DA 2CLXA 1RDQE 4QYHA 3QUEA 5FP5A 2A27A 4MWHA 5BUJA 4ZK5A 3LVPA 3TIYA 5LXMA 1URWA 3MFRA 4TXCA 4YMJA 5HLNA 4YJSA 4KSPA 5EK7A 3Q6WA 3CS9A 1FINA 2DS1A 1OITA 2FA2A 3A7IA 2J0JA 3FLSA 2BDFA 2WAJA 5EI8A 4DFUA 4EH5A 1M2QA 3AMAA 4C57A 5JFWA 3AT2A 3QXPA 4DFBA 4R7BA 2JEDA 4ITJA 4YP8A 1OI9A 1XH7A 3OCGA 4E73A 5CTPA 1G3NA 5IISA 5IEVA 1R0PA 1ZZLA 3NS9A 5CZHA 5T6KA 1ZZ2A 5E8TA 4ZY6A 5C8MA 2W1EA 4F6SA 3VBTA 4FKTA 1W84A 3CPCA 3QXOA 4IVBA 4S30A 5D11A 4CVAA 4TYIA 1YDTE 2OJGA 4MAOA 3WOWA 5ETIA 1U46A 1OVEA 4HYUA 4YNOA 3ZUTA 4L3PA 3PIXA 3R01A 4QPAA 5B2LA 2P2HA 2J9MA 3F82A 3R83A 4HPTE 4BKJA 2BRMA 5M09A 3D2KA 3F3ZA 5ANOA 3QX4A 5EOLA 3S4QA 2V0DA 3VHKA 4ANBA 4QYYA 4OAVB 3DJ5A 4I5MA 3TKHA 4ACDA 2JDTA 3GI3A 1IEPA 3DKCA 3R28A 5M55A 4X0MA 5L3AA 3R7OA 2X2MA 2BKZA 3KCFA 4EKLA 5CLPA 2ZB0A 1UNLA 3VW8A 1Q8ZA 3CR0A 2C6OA 4NUSA 4AWIA 4M66A 3UIUA 3JY9A 3MFUA 4O38A 1GOLA 3LXLA 5HNGA 4I21A 2JAMA 3A2CA 2XIKA 2J7TA 2BTRA 3D14A 2Z60A 1K2PA 4QP9A 4W4XA 5HNBA 2A0CX 3R9HA 3UYSA 5BVNA 4FIGA 4G5JA 5CI6A 4IVDA 1JAMA 2UVXA 2WMRA 4GW8A 4N0SA 1PXJA 2CCHA 3OOGA 3I0OA 3K5VA 4GJ2A 1ZOGA 4GV1A 2HK5A 4OTFA 2JGZA 4IE9A 5KMJA 4E4XA 1M7NA 4EBVA 4QMOA 5L6WL 1MRUA 1Q8UA 1BL7A 3RZFA 2CN5A 2UZVA 4BZNA 5CEKA 3N4TA 1Y8YA 3QL8A 4ZLOA 3I7CA 3V01A 4IZ5A 4CFUA 5C1QB 3Q4ZA 4C3PA 2XKFA 4IX3A 4FSTA 1FGKA 4NT4A 1H07A 3TV4A 4MBIA 1L3RE 3PXZA 4H1JA 3E92A 4I5CA 4JQEA 4PMSA 2ZMDA 3UZRA 4G6LA 1YWVA 2ZV8A 5HD4A 1U5QA 1NXKA 3O8UA 2C6LA 4KSQA 4HVIA 4C37A 1WVXA 2JKQA 4TZRA 2VGOA 4F6UA 3WIGA 4ASEA 2YCQA 3BIZA 3CTJA 3ZLWA 3LFQA 2Y6MA 4Z3VA 1YDSE 3RGFA 1H28A 3DLSA 2REIA 3GCSA 3EQRA 4I22A 3DFCB 4G3DA 4UYAA 2W1CA 2WNTA 3ZRLA 4D4RA 4DITA 4QQTA 1UA2A 1CKIA 3F88A 3NCGA 3UVPA 4AW2A 4YLJA 3DDQA 2WELA 3Q3BA 3WZKA 3A4PA 4NCTC 5GIPE 2ETKA 2O8YA 4GS6A 1H1PA 2XIYA 4OBPA 2W4OA 3VQUA 3ZUVA 3LMGA 5FEEA 4J98A 3G6HA 4E5BA 1JSTA 4EONA 4ZMFA 4USEA 3VW6A 3DXNA 2V7OA 4O7ZA 4FKLA 2QG7A 4IIRA 4YZBA 3OMVA 3DJ7A 4JRNA 2IN6A 3R30A 4FNZA 1JKSA 2J50A 3KGAA 2F7ZE 5LMBA 3PIYA 3E93A 3AD6A 1BYGA 4ONAA 3O17A 3WE8A 1Y57A 4MTAA 4C2WA 1WBWA 3EQCA 4IMYA 3G0FA 4DH1A 4K77A 4GSBA 2QI8A 4MXCA 2UZTA 3H10A 1ZXEA 3UVRA 3IECA 3TZ9A 4CFVA 4MNFA 3FSKA 4EH7A 3SXRA 4XUFA 1J3HA 5D1JA 2XK9A 5TOZA 4ZSJA 2C6KA 4FV2A 3VIDA 4EH6A 3QQUA 4J1RA 5L6PA 5ETAA 3RAIA 2I0YA 3OCBA 2X8EA 3SKCA 5BYLA 2VO0A 1V0BA 2GS7A 2CKOA 4F1MA 3L9PA 4O6EA 4BZOA 4DA5A 3GB2A 4RIWA 5LCJA 2J6MA 3QQGA 4OTDA 2VZ6A 5CSVA 5L2WA 3TZ8A 4D28A 1WVWA 4KAOA 3OVVA 3BU3A 2QURA 2YM3A 5J87A 3PLAE 1OUKA 2YM7A 2YLFA 3QGYA 1PJKA 5CU3A 5IH4A 5FTQA 3ORPA 3ZO3A 2WQMA 4EH2A 4L00A 2IPXA 4FTOA 4I41A 4CMUA 3HA6A 4RJ8A 4F0FA 3RWQA 4CKRA 3HDMA 4LRMA 3KQ7A 3R0TA 5E8WA 5H3QA 4YTIA 4LRJA 3FZTA 3FDNA 4LG4A 4TWPA 