1UA2A

Crystal structure of human cdk7
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
299
structure length
286
Chain Sequence
b'EKLDFLGEGQFATVYKARDKNTNQIVAIKKINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 7
publication title The Crystal Structure of Human CDK7 and Its Protein Recognition Properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, transferase
total genus 66
structure length 286
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ua2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ua2A01
5B2LA 5DH3A 2C3IB 5LCKA 3AC1A 3LFQA 2UZBA 4X21A 4FSTA 3UQFA 4PDPA 5FTGA 3ELJA 4PPCA 3IW7A 4X2JA 4BVUA 4UYNA 4NTTA 1BKXA 2PZYA 4PL3A 4NJDA 3WZDA 4ERKA 5DR2A 4XUFA 4LV8A 4QTAA 1PXKA 2F57A 1SNXA 4E3CA 4NFNA 2EWAA 1Q97A 4I20A 3TZ7A 4IMYA 3LFAA 5AAGA 2WMTA 3ORIA 4U5JA 2C5VA 5CTPA 1YOLA 5C8MA 3A60A 3QUEA 3EL8A 2GHMA 3HV3A 4CLIA 5DFPA 4AF3A 3QCSA 3QTRA 4G2FA 3KN5A 5KUPA 3RTPA 1FVTA 5LVOA 3R21A 2VX3A 2WELA 4D1XA 1WBPA 3G90X 5IA2A 3MB7A 4OBQA 2C69A 5J8IA 5HLNA 3OT3A 5M4CA 4EZ3A 1WBNA 2DS1A 2A4LA 4FTOA 4IJ9A 3ZC6A 4BTKA 1Q24A 1K3AA 2UVYA 3H10A 3E8CA 4FOCA 3COHA 1YI4A 4K33A 5I3OA 2YABA 4C3PA 4M12A 5H2UA 5C01A 3KRWA 5DT0A 3UMWA 4MD9E 4L8MA 3R02A 4L9IA 2C0TA 1BYGA 5FBOA 1KUTA 2UZEA 3D5VA 3O23A 3UNJA 4JLCA 2HENA 3EQGA 3NPCA 4OT6A 5HE1A 3NW5A 3AT2A 2WMRA 2F9GA 3SOAA 5A9UA 2VTAA 5AAEA 3GU6A 3V6RA 4EKLA 4GK3A 4ACMA 4M3QA 3O7LD 2IPXA 4QYEA 2OIQA 4CV9A 4M66A 4IH8A 4K11A 5HESA 3SLSA 1PMEA 3CQWA 4A7CA 5HD4A 1U5QA 5CU3A 4FKSA 2G9XA 2WQOA 2W4JA 4DHFA 5AP1A 5HI2A 3IDBA 4MYGA 2JITA 4Y46A 2PVFA 2UZLA 5HVKA 2R5TA 1R3CA 3PXZA 4EWQA 4EL9A 2W1DA 4DYMA 4IDVA 5ANJA 4EH9A 1NVQA 5AM7A 5FEDA 5ACKA 5JKGA 1O9UA 3D94A 4IAIA 1PMNA 4FZFB 3RCJA 3SW4A 3UP2A 1VJYA 3OF0A 2X1NA 3MIYA 2XEYA 3O8PA 5EI8A 5J9YA 2CNUA 2FA2A 4I6HA 3NUXA 3ZEWA 4A9RA 3COKA 4FSRA 3MESA 3HRFA 2CGWA 1MQ4A 3W2PA 2YDJA 3LMIA 4EH5A 5DN3A 4FTQA 2BRGA 3F2RA 2QOOA 3BGPA 4GVJA 4H58A 2IW6A 3Q6WA 4FSZA 4L42A 4W8DA 3ORPA 5L6WL 2PHKA 4ACCA 3ORKA 4BWPA 4E26A 3A7GA 4NK9A 2OBJA 2QOCA 3BPRA 3SA0A 3QUPA 4IB3A 2R9SA 4XOYA 3DCVA 4MH7A 4NW5A 1FQ1B 5FXQA 3UYTA 3WILA 5HBEA 3TIYA 3JVSA 1B38A 2WTIA 4BGQA 3V5TA 3GCUA 3EQCA 4FV1A 1Q62A 5G6VA 1Q8TA 4Y95A 2WMWA 5F94A 3VO3A 3ORMA 2H34A 2WEVA 2JKKA 3WI6A 3L8SA 3W32A 3PY1A 3AC8A 2EB3A 4FBXA 2WOUA 2BTRA 3UIUA 4FZ6A 2OJIA 1XR1A 4JRNA 1OVEA 4I5HA 5CI7A 1VEBA 4IWQA 2OZAB 4NH1A 2W96B 4CKIA 4GV1A 3WOWA 3E7VA 4DC2A 3LM0A 4YGAA 1XWSA 3LJ0A 5L2TA 3ZFXA 3MWUA 2SRCA 4WRGA 4MBLA 1ZY4A 3TJDA 4C33A 4RWKA 2B7AA 5HVYA 4OR5A 4OTGA 3FLSA 3BCEA 3R1QA 4E8AA 4HYSA 4EC9A 5EFQA 2HCKA 3G6GA 4O2ZA 3QXOA 3E62A 1L3RE 5AAFA 1YOMA 1H28A 3SX9A 2WMSA 3DZQA 3M2WA 4IC7A 3TTJA 5L2IA 4YMJA 2X7FA 2XK4A 4FC0A 5E1EA 3R9HA 4QD6A 1WVYA 4C2VA 2X6EA 4W4XA 4Y83A 4LOOA 1S9IA 3NIZA 3SD0A 4ANLA 3QCYA 5M44A 4FIFA 4J99A 3RPRA 5CNNA 5EM5A 1J7IA 1Y91A 3D15A 1W0XC 3IK3A 4FVPA 3V5LA 4JL9A 3S00A 3G51A 1M7QA 3N9XA 2AYPA 3SAYA 3SXSA 4TL0A 3P0MA 4FKLA 1HCLA 1Q3DA 1PXNA 2V22A 5CNOA 5E90A 1ZZLA 3RJCA 4A06A 3C4FA 5JZNA 4N70A 1RJBA 5AJQA 3QZHA 4YP8A 3R7OA 2WPAA 3EKKA 3F82A 5M57A 1YWNA 5HBHA 4I6BA 3BGQA 3UQGA 5K4IA 2QOIA 2XNPA 2HZ4A 4TXCA 4OTHA 2ITZA 3FXWA 5AP2A 1I09A 3FMNA 4EK4A 5DEWA 3TJCA 4V0GA 3LHJA 4UALA 1R0PA 2Z02A 2IG7A 4C4EA 1UU3A 4ZY4A 4AW2A 