1UA2A

Crystal structure of human cdk7
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
299
structure length
286
Chain Sequence
EKLDFLGEGQFATVYKARDKNTNQIVAIKKINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human CDK7 and Its Protein Recognition Properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, transferase
molecule keywords Cell division protein kinase 7
total genus 66
structure length 286
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ua2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ua2A01
4QMNA 3RVGA 2J2IB 4U79A 3FZTA 4BI0A 1NA7A 1H8FA 4FTAA 4BKJA 4NU1A 4R78A 4U43A 4NUSA 4RJ6A 1J91A 4MWHA 3WF6A 1E1VA 2GQRA 3MGYA 4MVFA 4I22A 3E3PA 4JX3A 2J51A 3ZUUA 5HO7A 3OXIA 1H1QA 3I7BA 3P9JA 4FTOA 4ONAA 5LMAA 4ZK5A 3LM5A 4TYGA 5ETFA 2UW3A 5A4TA 1SVEA 4TWNA 5IH4A 2WELA 5J7BA 2UZLA 3FUPA 4N70A 3E93A 3PE1A 5AMNA 2PZRA 3D4QA 3NYXA 3KXGA 3ACJA 4NM5A 4TKSA 3KXXA 5FBOA 4I21A 3R8VA 3RAKA 2C6DA 2UZWE 5CNNA 4MD7E 3VS1A 2QC6A 2RFDA 5IA5A 3R02A 1ZMVA 2R3FA 5IQDA 4YBKA 5LMKA 3UZTA 3CJFA 3FHRA 3L9PA 3D9VA 3HA8A 1BX6A 1GNGA 5EDQA 2OXXA 3GCPA 5DN3A 4EH2A 3QRTA 2P2HA 3DV3A 4IMYA 4BCOA 4IZYA 1KE7A 4GW8A 2P2IA 2R3QA 3VW6A 3E64A 5K5XA 2JC6A 3B8RA 2R9SA 2XNMA 4HJOA 5KO1A 4IBMA 1KWPA 5E8TA 3EL7A 3S95A 5DT0A 4AGDA 4BCGA 4WNKA 5B2KA 4NIFA 3RAIA 2QLUA 5AA8A 5L8LA 3AC8A 4D4SA 3VHEA 1YOJA 3WZEA 2YWPA 1H01A 3SLSA 3RPVA 4DGGA 3MVMA 4ZP5A 4DBXA 3EHAA 2C69A 4YU2A 3D7TB 2DUVA 1PJKA 1BMKA 4QP7A 2FB8A 3MYGA 4Y85A 4HPUE 3OTVA 4I4FA 4OTWA 5H8GA 5LMBA 3LFAA 4O96A 5DLSA 4WG3A 2GPHA 2VO6A 2WXVA 4IIRA 4O7SA 3LXNA 3LXKA 4ENYA 2IPXA 1UU9A 3PG3A 1Q8TA 3OWKA 5LARA 4K8AA 3O8TA 5K3YA 5DMZA 3QQKA 5LMKC 4Y46A 1UU3A 2WU7A 5AR5A 3RINA 3S4QA 2GFCA 5DEYA 5AP6A 5HU3A 4IX4A 4LOQA 1Y6AA 3E7VA 3EQGA 3FLWA 3FSFA 3T8OA 3BQRA 1UKHA 3F2NA 5EW3A 4DG3E 3EIDA 2QHNA 5A9UA 2WMAA 4F08A 4NKSA 2G1TA 2OJIA 5EG3A 2J0LA 1UU7A 3TDWA 1PXOA 3UNJA 4X2GA 2ITQA 3NWWA 2QOQA 4BKZA 1UV5A 5C27A 4PUZA 5C03A 4CFFA 5BMMA 3PSCA 4BDKA 2W06A 4OBPA 4DGMA 2CKEA 3F61A 4DFYA 2HWOA 2VTNA 1KV1A 4PQNA 3G5DA 3HX4A 1UNLA 1CKJA 2O63A 2XF0A 4KB8A 4MF1A 4CFNA 4C4EA 3T3UA 4DEHA 5L2TA 1NY3A 4D1XA 3ZRLA 1OM1A 3HMMA 1UU8A 1F3MC 1ZYJA 3Q9WA 3OWLA 4IANA 2IZSA 5CWZA 1YRPA 5CXHA 5DT4A 5EDPA 5I3RA 3TZ8A 3FMLA 3H4JA 3WARA 5J1VA 4OAUC 4DTAA 4GV1A 4LYNA 3R1SA 4EJ7A 4RWIA 1LUFA 5J8IA 5AR4A 5IA3A 4IWQA 4GKHA 4D1SA 2WOUA 5FTOA 2FGIA 2QO9A 3F6XA 5D9HA 3FY2A 4NTSA 4KKHA 4FV6A 4ITIA 4BYIA 3II5A 4HGTA 5HD7A 3TV7A 2J9MA 3PYYA 5AUTA 3SGCA 5FP6A 3GUBA 4YJQA 4DEDA 3Q04A 2XA4A 1ZZ2A 4JRNA 1U54A 2BUJA 1YWRA 4O0YA 1OECA 4UYAA 5T68A 3FXXA 1M2QA 2C6OA 2C1BA 4IFGA 3E8DA 1MQBA 3P78A 5CT0A 4MYGA 2XM9A 3IGOA 2X9EA 5EI2A 4CFWA 3QKLA 3QFVA 3R01A 4FTNA 4I0RA 2C68A 3FMHA 3BYOA 4XOZA 4GH2A 5EOLA 4ACGA 3H0ZA 4IWOA 3EQRA 3MH0A 4CXAA 3W1FA 2OKRA 3W8LA 2UW7A 3L8XA 3QU0A 4KIKA 3TNHA 3COHA 3MPMA 4R5SA 2VAGA 4HNIA 4BCQA 4E3CA 5I5ZA 3LCOA 3KVWA 5DRBA 4APCA 3S00A 1WBPA 3VQUA 3MVHA 4U6RA 2X39A 4BBMA 4HW7A 3L8VA 4YNOA 4FTIA 3N51A 3ZHPC 4GG7A 3SW4A 3I5NA 3AMYA 4L52A 1J7UA 1YVJA 4LOOA 3ORTA 2VWXA 4QTAA 3PJCA 3Q96A 4O7RA 3KQ7A 3BE2A 1JAMA 3BWFA 1Z57A 4GYIA 3LM0A 5E8YA 3WYXA 4BC6A 3R9NA 4BCHA 4BI2A 4D4VA 4QTEA 2C5OA 4IVCA 5A14A 5HVKA 4R6VA 4V0GA 4E5AX 2V62A 3LQ5A 3O23A 2FSMX 3S2PA 4F1MA 2JDTA 2VO3A 4YO4A 5M08A 2AYPA 2Y7JA 5J9YA 5I9UA 1AGWA 2HXQA 3IGGA 4JDJA 4EYJA 1PMNA 2WQBA 1UVRA 2VWIA 2WTVA 5EOBA 3EQBA 2UZVA 3CS9A 1WBWA 4PY1A 2BRBA 4G6OA 3TG1A 3SXFA 3KN6A 2C6KA 3QL8A 3FV8A 3QRIA 5HNBA 4XLIA 3Q6WA 4LI5A 5AAFA 5FXRA 5KBQA 5BQ0A 3RZFA 2G2IA 2W4OA 2Z8CA 2I7QA 3EJ1A 5BVKA 2PMNX 4PV0A 5CAQA 3UOLA 4ZSJA 1P4FA 3OTUA 4OTPA 4LM5A 3V5WA 3VRYA 5HU9A 2YZLA 4U9AA 2PL0A 3QAME 4QNAA 2FSLX 4YTHA 3ZXTA 3DCVA 5HD4A 3R30A 3GEQA 3KK8A 4AN2A 4IM2A 3KCFA 3VS6A 2GTNA 2QI8A 3DBEA 4AW5A 3NNWA 3BYUA 2IW8A 3R7VA 4ZMEA 1YOLA 2QURA 3MIYA 1CTPE 4HGEA 5GJFA 4BGQA 5JQ5A 4DTBA 3ZRMA 1ZLTA 4FL2A 1H07A 2V0DA 5D10A 4XS2A 4K2RA 3ODYX 5EFQA 5EKNA 1ZWSA 3DXPA 3WZUA 1GJOA 4IX5A 2GNIA 4V01A 1CDKA 1MP8A 3MV5A 4WUAA 3TKHA 5E91A 3QA8A 2YDKA 2PULA 4QMXA 2F2CB 4QMOA 3ACKA 3UNZA 2IVUA 4BWXA 2FSTX 4IZ7A 2H6DA 4X2KA 1GZ8A 5CZIA 4BKYA 5AM7A 4CZYB 2AC3A 3R1NA 4IJPA 3QX2A 2F49A 4ERKA 2JIUA 4TYHB 4L53A 3O2MA 3H9RA 3VS7A 2ZV8A 3A61A 1Q41A 3ULIA 3MJ1A 4FIIA 2ITYA 3R22A 4PPBA 2XNPA 2QNJA 3Q4ZA 2R3LA 3F5UA 4Q9SA 2CHLA 4WNPA 2QOCA 5BYZA 4HYSA 3CGOA 4KIQA 5DBXA 5LXMA 4GCJA 1CKPA 3HUBA 3DNEA 3UIUA 4E4LA 3F82A 2EB2A 4YUQA 3DKOA 2VTIA 5AADA 5DGZA 3NLBA 2EB3A 2OXYA 5L2IA 1K9AA 4JR7A 4TWOA 3A4OX 3TNQB 3P7BA 3P0MA 2VX3A 1SMHA 3F9NA 3FLZA 4ANOA 2PVHA 3RM6A 2PVLA 2WMBA 4XHKB 5FUTA 4YHFA 4TN6A 3EH9A 4H3BA 4FVPA 3COKA 3THBA 3TWJA 5D11A 1M52A 3ZUTA 4MXYA 3GENA 3NEWA 4DH1A 3SQQA 3DZQA 3CGFA 4J52A 4RC2A 3HYHA 5FEEA 3DB8A 3JVRA 2ITNA 4HGLA 4UV0A 3Q2MA 3WF9A 3TUCA 2PYWA 4U0IA 4QP3A 3KC3A 3EWHA 1XH6A 3LVPA 1XBBA 2J50A 3PPJA 4C4HA 2B9HA 4M8TA 4EOOA 4CV9A 3CEKA 1ZYLA 2OF4A 3NUXA 3RPOA 4F0GA 4O7LA 3OY1A 3UIMA 5ANEA 5EYDA 3TZMA 2E9PA 2F7ZE 4QMYA 3UYSA 3PRFA 1PXJA 5M4IA 4IX3A 3KFAA 4FR4A 4M69A 5FDXA 2YLEA 4AFJA 3MA6A 2JFMA 