2BUJA 1YXXA 3SVVA 4O0TA 4FGBA 3QTSA 2WOUA 2NPQA 1W98A 4TYHB 4TW9A 5J8IA 3RAHA 1U54B 3UIXA 5KCVA 2VWUA 3ZONA 3PJCA 3HUBA 3BZ3A 4BCQA 4FIFA 4WKQA 4J8MA 4JBOA 3M11A 4LYNA 3EQPA 2CJMA 4KRCA 4LV8A 2PE0A 5AP2A 4AGUA 5A4CA 5ICPA 1KE9A 4AW1A 5DR9A 2C0TA 2BRNA 3FZOA 3ZSGA 3FY2A 4DAWA 4YJVA 2OZAA 3OF0A 4V0GA 4RC4A 4AG8A 2B1PA 4FEUA 3FMEA 4F9BA 4CD0A 4RLLA 2Q83A 4FNYA 1Y6AA 3GU8A 2BAJA 4NTSA 3TJDA 2W05A 3PUPA 4FG8A 4DLJA 5M4UA 2GNIA 2PE2A 3RP9A 2CNVA 3LIJA 2WQEA 4P2KA 4WUAA 4BRXA 3EN7A 4WNOA 3S95A 2RIOA 3CY3A 3C0HA 3TUBA 4R3PA 2WO6A 3F61A 3QAME 1YOJA 2GDOA 3QHWA 2WFYA 4RLKA 3D5XA 3II5A 4B99A 4MK0A 4UEUA 4BGHA 4BDAA 3EQGA 3VULA 4G34A 4YTCA 3Q52A 4MD9E 4U40A 4E4NA 1HOWA 3SLSA 4XS2A 2H34A 3K2LA 3UBDA 4K0YA 4CV8A 5ETFA 3PWDA 3PSCA 5AV2A 3VUGA 3DAEA 2NNWB 4RWKA 3QKMA 3N4UA 3MPAA 5CAUA 4PP7A 2OIDA 4I4FA 3NYNA 4MQ2A 4CG8A 1XH5A 4O0RA 5IQAA 3VJNA 1V0PA 4AP7A 2ZM3A 3HMOA 2UW5A 1GZKA 3E7VA 4BDFA 3C9WA 3IW7A 2JITA 2YCSA 3MA6A 4FV9A 4IVAA 3HUCA 1KSWA 4NFMA 4OT6A 4QO9A 4C8BA 4JT3A 1OBGA 2GNFA 4FVQA 5IA4A 2RFDA 2OFUA 2ZM4A 3RPSA 5ANGA 2VD5A 1QPJA 1R3CA 3OXTA 4NFNA 3PG1A 2ITVA 4XV1A 4W4VA 3ACKA 2ZOQA 1H0VA 2J90A 3DBFA 4KS7A 1Y6BA 3OHTA 5EDQA 2R3IA 2ZAZA 3MV5A 3GBZA 4IACA 2PHKA 3H0ZA 4U81A 3NUYA 3MIYA 5DI1A 4YC8A 4GG5A 2WU7A 3BKBA 4XRLA 5AV1A 4L7SA 5M44A 1QCFA 2X7GA 5HICA 4C58A 4PP9A 4ZY5A 2YM8A 4W4WA 2C68A 4QP1A 5H9BA 4B7TA 4F63A 4G5PA 4I1ZA 3ID6C 3QYZA 4E7WA 4XG6A 4LMUA 3VN9A 4HNFA 3PTGA 4APPA 1LUFA 4A9SA 2QOHA 3LE6A 2H8HA 3FY0A 3MH3A 2FVDA 2YIWA 3VBXA 4GK3A 2VO6A 4YPDA 2Y4IB 4WBBB 4ZTNA 3EL7A 3EKNA 3SGCA 4DEBA 4B4LA 5TF9A 5F9EA 3NNWA 5HESA 4MF1A 4L8MA 4ANLA 3T8OA 4EOIA 3FLYA 5IQEA 4JG7A 5IEXA 2GMXA 4W8DA 4DFNA 4U8ZA 4V04A 3VS6A 5I9XA 3R8UA 4CLIA 5IUHA 3U6IA 4UB7A 1YI3A 3R8LA 4XNEA 2UUEA 3IW8A 3N9XA 4HVHA 3DK3A 1ZMVA 2XM8A 4AGDA 4EZ3A 4WG5A 4O84A 2X6EA 3ROCA 3ATSA 4LOPA 3C0IA 5AAFA 4AGWA 3E3BX 1OKYA 1YXSA 5I9ZA 2O65A 2R3RA 3L8XA 1WZYA 5ANEA 3TUDA 1LPUA 4CQEA 4NH1A 5CY3A 5DE2A 5ANDA 4C36A 4IM2A 2PPQA 4FZ7A 3UOHA 3NIEA 3Q9XA 3HMPA 2J4ZA 3OY1A 3OEZA 3JPVA 3R00A 3GCQA 3LFNA 4BDHA 3L9NA 3RHKA 1T45A 5AUTA 4HPUE 3HAMA 3CQWA 4MXYA 2C69A 5EDRA 4EHEA 4ACGA 1OIQA 3ZSHA 3LMIA 4E4MA 3LMHA 4JI9A 4ZIMA 2OGVA 5IH5A 5AUUA 2WHBA 4FVPA 4FL2A 3EN4A 4L52A 2YISA 4D2RA 4YJRA 1KE6A 2F9GA 4K6ZA 5FRIA 3COIA 2WTKB 4BTKA 2OICA 3A8WA 5FTGA 3GP0A 5AV0A 3BQCA 2EXMA 3CJFA 4C61A 2OJJA 3WZEA 5CEMA 2YDKA 3PY0A 4J71A 3QD0A 2QG5A 4DH3A 4LGHA 4XG7A 2WTDA 4BI0A 4DEAA 4BCKA 2WMSA 2X7OA 3WF9A 4FYOA 5DR6A 1TVOA 1Z5MA 2XK6A 4L53A 3PZHA 5HI2A 4GCJA 5EM5A 3QALE 3EQBA 3U4UA 2PUIA 5HVKA 4G6NA 1EH4A 4ENYA 3S00A 2BROA 3KXXA 3TNPC 4DGMA 2O63A 5C8NA 4TN6A 5FXQA 4CEGA 4FGRA 2YA9A 4DTKA 2WTVA 