1IAHA 3SXFA 1OM1A 1DI9A 4G6NA 3L9MA 3UZTA 4AZEA 3UPXA 4J95A 5CSXA 4CFVA 3NX8A 1W8CA 4BKZA 4DEGA 2ITOA 1JSUA 3OCBA 1BMKA 5DR9A 5JMSA 3CQEA 3RZBA 2XJ2A 3R8ZA 4GFGA 5ANIA 4IM2A 4MK0A 1U54A 2OGVA 4HZRA 4FZAB 5HD7A 3LFSA 3M11A 3CY2A 2XVDA 4QP3A 3GC0A 4UWBA 2C68A 4FG7A 4UYAA 4LYNA 4W4YA 1XHAA 1ZOHA 2WKMA 5HIDA 3DY7A 4E4NA 3DOGA 5JQ8A 4D5KA 3PXQA 3TDWA 2FH9A 4LGDA 4J96A 4J1RA 3GCPA 3QWJA 3A7IA 5LVPA 3DS6A 2C6EA 3IECA 4RIXB 2OG8A 4RRVA 4IX4A 5CZIA 4FNZA 4FNWA 4BCIA 4C34A 2XNGA 3P78A 4AUAA 4B6LA 3BBTB 3UC3A 4FX3A 4GFOA 4I94A 4EHEA 4AT4A 3EQDA 4ALVA 1CDKA 2J50A 2UZTA 2CJMA 4Y85A 1E1VA 4FIHA 3BQRA 3LFDA 5IDPA 4O6EA 4RA5A 2LGCA 4RJ3A 5FDPA 3LM5A 4I0TA 1Q61A 2BDFA 2GNGA 2IJMA 4RX7A 4U79A 2CNVA 4ZTLA 1JNKA 5CQWA 2FB8A 3PA5A 3KREA 4EWHA 5C27A 3FQSA 4PL5A 3DBDA 4TWNA 5BYLA 3RGFA 3FMMA 3HP5A 3HV4A 4LV5A 5EM7A 5EYCA 1A48A 2C47A 2O65A 3WZJA 3HX4A 4AW5A 3R71A 2RF9A 1YOJA 2CHLA 2J7TA 5E8VA 2B9HA 4C4HA 4QNAA 2WHBA 3FMLA 4UXQA 3LXKA 3ET7A 5L6PA 3T3UA 4PNKA 2B0QA 3VS6A 2WOTA 3KU2A 3R1YA 4ANNA 3T8OA 2ETRA 1PW2A 5LXMA 3EYGA 5A6NA 4UMPA 4J98A 4D5HA 2BPMA 1M2QA 3DKOA 3FAAA 5ETFA 5KKRB 3GC9A 3ROCA 3D5UA 4X3FB 1J3HA 1ERKA 2OJGA 2CKQA 2W4KA 4JQ8A 3PLSA 4MAOA 3FPQA 1REKA 5H8GA 3NIEA 1KOBA 2V62A 3FY0A 1PXMA 1JAMA 2YM4A 5JFWA 5EK7A 4UZHA 1UKHA 3KFAA 3HMIA 4RJ4A 4FR4A 3RALA 2XBAA 1JWHA 3HA6A 2REIA 3C1XA 4J7BA 2VTRA 4E5BA 5IQCA 2JDTA 5LOHA 4CKJA 3IPHA 4U43A 4RLKA 3LFCA 4FG8A 4GG7A 4R7HA 4V01A 2VTMA 3BLRA 3GP0A 4WG3A 4AN9A 1ZYSA 3F3VA 3OEZA 3ZBFA 4IFGA 1APME 3QU0A 4G16A 3R7EA 3WARA 1TQMA 2QHMA 3WZKA 3MJ2A 2XRWA 2W0JA 3PRIA 3IW4A 2WTCA 1F3MC 2X8DA 3MI9A 4YPSA 5AR4A 5T3QA 2QR8A 4PNIA 4BICA 5CAQA 4WO5A 2IWIA 4UWCA 1GIJA 1PXOA 3GENA 1F5QA 3UG2A 4LL5A 2I0HA 3Q4ZA 5E8WA 2X6DA 4GL9A 4YR8A 3EFKA 4CFWA 1M17A 2V0DA 5AP7A 2ITNA 3ZDUA 3QGYA 4U45A 5LMAA 3WZEA 2RIOA 4A4XA 4I93A 4D4SA 4RZVA 3EN5A 3K5VA 4KIOA 4BR3A 2R3LA 3NNXA 3D9VA 3ZFMA 3LCSA 3Q5IA 4CZTA 2Z7QA 2PWLA 5EH0A 5HO8A 4MBJA 2C4GA 4CV8A 5AUVA 4YUQA 2PUPA 4O82A 4AFEA 2O2UA 3ENHA 1YWVA 1H26A 4J97A 4F9YA 4MXYA 4FEXA 4BCHA 5IQIA 3SG8A 2BHHA 3A4PA 3MVMA 5A3XA 3NVMB 4O7VA 2EXCX 4YZNA 4WD5A 5AM6A 3RI1A 3AD6A 3FXXA 4D2RA 3R7IA 4EBVA 2QOBA 5JGBA 1FVVA 3DDQA 3O0GA 2XA4A 1ZYCA 4FT3A 4I22A 4PDSA 3VS0A 3WZUA 3ETAA 2ONLC 4BYIA 4EK3A 4H3BA 4GYIA 4NJ3A 3G9LX 4EH2A 4NL0A 3PYYA 4RT7A 3C0IA 3DU8A 2RL5A 5HVJA 3ZONA 4CYJA 4NEUA 3MY0A 4IZ5A 1GZNA 4QMLA 3RMFA 5AV4A 3QRUA 1NXKA 3Q9WA 5AIKA 3E63A 2ITXA 3EYHA 3K2LA 2YM8A 2R3IA 2WFYA 1JKLA 1NVRA 3Q04A 4OBPA 5CYIA 1YXSA 4RFZA 2PSQA 2OFVA 3TWJA 2XNEA 4EI4A 3EJ1A 3KULB 2ZV7A 3R9DA 4FTTA 3QALE 4TZRA 5AP4A 2DYLA 3EN7A 1H07A 4O0XA 3TEIA 3Q5ZA 5FWKK 1RW8A 3FBVA 4JAJA 3LCKA 4LUEA 1JLUE 4R3RA 5IUIA 5M4FA 3GU5A 5HU9A 4LRJA 5DBXA 3ZUVA 4PMMA 1FMOE 3DXNA 5D41A 5M51A 2XYUA 3TNQB 2JDSA 2XNMA 4QYFA 4RIYB 4ASZA 3OFMA 4KA3A 2C0IA 4TKSA 4RA4A 4K9YA 2VWXA 4JBVA 4PF4A 1NY3A 3QKKA 3R30A 2XK7A 2WIHA 4TWCA 2BKZA 1GZ8A 2JFMA 5EYKA 3VUHA 3R1NA 3S4QA 4BB4A 4H3PA 4U0IA 1KSWA 4XP0A 1IR3A 4PX6A 3LLAA 4USEA 3F5GA 4UV0A 4EYMA 4ANMA 3VHEA 2R3QA 4CD0A 5KMKA 4EUUA 2ZDTA 3UIXA 2H96A 4GJ3A 5EI2A 2EXEA 4NKSA 3IDCA 1IA9A 3HA8A 4DFYA 4FEVA 3N4UA 3MY1A 4CSVA 3VF8A 1UNGA 3DNEA 1ZY5A 3E3BX 4HPTE 3EWHA 4L44A 4OUCA 5IU2A 4Q5EA 2ZOQA 4RQVA 3WE4A 4QO9A 3DJ5A 2X4FA 4YTHA 4BWKA 