1H24A 5AV2A 4CNHA 4TW9A 1JBPE 2PHKA 4FKGA 3U9NA 5KMNA 2XP2A 4PPCA 5HG7A 3DBQA 4C4GA 4D2RA 4BDGA 5A4LA 5KBRA 4NSTA 4H3PA 4LGDA 4DFUA 4ZY6A 4AOTA 5B2MA 2VTPA 1F5QA 4NJ3A 4R3CA 2QOKA 3PVUA 4YZMA 3CBLA 4GJ3A 3RP9A 4S32A 5AR2A 3KY2A 4QP2A 1R1WA 5M44A 1YWNA 2Y0AA 1YDSE 4CG9A 2HW7A 5CU6A 4AW1A 3LJ1A 4EOSA 3ZZEA 4RMZA 3PWYA 5JRQA 3ODZX 2DS1A 3W55A 5IEXA 3QGWA 2WFYA 4QYFA 2JAVA 3DKCA 2C4GA 4B7TA 3E63A 1JKKA 2OW3A 3UZPA 3V5PA 2C0OA 4EOKA 3DFAA 4I5PA 4OAVB 3LQ8A 4B6LA 2R3IA 4R7HA 3ZS5A 3EQCA 3T9TA 3V5TA 4FTCA 1YHVA 3BU5A 2YM8A 3IW8A 5AUUA 4FEWA 4PX6A 4WO5A 4LV8A 1UNHA 5LWNA 4GT5A 4ZZOA 3I5ZA 1ZARA 1IG1A 3PVGA 3FYKX 1XH4A 3PA4A 4O0SA 4YJNA 3QTZA 5C8MA 4AXAA 5AX9A 3QD2B 4G17A 3VWAA 4A4LA 4AQCA 4Z55A 2UW4A 5J7HA 4DH3A 3OC1A 4EH9A 4R77A 1H0WA 3ORXA 3GC0A 4C4FA 4X0MA 5LOHA 3TN8A 2OO8X 3BLRA 5CEOA 4FSYA 5C01A 4AGCA 4EOLA 4V05A 3IW6A 5IA4A 1A48A 3SG9A 4D9TA 3R7GA 4EORA 4NM3A 3RCJA 4AA5A 1KSWA 4FE2A 4ZSGA 4Y8DA 3JPVA 4F4PA 1OIYA 3ZC6A 4V04A 3FBVA 4KAOA 3UVRA 4ALWA 3OS3A 4IM0A 5JRSA 5C26A 5AV1A 3CQUA 1SYKA 2UW8A 3IW5A 3JVSA 3BPRA 4ALVA 2ITPA 2QOIA 4DT8A 3T3VA 1IEPA 2VNYA 3H9FA 3FLNC 3MVJA 4BTJA 4C58A 4F7JA 3DKGA 4AA0A 2Q83A 3ZM4A 4RJ8A 2FO0A 4QQJA 4TWCA 4E6QA 3BGQA 2FH9A 3NUAA 3MSSA 3QRKA 4RIXB 3PTGA 3RMFA 3VS5A 4CRSA 3PJ1A 4X2FA 5TR6A 5KHWA 3JY0A 3KN5A 2QLQA 2R3OA 4NW6A 4FICA 3LHJA 3QCSA 4P4CA 5M4UA 2YWVA 4BDEA 3ZOSA 4FVQA 1E1XA 3I81A 1L8TA 4M97A 3R9RA 3QQLA 1UA2A 2XKDA 4KSQA 5FD2A 1Y8GA 5EI8A 3SX9A 4EH6A 5IH6A 2UVYA 3MTFA 5KMIA 1VZOA 4JG7A 4IB5A 2YCFA 2QOHA 2PVFA 3BLQA 4A06A 2PUNA 5CSVA 2GHMA 2GNGA 4IX6A 4BBFA 4LOPA 3HV4A 4FTRA 3MPAA 3QF9A 3UG1A 4FG7A 3W18A 1YDTE 2WU6A 4EZ3A 2UW0A 5CZHA 3U9CA 2H8HA 4WUNA 5TOZA 4A9YA 4AZVA 2GNJA 3O96A 3VF9A 3A7JA 3RI1A 5IA2A 4BL1A 4F9AA 4UWYA 4RFZA 1MRUA 5CVHA 3MDYA 2IN6A 1Q3WA 4I6QA 4JXFA 2VU3A 3NUSA 4NH1A 5HBJA 3MY0A 2Y4PA 2R2PA 4RX9A 4USEA 4FSWA 4FTQA 4HYUA 1J1CA 3A60A 4QMSA 2ITTA 4W4VA 1QPJA 2C6TA 2PVYA 3WZKA 4B99A 3E8EA 5IDPA 2G2FA 4RIYB 4FIJA 3MIAA 4EHGA 4XJ0A 3ZO2A 5D7VA 5HO6A 4MXZA 2BHHA 4ZTLA 5HKMA 3TNPC 3FI3A 4CCUA 3FZRA 3FJQE 3VUIA 4CFVA 3WBLA 4C34A 2C47A 2XVDA 3ZLSA 4EOQA 5KUPA 2R64A 2HW6A 4BFMA 4MXAA 2R3JA 2BVAA 4BGGA 5IEVA 4J8NA 5DR2A 3EOCA 3NR9A 2XK6A 3IOKA 5JH6A 4KKEA 4KS7A 3F2AA 3UC4A 4X6RA 4TTHB 2WIPA 4CT1A 4CRLA 4S30A 1VJYA 3HECA 3KF7A 3NW7A 2BFYA 3IG7A 3AT4A 5B7VA 3ORKA 5HX8A 3EFKA 5M57A 5DIAA 2QHMA 2WEVA 3PXQA 3E88A 3PJ8A 5J95A 5JKGA 4WIHA 1YWVA 4NKAA 5M06A 1AD5A 3CP9A 4AF3A 3KMMA 5JGBA 1XKKA 3LZBA 2QOFA 5H8BA 2BAJA 3NUNA 4CFXA 4WNMA 3DOGA 5A4CA 4G3GA 3WYYA 3ZYAA 2WOTA 4FSUA 4FF8A 4FL1A 5EM5A 5A46A 2FSOX 3K54A 2VO7A 4FI1A 4MHAA 3DK6A 3OMVA 3Q6UA 4C59A 2V55A 1OKVA 3FI2A 4RBLA 2BIKB 2YIXA 1KUTA 3FWQA 2ZOQA 4GYGA 3G6GA 4FV8A 4QD6A 1DAYA 3LFQA 3SOAA 4GEOA 2V22A 4E5BA 3PLAE 1ZOHA 4DH8A 2ZB1A 4XG8A 5HCZA 4BIDA 2RGPA 2OU7A 3QX4A 4DITA 1CSNA 1PKDA 3G9LX 2CGWA 1DI8A 3B2WA 3FC2A 5LJJA 4FV1A 4QTDA 2YISA 5LQFA 4FTUA 3OCGA 3KMWA 2GNFA 2PVMA 1Z5MA 4AN9A 4BCJA 4KNBA 4DYMA 4HVGA 3R28A 5HE2A 4AACA 4FTLA 1K3AA 4W4XA 5IUHA 1KE8A 2XYUA 4YNEA 5HNIX 4MNEA 4RGJA 1XBCA 4CFMA 2W1CA 4E6DA 2XJ1A 4UB7A 2X7FA 3EL8A 3SW7A 2UV2A 3BHTA 4J7BA 5M55A 4O1PA 5TKDA 3BBWA 3TNWA 1CKIA 3M2WA 2VO0A 4IQ6A 3D0EA 2RG6A 1H1RA 3ORIA 3R6XA 2Z2WA 4I0SA 5IMEA 2R3HA 4O7NA 1WFCA 5ACKA 4FT0A 4S31A 4ZY4A 3QHRA 5LVLA 4P5QA 3U6HA 3QXOA 3R7EA 2F9GA 3K2LA 1U4DA 4G9CA 1Q97A 3EMGA 1PYEA 3LFDA 4EOIA 3KK9A 2VZ6A 4O2ZA 3UGCA 5DR6A 2E2BA 4L45A 2J5FA 3NUUA 4J96A 4R1YA 3RK9A 2BCJA 1B6CB 4FV2A 4K9YA 3NZ0A 4ZIMA 3IW7A 5FP5A 4YLJA 4IHPA 1ZXEA 4JG6A 3F3TA 2O0UA 4OTIA 5K5NA 3DQWA 2B55A 5B0XA 2WMTA 4PNIA 4YZBA 5CEPA 3A7IA 3HL7A 3ZH8A 1Q4LA 1YI4A 1OITA 3JS2A 3ZEWA 3D5UA 4H58A 3SOCA 1P2AA 4DLIA 2H34A 1R78A 2OH4A 3O17A 3MBLA 4FZFB 2CMWA 2PVKA 1PY5A 4GIHA 4KS8A 3SG8A 3TTIA 4F65A 5BX0A 4DEAA 5HBHA 2W05A 5DPVA 3MFTA 1URWA 4RPVA 3UQCA 3DTWA 3SXSA 4QYEA 4ALUA 3I0OA 3NNUA 3CR0A 4AZFA 4TT7A 2JKKA 1ZY4A 3P4KA 4XEYA 2X9FA 3EQPA 4R7BA 3VAPA 4ZMFA 3DS6A 3KRLA 4IB1A 4JAIA 3C0IA 3AC1A 5JGDA 4Z16A 4YO6A 5C9CA 3TUBA 4CLIA 1W0XC 3BBTB 4I5MA 2UZNA 4AT5A 2BMCA 2XNGA 2YCRA 2JD5A 4JJRA 3A7HA 3IPHA 5E8SA 5GZ9A 4UMRA 4QP6A 1O6LA 2OJ9A 4F7SA 4KUJA 3OZ6A 4ZLYA 2W5HA 4U8ZA 1O9UA 4L9IA 5AX3A 1ND4A 3LJ2A 4KD1A 5I0BA 3ZO3A 2XIXA 4RIWA 4RG0A 3NVMB 2X2MA 3HV6A 4L6QA 4RVMA 1XH8A 4ZOGA 4GSBA 3FI8A 5CI7A 2OLCA 3IONA 1H00A 3AGMA 4ZS0A 4I5HA 4BBEA 5CAPA 4ASEA 4O27B 3QUPA 2W1FA 4AZSA 3SV0A 4MAOA 5CI6A 4ZLOA 3MB6A 5A3XA 5FTGA 5ACBC 4AE9A 4ANMA 5D12A 1PXMA 1HCLA 4PMTA 2XIRA 3KXHA 4QMWA 3W2OA 4PL5A 4IH8A 5FTQA 4BWKA 5AV3A 5TF9A 3CY2A 3PG1A 3ZLXA 5CAOA 1OBGA 2QU5A 3ZM9A 1YXSA 4X2JA 4DC2A 4D4RA 4E93A 4ORKA 2WHBA 1H25A 1MRVA 3POOA 4NT4A 4IDTA 3MA3A 3R1YA 5EM6A 1M2PA 4G3EA 3UVPA 4ASDA 3VUMA 4CKIA 3ZO1A 4M69B 4YC3A 5CEIA 4E7WA 2QO2A 3SC1A 4IZ5A 2P4IA 3P7AA 5E8WA 5AP1A 3HV3A 4MNFA 3RWQA 4UYNA 3UOKA 2BILB 2PZIA 2XNEA 1GY3A 3H10A 4YPDA 3G90X 4D55A 2OJFE 1PXLA 3W16A 3NYNA 3P86A 3QALE 4XLVA 1GOLA 4HVIA 4RC3A 2R3MA 1Q61A 2YFXA 4FG8A 2XCKA 3ALOA 4O0VA 4MEDA 4QYHA 2DWBA 1FMKA 1FVTA 3FQHA 3PA5A 3POZA 4CSVA 5I9ZA 