4YU2A 3L8PA 4FKSA 4EJ7A 2HCKA 4HVDA 1OL6A 4L42A 4BCOA 4K9YA 4IDTA 3GC7A 4H05A 2XK4A 3VF9A 4D55A 4D2TA 2P33A 4XOZA 5GHVA 5LVOA 2CPKE 5G1XA 3RCDA 2X7FA 4M97A 5GZ9A 4ZSLA 3KULB 4L44A 3DY7A 5FTOA 3S0OA 2QCSA 1UWHA 2P3GX 1KV1A 5HBJA 4C7TA 2GHGA 2GQGA 4TYHA 5DEYA 3OZ6A 2Z7SA 1U54A 4JX3A 1H01A 2ONLC 3FZ1A 4NTTA 4ZTSA 4LGDA 4HZRA 4DGNA 5AMNA 2RG6A 4TKSA 1PXLA 4TYJA 3V51A 2OZOA 4UX9A 1DI8A 2RGPA 3LLAA 4R5YA 5KUPA 1JKTA 3ORMA 4FSMA 2XK7A 3I6WA 4J99A 1YVJA 3IOPA 4U41A 5DBXA 5AP5A 3CP9A 4EK3A 3FI8A 1JLUE 4D2WA 5C01A 2PVKA 4OR5A 5IMXA 5IQIA 1BI7A 4ZSGA 5CSPA 2BFYA 2E9PA 3NUSA 3ZRKA 5I3OA 3DKOA 4FNXA 3OT3A 1JKKA 2BPMA 4LRKA 4WBOA 4XX9A 5CAVA 3TG1A 5AAEA 4ZS4A 2R3LA 3MESA 4FR4A 4CG9A 3PFQA 3QTIA 1P4OA 4X2JA 4UWBA 5DHJA 5KMOA 2Z8CA 3NAXA 1OL7A 4FI1A 1BL6A 2CKEA 2V22A 5M08A 4CYIA 1RW8A 2JFLA 5HQ0A 5J7HA 4YC3A 1H1RA 3OWKA 4J53A 3ZMMA 2IVTA 3ZZEA 4BIDA 4UXQA 3KL8A 4EH8A 1H4LA 3O7LB 4KIKB 4L7FA 3DFAA 4UMQA 5AUWA 4C4IA 3V8TA 5GIOE 2CCIA 4BDIA 5L8LA 1FVVA 3IONA 4HCVA 4TNBA 4MBLA 2XM9A 3EN5A 2ITYA 4ZSEA 4UN0C 4W9WA 1NA7A 5E9EA 4KWPA 4R7IA 3DKFA 4HOKA 3LM0A 4ZTMA 3ATTA 4R1YA 1M2RA 5GJDA 4L43A 3EH9A 4Y83A 4YBJA 2W1FA 3HV3A 1WBNA 2G1TA 5CZIA 3NUXA 3GVUA 1B6CB 4FZFB 4EK5A 5ITAA 1JNKA 3ZLXA 4FTKA 3S2PA 2JKKA 3Q53A 4YTHA 4IX5A 3OBJA 2HZNA 3SXSA 2X8DA 3W10A 4NIFB 1KE8A 3OXZA 2PVNA 4ZY4A 4GJ3A 3ULIA 5FQDC 4HYHA 2PVHA 5AX3A 3R7VA 2GNLA 3E63A 5A14A 4I92A 3DKGA 2VX3A 2C3JA 3F7ZA 5K3YA 1H08A 1ZOHA 4JBQA 4IZ7A 2PULA 2JIUA 3VRZA 4JRVA 4RQVA 2YIQA 4C33A 4F09A 3BHUA 3U6HA 4Z7GA 2XUUA 2VTIA 4EOMA 2IZSA 3PWYA 3LCTA 4FUXA 2C0OA 5CI7A 3NVMB 2JFMA 1E1VA 4JAIA 3NGAA 4WD5A 3T3UA 2J0LA 3R04A 4YUQA 4OT5A 2XJ2A 3C50A 5J79A 4LOOA 2ERKA 2I0HA 2XBJA 3BU5A 3NUUA 3UZPA 2O2UA 4AA0A 2UZEA 3QA8A 3R9NA 3F5UA 3FHIA 4YURA 3UJGA 4RA5A 4XP2A 4AZVA 2ZV2A 5AP4A 1U5RA 5DH3A 5H8GA 5L4QA 2B7AA 3LHJA 3FC1X 4UYNA 1UU3A 4FYNA 3FUPA 2VO7A 4XV3A 5CQWA 5M51A 3EFLA 4YJTA 4AN9A 3L9LA 3AC3A 1BUHA 2BDWA 4TYEA 4CSVA 3PVUA 2J51A 4D9UA 4FSNA 4BDCA 1FBNA 4D1ZA 4UALA 4YZCA 4YBKA 3LCOA 5HHWA 4IB5A 3HL7A 5HOAA 4X3JA 4F70A 2PVRA 3NYVA 3QTUA 4U79A 3VS3A 4E6AA 4F6WA 3OUNB 5M4FA 1H24A 2XJ0A 3MY1A 4FKQA 5JRSA 5I5ZA 4O82A 3PSDA 2YDIA 4EOPA 1Q5KA 3TKIA 2OIQA 4KS8A 2VWXA 3H3CA 3BELA 2UVYA 4RFYA 4XJ0A 4EH9A 4LGGA 1J1CA 3F3VA 4FVRA 4I6HA 3LLTA 4RX9A 4R77A 3W2PA 2RL5A 3SA0A 4IC8A 2JDOA 3NZ0A 1PYXA 3OWLA 4EYMA 2E9UA 2VGPA 4I0TA 4MBJA 5HCXA 1SNUA 3LXNA 4IAKA 2F49A 4ACHA 4YSJA 5JGAA 3F2RA 4GKHA 5FBNC 1H0WA 3QUPA 4ASDA 2G15A 4QNYA
chains in the Genus database with same CATH superfamily