5D10A 4F0FA 2XJ1A 2VTHA 2W9FB 1KWPA 3LQ8A 1XH9A 4M69B 5HCXA 3UOLA 4C35A 5A54A 4AZVA 3GU8A 5AUUA 1GOLA 3BI6A 4X2GA 1XH7A 2OK1A 4ZJJA 2R3JA 3BLQA 4R1YA 3AD4A 2RKUA 3D5XA 3DAJA 4ITIA 4RSSA 5J7HA 2CLQA 3JS2A 5L2WA 5BVOA 4KSPA 5D7AA 2CKEA 3AC4A 1P2AA 4ZLYA 1ZARA 2C5YA 3AC5A 5B2MA 2XH5A 4RQKA 4JVGA 5I9XA 2F7XE 3DBCA 4IWOA 4H1MA 1FGIA 4MXAA 4O7RA 3TZ8A 3VNTA 4OAUC 1W98A 1UNHA 2W4OA 3QD3A 3PIYA 4K2RA 1JKTA 2VUWA 2X2KA 2XIRA 3HRBA 1PMVA 3LXNA 5BMSA 4GKIA 5ANEA 2BIKB 5DG5A 4RWJA 4M67A 1H25A 4UBAA 5F1ZA 3DK6A 3FZ1A 3KK9A 2YACA 1FMKA 1TKIA 2XIXA 2ZMDA 1JKSA 3DT1A 4KIKA 4TYHA 2W9ZB 1JSTA 3HV7A 5E8XA 1YI6A 1YHWA 3FMJA 4QMSA 5IQGA 2GS2A 3CTQA 3QBNA 3U9NA 3TNWA 4HVDA 4EK6A 4D2SA 2Y6MA 3PE1A 5L2QA 3OW4A 4QTBA 1VYWA 3LKMA 4WNKA 2WTWA 1WBTA 4ZS4A 4HCTA 4ZSGA 3MH0A 2PE0A 4U44A 5FEEA 2DQ7X 3OY1A 2BIYA 3MVJA 2H6DA 3R6XA 3PP0A 1Y6AA 2FGIA 2UZWE 3HMPA 3IOPA 4QMZA 4RPVA 5CU2A 4C4FA 4WNOA 3UYSA 2VX1A 3AMBA 3MH1A 3QA8A 4NIFB 3F3TA 3QQJA 3CS9A 1W84A 3VWAA 3P79A 3F7WA 1WZYA 1V1KA 3LFNA 3RKBA 3UC4A 1URCA 3QC9A 3H9OA 5DPVA 3R8PA 4N57A 1HCKA 4YURA 4CG8A 3TKIA 3C51A 3EHAA 4RC3A 4ZXTA 4X6RA 4WUAA 4LFIA 4CLJA 3JPVA 4MX9A 4RIOA 5DYJA 5EM6A 4CXAA 2F2UA 5GIPE 5TKDA 1MRYA 5EDQA 1H1QA 3GOKA 3CKWA 4HVGA 4EOQA 2G01A 4TW9A 4EONA 4BHNA 5I9VA 2O0UA 3QQUA 3FI2A 2OJFE 1OBDA 4QMOA 4RX5A 5LMBA 4AZWA 5IEVA 3PPJA 4WG5A 3C7QA 3VQHA 3ZO2A 2FO0A 3OBJA 1OB3A 5GZ8A 3ZZEA 2PY3A 2PVYA 2YAAA 2W7XA 5KMIA 4Y5HA 4R7IA 1KOAA 4AAAA 3RPVA 2UW4A 3D83A 3QXPA 4HGSA 4IDTA 4UEUA 2JAVA 2VWVA 3UIBA 4MNFA 4YJOA 5T6KA 1YWRA 4EHVA 2BRHA 4I21A 5K3YA 1BI7A 2ETMA 1PKGA 4ZS0A 4FTIA 5HOAA 1Q99A 4Z7GA 3ULIA 3BV2A 3DZOA 3F3WA 3PJ2A 3PSBA 4IC8A 4XG9A 1WVXA 4AN2A 4DLIA 3UDBA 2BRBA 4C4IA 3TTIA 2P0CA 1OL2A 4PDYA 4G3GA 4JT3A 3QTXA 4QP6A 2AC5A 3VUMA 4KS8A 5F4NA 1GZKA 4GVAA 4DITA 4YZMA 3EQFA 4W8EA 4FV6A 5ETCA 5I9YA 5CAPA 5M07A 3FUPA 5JQ5A 2E9VA 5J1WA 2ITUA 2P55A 2R3RA 3W33A 2BFXA 2E9UA 3S1HA 2W1FA 4J8MA 4CT2A 3BZ3A 4NTSA 5AP5A 3H30A 5F20A 1U5RA 2JC6A 2ZMCA 2B9IA 4XG8A 1JPAA 2X9FA 2ITTA 1O6YA 1J7UA 3ZSIA 4D1ZA 2VTIA 2XK8A 3EN9A 4IB1A 4XCUA 4JBQA 2XIYA 5FUTA 2CGXA 3D14A 4CMTA 4K18A 4D9TA 2G2IA 4FGRA 4I5PA 2J0IA 4EJ7A 4PMTA 3A7JA 4BL1A 1VZOA 4MEDA 3V3VA 4AX8A 3IW8A 1Q8UA 3OCSA 5D1JA 3E8NA 3VBVA 4IADA 1UWJA 3PG3A 4EKKA 5A4QA 4U42A 4EHGA 2PMOX 2O3PA 5HX8A 1Y57A 2QOKA 4QMMA 4MWIA 5HE3A 1YXUA 4MNEA 3Q9ZA 5J1VA 4X2NA 3GUBA 4C38A 4D28A 2J5EA 4YJSA 2DWBA 2UZNA 4YHFA 2XS0A 5JFSA 1IASA 3FMEA 3ITZA 5AV2A 2VO7A 3JVRA 2PE1A 5J95A 4YHJA 4FT0A 2JGZA 4FSMA 4QMPA 2PUNA 3Q9YA 2IVTA 2HXQA 2J0LA 3NUNA 5L8KA 3LVPA 1DAYA 3KVWA 2VRXA 3QCXA 4XG6A 4AQCA 4AW0A 4BIDA 3ZDIA 4UB7A 5FLFA 3HKOA 5J5SA 4PP9A 4L67A 4BTFA 3HNGA 4C0TA 3MPTA 4R3CA 4NWMA 2BROA 2FSTX 5CS6A 4MWHA 3R28A 4R1VA 3TI1A 1KV2A 4YSMA 3GQLA 3WF5A 1J1BA 3GC8A 2B54A 2HW6A 4V04A 4EOLA 1YKRA 5IUGA 4ORKA 1OITA 4CGAA 2C0OA 4DEHA 3DGKA 3FKOA 4LMUA 1STCE 3U4UA 5KMOA 3NEWA 5C8KA 2Y7JA 5M4IA 3PTGA 4U97A 5AUXA 5F95A 2KTYA 3WE8A 3M42A 3DPKA 5AR3A 2VO3A 3TUCA 3CIKA 3NUSA 2UW7A 3QX2A 5JK3A 4O0RA 3VJNA 4BBEA 2R3OA 4PPBA 3RBWA 2W1ZA 2CKPA 2IVVA 5IQFA 3Q3BA 4OTWA 4F64A 1Z57A 3BV3A 2QOQA 3EN4A 4DFLA 5BVDA 5CALA 2OU7A 5IH5A 2WQBA 4HNFA 2QONA 2HY0A 4LQMA 4PDOA 4ITHA 3P7AA 4FTAA 4BTJA 3KGAA 3QKLA 3V5JA 4AACA 4YZDA 3V6SA 4F99A 3VS4A 4JJRA 