3ROYA 2OGVA 2VGPA 5KMKA 3HP2A 5GIPE 2NP8A 3DBCA 2WTKB 2O65A 4C3RA 4C4IA 2PVJA 2PVNA 4K18A 2EUFB 4O7WA 3QQUA 3OT3A 4IC7A 2CGXA 3FSKA 5AIKA 5DI1A 4BICA 4FSTA 2REIA 2GS2A 5HE3A 4L42A 3R8MA 4D2WA 3JXWA 2XBJA 2F2UA 2I1MA 4XX9A 5EHYA 2QQ7A 4TYJA 2W99B 3WF8A 2W9FB 5CASA 1M7QA 5E4HA 4G2FA 4E4MA 3MH3A 1BUHA 2PK9A 4GK4A 1A9UA 5AWMA 5TO8A 3PIZA 2RFNA 3HV7A 2F7EE 3K3IA 3R0TA 1S9JA 2I6LA 2DQ7X 4FC0A 4M67A 5KMLA 1OVEA 1YXTA 3UO6A 5A4EA 5CEQA 3VS4A 2XEZA 4F63A 3H9OA 4G1WA 5CYIA 3LE6A 2OSCA 4GU9A 5CEMA 2PE2A 5LCJA 1YDRE 3P7CA 5E7RA 5KMOA 2W5AA 3DK3A 3KKVA 4C36A 2E9UA 2JIIA 4H39A 1K2PA 4BDIA 4OTFA 2J6MA 5L6PA 3KRRA 4QP8A 5AV4A 4JIAA 4IDVA 4A07A 5HE1A 4WOVA 4G31A 2WMSA 5E8VA 1Q8UA 3BZ3A 3QZHA 2ETKA 3UMXA 4O0WA 3VRZA 2RG5A 3ZEPA 4CD0A 1RE8A 4Z9LA 4U7ZA 5TE0A 4EUUA 3ITZA 4TYEA 3OCSA 4UZDA 5CENA 1WVXA 4LQMA 5KKRC 4ZJJA 3NNXA 2BZJA 1OPLA 2O5KA 5IH5A 3MW1A 3ZTXA 4FOCA 4CKJA 2YM3A 3BHUA 5BVOA 4JAJA 4DEGA 3MJ2A 2XIZA 1OIRA 4HCUA 2YIYA 1LP4A 2CCIA 2VGOA 3GU4A 3R71A 1UKIA 2FYSA 3JY9A 5I9XA 4GG5A 4C62A 5F9EA 1ZOEA 5HG5A 5CU4A 1WAKA 3G6HA 3CLYA 5M09A 3IS5A 1MRYA 3O51A 4QYGA 2GSFA 2QONA 1U59A 4NL0A 4HCTA 4L67A 3LJ0A 4YC8A 1Y8YA 5CU2A 4Y73A 4GJ2A 2C3KA 2YABA 3REPA 4XG4A 5JN2A 4BRXA 2ZM1A 4FZ6A 5HG8A 3MI9A 3DNDA 1U46A 2ZJWA 4BDJA 2Y6OA 4XG9A 3IO7A 4J8MA 3AC2A 5JMSA 1BLXA 1ZYDA 2C6IA 3HAMA 5CANA 5BMSA 4CMUA 4O91A 2HZ0A 1YXXA 4FKJA 4TRLA 2FVDA 1SM2A 2XNBA 3E92A 4RVKA 3Q53A 4MK0A 2NRUA 5M53A 2PSQA 4NZWB 3VUHA 4O7VA 2PMOX 3RAWA 3K3JA 3VBYA 5BYYA 5GIOE 3PP0A 3BHHA 1SNUA 4ANSA 3NAYA 3E3BX 4PRJA 4RIXA 3QCXA 5J9ZA 3CQWA 2VWWA 3QC4A 3BEAA 3UO4A 3QTQA 3O7LB 3G33A 2EXEA 3F88A 5LVMA 3D94A 3Q9XA 5HVYA 3BU3A 4NEUA 3FAAA 1YI3A 4UALA 4QQCA 4DEEA 2VRXA 5HX6A 4JBPA 4F9WA 4RVTA 2CLXA 5CSXA 5D7AA 1OPJA 4MBJA 3FDNA 5KZ0A 3COMA 3S3IA 5I9WA 3GXLA 3KL8A 4QPSA 1M2RA 2R0UA 3CKWA 3QUDA 4H36A 4MXOA 2CN8A 4F6SA 2UZOA 3CIKA 4J98A 4OGRA 3LKMA 3GFWA 4C8BA 3Q4CA 3ZSGA 2W4JA 1NXKA 3E87A 3EYGA 3KXMA 4PMSA 3CD8A 3MY5A 3I6UA 3GFEA 4QPAA 3ZC5A 3AOXA 2A27A 4D4YA 2CNVA 5F4NA 2QOBA 2ZYBA 1U5RA 5BVEA 5JFVA 2ESMA 5GJDA 3QA0A 1WBOA 3C4CA 3UOHA 5DH3A 3PP1A 1UWHA 4M12A 3DDPA 4AWIA 1G8SA 2JBOA 5J79A 4K0YA 3OEFX 3UIXA 4AOIA 5EH0A 2WPAA 2BROA 2W1DA 3NUPA 5AP7A 3I7CA 4FZDB 4D28A 3GQIA 4EQMA 3OVVA 2X7OA 4IWPA 5BYLA 4HNFA 4FZ7A 1KE9A 3F3UA 3GQLA 3LXPA 4PL4A 1YXVA 4LMNA 4EC9A 4FUYA 2I0EA 1FVRA 4I23A 4AZTA 1XJDA 4RIYA 2PUPA 2ZMCA 2XJ2A 3C0GA 3HGKA 3VVHA 2WMQA 3G0EA 3UZRA 1XQZA 4JX7A 5E90A 4AN3A 1OKWA 4JL9A 5CEKA 1WZYA 1YW2A 1A06A 2VTOA 2OXDA 3FHIA 3VBWA 4I94A 3LCDA 2C5NA 2BDWA 3BYSA 4E4NA 2XZSA 3F7WA 3VS2A 3AC5A 4R7IA 2IZTA 3TZ7A 4GUEA 4O83A 1PXPA 3KRWA 4PMPA 2BFXA 5AUYA 4PF4A 3QLFA 5T3QA 4DFBA 1FQ1B 3BI6A 3LFCA 4Z3VA 4DFXE 3G9NA 3G51A 4YR8A 4IEBA 4EBVA 5DE2A 5JSMA 3EZVA 2HIWA 3F5PA 3QTXA 1KOAA 4FODA 4O81A 3HLLA 2CN5A 2BDJA 5J1WA 4ZXTA 1ZZLA 2NO3A 2GDOA 4ARKA 3F7ZA 2G9XA 3H0YA 3GI3A 4F9CA 4FL3A 4CVAA 4JBOA 5AUWA 3DBFA 1FGKA 4ZTQA 3E5AA 4GMYA 3R9DA 4FTTA 2E9OA 1DS5A 1Y91A 4MBLA 2PZPA 5FXSA 1PF8A 4RA4A 3UP2A 2P55A 4EH5A 4EH8A 3HDMA 3C51A 3FZSA 3HEGA 3UQGA 5LVOA 3D5WA 4IAZA 4C4JA 1JSTA 2VNWA 4F7NA 2IO6A 5M56A 4RFMA 2Z02A 4RLKA 1YXUA 2WO6A 3A4PA 3KULA 4U81A 1ATPE 2ITVA 4MTAA 1ZY5A 3IQ7A 1J7LA 3EN9A 4P2KA 2W1EA 5HHWA 2YDJA 3FZPA 4QO9A 4I24A 1U54B 4I20A 5IEYA 2UZBA 2OIBA 1G5SA 3QKMA 4FKWA 4J53A 5DWRA 3EB0A 3KRJA 4FNZA 4UXLA 1H1SA 3ELJA 1B39A 2Y4IB 3R9OA 3DFCB 4YJVA 5IDNA 2WQNA 4FT7A 4ZEGA 3BELA 4RSSA 2QCSA 2HAKA 3NAXA 4RT7A 4EBWA 2VWYA 1KV2A 3MH2A 3S1HA 5F20A 5HG9A 1P5EA 3EQIA 2VTAA 4RWKA 5CSWA 3CC6A 4ERWA 4FG9A 3E8CA 2VN9A 4KWPA 1T46A 4FEUA 1RDQE 4UMUA 1WVWA 5A6OA 5E92A 3ZDIA 4WG5A 3NCGA 4EOPA 2NNWB 3WIGA 3C1XA 2PUUA 5DNRA 4UN0C 2WNTA 2JIVA 2R3KA 3GT8A 4M7IA 3DTCA 3OOGA 3F5GA 3PPKA 4L8MA 4RQVA 5FLFA 5E9EA 2JFLA 3AXWA 3TV4A 4CFUA 4QQTA 2OI4X 4XOYA 3NGAA 4LRJA 4O82A 4QRCA 3RHXA 5LWMA 4FEVA 2CJMA 4M68A 3OUKA 2XBAA 4ZSEA 5G6VA 4BCPA 3SVVA 4O86A 4KRCA 4EJNA 5M51A 4QMPA 5HO8A 2HXLA 4BWPA 2VWZA 4J99A 2R0IA 3M11A 3HP5A 3C13A 2VX1A 3FQSA 1OIQA 4BDCA 5EHOA 3NPCA 4C0TA 3ID6C 1O6KA 5A4QA 3K5UA 1GAGA 4XRJA 4JQEA 5HQ0A 2O8YA 2BRHA 5H3QA 2C5XA 5M07A 3A8XA 1Z9XA 5IF1A 4LRKA 3DXNA 2ITXA 3F3VA 2OZOA 3TXOA 3GCQA 4I6BA 1WBTA 3KXZA 4RWJA 3MFRA 4MKCA 2G15A 3SXRA 5T6KA 4JQ8A 1MQ4A 5IUGA 4IAFA 1X8BA 5CQUA 2R4BA 5ANDA 5ANIA 2VUWA 2C3JA 5GZ8A 5K4JA 2YM5A 3Q5ZA 3G2FA 3VBXA 2WZJA 4QP1A 4D2PA 1GZKA 5EKOA 2B9JA 3QCQA 4E8AA 1NVRA 4I3ZA 3RTPA 5EYMA 1QPDA 4CTCA 4USDA 1J1BA 5BUIA 2X8DA 4TNBA 4JQ7A 3MS9A 4WSYA 2H9VA 2JKOA 3FMMA 3SD0A 4LG4A 5DFPA 2GQGA 4ZTMA 1PRYA 3VS3A 5EW9A 4F9YA 5JT2A 3L8PA 3GU8A 4H1JA 4FIHA 3WF5A 4ZY5A 2Z7LA 3FL5A 3OF0A 5K0XA 2XIYA 4O7YA 3BV2A 4H3QA 4IE9A 2Z7QA 5K4IA 5A54A 2OK1A 5AP0A 3ZLYA 5IQEA 2A4LA 2O2UA 1OGUA 1R0PA 2ZDTA 1V0BA 4HYIA 4L3PA 3UG2A 4QMLA 4YLKA 3M42A 4UWCA 3V6SA 5IMXA 5AR3A 4AUAA 3UO5A 4O7ZA 4PP7A 4GK2A 2QG7A 3WILA 3CPBA 4Q2AA 4C35A 5LVPA 1ERKA 5JGAA 3OEZA 2P0CA 5K9IA 3CTJA 2WKMA 3F69A 1SNXA 3GOPA 5FGKA 4BTMA 1FMOE 5IU2A 3QKKA 1JSVA 3C4FA 4QMUA 2XK3A 3DJ5A 2YLFA 4Y5QA 3TKUA 4KBCA 4RRVA 1VYZA 3EFJA 4KBAA 4WRSA 