5LQFA 4X2NA 3W2CA 2WMTA 3HA8A 4U45A 5I4NA 3LFBA 4BYJA 2X4ZA 3QZHA 2QKWB 4DF3A 2SRCA 4PTGA 1MRVA 4KBAA 4RWLA 5G6VA 4X3FC 2GHLA 3C5UA 4S34A 2VWYA 4ZMEA 3QCXA 3VVHA 5CVGA 5TO8A 3V3VA 3AOXA 4QMNA 3IKAA 3UYTA 4MUQA 4TT7A 3DQWA 5BVOA 5EKOA 3ZUUA 3I6UA 3KN6A 4IX6A 3RZBA 3UTOA 4EUTA 2XIRA 4KIOA 1NY3A 5C8KA 1J1BA 2XNMA 4RC3A 5D7AA 4W8EA 2R7BA 5HD7A 4K1BA 3VNTA 4N6ZA 4U44A 3MB6A 4ZTHA 4GUEA 4FKWA 2YERA 1ZYCA 5DNRA 2W4JA 4MKCA 4MF0A 1DAWA 1CTPE 4H3QA 4AQKA 2E9NA 2P4IA 2UW6A 4LOQA 3G2FA 1FOTA 2VTPA 4N6YA 3P5KA 4E93A 4UBAA 1F5QA 2QVSE 3NW7A 3TV6A 3BLQA 5D9HA 1XQZA 4ANOA 1Q61A 1Q8TA 3W33A 4FT5A 4X7QA 3CIKA 4XCUA 1LEWA 5CVFA 3H9OA 4AAAA 5D10A 4AU8A 4P5QA 3ZO1A 4BJJA 2JIVA 4NW6A 4CNHA 4JLCA 2HYYA 5I0BA 3RINA 1K9AA 2I40A 4A06A 4CT2A 3KULA 4BTJA 4JVGA 2W5HA 3WF6A 2ITQA 4J96A 1W83A 3FMHA 4IM3A 4FTMA 5IQHA 1IG1A 1YI4A 3M1SA 3I81A 4OW8A 2QOFA 2R3GA 4L45A 4BHNA 2IW9A 2CNQA 2KTYA 2ACXA 5J95A 3ANRA 4FBXA 1H26A 1M17A 4U43A 1XKKA 5EHLA 5EYKA 3UO4A 5HLWA 4AACA 3ORKA 4C02A 5HTIA 2QOCA 4IFCA 3NAYA 2YIYA 4ZTQA 4PDSA 4ZLYA 3U9NA 4DCAA 1DAYA 2ZM1A 4AA4A 5A4LA 2BRHA 2J0KA 5HLPA 3OW4A 3QTXA 4TTHB 4FMQA 2ZJWA 3F3WA 4MXXA 4QMZA 4U0IA 4FKVA 1UNHA 4PY1A 3MJ2A 4MYGA 4IW0A 2ETMA 3R8ZA 1LP4A 4E5WA 1I44A 3HMNA 4GK4A 5HU3A 3KMWA 3WE4A 4AOJA 2BAKA 2YIXA 4I4EA 1YKRA 3F5PA 3I5ZA 4X2KA 4IAFA 3EKKA 5EDPA 4FEXA 2QLQA 3BPRA 4WG4A 4CV9A 5DMZA 4FSRA 1ZYLA 3RMFA 4GFGA 4PF4A 2RFEA 3G5DA 3H30A 3JVSA 2IEWA 4F7LA 2OU7A 1GIHA 3EYHA 3F5GA 3PG3A 3R21A 3DLZA 3ENMA 3PXFA 3EL8A 1MQBA 3MH1A 4KIKA 1IASA 2PZIA 1M52A 3E87A 1H1QA 4PPBA 5IA3A 2C4GA 4GU9A 3KK9A 4I6BA 1GY3A 4OGRA 1MQ4A 4G3GA 4HGEA 3WBLA 2XCKA 4ZLZA 2B9FA 3AMBA 2JBOA 2RF9A 1NW1A 3FQHA 5KMNA 3IW4A 3F3UA 3MVLA 4BDDA 3FYKX 3A7GA 1YXUA 3EZVA 4PMTA 5EI2A 2GHMA 4JX7A 5A4TA 5BV3A 4O1PA 2C6IA 4J97A 4ORKA 1J91A 5L8JA 3TV7A 4M84A 3TNIA 3G51A 2J5EA 4CKJA 4BY9E 3R1SA 4FTQA 4XG8A 4BDBA 3OG7A 5IA1A 1Q8WA 3QTWA 3OC1A 4C59A 4H39A 3ERKA 3RCJA 3LQ3A 3G0EA 4I6QA 3KXNA 4NIFA 3FMNA 3SRVB 3MY5A 2IW8A 4XP0A 4YZNA 4WHZA 4ACMA 5M06A 5FXRA 2R3MA 3H9RA 2XNPA 4RIYB 2ZV9A 1UU9A 5AJQA 5FWKK 3TIZA 4RZVA 4NW5A 3EHAA 4YO4A 3LFEA 2VTTA 4FKJA 3CBLA 1OZ1A 3LCKA 3UODA 4PTEA 3PVWA 3MN3A 4RVMA 3MWUA 4TRLA 2YJRA 3FJQE 4MXAA 5DN3A 5HBEA 4D58A 4AFJA 2X0GA 3BV2A 3LFAA 4QMPA 3A7JA 3OCTA 3TL8A 4D0XA 3QTRA 2AEGA 1FVTA 2VX0A 4RFZA 1VLRA 4NZWB 3HP5A 3POZA 2P2IA 3VUDA 3GENA 4DFZE 4QMUA 5CANA 4DT8A 3O96A 4O4BB 5GNKA 4MNEB 5E8XA 4L3JA 3P5JC 3PXYA 3SXFA 4MVFA 1OMWA 4IVCA 1WMKA 4N70A 4RGJA 5BYYA 2EXEA 4FL1A 3QTQA 3BWFA 4ASXA 4QMMA 2X8IA 4L01A 3RAWA 4QMTA 4CZTA 2BRGA 2X39A 3SD0A 5HX6A 5JZNA 1FVRA 3ZDUA 5JSMA 5HO7A 4MWIA 3CXWA 2CGWA 3MBLA 3MB7A 1REJA 1OIRA 2QHMA 3MI9A 4YJNA 3TJCA 4DH7A 5HNIX 5LMKC 2Z2WA 4I93A 5EW3A 5FBOA 2GFCA 1AD5A 3IS5A 4IWPA 2ZYBA 4U80A 5IA2A 3HV4A 3FHRA 4WNPA 3VRYA 1AQ1A 