3A7FA 4PY1A 2CGVA 4AZTA 1JKKA 3HMMA 1P5EA 4BIBA 4S34A 3BE2A 4E1ZA 2VWYA 4FGBA 3DQWA 3ZZWA 5H3QA 3FEGA 3PWYA 4V05A 4BCNA 3JY0A 3IKAA 3BHUA 4FKRA 4UX9A 4HGLA 3W16A 3ZM9A 2B55A 3O50A 3I1AA 3KKVA 4KWPA 4GEOA 4G5PA 3NLBA 5ACBC 3U6IA 1P4FA 3M1SA 4DEAA 4ZIMA 4U3YA 3RHXA 2BUJA 2J9MA 4O1OA 2BTSA 2WMAA 4YZ9A 4JDJA 5HU3A 5C8NA 3EQRA 4RIWA 3L9LA 4FL2A 3F2NA 1OKYA 4M68A 3VUKA 3BEGA 4GT4A 3FY2A 1ZMVA 3QUDA 2C6MA 5FQDC 3GGFA 1KE9A 3IW6A 4GT5A 3G2FA 4S33A 1TVOA 2ZJWA 2CPKE 3P7CA 2A0CX 2X2LA 3O8TA 5L2SA 4BCJA 4OLIA 1OKZA 3UBDA 5JZJA 3QFVA 3TM0A 4X2FA 1CKIA 3FDNA 3C9WA 2I6LA 3Q2MA 2RFSA 2GS6A 2ETKA 4FSQA 3WIGA 1K9AA 4LOPA 1I44A 3KN6A 3NSZA 3NZ0A 4WSYA 3ZO4A 4CQEA 4S31A 3ZBXA 3FZOA 3RZFA 5I0BA 4MQ2A 1G5SA 3QC4A 4O7NA 4O1PA 5K9IA 4LL0A 3T9TA 4IAYA 2R3GA 3QHRA 3OD6X 4AA0A 3LZBA 1OPKA 5HG7A 3P5KA 4BWXA 4C2WA 5HO7A 4G31A 3R01A 4O38A 3UNZA 5CENA 4WA9A 1YQJA 3Q60A 2YM3A 4FTCA 2WTKC 3SHEA 1CTPE 1YXVA 2YJSA 1H1RA 3ROYA 4BCQA 3I0OA 1AGWA 2UW5A 4BDBA 2C1BA 4H3QA 3QTIA 3CD8A 5CVFA 3II5A 4TRLA 3QKMA 3UZRA 2EUFB 3H4JA 3I5ZA 2Y0AA 4GFMA 5AP0A 1JVPP 5EG3A 3ANQA 2E9OA 3R2BA 3ZEPA 4DFUA 2PTKA 4RJ8A 4ZMFA 5FGKA 2A19B 1KE8A 4I6FA 5GNKA 4ZZNA 4O0UA 5CLPA 2I1MA 4EZ7A 4DH8A 4HVIA 4J71A 2VTNA 2HZIA 3W2CA 1V0OA 4XV9A 4N6YA 1YXTA 2BALA 4L7SA 4M8TA 4RVMA 3AMYA 3ZXZA 4AWIA 1OIRA 2F49A 4IX5A 1PHKA 3UE4A 3LLTA 4FF8A 4DGLC 3GBZA 3TV6A 5IISA 2QVSE 5JRQA 4QTCA 3NNWA 2J51A 3HV5A 2CGUA 2CCIA 3OWPA 2YIWA 1SM2A 1PKDA 1QPCA 2VTQA 3V5WA 3QLGA 4OT5A 2WMUA 4G6LA 4BKJA 1O6LA 5CI6A 4OTPA 2WZJA 4JG7A 4YNEA 4FIEA 3VRZA 3W8QA 3P23A 2OW3A 2A2AA 2GS7A 3FV8A 1KE7A 3P9JA 3AGMA 5CEQA 4ZLOA 5FG8A 3F61A 2VZ6A 2O64A 3FMHA 3PZEA 1WFCA 3R7UA 3U55A 3MYGA 3TL8A 4FTUA 5AADA 2VU3A 2Z60A 4YHTA 4C4GA 2PUIA 1IAJA 2X0GA 4DEBA 1OL7A 2UV2A 2YERA 3BHVA 3KB7A 5JN2A 2QU5A 1GAGA 2XNOA 3NYOA 3PSDA 5E92A 1KE6A 4XP2A 1CMKE 3NNVA 4O0SA 3UZPA 1XJDA 4GKHA 2Q0BA 3BHHA 4AS0A 2X7OA 3C5IA 2QOLA 3ODYX 4XNEA 3MFSA 3HVCA 2OXXA 3KXNA 4C58A 4TNBA 3UO4A 1ZYDA 1UU9A 5GZ9A 4G3CA 2XKDA 4ZEGA 3OXZA 4YJQA 2X7GA 3HV6A 3CJFA 4ZSAA 3LFFA 5DVRA 4W4WA 4ERWA 1YXXA 4ZMEA 2YCRA 3CC6A 3DTCA 2NRUA 4M7IA 2W1CA 2VWBA 3PJCA 3TDVA 4U6RA 4F1MA 4NUSA 5CEOA 3VBQA 4EH3A 3MSSA 3EOCA 1LR4A 2XK3A 4FTMA 4II5A 5GHVA 4F0IA 4J53A 4MF0A 3UODA 4FV3A 5FM2A 5CAOA 3HAVA 5EHLA 4D1SA 5BVKA 1OL1A 3FI3A 5KHXA 3FYKX 4F9CA 3EQBA 3C4ZA 4O0YA 4YJPA 2XCHA 3UVPA 4DTBA 2HY81 2YM7A 4NW6A 1IEPA 2IZTA 2QO2A 2RG5A 2VGPA 2YIYA 3F6XA 2PU8A 1GNGA 1V0PA 2UW8A 3OY3A 3V01A 5B7VA 3KXMA 2C6TA 2GNFA 2R4BA 2WTJA 4PTGA 4XLVA 2A1AB 5M53A 3U4WA 4DG0E 4E6QA 5AA8A 1KV1A 3GNIB 2VTPA 1RE8A 2W05A 3REPA 5IQEA 2XJ0A 2ITQA 1MRUA 3FLYA 5KNJA 3ATTA 4F7SA 3B2TA 2B1PA 4P4CA 4GIIA 2IVUA 4FNYA 4ALWA 4W9XA 4L7FA 4B4LA 2FSLX 3RPYA 4EH6A 3MB6A 4FZ7A 4RC2A 3LCTA 3RWPA 4EK8A 2XF0A 3NYVA 3QQGA 4FT7A 2VNYA 4RMZA 1A06A 3NNUA 2YLEA 4RJ5A 3SC1A 4LM5A 4ZLZA 1YHSA 1LEWA 4C02A 3E8DA 4CFXA 2XNBA 5HTBA 4BDJA 5FEQA 2YDIA 2ZV2A 3MJ1A 2RG6A 2Y4IB 2X81A 4OTDA 4Y72A 5B0XA 4BDEA 5E4HA 3D0EA 1JOWB 2XM9A 1CM8A 3BYUA 4BZDA 5FM3A 3VW8A 1YRPA 2ITWA 3NDMA 5KCVA 3UP7A 2IN6A 4QP9A 4GCJA 5AP6A 4UY9A 2BZIB 3F5UA 5AWMA 4FKOA 1BX6A 4AW1A 4LMNA 4H39A 4D58A 2PVRA 5IMEA 2Z7SA 1PXLA 4JIKA 5D11A 5DE2A 4BCGA 4GUEA 3ZHPC 5JH6A 2R64A 1PYEA 4FUXA 4FUYA 3PRFA 3I79A 3FLWA 3MN3A 3RPOA 