3C0HA 4R1VA 4YTCA 4PNKA 1REKA 2JLDA 2QO7A 4FTJA 2GU8A 4FSNA 4RVLA 2ITWA 3GU5A 3PIYA 4AW0A 4EWQA 2ZDUA 5JEBA 5HLWA 3F2RA 3HNGA 1TQPA 4Y95A 3PSBA 4ZTHA 2OFUA 1G8AA 2HELA 3OW3A 5AV0A 4YJPA 3QLGA 2ERZE 3ENMA 3R73A 3MPTA 3QRUA 3V51A 4FKVA 3ORPA 4YZDA 4A9SA 4D58A 3I79A 2J0MB 4EUTA 2EVAA 3VJNA 4D5KA 1JKTA 1J7IA 1G3NA 1M14A 4WKQA 3QD0A 2WTIA 3ORNA 2O64A 4NTTA 3H30A 2ETRA 2B7AA 4X21A 2C1AA 4XCUA 2XYNA 4XNEA 4AFEA 4O2PA 5IQFA 4UXQA 3UQFA 4KKGA 3EYHA 3AQVA 4FK3A 4I6FA 5KNJA 4D0XA 4FKIA 4CMOA 4DH5A 5IQAA 1SVHA 4CTBA 5FM2A 3A62A 4UWBA 4FYOA 4EH7A 2UVZA 3QZIA 3EN6A 3EFWA 5CALA 3TDVA 4FNXA 4CYJA 1OI9A 4LL0A 4J71A 3VN9A 4PTCA 5EYCA 4GUBA 4YURA 1JQHA 5J5TA 4RC4A 4GFGA 5L8KA 4DE4A 3GOKA 2YACA 4XV3A 2YN8A 3IW4A 3QTIA 2YCSA 3ZBXA 1ZMWA 4EQCA 2RFSA 4YZ9A 3PWDA 1QPEA 4F6WA 4QMVA 3DAEA 3ZRKA 3OHTA 4OTHA 5KMMA 1FPUA 4M0ZA 2X2LA 4I4EA 4X7QA 3C4XA 2UW6A 5I3OA 4RFYA 2XJ0A 4N6YA 4BDFA 3LFBA 2ITOA 5CQWA 3V5JA 4CMTA 2PE1A 4AT4A 4GFMA 4ZJIA 4R3PA 3Q3BA 3C4EA 3CQEA 5AR8A 2E9NA 4FV7A 5L3AA 3AMBA 3HRCA 1R0EA 3HKOA 4AAAA 3HA6A 4CZTA 4BIEA 1OKZA 3DAKA 4MNEB 1VR2A 2BIYA 4L7FA 1W7HA 1W82A 4YPSA 1BI7A 3CY3A 5JFWA 1J3HA 4WBOA 4LGGA 3TZ9A 4YTIA 3KU2A 2QKRA 3HDNA 2R3PA 3PJ2A 3QD4A 5L4QA 2CNUA 4TNDA 3VS0A 1XWSA 2PE0A 5CTPA 4ENXA 2A0CX 4CKRA 4BZNA 1H1WA 5DG5A 3P23A 4DGNA 3LLAA 5EK7A 4FNWA 3ZZWA 1SVGA 3KULB 4FVRA 4JVGA 4NM0A 4ZAUA 4Q5HA 4FEQA 2IVTA 4Y5HA 4M14A 4ASXA 2WD1A 1CMKE 3C50A 3PVWA 2V7OA 2V7AA 3LW0A 4RA5A 4JBVA 2ITUA 4GT4A 4OBOA 4AA4A 3L1SA 4FGRA 3OXZA 2CCHA 4YMJA 3BYVA 4H05A 4MCVA 1HOWA 2F7XE 1WBSA 3HZTA 5LCKA 2VTMA 3P5KA 2OWBA 2EWAA 2OH0E 5IQHA 4CT2A 2BPMA 2UZUE 3RAHA 4C3FA 2X1NA 4L68A 5AAEA 4MQ1A 4F0IA 2Y4IC 4IM3A 4YLLA 5LVNA 4G6NA 4KIKB 4NWMA 2GS7A 3OXTA 4E6CA 3FLSA 3V6RA 2UUEA 3D83A 3LOKA 3C7QA 5AIRA 4DA5A 4JIKA 5I9VA 4QTBA 1OL7A 3N4VA 5EHLA 1Q3DA 2V5QA 4IVBA 1R39A 3V3VA 4WNOA 2IZRA 5CNOA 4FK6A 4O38A 3GC8A 5AJQA 5ANOA 3SAYA 2QKWB 4JDHA 3FMDA 3TACA 4S33A 3TUDA 3EFLA 3R2YA 2QD9A 4APPA 5AP4A 2XEYA 3WE4A 4PDOA 5KZIA 1IA9A 4XG3A 2LAVA 1V1KA 3I60A 2J7TA 5EM8A 1H27A 3E7OA 1BKXA 1PW2A 1W84A 4P90A 5CVFA 2RIOA 5DHJA 1ZMUA 3OD6X 1JNKA 5CF4A 3NSZA 4JNWA 1WVYA 3DKFA 5CT7A 4GU6A 2QOLA 3BKBA 4PDPA 3LQ3A 3MTLA 5HORA 4AGUA 3VUKA 4OTDA 3OY3A 2PZYA 1JVPP 3FYJX 4FSMA 4J97A 1BI8A 4AW2A 4DTKA 1I09A 2YERA 5GNKA 5CX9A 1H08A 3MESA 2WAJA 4FIGA 3V8TA 2WMRA 1OL1A 2HY81 2JEDA 5FRIA 4Q5EA 2W9ZB 4BB4A 4D0WA 4YSJA 3CKXA 1TQIA 3BE9A 4Z7GA 1QCFA 5CSPA 4Z7HA 3ORLA 4A4OA 3PY1A 3QTUA 3Q32A 2GCDA 3TJDA 3LCSA 1JWHA 2WEIA 3GC7A 3GCSA 3NX8A 1VYWA 4D5HA 3C4WA 4AU8A 3TNIA 3R8PA 2I0HA 2UW9A 4IAIA 4L3JA 3V5LA 1OL2A 4KA3A 2JDSA 4RJ4A 1W98A 3ULZA 5M4FA 2J4ZA 1YHSA 2UVXA 3Q4UA 3DAJA 2CPKE 1STCE 4BZOA 4AX8A 3CSVA 4CQGA 3A7FA 4NK9A 3RJCA 2RFEA 5HESA 2ONLA 2BHEA 3JUHA 4YZNA 4HVDA 4FKUA 4TY1A 3C5IA 2PTKA 2C5YA 2YM7A 3NW5A 4EC8A 5JQ8A 1NVSA 3KF4A 4ANNA 3QC9A 4JLCA 3ZU7A 4XV1A 4N4SA 3B2TA 4BIBA 1TKIA 3WOWA 3FI4A 5HTBA 4ZZMA 4HZRA 3HRBA 4IFCA 4UMPA 4UMTA 2B1PA 1YQJA 3V8SA 4CLJA 2BZHB 4OTQA 3LMHA 3QZGA 3NYVA 3SDJA 4ACHA 2VTQA 1GZNA 3ZSHA 3AC3A 3DBDA 3OWJA 2X7GA 4IVAA 4PTGA 5EW8A 2YITA 4YHJA 4BTFA 4E26A 2PU8A 3FPMA 4PWNA 2C5VA 3M1SA 4MH7A 3OBGA 3MWUA 3U54A 4YGAA 1WBVA 4HVHA 2WTCA 1YOMA 1IAHA 1Q8WA 3BQCA 5HLPA 3C9WA 3OBJA 2I0VA 5J5SA 4W9WA 3BLHA 3VC4A 5D1JA 3LIJA 5L6OA 4ACDA 4RJ3A 3V04A 1JLUE 3A99A 5FDPA 4RX8A 2VWUA 4TZRA 1IASA 1Q99A 3O8PA 4KABA 5J87A 4BTKA 4C3PA 2WTJA 3P1AA 3FKNA 4OR5A 3FMEA 4FNYA 4EK8A 3R7UA 2XNNA 1REJA 4M0YA 2YM4A 1M17A 3K5VA 3U87A 4O0RA 4K33A 4OBQA 3EKNA 5AM6A 5HIBA 2W5BA 2ZM4A 4EK5A 2PMLX 4YJUA 5AUXA 4F09A 3W2PA 4F0FA 1O6YA 4UY9A 4YBJA 4UEUA 4ACCA 4DCEA 2X6EA 4IWDA 2W1IA 4P5ZA 3TJCA 3KB7A 2XKFA 2Z60A 4ASZA 5JFXA 5E8UA 1LPUA 2ZV9A 5L8JA 3MVLA 3UP7A 1P4OA 4JS8A 3FY0A 3B8QA 2WB8A 3CCNA 3D2IA 3D7ZA 4TWPA 3GVUA 5GINE 2JKQA 4W4WA 3ZONA 3AD4A 3BU6A 3IDBA 3PZEA 5G1XA 3MB7A 4BGHA 2JDOA 5BNJA 3R83A 3ENHA 4G5PA 1S9IA 3F66A 3E62A 2O3PA 3QYWA 2X2KA 3ZCLA 1AQ1A 4QMQA 2RSVA 3BRBA 4F1OA 4FBXA 3DGKA 4AS0A 2BDFA 4B4LA 4LUEA 4XG6A 5KKRB 1FVVA 3ERKA 3PLSA 3UPXA 2VTJA 5IUIA 4FMQA 1VEBA 2XMYA 3AG9A 1JKSA 2QODA 2QVSE 2YIRA 3PPZA 1OBDA 2XRUA 2A2AA 2R3RA 4XYFA 4WSQA 5DVRA 3RPRA 5HTIA 1QMZA 2J5EA 3P08A 4IJ9A 3UOJA 3KREA 4BR3A 1PXKA 3QCYA 5F94A 3R8LA 1OUKA 1ZRZA 4BCFA 1L3RE 5J9LA 3R7OA 4EWHA 2BRGA 3ZLWA 3UNKA 2XK8A 4N0SA 3KRXA 2J90A 4NJDA 2VTRA 2XK9A 4I6HA 2FUMA 3R7YA 4FYNA 4AGWA 4GIIA 4MD9E 5IQBA 5FEDA 3ET7A 1JKLA 3R63A 2YDIA 2C6MA 4OUCA 3ZXZA 2NRYA 3DJ6A 3R1QA 5JK3A 2B0QA 3DA6A 4IAYA 4FSQA 3ROCA 4U42A 3LFEA 2R5TA 3LMGA 5BUJA 3U6IA 4HGSA 2OBJA 2VD5A 3PY0A 3CD3A 2UZDA 2YA9A 3UIBA 4FOBA 1OIUA 4QPMA 2QR7A 3PXRA 4BDDA 3RZBA 2G01A 4D2TA 2WTKC 4FKOA 4V0GB 5C4KA 3F3WA 4L3LA 2QG5A 1Q5KA 4U97A 1H1PA 4R5YA 4EH3A 1OL6A 1JOWB 2VV9A 3ZFXA 3O7LD 3VO3A 4W8EA 4CV8A 3NIZA 4EH4A 4EYMA 1M7NA 3FC1X 3BV3A 4E1ZA 2BKKA 4X3JA 1ZAOA 2GQSA 1XO2B 5C8NA 1V0OA 3TT0A 5H8EA 4P7EA 1Y57A 2WMWA 3SRVA 3OT8A 3AD6A 1KE6A 2WIHA 2ITZA 3AC4A 4XH6A 4XV2A 4DN5A 3KGAA 1URCA 2XIKA 1PXIA 3D2KA 4RJ5A 4RLLA 3I0QA 4W8DA 4WBBB 5HCXA 3W32A 5D41A 1GIJA 2BZKB 4IAAA 