3PZEA 4BFMA 4EHZA 4NCTA 3BE2A 3AKLA 3REPA 5IF1A 2FSOX 4IZYA 2B0QA 4QQJA 2V55A 5CF6A 4DEGA 3RPRA 5IQGA 5FM2A 2C1BA 2IZUA 1PW2A 2UZWE 1YWRA 3KF4A 5CF8A 1HCKA 3IQ7A 3Q4UA 2W7XA 1UNGA 1XO2B 3A7HA 3FWQA 4EZ7A 3KIOC 2AC3A 4HCTA 4LUDA 1IA8A 3Q96A 5AIRA 1Q3WA 4FIIA 5D12A 3QRJA 3ETAA 4XLVA 5A4EA 2LAVA 1V1KA 4KIQA 5KHXA 3ZYAA 4G1WA 1JOWB 2RFNA 3C4EA 5LWNA 3RALA 5AADA 2VWVA 2WEIA 4XG4A 4RX7A 3NLBA 3Q04A 4XH6A 2F7EE 3DNDA 3SV0A 1IAJA 2XIXA 4JBPA 2JKOA 3F2NA 3GC0A 5JKGA 2PMLX 1FPUA 5ACKA 4R8QA 4NYEA 2Y7JA 3ZH8A 4OTPA 4O7WA 2HZ4A 3QD2B 3W32A 3WZUA 4IJ9A 3ODZX 3CCNA 3QCQA 4WSYA 5H8BA 4E4LA 1YW2A 2ZMCA 5DFPA 4M68A 2QR7A 1OKWA 1IR3A 5FGKA 3THBA 2PSQA 4TWOA 2R7IA 1LR4A 2VTSA 3DB8A 2J5FA 1XWSA 3F3TA 3GCUA 4XLIA 5BPYA 4PMMA 4AX8A 4A4XA 3E64A 4O4CA 4JNWA 3Q5ZA 3QWKA 3TWJA 4OLIA 2VU3A 3NSZA 4FT0A 2QOKA 4DTBA 2UZDA 1SZMA 2XZSA 2OXXA 2PU8A 2WEVA 1ZY4A 5IQBA 5DLSA 4O22A 4BF2A 5HBHA 3DTWA 3QWJA 4FKGA 4I0RA 3ZRMA 5KMKA 2IZRA 4QMQA 1PMUA 2BZKB 5A9UA 5CAQA 2GNGA 4PNKA 3FAAA 1UU8A 4M13A 4FL3A 4ANSA 4BCMA 2I0VA 2FYSA 4Y72A 2ZDUA 4B8LA 5AIKA 4NK9A 4K18A 1KE5A 1URCA 2X0PA 1CKJA 3PRIA 3RTPA 4CQGA 3Q32A 2G01A 4LM5A 3SQQA 4O0UA 4DHFA 1ZY5A 3WF5A 3DBEA 2A1AB 4BB4A 4WA9A 3BHYA 5AWMA 3DOGA 1G8AA 4IZAA 3U4WA 3GU5A 4P4CA 3U51A 1B38A 3WF7A 1G8JA 4JDJA 3VS5A 2JDRA 4FZDB 5HVYA 4EHVA 2OWBA 2C1AA 3D7ZA 5HCYA 1WBTA 5JK3A 3PXKA 4RFMA 4GUBA 3Q4TA 1KV2A 3SAYA 3BEGA 3VUTA 4ZXTA 3E8EA 4QT1A 4GL9A 5BVWA 5TE0A 1WBVA 2WTCA 5CVHA 2OXYA 4Z55A 3RNIA 2YAAA 3AD4A 4FKOA 3KMUA 3MTLA 4JAJA 3M2WA 2QKRA 5I9YA 3ZC6A 3HKOA 3RWPA 2JKMA 3PXQA 4PWNA 4S31A 3D5VA 4EOSA 4QTBA 2A4LA 3T3VA 5EQPA 5IZFA 2GS2A 3IGOA 4LFIA 4N4SA 2E9OA 5I3RA 3OUKA 3R8MA 5F20A 4C3FA 5DYJA 3E3PA 3MVMA 4RVKA 3VUMA 3JS2A 1KOAA 4XV2A 2WIHA 1V0OA 5A6NA 4GKIA 1J7UA 3C1XA 2W5BA 4OTIA 4PDOA 1ERKA 4EEVA 4ERWA 3F9NA 5FEDA 1NVQA 4PNIA 5ANKA 4DE4A 5L2SA 2XNNA 2YDJA 3BE9A 5E1EA 2XH5A 2FSTX 2OK1A 4KKGA 4O91A 2VWZA 3FKLA 3GU7A 3ULZA 3KN5A 4X2FA 5CYIA 3UQCA 3FKOA 3UPXA 2E2BA 4IWOA 3ZEPA 2WIPA 2YZAA 3D15A 1BLXA 3HX4A 5H8EA 4UMUA 1OGYA 3V8SA 2VNYA 5A3XA 1XBAA 2PZRA 3DXPA 2OSCA 3V6RA 4E6CA 4KIPA 3MS9A 2XAMA 1Q3DA 3BEAA 3FI4A 4GYGA 3OW3A 5CXHA 3UQFA 4IAYA 4WOVA 3SRVA 1H8FA 5C4LA 2J2IB 2IVUA 5HE0A 3FC2A 5E1SA 5D7VA 1WBSA 2P0CA 2XEZA 3VAPA 2RSVA 4RIYA 2WTWA 3QA0A 5AP3A 3TN8A 2B4SB 1PXKA 2VWBA 1H25A 2VO3A 3JYAA 4IFGA 4NJDA 3R8PA 1M2PA 2Y8OA 4RIOA 3P1AA 4BN1A 1YHSA 3CJGA 4EWQA 3O0GA 4QYGA 1Y91A 5AM6A 5AM7A 4BVUA 4ZJIA 3C4ZA 1ATPE 4FSQA 5BUEA 5I9VA 2XARA 1FGIA 3QQKA 3ORNA 1OM1A 2XS0A 3QRUA 3PY3A 1OPJA 5DT4A 2Y4PA 4YZ9A 3ZTXA 3F6XA 2PVFA 3POOA 3FLNC 1YI6A 2XRUA 4MNEA 4NL0A 3UQGA 2I6LA 4BCJA 1YQJA 2A98A 1R39A 2OG8A 4JQ8A 4E20A 4MQ1A 1M14A 