3C4XA 2GTNA 3HRCA 2GCDA 1ZMWA 3UOKA 3GB2A 4C36A 4I41A 4ZSEA 4A9SA 4EH7A 1S9JA 4CFUA 3GFEA 2W1HA 3O96A 2W1EA 3BBWA 4G3EA 4XV2A 2WU7A 3LCDA 5JGDA 4AZFA 4C3RA 3AC2A 2WMVA 1WMKA 5EW9A 1SZMA 3GU7A 5HHWA 4F70A 4DTAA 2ZM3A 4RG0A 3AT3A 4GMYA 4JXFA 4NSTA 1NT2A 2OZAA 2O5KA 4IAAA 3NYXA 3PP1A 4BZNA 4XG4A 3EFLA 3KRJA 4HYUA 2QLQA 3I7CA 2J90A 3FKNA 3QD0A 5JRSA 5D7VA 5DWRA 1ZRZA 4GS6A 4WBOA 5CSWA 4BCFA 3KRLA 3LPBA 4XV1A 5BVFA 3C4WA 4JQEA 4BKYA 1IG1A 4P90A 4DFXE 4HVHA 3QGWA 2WAJA 4IFCA 1FVRA 4ZTHA 4C61A 3CLYA 3E64A 3NAXA 1PRYA 1P4OA 2ONLA 2OKRA 3QTUA 3I6WA 5AUWA 3B2WA 4EOSA 5E8UA 3V8TA 1J91A 3F7ZA 3DTWA 4FKGA 3DLSA 5TE0A 3FXZA 3R22A 4FIJA 4NT4A 2J6MA 3RHKA 5EYMA 1W82A 3EZVA 2ZVAA 4FIGA 3VIDA 3FC2A 3AT4A 3QQLA 4O6LA 3OUKA 5IEYA 4G34A 5KMNA 2FVDA 4QP7A 4APPA 2C3KA 3BU3A 3RK9A 4TYIA 3BYOA 3OCGA 2WIPA 4EOIA 3TN8A 4F09A 2G15A 5CEKA 3SG9A 3GT8A 3VVHA 1NA7A 4E20A 3EQIA 4ZTSA 3HYHA 4QQ5A 3NMUF 4D4RA 3GC7A 4HOKA 1M2PA 2A27A 5HZNA 3W2OA 3VUDA 2JFLA 3OWJA 5E91A 4USDA 5EQPA 2JDRA 2IZUA 2QD9A 4LG4A 3HDMA 2R3PA 4D0WA 3A4OX 3VUTA 4F6UA 3COMA 4C4JA 5IG1A 2P2IA 4P5ZA 4L45A 2VTJA 4DN5A 3FMKA 5CSVA 3R8VA 3FWQA 3FE3A 4GG5A 3WYYA 3RK5A 4KUJA 4B99A 3ZUTA 4BTMA 4QNYA 4HYIA 3MTFA 3VHKA 4HGTA 2C6DA 2JIVA 4C37A 3COIA 4X3JA 4CFFA 4XG2A 5EHYA 4XBUA 2HOGA 5EW3A 2BHEA 4ONAA 3TV7A 2VWZA 3MDYA 3PUPA 3C13A 3OT8A 2YCSA 1KE5A 3G0EA 3ZU7A 5AFVA 1XH6A 4FEQA 2QCSA 4FKTA 1DAWA 3TCPA 4YO4A 4AGDA 4I4FA 3FZPA 4FV0A 2WQNA 3GEQA 4DFZE 4EOMA 4Q9ZA 4GU6A 3Q9XA 4IXPA 2VN9A 3A7HA 4ZJVA 2C3LA 2BZJA 2C6KA 3PXKA 4FTRA 2OO8X 5CANA 1OL6A 4RIXA 2IZSA 5KX8A 2VWIA 3KMMA 2R7BA 4FKVA 4IQ6A 4JBOA 4RFYA 4WSQA 4BF2A 4EOJA 5IQHA 4EBWA 2XRUA 3OOGA 3MY5A 1M52A 4FTJA 4FYOA 4KB8A 4A4OA 2EU9A 3AGLA 3CXWA 3PZHA 4ASXA 5CQUA 4QYGA 1WAKA 2OF2A 3OHTA 3OUNB 5DT4A 3IGOA 2VO6A 3LJ1A 2OSCA 1WVWA 2UW0A 3NYNA 3W55A 3PDTA 1H8FA 4I24A 4BCPA 4H05A 4CT1A 4DTKA 4DH5A 5AIRA 3LMHA 3FQHA 2ESMA 2VWUA 3RINA 3MS9A 4L46A 3ZO3A 2XCKA 1OMWA 4Z16A 4JDKA 4XJ0A 5HCYA 4W4VA 4EQMA 3LIJA 2YDKA 1FPUA 3PE2A 4HVSA 4NM7A 3L9NA 4P7EA 2QOHA 4YLJA 5EHOA 4O96A 2UW3A 3MPAA 5IA3A 4PMPA 4FSNA 4LRKA 4EOKA 3BU5A 4ZSLA 2J5FA 4DT9A 5E8ZA 2PZRA 2GHLA 3IDPA 4QP2A 4BDAA 3AC3A 3ZH8A 4CMUA 4IBMA 2ZAZA 3UGCA 2QLUA 3LXPA 4JAIA 3ZLSA 3PJ3A 1DI8A 4G3FA 4M13A 4D2PA 3CKXA 4CG9A 4LOQA 3VUIA 4X3FA 4DAWA 3K3JA 3PY3A 4E93A 4PPAA 4MXXA 3R9OA 3U9CA 5I9WA 2QC6A 1QPEA 2FUMA 5E9EA 4AE9A 1LPUA 3DBQA 4BBMA 2XBJA 3CEKA 4EC8A 3LFEA 3QYWA 3VS3A 2IZRA 4JQ7A 2Y4IC 4QMNA 2VV9A 3ZXTA 4BDKA 3VBTA 3JY9A 4ZAUA 1NVSA 4IWDA 4WNPA 4O22A 4O27B 3HLLA 3Q32A 4RVTA 4G9RA 3BHYA 4Y73A 2QOFA 4ZTNA 3P08A 3Q53A 3PLAE 3NUYA 3GI3A 3Q4UA 4FV9A 1PXJA 4XLIA 3ULZA 2O63A 2PL0A 1OUYA 1PMUA 4TYJA 4UMTA 4OAVB 4YBJA 3KXXA 5KMMA 1SNUA 4UXLA 3SRVA 4RJ6A 4R77A 2QI8A 4HPUE 3D4QA 3CP9A 1ZLTA 1T46A 3H3CA 3VBYA 3ERKA 3CPBA 3ANRA 3MVLA 4D9UA 1O6KA 4Z3VA 3OXIA 3BELA 3MH3A 3PXRA 3R83A 4YJNA 5CXZA 1ZYJA 4OW8A 4R5YA 3IW5A 3SW7A 3PVUA 4R6VA 3ZM4A 3QCQA 5HTCA 1ZAOA 4BGGA 4TN6A 4DH3A 4F9AA 4YTFA 4CKRA 1H1WA 2WTDA 4Y8DA 5EQYA 3OCTA 4LRMA 5FXRA 4OTIA 3ALNA 1H01A 3R9NA 2XEZA 3ORNA 3O7LB 4XEYA 4QQTA 5EKNA 4BCOA 3Q52A 1DM2A 2QHNA 4D2TA 2QO9A 2B9JA 2GNHA 3EH9A 4DINA 3TV4A 3VAPA 5KKRC 4L6QA 5CEMA 2BFYA 4S2ZA 4X3FC 4QT1A 1DS5A 2DUVA 3W10A 3G15A 4PWNA 4QRCA 4G1WA 1YDTE 