4GT3A 4EK4A 3ANQA 2R7BA 2RF9A 4NM7A 3GCVA 4XP0A 4N6ZA 4D2SA 3FZ1A 5HLNA 3D5XA 4XP3A 2WMVA 2R7IA 3NVKI 2GS6A 4YJSA 2XH5A 4MD8E 2Q0NA 3L9NA 1Y6BA 2YM6A 3DK7A 3O0GA 3DT1A 4FUXA 4M66A 3I1AA 2ZVAA 3COIA 5IA1A 5DR9A 5HICA 4DGOA 3IDPA 2YCQA 2VTTA 1IR3A 3BIZA 3DY7A 1Q8YA 3OROA 4IAKA 4GFOA 4MXCA 3VQHA 3MFSA 4L7SA 2OJJA 2YAAA 5IPJA 5GZAA 4F70A 3HMPA 3QQHA 2EU9A 2OZAA 4YP8A 4PMMA 3PDTA 5EQPA 5HTCA 4ITHA 1OKYA 3HAVA 1OZ1A 4HVSA 4ZTNA 5A6NA 3ZFMA 3FKOA 4TYHA 2CKQA 4QMMA 3U4UA 5IG1A 3QYZA 4G3DA 4BDBA 3ALNA 1XR1A 4WG4A 5CLPA 3E8NA 4B9DA 5AEPA 4U80A 3P79A 5CY3A 2A19B 5C1QB 1XHAA 4J1RA 5ICPA 3EN7A 2JAMA 4L43A 4C33A 4QT1A 3DQXA 5BVWA 1UNGA 4G6LA 4D9UA 2IJMA 4FKLA 4MXXA 4XP2A 4C57A 2W0JA 5HNGA 3N4TA 5ITAA 4IZAA 3QZFA 5HVJA 2ZV2A 1BYGA 3KVXA 4X3FA 3CE3A 4A9UA 3UTOA 1QL6A 4EK6A 2JBPA 3CXWA 4Q9ZA 2A1AB 1ZOGA 3PIXA 2OZAB 4FA2A 4BHZA 4DH7A 4K77A 4A7CA 5DEWA 1PHKA 5CAVA 5HE0A 4AZEA 4G3FA 1H28A 3S0OA 4O21A 5K0KA 2RL5A 2IVVA 5AUZA 5HGIA 3QXPA 3VBQA 4E5WA 2IZUA 2B53A 4EQUA 2VTSA 2LGCA 4EZ7A 3UBDA 4DF3A 3OFMA 4ZTRA 2HENA 3BEGA 4YC6A 2ACXA 4RX5A 3GP0A 4J95A 3W33A 3GU7A 3NDMA 4PTEA 4WRGA 2IW6A 1FINA 4OW8A 1BL7A 1V0PA 4UMQA 4IB3A 4XG2A 2FA2A 4BF2A 4MX9A 1PYXA 4O6EA 4EL9A 5M4CA 2WTDA 5ETCA 4G34A 2C30A 1NVQA 2XS0A 3ZO4A 4CCBA 3R9HA 5L6WL 5C8KA 1TQMA 5FXQA 5HBEA 3GB2A 4I92A 3PFQA 2IG7A 4FV3A 5AP5A 2XUUA 3NS9A 2UZEA 5BPYA 1YHWA 4FV5A 3R04A 4XBUA 3FZOA 3O50A 3AT3A 4O0UA 3IOPA 4OLIA 3R21A 2EXMA 4JRVA 4C2WA 3TIZA 3G0FA 5E8XA 4L44A 2H96A 1U5QA 4GL9A 4PDSA 3HUCA 3VBTA 4DT9A 3FMKA 3ORMA 4X2NA 3TL8A 3FEGA 3OCTA 3GC9A 1PMVA 3WZDA 3C4ZA 4M3QA 1OL5A 4FV9A 3BGPA 3HMIA 3V8WA 3I4BA 5AP2A 1JPAA 2R3NA 3IECA 3U51A 2AC5A 2IWIA 3EQDA 5I9YA 4ZS4A 4FTKA 4FT9A 4B8MA 5HIEA 1PKGA 3NRMA 4NFNA 3U6JA 3NMUF 4O0TA 5GHVA 3AD5A 1ZYCA 3NNVA 3LFSA 2HCKA 4ZZNA 4HYHA 4S34A 2Q0BA 5HOAA 3EN5A 3UE4A 4YJTA 1FOTA 2VWVA 4BZDA 1XH5A 3Q9YA 4JDIA 4JOAA 4MF0A 4DG2E 5L2QA 2BALA 1PMUA 1RQQA 3VF8A 3VIDA 4FEXA 2HZIA 5BVNA 1WCCA 3EQHA 3QTWA 3OW4A 3BCEA 2W96B 4FKRA 3MY1A 4JT3A 4QQ5A 2X6DA 4F99A 4B8LA 4BDAA 1Q24A 2OIQA 3VUGA 4I41A 4BCNA 1PMEA 1E9HA 3O8UA 5HZNA 2J0JA 1DM2A 4ZTSA 3RCDA 1H4LA 3OWPA 5CS6A 1T45A 1I44A 3HMNA 4DFLA 3W8QA 3NCZA 4QOXA 3UC3A 4EKKA 4OTGA 4YSMA 4ID7A 2KTYA 3BGZA 2XB7A 3L9MA 3LFFA 2KULA 4TXCA 3FMJA 5KE0A 4NFMA 5DA3A 5I4NA 3TTJA 4PP9A 1IAJA 4UZHA 3FXWA 5HEZA 1W8CA 4DG0E 4EKLA 4FX3A 4L01A 3HVCA 3VJOA 2BTSA 4EHVA 2ZB0A 4C7TA 3U55A 4KINA 2YEXA 3RK7A 2HZ4A 4PDYA 2IW9A 2G2HA 4ACMA 3UPZA 3RGFA 1YI6A 2X8EA 3SRVB 4DFZE 4IB0A 3O71A 2VWBA 4FV4A 4FSRA 5C4LA 4FKTA 3ZBFA 4YHTA 3TEIA 5FG8A 4N57A 3QWJA 2X4ZA 4PL3A 5AA9A 4W9XA 3GBZA 2HYYA 2XNOA 3U8WA 2XK4A 3H3CA 3JR1A 3G15A 3PUPA 4U3ZA 3VW8A 4LRMA 3DXQA 2OFVA 4KRDA 4RJ7A 1H0VA 4O6LA 3RALA 2W7XA 3RKBA 4FKQA 1LR4A 3DB6A 3ETAA 1GIHA 3R8UA 4DGLC 3PRIA 3QGYA 5L2SA 4XMOA 2JITA 3ATTA 4FIEA 3BWJA 3EKKA 2ZM3A 3DDQA 4F1TA 5DRDA 4CEGA 4TL0A 1SZMA 4MQ2A 4WA9A 1YKRA 4FTMA 4I0TA 4LMUA 4I1ZA 2CKPA 2HWPA 2I0YA 4HPTE 2GFSA 4RIWB 5H9BA 3QQGA 1HCKA 1ZYSA 1KE5A 3QUEA 4QMTA 3DJ7A 3RHKA 4CG8A 1BL6A 4FZAB 3LAUA 3UMWA 4NCTA 5HIDA 2PVRA 4BYJA 2BAKA 4DINA 3DLZA 4W4YA 3N4UA 3RK5A 3W2QA 2BRNA 2BRMA 4FKPA 4BN1A 4XBRA 4X3FC 2NPQA 2Z7SA 1IA8A 3AT2A 2BKZA 1DAWA 1B38A 3WE8A 4DBNA 2ZAZA 4FIFA 4XG7A 2ZMDA 4G9RA 4O1OA 5IQCA 4AE6A 4OT5A 4EONA 3VHKA 3C5UA 2ERKA 4XRLA 5CF5A 4ANQA 5CF6A 3OG7A 3ORZA 3W10A 3A7GA 4EHZA 1XH7A 4BI1A 3FL4A 3ATSA 3QTRA 1R3CA 1WMKA 1NT2A 3KEXA 2JDRA 2Y9QA 4M84A 4HCVA 4EK3A 3HRFA 3HV5A 3DPKA 3F5XA 1Q62A 3Q52A 5H2UA 4DEIA 2OJGA 3LCTA 3PXKA 5HCYA 3F3ZA 4E6AA 1FBNA 3R2BA 4JBQA 3HMOA 4S2ZA 2JDVA 5IZFA 3BHYA 5CAUA 5FM3A 2GNHA 3AGLA 3SKCA 1LEWA 4K1BA 1P14A 1OPKA 3VNTA 5IQIA 4E20A 3DZOA 4CQEA 5KHXA 4LL5A 4KSPA 5B2LA 2VX0A 3W2CA 4WT6A 3MFUA 5L2WA 2WTWA 3LXLA 4A9TA 3KA0A 2X0GA 2C0TA 2YAKA 3QQJA 2B54A 2JGZA 4NCTC 4GVAA 4JR3A 2CGVA 2GHLA 4I5CA 3IK3A 4RQKA 5BUEA 3RBWA 4C02A 3DLSA 4C61A 4EEVA 4GRBA 1MUOA 1QPCA 5E1EA 4A4XA 4G3CA 3WI6A 4ANLA 3ZSIA 2GHGA 2GNLA 3AMAA 4U41A 2X81A 2W1HA 3PJ3A 4JDKA 4CZUA 1GZOA 2E9VA 3PY3A 3PSDA 2P33A 5EI6A 4KBKA 3QD3A 2YJSA 4IW0A 4BCKA 3EZRA 2W1GA 4NYEA 2C3LA 3WF7A 4ZSLA 4BHNA 4CGAA 3L8SA 4DHFA 3N9XA 4FKSA 5F1ZA 5FBNC 4IC8A 1KOBA 2I40A 4XUFA 4YJRA 5KMJA 3OUNB 5CXZA 2WQMA 5CSHA 1RW8A 3QBNA 3EN4A 3WIKA 4LV5A 4YZCA 4U45A 3VUTA 2CDZA 2YJRA 1RJBA 3QTSA 3TIYA 2QU6A 3PE2A 3I6WA 4D1ZA 1UWJA 4AP7A 3FXZA 2YZAA 4FT3A 4IACA 4ZJVA 3ZMMA 2W17A 3VBVA 2QOOA 5EDRA 4EOJA 2X4FA 5DOSA 2B9FA 4LUDA 5ETAA 3W2SA 4USFA 2Y8OA 3UJGA 3NYOA 1NW1A 4L46A 2CLQA 4GS6A 4RWLA 4C2VA 1W83A 1OMWA 3ZUVA 3QRJA 5FQDC 3V01A 4MBIA 5BVDA 2Z7RA 3RPSA 4KIOA 5AAGA 3RM7A 4QP4A 4F7LA 4GK3A 3RNIA 4GVJA 3BYMA 4TPTA 4AG8A 2PUIA 3DU8A 4M13A 2XK7A 1FGIA 2EXCX 4MWIA 4NW5A 3RWPA 4RZWA 5IISA 4UX9A 2CSNA 4K6ZA 4U44A 5ANGA 3CJGA 4X3FB 3LFNA 3UVQA 4C38A 3BX5A 2BZIB 2UZTA 2OF2A 4WHZA 2BAQA 3R7IA 2F57A 3KXNA 3L9LA 4O0XA 2VTLA 4FT5A 4ITJA 4BCIA 3IDCA 3TM0A 4OT6A 2IVSA 5JFSA 2SRCA 4X6QC 4DLJA 2ETMA 3R8ZA 4RX7A 4ZSAA 3D7TA 3PXFA 4UBAA 5F95A 2WMUA 3QQFA 5ETIA 1PXNA 2VTHA 5EM7A 1GIIA 3LPBA 2PWLA 2W1ZA 3D15A 4D2VA 3PXYA 