3P7BA 5A46A 3ANQA 5JMSA 1ST4A 1IRKA 3KMMA 1CMKE 4D5KA 2VTMA 2JDSA 2JBPA 3I7BA 4TNDA 5JFXA 3KXHA 5AR5A 2DYLA 5IMEA 4I3ZA 1UWJA 3LCSA 3B8RA 4FT7A 3RK5A 4CKIA 3UPZA 1K3AA 4PDYA 5TKDA 3UIMA 1HCLA 3IG7A 1XR1A 1Z9XA 4F7NA 4ZS0A 3MPMA 5CEOA 4WUNA 2R3PA 2XRWA 3C4WA 4FG9A 4FEQA 3Q2MA 4JJRA 2O64A 3ALOA 3DAJA 3DB6A 3EMGA 3W1FA 3HV7A 4ARKA 2WKMA 3PY1A 4O2PA 3Q60A 4AZWA 4FTJA 1KWPA 3NNVA 2OF2A 4X6QC 3D5UA 3MH2A 3QCYA 2LGCA 3R73A 4Q2AA 3UO6A 4V05A 3M42A 3IDCA 4IB0A 5HO8A 4HGTA 4NKSA 4M3QA 5FDXA 3QLFA 2A19B 3PA4A 3KXMA 3D9VA 3FSFA 2W5AA 1PMNA 3PJ3A 4UXLA 1JSVA 2BZIB 1WBPA 2EU9A 2XA4A 3EB0A 3Q5IA 3GFEA 5CAOA 4ASZA 5AA8A 2W17A 2WOTA 3N51A 4X3FB 4O7NA 1GZ8A 1XH4A 2EWAA 3L8VA 4NM3A 4WIHA 4ALVA 2F4JA 3RM6A 3OTUA 3VUHA 1FMOE 3T9IA 4FTTA 3AGMA 4BWXA 3BYSA 2UW0A 5C9CA 3QZFA 3FBVA 5T68A 4ALWA 4UWCA 2BDJA 2CGUA 3P23A 5JFVA 1SNXA 2HXQA 4AZFA 4BBMA 3MPTA 3JXWA 4WO5A 5BVDA 4RX5A 4CGAA 3AC4A 3KRRA 4AXCA 1B39A 3OOMA 4RWJA 3K5UA 4FIHA 2IJMA 4A9UA 2AC5A 2ITPA 4F0IA 4D4SA 3GFWA 2YACA 5LVNA 3CEKA 4RMZA 2W9FB 4Y95A 1CSNA 5AP6A 5E8SA 3UO5A 4AAYA 2R3HA 4H1MA 3O5AA 2VV9A 4RJ3A 3TZMA 3QX2A 1J7IA 2BHEA 2YLEA 4U9AA 4EORA 2W1HA 4CYJA 1W82A 3BX5A 4ANNA 2VWIA 3PPKA 2W06A 2PK9A 3AC2A 3LOKA 3VUKA 1YHWA 1PRYA 2HY0A 2UW3A 3MIAA 4ZP5A 2YCFA 3FI2A 4D9TA 4DBNA 3FXZA 5HG8A 4J8NA 5F4NA 3EFWA 2I0EA 1SVEA 5CSHA 2CKPA 3UNJA 5HE2A 5J7BA 1A06A 2C6MA 4XHKB 3TZ7A 5JGDA 2Y0AA 3BGPA 4FSUA 5M53A 1PMVA 4CCUA 3LFDA 4O21A 4RRVA 2ONLA 3QU0A 5TR6A 3D83A 2Y9QA 5AUVA 4L46A 3SG8A 3EN9A 2DUVA 2GTMA 5EYDA 4UMTA 3K3IA 1MUOA 1VYWA 3NUPA 4I6FA 2AUHA 2C5OA 4IADA 2X0QA 5CAPA 3FZPA 4AZSA 3KCKA 3KEXA 2VTRA 4QP3A 5AA9A 4HW7A 1AGWA 3ZU7A 2NO3A 5FP6A 3BBTB 2FO0A 2XAOA 5JZJA 3WYXA 4FK6A 2VTAA 4GIIA 4JDKA 4CZUA 5IPJA 1ZLTA 2J0MB 3V8WA 3QFVA 3B2TA 2Z7RA 4RG0A 1QPEA 4F0GA 4GT3A 3O50A 3F69A 3W8LA 4EK6A 3O71A 3NEWA 3UNKA 3BYUA 3COKA 2VTHA 4EC8A 3LXPA 4LMNA 2BZHB 2BIYA 3BGQA 3RK7A 5CASA 1PF8A 3QKLA 3D7TB 4IXPA 4B0GA 4CMTA 3BYVA 4ZOGA 3ZFYA 3Q9WA 5IG1A 5AUXA 1IA9A 4ZJJA 4P7EA 1PY5A 3AQVA 3OEFX 2W1GA 1H27A 3WF8A 4EQUA 2O0UA 3QTZA 4FJVA 2BFXA 2DWBA 3OTVA 4DHIB 4BYIA 3KREA 3W0PA 4ZZMA 5CQUA 4RX8A 3G15A 3ALNA 4H58A 3WILA 4EQCA 3NDMA 2ITZA 1OKZA 4QPMA 4KNBA 4K8AA 3RM7A 3O23A 4AS0A 3OCSA 2NRYA 4BCFA 3MA3A 4F9WA 2ETRA 4GYIA 3VHEA 3PPJA 4F9YA 5I9WA 3D0EA 4NEUA 4UV0A 3CQUA 5ANIA 2GU8A 4EOQA 4I6LA 3VQHA 3DS6A 4R78A 5B0XA 3V5PA 4YNEA 4XEYA 2X9EA 1OPLA 2QU6A 4GVAA 3FMLA 1GAGA 4GH2A 4TY1A 4YJUA 4D4VA 2GSFA 2QC6A 1OUYA 3SW7A 2GNJA 3OWJA 1PMEA 1DS5A 3HEGA 5EQYA 4AZTA 3S1HA 3C13A 2HWOA 2VX1A 5DR2A 3KU2A 2BILB 3O2MA 3QD4A 5CF4A 5JQ8A 3EQHA 3W2QA 3UC3A 3ZM4A 4EZ5A 1ZAOA 5HO6A 4CRSA 3C5IA 3ITZA 4JL9A 5AP1A 5LARA 3NPCA 