4DA5A 4XS2A 5E8SA 2R3KA 4ZK5A 1M14A 3ZLYA 5CF5A 2BVAA 2PVLA 4WT6A 1UWHA 1BL6A 5LVLA 3U54A 4MD7E 3FI8A 2YZAA 4JOAA 2I0EA 2X2MA 3QZIA 2YEXA 2WMBA 4FSUA 3RAKA 4I0SA 4MKCA 4O83A 1GIIA 3NCGA 4XMOA 3MW1A 4JS8A 2B4SB 1H1PA 2EVAA 4QP8A 4BIEA 3OTUA 3EL7A 5HIBA 5L8LA 2VGOA 3KXZA 4W9WA 4DH7A 2GSFA 3RAWA 3NUAA 1UKIA 3FC1X 3V8SA 5HIEA 1UNLA 4MQ1A 4M15A 3ZSHA 1VYZA 4I5CA 2UW9A 1PXPA 2ITYA 4AT3A 1LEZA 4ZZMA 5C4LA 3EN6A 3MIAA 3A2CA 5A6OA 3SGCA 3BYSA 3CD3A 3LXLA 2XMYA 3PWDA 5CSHA 1ZOGA 4CTBA 1REJA 3A8XA 4RIYA 1YVJA 3MTLA 3QD4A 4GRBA 3F66A 4GH2A 4NKAA 4FIIA 2W1IA 3UJGA 5IQBA 2WU6A 2JKOA 5BYZA 3GOPA 2GU8A 5HBJA 4YO6A 3QQKA 2GFCA 1QPDA 2I0YA 3KXHA 1ND4A 4NFMA 5EOLA 4D55A 5CF8A 1ZWSA 4ACDA 3RP9A 4HJOA 4YPDA 5DOSA 1H4LA 3QRTA 5CU4A 3TZMA 3R0TA 2PMIA 4QPAA 5ITAA 1U59A 1A9UA 2HAKA 5BNJA 4YC6A 4H36A 5AR8A 2G2FA 1QL6A 4KRDA 4M0ZA 3RNIA 1Q41A 2F4JA 3O2MA 3OMVA 3ACKA 4WKQA 3Q4TA 1H0WA 1PF8A 4AOIA 4C8BA 1JSVA 4AT5A 3VQUA 4F0GA 4M69A 3TG1A 4TYGA 4TYEA 5K0KA 1YW2A 4ASDA 3IOKA 4L3LA 5L8JA 3V51A 5IF1A 2PMLX 3SXRA 4DG3E 2YA9A 3PPKA 2BRNA 4RX9A 3RCDA 5L3AA 4NM5A 4GU9A 5AUZA 4HW7A 3LAUA 2P2HA 3BU6A 1OPLA 2VWWA 4ACHA 3PVBA 5GJFA 3OP5A 3BWFA 4FA2A 4F63A 2HXLA 4A07A 4BI1A 3FZSA 2EB2A 2QURA 5BYYA 4MF1A 4YLLA 1YHVA 4ARKA 2PULA 1SVHA 1H1SA 3DK7A 1WBVA 2B52A 3K3IA 5FTOA 5TF9A 2V7OA 1PJKA 5HNGA 1G8SA 4DGGA 5CT7A 2XYNA 3QRKA 3KQ7A 1HOWA 3POZA 3LCOA 3OZ6A 4FICA 3OROA 5H8EA 3FLNC 3QHWA 3BRBA 5I9ZA 1Y8YA 3GXLA 3V04A 2W1GA 3U8WA 4EH8A 1XH4A 2WMQA 4FI1A 4EQCA 4YTIA 2XZSA 3D7ZA 4IM0A 3DK3A 2ZB0A 3G33A 4JNWA 4FL3A 4WNMA 2E9NA 2OFUA 3KL8A 3QZGA 4JDHA 5LMKA 3NVKI 1BLXA 4K77A 2YM5A 3EQHA 2XKFA 1OKVA 2C30A 4QMWA 5CWZA 1R39A 5IA5A 5FD2A 4UZDA 3TIZA 2R0UA 4XHKB 2P4IA 3ZOSA 3ZUUA 3KA0A 2V5QA 2ZV9A 3HMOA 3KF4A 3MGYA 5F9EA 3F2AA 4APCA 3WF7A 5CF4A 1G8AA 4FKQA 4RVKA 3W8LA 3D2KA 4JX3A 1MP8A 5A4LA 4DG2E 4AP7A 3BLHA 2BILB 3EFWA 4O2PA 3IG7A 2JAMA 4NM0A 2BDJA 1Q8ZA 2Y6OA 4NIFA 4QPSA 4AGCA 3AD5A 5CAUA 2BZKB 2I40A 3MA6A 3UTOA 4CCUA 3FHIA 3CTJA 2VNWA 5K4JA 4IX3A 2PYWA 1OBGA 2GNJA 2PZ5A 3D7TA 3SVVA 3W2RA 4RVLA 3FQEA 3L9PA 1M2RA 4CCBA 4RWIA 2I7QA 1IA8A 3WF8A 1SVGA 1ZMUA 4CMOA 2IW8A 4EOPA 3ORLA 4PTCA 4RZWA 1G3NA 3OEFX 4FKJA 3LOKA 5C03A 4AOTA 2RFDA 3F69A 4O21A 3OOMA 2CKOA 5EDRA 4TNDA 2ERZE 2IVSA 2QR7A 4CNHA 2GQGA 3O51A 2GMXA 2GQSA 4MBIA 3I0QA 1P14A 5CVHA 1V0BA 3FPMA 1JQHA 5CX9A 3UQCA 4R7BA 4QTEA 3DAKA 3MVHA 4D0XA 4IW0A 4L00A 5CXHA 3F5XA 2BAKA 3F9NA 3BYMA 5DGZA 3TNPC 5B2KA 3OXTA 5L6OA 4AE6A 5E7RA 4PTEA 4U7ZA 3DXQA 4I4EA 2W06A 5AMNA 5CSPA 5LMKC 4YU2A 4A9TA 2H9VA 2ZV8A 5AP3A 4JR3A 4U81A 3VN9A 3L8XA 2HW7A 4LGGA 5BQ0A 3FLQA 3V5PA 2FSMX 3KXGA 4TTHB 4AOJA 5D12A 5HCZA 3LQ3A 4IB5A 4V0GB 4E4LA 3I7BA 4YC3A 5TO8A 5A46A 3DKGA 1OPJA 4BYJA 2J0JA 4BFMA 2X8EA 1OL5A 4L68A 1BI8A 3TKHA 2YISA 4O7YA 5M55A 1T45A 4B7TA 4MXOA 4NM3A 3HAMA 4Y5QA 3I60A 2CCHA 5EM8A 1U4DA 3DLZA 5IQDA 3E87A 4ANSA 4YNOA 1U54B 4X6QC 2GTMA 2YAKA 5GIOE 4E6DA 1Q8YA 1OIYA 3CR0A 4MCVA 3NW7A 2XK6A 4X0MA 3ZS5A 5CU0A 4X2KA 3B8QA 4WIHA 2WEIA 3F88A 3KRXA 4KAOA 3C4EA 5GJGA 1QPJA 3TACA 5AV1A 2CLXA 1YI3A 1SVEA 4G3DA 1Q4LA 3OW3A 4I5MA 5T68A 3A62A 3FKLA 3PJ8A 3VF9A 5IPJA 1Z9XA 2ITVA 3NS9A 2GDOA 3ORTA 4FMQA 4FOBA 4IWPA 4QMUA 3RNYA 1H08A 5IA1A 4U80A 4D4VA 4F7JA 4O7LA 3QTSA 5EDPA 2Y8OA 3DB8A 3R7VA 1XKKA 