5IA0A 4EI4A 1LEZA 4KIPA 4LGHA 5AR7A 2C6EA 2XM8A 3PXZA 4I93A 3UODA 3W2RA 3QHWA 2WMXA 1WBNA 3TV6A 2CGUA 4DEBA 5DYJA 4QTCA 3KCKA 3GCUA 3VUDA 3TKIA 2WQEA 3OCBA 4Y72A 4EOMA 4NIFB 5CF8A 4YTFA 3SHEA 2C0IA 5EQEA 2UW5A 1OUYA 3A8WA 4JI9A 4QMZA 4E4XA 3FLYA 4IADA 1XH9A 4ANBA 1F0QA 2F4JA 2ONLC 3A2CA 3GGFA 3NUYA 5JZJA 3TI1A 4F9BA 5AFVA 2OIDA 5ANJA 3FMNA 2YIQA 3RPYA 5KCVA 1APME 3PZHA 3V5QA 4BDHA 2PZ5A 3SA0A 3EQFA 3ZFYA 4F64A 4ZLZA 1XBAA 1TVOA 3BHVA 3LLTA 5TT7A 5FEQA 1DI9A 2YIWA 4B0GA 4U40A 4BVUA 5JZNA 4IXPA 3KMUA 5CVGA 3CTHA 3FPQA 4IVDA 5HI2A 2WQOA 4C37A 4QP9A 2PMIA 3RNYA 5CU0A 2XKCA 5E1SA 2XKEA 4CYIA 4E73A 4FGBA 4A9RA 5IKWA 3T9IA 2DYLA 2OICA 4OTRA 3OP5A 4AZWA 3Q2JA 5IQGA 3UDBA 3IKAA 4Y83A 2HY0A 4WD5A 4AT3A 4JG8A 2RKUA 4U5JA 4EZ5A 3FQEA 3ZDUA 4DAWA 3NW6A 3JYAA 4HOKA 2ZV7A 2WGJA 3MN3A 5FWKK 3Q5IA 3R00A 2C6LA 3MH1A 3U4WA 4M15A 4AOJA 4QNYA 2HK5A 3OOMA 4G16A 1IRKA 1Q8ZA 4O7TA 3CPCA 2HZNA 1H26A 2P3GX 4F6UA 4RZVA 3TCPA 2PPQA 4DCAA 5EYKA 3D5VA 3GNIB 3Q60A 2AUHA 2JKMA 4G5JA 4O84A 4GKIA 1OB3A 3NIEA 2X8IA 5AP3A 5EQYA 4RIOA 5E8ZA 4R3RA 5DT3A 1EH4A 2J0KA 4PPAA 3ANRA 2R3GA 2BTRA 3FE3A 4O22A 2CKOA 2W4KA 4U3YA 2CNQA 2HOGA 2J0IA 2BR1A 3LCKA 2B9IA 3GU6A 4II5A 4EHEA 3WZJA 3CTQA 3UYTA 4K11A 4XV9A 4FSZA 4TYIA 4LFIA 3Q9ZA 2B4SB 2GTMA 4L00A 4R8QA 1CM8A 3FKLA 2GMXA 3VULA 4HZSA 5BVFA 5KX8A 4BY9E 1JSUA 3PA3A 4H1MA 5ANKA 3PVBA 2C3IB 2B52A 3QWKA 5GJGA 2Y6MA 2YHVA 3FLQA 3LMIA 2PY3A 3Q4TA 4FV0A 2OG8A 5CU3A 3D14A 4BCMA 4YJOA 5AUVA 2XCHA 4DFNA 4QYYA 2XRWA 2QR8A
chains in the Genus database with same CATH superfamily
4QMNA 3RVGA 2J2IB 4U79A 3FZTA 4BI0A 1NA7A 1H8FA 4FTAA 4BKJA 4NU1A 4R78A 4U43A 4NUSA 4RJ6A 1J91A 4MWHA 3WF6A 1E1VA 2GQRA 3MGYA 4MVFA 4I22A 3E3PA 4JX3A 2J51A 3ZUUA 5HO7A 3OXIA 1H1QA 3I7BA 3P9JA 4FTOA 4ONAA 5LMAA 4ZK5A 3LM5A 4TYGA 5ETFA 2UW3A 5A4TA 4O4DA 1SVEA 4TWNA 5IH4A 2WELA 5J7BA 2UZLA 3FUPA 4N70A 3E93A 3PE1A 5AMNA 2PZRA 3D4QA 3NYXA 3KXGA 3ACJA 4NM5A 4TKSA 3KXXA 5FBOA 4I21A 3R8VA 3RAKA 2C6DA 2UZWE 5CNNA 4MD7E 3VS1A 2QC6A 2RFDA 5IA5A 3R02A 1ZMVA 2R3FA 5IQDA 4YBKA 5LMKA 3UZTA 3CJFA 3FHRA 3L9PA 3D9VA 3HA8A 1BX6A 1GNGA 5EDQA 2OXXA 3GCPA 5DN3A 4EH2A 3QRTA 3BLAA 2P2HA 3DV3A 4IMYA 4BCOA 4IZYA 1KE7A 4GW8A 2P2IA 2R3QA 3VW6A 3E64A 5K5XA 2JC6A 3B8RA 2R9SA 2XNMA 4HJOA 5KO1A 4IBMA 1KWPA 5E8TA 3EL7A 3S95A 5DT0A 4AGDA 4BCGA 4WNKA 5B2KA 4NIFA 3RAIA 2QLUA 5AA8A 5L8LA 3AC8A 4D4SA 3VHEA 1YOJA 3WZEA 2YWPA 1H01A 3SLSA 3RPVA 4DGGA 3MVMA 4ZP5A 4DBXA 3EHAA 2C69A 4YU2A 3D7TB 2DUVA 1PJKA 1BMKA 4QP7A 2FB8A 3MYGA 5BV3A 4Y85A 4HPUE 3OTVA 4I4FA 4OTWA 5H8GA 5LMBA 3LFAA 4O96A 5DLSA 4WG3A 2GPHA 2VO6A 2WXVA 4IIRA 4O7SA 3LXNA 3LXKA 4ENYA 2IPXA 1UU9A 3PG3A 1Q8TA 3OWKA 5LARA 4K8AA 3O8TA 5K3YA 5DMZA 3QQKA 5LMKC 4Y46A 1UU3A 2WU7A 5AR5A 3RINA 3S4QA 2GFCA 5DEYA 5AP6A 5HU3A 4IX4A 4LOQA 1Y6AA 3E7VA 3EQGA 3FLWA 3FSFA 3T8OA 3BQRA 1UKHA 3F2NA 5EW3A 4DG3E 3EIDA 2QHNA 5A9UA 2WMAA 4F08A 4NKSA 2G1TA 2OJIA 5EG3A 2J0LA 1UU7A 3TDWA 1PXOA 3UNJA 4X2GA 2ITQA 3NWWA 1G8JA 2QOQA 4BKZA 1UV5A 5C27A 4PUZA 5C03A 4CFFA 5BMMA 3PSCA 4BDKA 2W06A 4OBPA 4DGMA 2CKEA 3F61A 4DFYA 2HWOA 2VTNA 1KV1A 4PQNA 3G5DA 3HX4A 1UNLA 1CKJA 2O63A 2XF0A 4KB8A 4MF1A 4CFNA 4C4EA 3T3UA 4DEHA 5L2TA 1NY3A 4D1XA 3ZRLA 1OM1A 3HMMA 1UU8A 1F3MC 1ZYJA 3Q9WA 3OWLA 4IANA 2IZSA 5CWZA 1YRPA 5CXHA 5DT4A 5EDPA 5I3RA 4AQKA 3TZ8A 3FMLA 3H4JA 3WARA 5J1VA 4OAUC 4DTAA 4GV1A 4LYNA 3R1SA 4EJ7A 4RWIA 1LUFA 5J8IA 5AR4A 5IA3A 4IWQA 4GKHA 4D1SA 2WOUA 5FTOA 2FGIA 1W2FA 2QO9A 3F6XA 5D9HA 3FY2A 4NTSA 4KKHA 4FV6A 4ITIA 4BYIA 3II5A 4HGTA 5HD7A 3TV7A 2J9MA 3PYYA 5AUTA 3SGCA 5FP6A 3GUBA 4YJQA 4DEDA 3Q04A 2XA4A 1ZZ2A 4JRNA 1U54A 2BUJA 1YWRA 4O0YA 1OECA 4UYAA 5T68A 3FXXA 1M2QA 2C6OA 2C1BA 4IFGA 3E8DA 1MQBA 3P78A 5CT0A 4MYGA 2XM9A 3IGOA 2X9EA 5EI2A 4CFWA 3QKLA 3QFVA 3R01A 4FTNA 4I0RA 2C68A 3FMHA 3BYOA 4XOZA 4GH2A 5EOLA 4ACGA 3H0ZA 4IWOA 3EQRA 3MH0A 4CXAA 3W1FA 2OKRA 3W8LA 2UW7A 3L8XA 3QU0A 4KIKA 3TNHA 3COHA 3MPMA 4R5SA 2VAGA 4HNIA 4BCQA 4E3CA 5I5ZA 3LCOA 3KVWA 5DRBA 4APCA 3S00A 1WBPA 3VQUA 3MVHA 4U6RA 2X39A 4BBMA 4HW7A 3L8VA 4YNOA 4FTIA 3N51A 3ZHPC 4GG7A 3SW4A 4AXFA 3I5NA 3AMYA 4L52A 1J7UA 1YVJA 4LOOA 3ORTA 2VWXA 4QTAA 3PJCA 3Q96A 4O7RA 3KQ7A 3BE2A 1JAMA 3BWFA 1Z57A 4GYIA 3LM0A 5E8YA 3WYXA 4BC6A 3R9NA 4BCHA 4BI2A 4D4VA 4QTEA 2C5OA 4IVCA 5A14A 5HVKA 4R6VA 4V0GA 4E5AX 2V62A 3LQ5A 3O23A 2FSMX 3S2PA 4F1MA 2JDTA 2VO3A 4YO4A 5M08A 2AYPA 2Y7JA 5J9YA 5I9UA 1AGWA 2HXQA 3IGGA 4JDJA 4EYJA 1PMNA 2WQBA 1UVRA 2VWIA 2WTVA 5EOBA 3EQBA 2UZVA 3CS9A 1WBWA 4PY1A 2BRBA 4G6OA 3TG1A 3SXFA 3KN6A 2C6KA 3QL8A 3FV8A 3QRIA 5HNBA 4XLIA 3Q6WA 4LI5A 5AAFA 5FXRA 5KBQA 5BQ0A 3RZFA 2G2IA 2W4OA 2Z8CA 2I7QA 3EJ1A 5BVKA 2PMNX 4PV0A 5CAQA 3UOLA 4ZSJA 1P4FA 3OTUA 4OTPA 4LM5A 3V5WA 3VRYA 5HU9A 2YZLA 4U9AA 2PL0A 3QAME 4QNAA 2FSLX 4YTHA 3ZXTA 3DCVA 5HD4A 3R30A 3GEQA 3KK8A 4AN2A 4IM2A 3KCFA 3VS6A 2GTNA 2QI8A 3DBEA 4AW5A 3NNWA 3BYUA 2IW8A 3R7VA 4ZMEA 1YOLA 2QURA 3MIYA 1CTPE 4HGEA 5GJFA 4BGQA 5JQ5A 4DTBA 3ZRMA 1ZLTA 4FL2A 1H07A 2V0DA 5D10A 4XS2A 4K2RA 3ODYX 5EFQA 5EKNA 1ZWSA 3DXPA 3WZUA 1GJOA 4IX5A 2GNIA 4V01A 1CDKA 1MP8A 