4Y73A 4BCGA 5EOBA 4X21A 3UZTA 4NM7A 3DJ6A 1OKVA 3FMMA 3KA0A 1GNGA 1REKA 4RJ7A 3K3JA 4O4EA 5L8KA 4O4FA 3P9JA 5CWZA 4QOXA 4JIAA 4FG7A 4M7IA 5IEYA 4QMXA 1Q24A 2RFSA 3V6SA 5JRQA 1GZNA 2YM5A 1ND4A 4CFXA 4AUAA 4FKIA 2E9VA 3OWPA 4G3CA 3BLRA 3MYGA 4C35A 2G2IA 5DRBA 1P14A 4CT1A 4GT5A 2R3QA 3JY0A 4O0WA 5CEPA 3BI6A 4QP4A 5E4HA 1WFCA 1BX6A 3P78A 5HEZA 3UOLA 3EFJA 4FODA 4EWHA 2YCRA 3B2WA 3OP5A 3NMUF 3DK6A 4M15A 4F9CA 3HMMA 2R0IA 3FL4A 4KD1A 1Q4LA 2YIRA 3UGCA 1TFFA 1OIYA 2XANA 5DEWA 3EQIA 5BVEA 5AR4A 4AQCA 3R02A 4U97A 3GOKA 2PTKA 3BL7A 4ZZNA 2HZIA 4RQKA 3QYWA 4FOCA 4RWIA 4NM5A 3FI3A 3ZO4A 3COHA 4BHZA 3UG2A 2ITXA 2QR8A 4D5HA 3BU6A 3LAUA 4E6QA 2EXCX 2JDVA 5FXSA 5KZIA 4R5SA 4CMOA 2I7QA 2OJIA 5DOSA 1VJYA 4YJQA 4PMPA 5GINE 3JUHA 1P4FA 4H3BA 5LVMA 4FTCA 3TACA 2CKQA 5KBRA 3NRMA 2XNBA 3GT8A 4RPVA 2CGXA 2ITWA 2ZVAA 3AC1A 4MH7A 3P4KA 5EM6A 1APME 1W2CA 4EK8A 3H0YA 3HYHA 3VWAA 4CXAA 1P5EA 3QKKA 4Z9LA 1QPDA 1WCCA 2XKDA 5CT7A 3I0QA 4X3FA 4EL9A 3UC4A 5EQEA 2WQBA 4QMVA 1YOMA 3HRBA 4FE2A 2CNUA 3QRIA 2ITNA 3B8QA 4U7ZA 5F95A 4AT5A 3CKWA 4AGCA 5DWRA 5KX8A 4D1SA 2CSNA 4EUUA 3CD3A 2VAGA 3CD8A 4KINA 5C27A 2BALA 3MVHA 3ODYX 2OH0E 3BHVA 4FA2A 3AKKA 1XBCA 3IDBA 3U54A 2WB8A 2ZB1A 4M12A 3VS2A 3MW1A 4AXAA 4EH3A 5BNJA 5E8VA 3ZBFA 1G5SA 3A61A 3R9OA 3ZZWA 2RKUA 3ORTA 4IB3A 4J7BA 3SC1A 1ZYDA 4CFMA 2BZJA 4ZJVA 4L9IA 2QO7A 4WRGA 3U55A 2PVLA 2R0UA 2R9SA 1OL1A 5L6OA 5BVFA 4LV7A 3IGGA 3DPKA 4C62A 1ZARA 3ENHA 2GTNA 5CS6A 5AP7A 4AN3A 4AT4A 4UMRA 4HYSA 4BGQA 4BTMA 4A9TA 5K9IA 4UY9A 4F1OA 2G9XA 2EVAA 1Y8GA 2B52A 4O2ZA 5DG5A 4M8TA 3ZDIA 4ERKA 5AUZA 3I79A 2XK3A 4HGSA 4OBOA 4YO6A 4DINA 4BDEA 4JXFA 3SW4A 4YJPA 4Y5QA 3PSBA 5IH6A 2YM6A 1XBBA 1OECA 1OL2A 4TWNA 3UVQA 2HENA 3G33A 2IVVA 4TPTA 3HNGA 3W0OA 2B54A 4GEOA 1XJDA 4FUYA 4CCBA 4FV6A 4IB1A 2R3JA 1E9HA 5L2QA 4GIHA 5KKRC 3VO3A 4OAUC 2UZLA 3CSVA 2VTJA 3AD5A 3CC6A 4GFOA 4BGGA 2GPHA 3TTIA 4R1VA 4IM0A 2YEXA 2FUMA 2WQOA 1OL5A 1UKIA 3V5LA 4QP7A 4KUJA 3DTCA 3OY3A 4IAZA 1Q97A 3IPHA 4G9RA 4PL3A 3DBCA 5E8ZA 1OBDA 5LVPA 1ST0A 4CTBA 5JH6A 5DGZA 4ITHA 1O6KA 1PHKA 2QODA 3AT4A 3MFTA 5HIBA 5E7RA 3Q9ZA 3QRTA 4PPAA 3A8XA 4ZTRA 4DYMA 1Q8YA 2OIBA 3TCPA 4L6QA 4G9CA 3GC9A 4M69B 4OUCA 3TI1A 3VJOA 5IU2A 2B9IA 1ZMUA 3D7TA 1ZMWA 3VS4A 4EQMA 4G17A 5ACBC 5J9ZA 5LOHA 1UU7A 3I5NA 3PDTA 3W0SA 4L67A 4YZDA 1A9UA 4O7LA 4LL0A 1R78A 3W16A 4II5A 3TT0A 4Z7HA 4KB8A 1TQPA 2UZBA 4ZEGA 3Q9YA 4G31A 2WMBA 4FT9A 2QOIA 4MHAA 2B55A 1H1WA 2WMXA 5CT0A 1Q41A 4CFFA 2PZPA 3EOCA 4IAIA 1SMHA 2PUUA 4FC0A 5JQ5A 5K4IA 3U8WA 1RE8A 3E88A 3NIZA 4M14A 4C34A 1LEZA 3KK8A 2CLQA 5FUTA 2G2FA 4AT3A 1BI8A 4E1ZA 5HIDA 4UMPA 3RAKA 3V5JA 3TNQB 1TQMA 3HRFA 4FV0A 4I23A 1W2FA 3L9MA 3R7UA 4G3EA 2EB3A 