2OZOA 5JFXA 5ANKA 2HIWA 4CZUA 1H24A 2WXVA 3OC1A 3R1SA 2CN5A 4QYYA 5M06A 4CFNA 4O0WA 2YITA 3NGAA 1RDQE 3EFJA 2OH0E 4XG7A 1FGKA 1K2PA 2H8HA 3CGOA 2W99B 2XIZA 4IAFA 4QQJA 3VBWA 3ZSGA 4M14A 1Q8WA 5DI1A 3RPSA 3VS1A 1Q5KA 4RLLA 4U3ZA 4YJUA 4ZTQA 1OZ1A 5H9BA 4FTKA 4QMVA 4BCKA 3JR1A 3POOA 5DA3A 3LE6A 3GCVA 4TWOA 1Q3WA 4D4YA 2YIRA 1B6CB 5IA4A 2Q0NA 2PE2A 3QYZA 2Z8CA 5HX6A 2HWPA 3OTVA 3E5AA 4M97A 5FP5A 5AR5A 2HZ0A 4ZTRA 4JBPA 4AGUA 3CCNA 2ZB1A 4FV2A 3KCKA 4XP3A 3UVRA 1BUHA 2G1TA 4FT9A 4FV7A 2Z2WA 2VTTA 3P86A 1Y8GA 5C4KA 4AU8A 3UVQA 3AXWA 4XH6A 4L3PA 3TNHA 1H00A 4ZJIA 1WBWA 5KO1A 4A9UA 2WQMA 3RWQA 5ETAA 4S32A 5HG9A 4WRSA 3S2PA 4C7TA 4RC4A 2UVZA 4O7TA 1SMHA 3C5UA 3RAHA 3FZRA 4UN0C 4MHAA 2R0IA 3D2IA 4QMTA 4F4PA 3QA0A 2CN8A 4O86A 4YJVA 4B0GA 1XQZA 3QQFA 4BDDA 4IVAA 2Z7RA 1BL7A 2OF4A 4FSYA 4FV8A 4MD8E 2JBPA 5HNBA 3KY2A 2F7EE 5IQAA 4DF3A 3QX4A 1CSNA 3FJQE 4IB0A 2YM6A 5M56A 5AR7A 1JBPE 4BY9E 4RX8A 5GZAA 3IONA 4F6WA 2J2IB 2XK9A 3QLFA 2JD5A 2YJRA 3VULA 2V55A 4TWPA 3R00A 5ANGA 5KMLA 4FKPA 3AG9A 3ZMMA 3FHRA 4WOVA 5HKMA 3SV0A 4JG6A 3R9RA 3Q96A 4G5JA 4AN3A 1ZOEA 5TR6A 4TPTA 5JEBA 5CEIA 4RGJA 4ANOA 4R3PA 5K5NA 3FMDA 2P3GX 2PMNX 3O71A 5TOZA 5AV0A 4FNXA 4ALUA 4BI0A 4O7SA 3H0YA 3R7GA 4I3ZA 4IM3A 1PYXA 3CSVA 4F1OA 5IMXA 3N4VA 4IZAA 4YTCA 5ETIA 3ZRMA 4F9BA 2JKQA 3NAYA 3QD2B 2W17A 4KSQA 2JBOA 4XOZA 4PP7A 3L1SA 2VAGA 3CY3A 2ZM4A 4FK6A 1AD5A 3K54A 3ZLWA 3AQVA 4KINA 3CBLA 4GT3A 3C50A 4HNIA 2QKRA 3SDJA 5M08A 2BAQA 2C3JA 4JDIA 4O91A 1FBNA 2GPHA 5LCJA 4I23A 4CFMA 4K8AA 3S3IA 3F5PA 3R8MA 4EUTA 5IUHA 2R7IA 3LW0A 1UA2A 3E8EA 3DBFA 4PL4A 2IW9A 2BRMA 5AR2A 3HECA 2BCJA 2ERKA 4IEBA 4NU1A 4IACA 4GW8A 4DBNA 4N0SA 5I4NA 4FYNA 2WTVA 2B9FA 4JI9A 5DR6A 4NZWB 1UVRA 3GFWA 3HUBA 4DLJA 3ORXA 3ALOA 2B53A 2C1AA 5H8BA 3ZFYA 4DCEA 3BGZA 4FV5A 4YJRA 4GK4A 3RK7A 2BAJA 1R0EA 3I5NA 3GQIA 4K1BA 1OGUA 2UZVA 3UNKA 4G6OA 4QTDA 4ZTMA 3A8WA 4E73A 3QRJA 3A99A 4O0TA 5KZIA 2BMCA 3I6UA 5BUJA 5TT7A 1J1CA 3QAME 3LQ5A 4KNBA 5HLPA 2NRYA 2PVNA 4FTLA 3EMGA 4Q9SA 3C4CA 4DFBA 4PRJA 1TQIA 4CTCA 1W83A 4FKUA 3FYJX 4L43A 4CYIA 4U8ZA 2YZLA 2XUUA 3TXOA 3NRMA 3ODZX 3PXFA 4K0YA 5GINE 2VTOA 4KIQA 4BI2A 4KKEA 3KK8A 4TY1A 2HZNA 5HNIX 4FEWA 5EOBA 4C3FA 4EJNA 4JIAA 4XX9A 5FTQA 1NW1A 2ACXA 4FKIA 2QQ7A 4DEIA 2Y4PA 2BZHB 5LQFA 3MA3A 4Z7HA 4X7QA 4ITJA 2NP8A 2QODA 2ZYBA 4ACGA 3UO6A 3N51A 5FDXA 2QO7A 3E93A 3MPMA 4L53A 4DH1A 3DKCA 3ZRLA 2YN8A 4XRJA 5G1XA 3GVUA 5AX3A 4CRLA 5CEPA 4AXAA 2C6LA 4J8NA 5BPYA 5ICPA 3UG1A 2AC3A 4WG4A 4EK5A 2OICA 2YCQA 3KEXA 4I0RA 4EORA 3NR9A 3PJ1A 2XP2A 3OG7A 4IX6A 3ID6C 4HZSA 4BHZA 4IZ7A 4L3JA 4M0YA 5IH4A 2UVXA 1ZXEA 3R2YA 3I4BA 3LJ2A 2XKEA 4IANA 4B9DA 2WMXA 4DEDA 4R5SA 5C1QB 4U40A 3BEAA 4FZDB 1R1WA 5BUEA 4U41A 2YCFA 3OWKA 1OUKA 3TKUA 4CEGA 5CASA 4HGEA 2RFEA 4L01A 4KBCA 5KMJA 4FODA 3C0HA 4IVBA 1FOTA 5A14A 3ZCLA 4N4SA 4QMXA 3QWKA 2V7AA 4MXZA 2OIBA 3DV3A 3C0GA 1UU7A 1MQBA 3OWLA 5JFVA 1ZYLA 3THBA 5CF6A 3PIXA 2X4ZA 2F7ZE 3BHTA 3PXYA 4PV0A 4TT7A 1WCCA 5FRIA 3BKBA 3DXPA 4IAKA 4KABA 3ORZA 3SRVB 5KBQA 2F2CB 4PMSA 4KIKB 4FG9A 4TYHB 3L8PA 3CJGA 2R2PA 3Q2JA 2CDZA 4RJ7A 4PQNA 1QCFA 2KULA 4KKGA 3PA4A 2JLDA 4FL1A 4QYHA 2OWBA 4XBRA 5CU6A 2J4ZA 4IJPA 5JGAA 5CVGA 3BQCA 4GK2A 1WBOA 3PIZA 2J0KA 5DRBA 4QQCA 4QP1A 4DFNA 1F0QA 4ZZOA 2W5HA 5CT0A 4BDFA 