3MV5A 4WUAA 3TKHA 5E91A 3QA8A 2YDKA 2PULA 4QMXA 4DHJA 2F2CB 4QMOA 3ACKA 3UNZA 2IVUA 4BWXA 2FSTX 4IZ7A 2H6DA 4X2KA 1GZ8A 5CZIA 4BKYA 5AM7A 4CZYB 2AC3A 3R1NA 4IJPA 3QX2A 2F49A 4ERKA 2JIUA 4TYHB 4L53A 3O2MA 3H9RA 3VS7A 2ZV8A 3A61A 1Q41A 3ULIA 3MJ1A 4FIIA 2ITYA 3R22A 4PPBA 2XNPA 2QNJA 3Q4ZA 2R3LA 3F5UA 4Q9SA 2CHLA 4WNPA 2QOCA 5BYZA 4HYSA 3CGOA 4KIQA 5DBXA 5LXMA 3AKLA 4GCJA 1CKPA 3HUBA 3DNEA 3UIUA 4E4LA 3F82A 2EB2A 4YUQA 3DKOA 2VTIA 5AADA 5DGZA 3NLBA 2EB3A 2OXYA 5L2IA 1K9AA 4JR7A 4TWOA 3A4OX 3TNQB 3P7BA 4FJVA 3P0MA 2VX3A 1SMHA 3F9NA 3FLZA 2A98A 4ANOA 2PVHA 3RM6A 2PVLA 2WMBA 4XHKB 5FUTA 4YHFA 4TN6A 3EH9A 4H3BA 4FVPA 3COKA 3THBA 3TWJA 5D11A 1M52A 3ZUTA 4MXYA 3GENA 3NEWA 4DH1A 3SQQA 3DZQA 3CGFA 4J52A 4RC2A 3HYHA 5FEEA 3DB8A 3JVRA 2ITNA 4HGLA 4UV0A 3Q2MA 3WF9A 3TUCA 2PYWA 1TZDA 4QP3A 3KC3A 4U0IA 3EWHA 1XH6A 3LVPA 1XBBA 2J50A 3PPJA 4C4HA 2B9HA 4M8TA 4EOOA 4CV9A 3CEKA 1ZYLA 2OF4A 3NUXA 3RPOA 4F0GA 4O7LA 3OY1A 1TFFA 3UIMA 5ANEA 5EYDA 3TZMA 2E9PA 2F7ZE 4QMYA 3UYSA 3PRFA 1PXJA 5M4IA 4IX3A 3KFAA 4FR4A 4M69A 5FDXA 2YLEA 4AFJA 3MA6A 2JFMA 1H24A 5AV2A 4CNHA 4TW9A 1JBPE 2PHKA 4FKGA 3U9NA 5KMNA 2XP2A 4PPCA 5HG7A 3DBQA 4C4GA 4D2RA 4BDGA 5A4LA 5KBRA 4NSTA 4H3PA 4LGDA 4O4EA 4DFUA 4ZY6A 4AOTA 5B2MA 2VTPA 1F5QA 4NJ3A 4R3CA 2QOKA 3PVUA 4YZMA 3CBLA 4GJ3A 3RP9A 4S32A 5AR2A 3KY2A 4QP2A 1R1WA 5M44A 1YWNA 2Y0AA 3W0MA 1YDSE 4CG9A 2HW7A 5CU6A 4AW1A 3LJ1A 4EOSA 3ZZEA 4RMZA 3PWYA 5JRQA 3ODZX 2DS1A 3W55A 5IEXA 3QGWA 2WFYA 4QYFA 2JAVA 3DKCA 2C4GA 4B7TA 3E63A 1JKKA 2OW3A 3UZPA 3V5PA 2C0OA 4EOKA 3DFAA 4I5PA 4OAVB 3LQ8A 4B6LA 2R3IA 4R7HA 3ZS5A 3EQCA 3T9TA 3V5TA 4FTCA 1YHVA 3BU5A 2YM8A 3IW8A 5AUUA 4FEWA 4PX6A 4WO5A 4LV8A 1UNHA 5LWNA 4GT5A 4ZZOA 3I5ZA 1ZARA 1IG1A 3PVGA 3FYKX 1XH4A 3PA4A 4O0SA 4YJNA 3QTZA 5C8MA 4AXAA 5AX9A 3QD2B 4G17A 3VWAA 4A4LA 4AQCA 4Z55A 2UW4A 5J7HA 4DH3A 3OC1A 4EH9A 4R77A 1H0WA 3ORXA 3GC0A 4C4FA 4X0MA 5LOHA 3TN8A 2OO8X 3BLRA 5CEOA 4FSYA 5C01A 4AGCA 4EOLA 4V05A 3IW6A 5IA4A 1A48A 3SG9A 4D9TA 3R7GA 4EORA 4NM3A 3RCJA 4AA5A 1KSWA 4FE2A 4ZSGA 4Y8DA 3JPVA 4F4PA 1OIYA 3ZC6A 4V04A 3FBVA 4KAOA 3UVRA 4ALWA 3OS3A 4IM0A 5JRSA 5C26A 5AV1A 3CQUA 1SYKA 2UW8A 3IW5A 3JVSA 3BPRA 4ALVA 2ITPA 2QOIA 4DT8A 3T3VA 1IEPA 2VNYA 3H9FA 3FLNC 3MVJA 4BTJA 4C58A 4F7JA 3DKGA 4AA0A 2Q83A 3ZM4A 4RJ8A 2FO0A 4QQJA 4TWCA 4E6QA 3BGQA 2FH9A 3NUAA 3MSSA 3QRKA 4RIXB 3PTGA 3RMFA 3VS5A 4CRSA 3PJ1A 4X2FA 5TR6A 5KHWA 3JY0A 3KN5A 2QLQA 2R3OA 4NW6A 4FICA 3LHJA 3QCSA 4P4CA 5M4UA 2YWVA 4BDEA 3ZOSA 4FVQA 1E1XA 3I81A 1L8TA 4M97A 3R9RA 3QQLA 1UA2A 2XKDA 4KSQA 5FD2A 1Y8GA 5EI8A 3SX9A 4EH6A 5IH6A 2UVYA 3MTFA 5KMIA 1VZOA 4JG7A 4IB5A 2YCFA 2QOHA 2PVFA 3BLQA 4A06A 2PUNA 4AXEA 5CSVA 2GHMA 2GNGA 4IX6A 4BBFA 4LOPA 3HV4A 4FTRA 3MPAA 3QF9A 3UG1A 4FG7A 3W18A 1YDTE 2WU6A 4EZ3A 2UW0A 5CZHA 3U9CA 2H8HA 4WUNA 5TOZA 4A9YA 4AZVA 2GNJA 3O96A 4QDEA 3VF9A 3A7JA 3RI1A 5IA2A 4BL1A 4F9AA 4UWYA 4RFZA 1MRUA 5CVHA 3MDYA 2IN6A 1Q3WA 4I6QA 4JXFA 2VU3A 3NUSA 4NH1A 5HBJA 3MY0A 2Y4PA 2R2PA 4RX9A 4USEA 4FSWA 4FTQA 4MUQA 4HYUA 1J1CA 4DDGA 3A60A 4QMSA 2ITTA 4W4VA 1QPJA 2C6TA 2PVYA 3WZKA 4B99A 3E8EA 5IDPA 2G2FA 4RIYB 4FIJA 3MIAA 4EHGA 4XJ0A 3ZO2A 5D7VA 5HO6A 4MXZA 2BHHA 4ZTLA 5HKMA 3TNPC 3FI3A 4CCUA 3FZRA 3FJQE 3VUIA 4CFVA 3WBLA 4C34A 2C47A 2XVDA 3ZLSA 4EOQA 5KUPA 2R64A 2HW6A 4BFMA 4MXAA 2R3JA 2BVAA 4BGGA 5IEVA 4J8NA 5DR2A 3EOCA 3NR9A 2XK6A 3IOKA 5JH6A 4KKEA 4KS7A 3F2AA 3UC4A 4X6RA 4TTHB 2WIPA 4CT1A 4CRLA 4S30A 1VJYA 3HECA 3KF7A 3NW7A 2BFYA 3IG7A 3AT4A 5B7VA 3ORKA 5HX8A 3EFKA 5M57A 5DIAA 2QHMA 2WEVA 3PXQA 3E88A 3PJ8A 5J95A 5JKGA 4WIHA 1YWVA 4NKAA 5M06A 1AD5A 3CP9A 4AF3A 3KMMA 5JGBA 1XKKA 3LZBA 2QOFA 5H8BA 2BAJA 3NUNA 4CFXA 4WNMA 3DOGA 5A4CA 4G3GA 3WYYA 3ZYAA 2WOTA 4FSUA 4FF8A 4FL1A 5EM5A 5A46A 1G8KA 2FSOX 3K54A 2VO7A 4FI1A 4MHAA 3DK6A 3OMVA 3Q6UA 4C59A 2V55A 1OKVA 3FI2A 4RBLA 2BIKB 2YIXA 1KUTA 3FWQA 2ZOQA 4GYGA 3G6GA 4FV8A 4QD6A 1DAYA 3LFQA 3SOAA 4GEOA 3W0SA 2V22A 4E5BA 3PLAE 1ZOHA 4LDTA 4DH8A 2ZB1A 4XG8A 5HCZA 4BIDA 2RGPA 2OU7A 3QX4A 4DITA 1CSNA 1PKDA 3G9LX 2CGWA 1DI8A 3B2WA 3FC2A 5LJJA 4FV1A 4QTDA 2YISA 5LQFA 4FTUA 3OCGA 3KMWA 2GNFA 2PVMA 1Z5MA 4O4BB 4AN9A 4BCJA 4KNBA 4DYMA 4HVGA 3R28A 5HE2A 4AACA 4FTLA 1K3AA 4W4XA 5IUHA 1KE8A 2XYUA 4YNEA 5HNIX 4MNEA 4RGJA 1XBCA 4CFMA 2W1CA 4E6DA 2XJ1A 4UB7A 2X7FA 2XANA 3EL8A 3SW7A 2UV2A 3BHTA 4J7BA 5M55A 4O1PA 5TKDA 3BBWA 3TNWA 1CKIA 3M2WA 2VO0A 4IQ6A 3D0EA 2RG6A 1H1RA 3ORIA 3R6XA 2Z2WA 4I0SA 5IMEA 2R3HA 4O7NA 1WFCA 5ACKA 4FT0A 4S31A 4ZY4A 3QHRA 5LVLA 4P5QA 3U6HA 3QXOA 3R7EA 2F9GA 3K2LA 1U4DA 4G9CA 1Q97A 3EMGA 1PYEA 3LFDA 4EOIA 3KK9A 2VZ6A 4O2ZA 3UGCA 5DR6A 2E2BA 4L45A 2J5FA 3NUUA 4J96A 4R1YA 3RK9A 2BCJA 1B6CB 4FV2A 4K9YA 3NZ0A 4ZIMA 3IW7A 5FP5A 4YLJA 4IHPA 1ZXEA 4JG6A 3F3TA 2O0UA 4OTIA 5K5NA 3DQWA 2B55A 5B0XA 2WMTA 4PNIA 4YZBA 5CEPA 3A7IA 3HL7A 3ZH8A 1Q4LA 1YI4A 1OITA 3JS2A 3ZEWA 3D5UA 4H58A 3SOCA 1P2AA 4DLIA 2H34A 1R78A 2OH4A 3O17A 3MBLA 4FZFB 2CMWA 2PVKA 1PY5A 4GIHA 4KS8A 3SG8A 3W0OA 3TTIA 4F65A 5BX0A 4DEAA 5HBHA 2W05A 5DPVA 3MFTA 1URWA 4RPVA 3UQCA 3DTWA 3SXSA 4QYEA 4ALUA 3I0OA 3NNUA 3CR0A 