2Z02A 3HECA 2HAKA 4FTIA 5TT7A 3PIZA 4F7SA 4BL1A 5J5SA 3BCEA 1QPCA 3HV6A 4XBRA 4Y46A 5A54A 3U87A 4U5JA 3OT8A 5K5NA 3RKBA 1JPAA 4O6LA 2HY81 3L1SA 2BR1A 3PRFA 5EM7A 2YHVA 4FEWA 2XNOA 4IC7A 4F4PA 5HG7A 3ZM9A 1H1SA 4X6RA 2W9ZB 3ORZA 5DVRA 1SVGA 3GEQA 5C4KA 3I4BA 3ZLYA 4BCIA 4DEHA 5HORA 1YOLA 5K0KA 4BDKA 1Z57A 2AYPA 2OO8X 4DFXE 3PE1A 1WVYA 4E5AX 3CGFA 4CFWA 3TNHA 5JGBA 2W0JA 4F99A 4QTCA 4Q9ZA 4O1OA 5KMLA 4E8AA 4FSYA 3FXWA 4H36A 1PXPA 2XYNA 1OPKA 2FSMX 4PRJA 5AFVA 2QLUA 4WG3A 3NCZA 4QTAA 3A4OX 3RJCA 2OKRA 4YLLA 5HE3A 1YRPA 5IDNA 5AV4A 1O6LA 4QP8A 1ZRZA 4EHGA 2JIIA 2Q0BA 3AG9A 3FZRA 1O6YA 4YLKA 4BDJA 3W8QA 2XYUA 4M67A 1S9IA 4XG2A 4DGOA 3PP1A 4AF3A 1W2DA 2R3KA 2IW6A 2W96B 3MY0A 4L68A 3WZDA 4PL4A 2JAVA 4BCHA 3JVRA 4O96A 4PDPA 3NUNA 4EOKA 3KRXA 4YHJA 3FEGA 1X8BA 2CN8A 3ZS5A 1U4DA 2WMQA 3ZO2A 4FZ6A 4LL5A 1SYKA 4Q5EA 4GK2A 1NT2A 3UDTA 2YWPA 2F2UA 2B9HA 3GC8A 3HP2A 4FZAB 5JN2A 2WQNA 5DIAA 2DQ7X 2YAKA 2C3IB 4ITIA 4RIXB 3HZTA 5LMKA 3HGKA 1KOBA 5FDPA 4IH8A 4OTGA 4NU1A 2ITUA 3QLGA 4EBWA 4NM0A 4O0SA 4BKZA 4XG3A 2ZV7A 3ACJA 4EOJA 1XH6A 3DDPA 2FH9A 4WNMA 4DN5A 4E26A 3BHTA 3NYOA 4PPCA 4LI5A 4BI2A 3CE3A 4XRJA 4M0YA 3ZC5A 4D2VA 3C4FA 5CX9A 5CU0A 3DBDA 5BVKA 3COMA 1UKHA 2C5VA 3EQFA 3NX8A 5HVJA 5HTCA 3DXQA 4WT6A 3UE4A 5KBQA 1RJBA 2W99B 4H3PA 4I94A 4GMYA 3KC3A 4USFA 4HYIA 3LFSA 4IANA 2V7AA 4A4OA 2OLCA 5DRDA 5HZNA 4FOBA 1GJOA 1MRYA 3ZFXA 4QQ5A 2Q0NA 5EG3A 3ZEWA 4QNAA 2VTOA 5L2TA 3C4XA 3ZFMA 4RSSA 5HX8A 4PUZA 4FICA 3UIBA 3ROYA 4DHZA 4MEDA 1ZOEA 4K11A 5B2KA 3WIKA 4FKPA 3BRBA 1ZWSA 5M07A 5BMSA 1XHAA 5IQDA 5CXZA 2FSLX 4FTLA 4K2RA 3NNUA 4NWMA 5EHYA 3SOCA 5KHWA 4XV9A 3UOJA 2OF4A 2H9VA 4ALUA 5HE1A 2WGJA 5BQ0A 2XJ1A 4O0YA 3G9NA 3RPOA 4TL0A 4I0SA 3FKNA 3KY2A 4FF8A 2PUNA 3R1YA 3PVBA 2WZJA 3BV3A 4LQMA 4KBKA 3FPQA 3RPVA 2OW3A 4ZSAA 4O7YA 5JFSA 1JQHA 3LPBA 4MXOA 1Q62A 2O3PA 2RG5A 3AT3A 3QQFA 4PX6A 4BCPA 3MVJA 5HGIA 4FKRA 2W1ZA 3FMKA 4FT3A 3TXOA 3GCVA 3W2RA 4AA5A 2C3KA 5M57A 4DFLA 2KULA 4UWYA 3GGFA 2UVZA 1YXTA 3RI1A 4DG0E 4L3LA 3T9TA 4FSZA 4F64A 2R4BA 5AP0A 4KABA 4FV1A 3PA5A 3QZGA 2C47A 3LCDA 3TTJA 5CNOA 4FV4A 4J95A 5DT3A 4ZTLA 3PA3A 4BWKA 4FTNA 3PJ8A 2CMWA 5GZAA 3QRKA 2YJSA 4FTRA 2C6EA 3IK3A 5AR7A 4E6DA 4QMWA 4IJPA 4K33A 3Q2JA 4QRCA 3H4JA 5IDPA 3TDVA 4MXZA 3QQLA 4RVLA 5GJFA 5CEQA 4FNWA 4V01A 3R2BA 4DH5A 3LXKA 2UW7A 1JVPP 3UP2A 3BYOA 3AGLA 2BVAA 2PMOX 3GQIA 4UZHA 1FMKA 2F7XE 3EWHA 4FTAA 4HVSA 2VN9A 5CF5A 2YWVA 2C5YA 3CKXA 3NW5A 3QGWA 3NVKI 5AEPA 2X81A 4XYFA 4EYJA 2BKKA 3K54A 4YJOA 2OJ9A 1Q99A 4EKKA 1SVHA 3D5WA 3F2AA 4IBMA 1IAHA 4CRLA 3LW0A 2WXVA 3MJ1A 3VONA 2C0IA 3LFCA 4IWDA 4O7TA 4DGGA 3WARA 4M0ZA 3R1QA 2XCHA 2I1MA 4BBEA 1OB3A 4ENXA 2IWIA 2YN8A 3KXZA 4G