4AZFA 4TT7A 2JKKA 1ZY4A 3P4KA 4XEYA 2X9FA 3EQPA 4R7BA 3VAPA 4ZMFA 3DS6A 3KRLA 4IB1A 4JAIA 3C0IA 3AC1A 5JGDA 4Z16A 4YO6A 5C9CA 4JMQA 3TUBA 4CLIA 1W0XC 3BBTB 4I5MA 2UZNA 4AT5A 2BMCA 2XNGA 2YCRA 2JD5A 4JJRA 3A7HA 3IPHA 5E8SA 5GZ9A 4UMRA 2XALA 4QP6A 1O6LA 2OJ9A 4F7SA 4KUJA 3OZ6A 4ZLYA 2W5HA 4U8ZA 1O9UA 4L9IA 5AX3A 1ND4A 4AAYA 3LJ2A 4KD1A 5I0BA 3ZO3A 2XIXA 4RIWA 4RG0A 3NVMB 2X2MA 3HV6A 4L6QA 4RVMA 1XH8A 4ZOGA 4GSBA 3FI8A 5CI7A 2OLCA 3IONA 1H00A 3AGMA 4ZS0A 4I5HA 4BBEA 5CAPA 4ASEA 4O27B 3QUPA 2XARA 2W1FA 4AZSA 3SV0A 4MAOA 5CI6A 4ZLOA 3MB6A 5A3XA 5FTGA 5ACBC 4AE9A 4ANMA 5D12A 1PXMA 1HCLA 4PMTA 2XIRA 3KXHA 4QMWA 3W2OA 4PL5A 4IH8A 5FTQA 4BWKA 5AV3A 5TF9A 3CY2A 3PG1A 3ZLXA 5CAOA 1OBGA 2QU5A 3ZM9A 1YXSA 4X2JA 4DC2A 4D4RA 4E93A 4ORKA 2WHBA 1XMLA 1H25A 1MRVA 3POOA 4NT4A 4IDTA 3MA3A 3R1YA 5EM6A 1M2PA 4G3EA 3UVPA 4ASDA 3VUMA 4CKIA 3ZO1A 4M69B 4YC3A 5CEIA 2X0PA 2QO2A 3SC1A 4E7WA 4IZ5A 2P4IA 3P7AA 5E8WA 5AP1A 3HV3A 4MNFA 3RWQA 4UYNA 3UOKA 2BILB 2PZIA 2XNEA 1GY3A 3H10A 4YPDA 3G90X 4D55A 2OJFE 1PXLA 3W16A 3NYNA 3P86A 3QALE 4XLVA 1GOLA 4HVIA 4RC3A 2R3MA 2X0QA 1Q61A 2YFXA 4FG8A 2XCKA 3ALOA 4O0VA 4MEDA 4QYHA 2DWBA 1FMKA 1FVTA 3FQHA 3PA5A 3POZA 4CSVA 5I9ZA 3ROYA 2OGVA 2VGPA 5KMKA 3HP2A 5GIPE 2NP8A 3DBCA 2WTKB 2O65A 4C3RA 4C4IA 2PVJA 2PVNA 4K18A 2EUFB 4O7WA 3QQUA 3OT3A 4IC7A 2CGXA 3FSKA 5AIKA 5DI1A 4BICA 4FSTA 2REIA 2GS2A 5HE3A 4L42A 3R8MA 4D2WA 3JXWA 2XBJA 2F2UA 2I1MA 4XX9A 5EHYA 2QQ7A 4TYJA 2W99B 3WF8A 2W9FB 5CASA 1M7QA 5E4HA 4G2FA 4E4MA 3MH3A 1BUHA 2PK9A 4GK4A 2ZFYA 1A9UA 5AWMA 5TO8A 3PIZA 2RFNA 3HV7A 2F7EE 3K3IA 3R0TA 1S9JA 2I6LA 2DQ7X 4FC0A 4M67A 5KMLA 1OVEA 1YXTA 3UO6A 5A4EA 5CEQA 3VS4A 2XEZA 4F63A 3H9OA 4G1WA 5CYIA 3LE6A 2OSCA 4GU9A 5CEMA 2PE2A 5LCJA 1YDRE 3P7CA 5E7RA 5KMOA 2W5AA 3DK3A 3KKVA 4C36A 2E9UA 2JIIA 4H39A 1K2PA 4BDIA 4OTFA 2J6MA 5L6PA 3KRRA 4QP8A 5AV4A 4JIAA 4IDVA 4A07A 5HE1A 4WOVA 4G31A 2WMSA 5E8VA 1Q8UA 3BZ3A 3QZHA 2ETKA 3UMXA 4O0WA 3VRZA 2RG5A 3ZEPA 4CD0A 1RE8A 4Z9LA 4U7ZA 5TE0A 4EUUA 3ITZA 4TYEA 3OCSA 4UZDA 5CENA 1WVXA 4LQMA 5KKRC 4ZJJA 3NNXA 2BZJA 1OPLA 2O5KA 5IH5A 3ML1A 3MW1A 3ZTXA 4FOCA 4CKJA 2YM3A 3BHUA 5BVOA 4JAJA 4DEGA 3MJ2A 2XIZA 1OIRA 4HCUA 2YIYA 1LP4A 2CCIA 2VGOA 3GU4A 3R71A 1UKIA 2FYSA 3JY9A 5I9XA 4GG5A 4C62A 5F9EA 1ZOEA 5HG5A 5CU4A 1WAKA 3G6HA 3CLYA 2XAOA 5M09A 3IS5A 1MRYA 3O51A 4QYGA 2GSFA 2QONA 1U59A 4NL0A 4HCTA 4L67A 3LJ0A 4YC8A 1Y8YA 5CU2A 4Y73A 4GJ2A 2C3KA 2YABA 3REPA 4XG4A 5JN2A 4BRXA 2ZM1A 4FZ6A 5HG8A 3BL9A 3MI9A 3DNDA 1U46A 2ZJWA 4BDJA 2Y6OA 4XG9A 3IO7A 4J8MA 3AC2A 5JMSA 1BLXA 1ZYDA 2C6IA 3HAMA 5CANA 5BMSA 4CMUA 4O91A 2HZ0A 1YXXA 4FKJA 4TRLA 2FVDA 1SM2A 2XNBA 3E92A 4RVKA 3Q53A 4MK0A 2NRUA 5M53A 2PSQA 4NZWB 3VUHA 4O7VA 2PMOX 3RAWA 3K3JA 3VBYA 5BYYA 5GIOE 3PP0A 3BHHA 1SNUA 4ANSA 3NAYA 3E3BX 4PRJA 4RIXA 3QCXA 5J9ZA 3CQWA 2VWWA 3QC4A 3BEAA 3UO4A 3QTQA 3O7LB 3G33A 2EXEA 3F88A 5LVMA 3D94A 3Q9XA 5HVYA 3BU3A 4NEUA 3FAAA 1YI3A 4UALA 4QQCA 4DEEA 2VRXA 5HX6A 4JBPA 4F9WA 4RVTA 2CLXA 5CSXA 5D7AA 1OPJA 4MBJA 3FDNA 5KZ0A 3COMA 3S3IA 5I9WA 3GXLA 3KL8A 4QPSA 3VONA 1M2RA 2R0UA 3CKWA 3QUDA 4H36A 4MXOA 2CN8A 4F6SA 2UZOA 3CIKA 4J98A 4OGRA 3LKMA 3GFWA 4C8BA 3Q4CA 3ZSGA 2W4JA 1NXKA 3E87A 3EYGA 3KXMA 4PMSA 3CD8A 3MY5A 3I6UA 3GFEA 4QPAA 3ZC5A 3AOXA 2A27A 4D4YA 2CNVA 5F4NA 2QOBA 2ZYBA 1U5RA 5BVEA 3PUFC 5JFVA 2ESMA 5GJDA 3QA0A 1WBOA 3C4CA 3UOHA 5DH3A 3PP1A 1UWHA 4M12A 3DDPA 4AWIA 1G8SA 2JBOA 5J79A 4K0YA 3OEFX 3UIXA 3W0RA 4AOIA 5EH0A 2WPAA 2BROA 2W1DA 3NUPA 5AP7A 3I7CA 4FRFA 4FZDB 3GQIA 4D28A 4EQMA 3OVVA 2X7OA 4IWPA 5BYLA 4HNFA 4FZ7A 1KE9A 3F3UA 3GQLA 3LXPA 4PL4A 1YXVA 4LMNA 4EC9A 4FUYA 2I0EA 1FVRA 4I23A 4AZTA 1XJDA 4RIYA 2PUPA 2ZMCA 2XJ2A 3C0GA 3HGKA 3VVHA 2WMQA 3G0EA 3UZRA 1XQZA 4JX7A 5E90A 4AN3A 1OKWA 4JL9A 5CEKA 1WZYA 1YW2A 1A06A 2VTOA 2OXDA 3FHIA 3VBWA 4I94A 3LCDA 2C5NA 2BDWA 3BYSA 4E4NA 2XZSA 3F7WA 3VS2A 3AC5A 4R7IA 2IZTA 3TZ7A 4GUEA 4O83A 1PXPA 3KRWA 4PMPA 2BFXA 5AUYA 4PF4A 3QLFA 5T3QA 4DFBA 1FQ1B 3BI6A 3LFCA 4Z3VA 4DFXE 3G9NA 3G51A 4YR8A 3KIOC 4IEBA 4EBVA 5DE2A 5JSMA 3EZVA 2HIWA 3F5PA 3QTXA 1KOAA 4FODA 4O81A 3HLLA 2CN5A 2BDJA 5J1WA 4ZXTA 1ZZLA 2NO3A 2GDOA 4ARKA 3F7ZA 2G9XA 3H0YA 3GI3A 4F9CA 4FL3A 4CVAA 4JBOA 5AUWA 3DBFA 1FGKA 4ZTQA 3E5AA 4GMYA 3R9DA 4FTTA 2E9OA 1DS5A 1Y91A 4MBLA 2PZPA 5FXSA 1PF8A 4RA4A 3UP2A 2P55A 4EH5A 4EH8A 3HDMA 3C51A 3FZSA 3HEGA 3UQGA 5LVOA 3D5WA 4IAZA 4DHZA 4C4JA 1JSTA 2VNWA 4F7NA 2IO6A 5M56A 4RFMA 2Z02A 4RLKA 3P5JC 1YXUA 2WO6A 3A4PA 3KULA 4U81A 1ATPE 2ITVA 4MTAA 1ZY5A 3IQ7A 1J7LA 3EN9A 4P2KA 2W1EA 5HHWA 2YDJA 3FZPA 4QO9A 4I24A 1U54B 4I20A 5IEYA 2UZBA 2OIBA 1G5SA 3QKMA 4FKWA 4J53A 5DWRA 3EB0A 3KRJA 4FNZA 4UXLA 1H1SA 3ELJA 1B39A 2Y4IB 3R9OA 3DFCB 4LV7A 4YJVA 5IDNA 2WQNA 4FT7A 4ZEGA 3BELA 4RSSA 2QCSA 2HAKA 3NAXA 4RT7A 4EBWA 2VWYA 1KV2A 3MH2A 3S1HA 5F20A 5HG9A 1P5EA 3EQIA 2VTAA 4RWKA 5CSWA 3CC6A 4ERWA 4FG9A 3E8CA 2VN9A 4KWPA 1T46A 4FEUA 1RDQE 4UMUA 1WVWA 5A6OA 5E92A 3ZDIA 4WG5A 3NCGA 4EOPA 2NNWB 3WIGA 3C1XA 2PUUA 5DNRA 4UN0C 2WNTA 2JIVA 2R3KA 3GT8A 4M7IA 3DTCA 3OOGA 3F5GA 3PPKA 4L8MA 4RQVA 5FLFA 5E9EA 2JFLA