4BDIA 2PK9A 3MFUA 1MRVA 4A4LA 4EYJA 3W2QA 5AV3A 5DMZA 1WBSA 2JIUA 3DAEA 4J52A 5CZHA 3EQPA 5EW8A 4ZY6A 4E7WA 4IIRA 3DFCB 4DGNA 1XO2B 2XNNA 3AMAA 5HEZA 3R8UA 2X9EA 3CGFA 1H0VA 2GNIA 2QU6A 3D5WA 5FP6A 1OI9A 4DT8A 4ZOGA 4ZY5A 4DE4A 4RWLA 4IE9A 2CNQA 5I5ZA 1E9HA 4RFMA 3GCSA 5LVNA 1XH5A 4ENYA 1M7NA 2CSNA 3SOCA 3A61A 5LWNA 4YBKA 3VRYA 3VBXA 4EQUA 3U6HA 3R63A 2OLCA 2GNLA 5I3RA 2PVJA 3PFQA 3ZC5A 1URWA 2YIXA 3BE9A 3DA6A 4WBBB 3UMXA 2VTLA 2HELA 3JUHA 2HWOA 4QP4A 2X8IA 2R3HA 4B8LA 3VUGA 2C5OA 2JKMA 4N6ZA 2UZDA 2UZOA 5DNRA 3VC4A 4CRSA 2W5AA 5EKOA 4GYGA 1LUFA 3U51A 3E92A 3I81A 2GHGA 3O8UA 5JSMA 2XIKA 3FL5A 1IRKA 2IO6A 2OXYA 1CKPA 3OVVA 4YSJA 4C57A 3MH2A 4IVDA 3CE3A 5AUTA 3DFAA 3FSKA 3NUUA 5HG8A 5AUYA 3OBGA 3H9RA 4G9CA 2QNJA 4AZSA 2WNTA 1UU8A 3F3UA 4BBFA 4NYEA 3Q4CA 4LI5A 4ID7A 3DB6A 5J7BA 1Y6BA 4R78A 3H9FA 2WO6A 3MFTA 4FVRA 5ANDA 4Z9LA 5EI6A 5BVWA 4QMQA 1XBBA 2XKCA 3TUBA 2PVMA 3R04A 3PVWA 4KBAA 4AA4A 1E1XA 4AA5A 3DJ6A 4Q2AA 4CQGA 2BKKA 2Q83A 4UMUA 4K6ZA 2C6OA 4GJ2A 4DEEA 4FT5A 5IA0A 2FSOX 5ANOA 4BCMA 3PA3A 5J79A 3F3ZA 5J87A 4GUBA 4I6QA 4AFJA 5K0XA 3FLZA 4R8QA 2JEDA 3SQQA 3BYVA 5HLWA 3W1FA 3DJ7A 3VS5A 4OGRA 1GY3A 5IDNA 2C6IA 2JIIA 3EB0A 4EHZA 5D9HA 5EQEA 3K5UA 2LAVA 3ZTXA 3RM7A 1PXIA 1RQQA 2QG7A 4H1JA 4P5QA 3AOXA 4JR7A 4QOXA 4ZSJA 3DDPA 3IO7A 3IGGA 3WIKA 4BDCA 2OJJA 2OXDA 2PVKA 3V5QA 1ZZ2A 2PZPA 4OTQA 3V8WA 2GQRA 4DGMA 3UPZA 2NPQA 3DKFA 1XBAA 2QKWB 4RBLA 5HICA 4DBXA 4OTFA 5HQ0A 3QQHA 4MXCA 5IZFA 3PY0A 4UMRA 4NCTA 5HO6A 3IQ7A 3MV5A 4MNEB 4ASEA 4EOOA 4QPMA 3HL7A 3P1AA 3EIDA 1W7HA 4FKWA 5AA9A 3S95A 2HYYA 4E5WA 2PVHA 2YHVA 3QF9A 4GSBA 5C9CA 3WF6A 4M84A 4OBOA 3ZYAA 5A4EA 3S0OA 4UWYA 4DGOA 2YWPA 3TZ9A 2RFNA 3VS7A 3ATSA 5IH6A 5KBRA 4F9WA 2WGJA 1FINA 1UV5A 3HUCA 5C26A 1QMZA 2OIDA 3BX5A 2VD5A 4OTRA 3KVXA 4D2WA 5CY3A 5JT2A 5FXSA 4XG3A 2I0VA 1GJOA 3WBLA 4YLKA 5BVEA 4BGHA 4EH4A 3IS5A 4USFA 2R3NA 3HGKA 4KD1A 2J0MB 2RSVA 3T3VA 5HORA 4ANQA 2JDOA 4BC6A 4F65A 2BDWA 4E4MA 3W18A 3HMNA 3P7BA 2UW6A 4Z55A 4G17A 2VO0A 5LARA 1MUOA 2Z7LA 3RM6A 4I1ZA 4FEUA 4QMYA 3EZRA 4S30A 4YZCA 4HCVA 1GIHA 3RAIA 2E9PA 1R78A 2WB8A 1U46A 2C5NA 4FTNA 4WUNA 5A4TA 3RVGA 5BX0A 3PSCA 4F08A 3QL8A 2OI4X 3G5DA 1OECA 4JRVA 1TQPA 2XM8A 4E6CA 4ENXA 3BWJA 5BUIA 3O17A 3WYXA 3VS2A 4XYFA 1OIQA 3UOHA 3G9NA 3FL4A 1X8BA 2E2BA 2OJ9A 3D7TB 4ZP5A 4NCTC 2NNWB 3QZFA 4B8MA 4I92A 3E7OA 4D2VA 5J5TA 5J9ZA 3CPCA 3KULA 5FBNC 2G2HA 4BZOA 3HEGA 5E1SA 3TNIA 4LGHA 4IZYA 2WTKB 5M09A 3DQXA 2FYSA 4MVFA 5BMMA 2P33A 4HCUA 1Z5MA 4LUDA 4FSWA 5L4QA 2C5XA 1XBCA 1YDSE 4XV3A 4DCAA 3GU4A 5E8YA 1L8TA 3R8LA 4A9YA 3NCZA 3HDNA 4O0VA 3W2SA 2WD1A 5M4UA 3ACJA 4ANBA 2HK5A 3EKNA 2GFSA 3KMUA 5DEYA 5KE0A 3LMGA 3FI4A 3KMWA 3FSFA 4RIWB 1PY5A 4FE2A 4XRLA 4L52A 3UOJA 2AUHA 2YWVA 5HG5A 5AX9A 4YJTA 4KKHA 4F7LA 1EH4A 3R73A 3QTQA 4O7ZA 1VR2A 5K5XA 4CVAA 3E3PA 5HE0A 4O7WA 2ITPA 3VW6A 3JYAA 3TUDA 3ZO1A 3R7YA 4E4XA 3E88A 4BDGA 4BDHA 3N4TA 2UZUE 3U87A 5DLSA 1B39A 1GZOA 4HYHA 3HP2A 3G6HA 4U9AA 3PG1A 5BVNA 3ZRKA 5LJJA 3U6JA 2R3MA 4JG8A 2XB7A 4IVCA 3KC3A 4F7NA 3CTHA 2OH4A 2RGPA 5DHJA 2YLFA 4MTAA 4Q5HA 4AG8A 5A4CA 3KCFA 1AQ1A 1LP4A 3CQUA 5J9LA 5LVMA 2UUEA 3KF7A 3B8RA 4O81A 5GJDA 1J7LA 3QTWA 5HGIA 5AEPA 4C62A 3H0ZA 3FZTA 3GCQA 3NWWA 3T9IA 4E5AX 3P4KA 1ATPE 2PPQA 4FV4A 5KHWA 4AGWA 4KRCA 5DIAA 4IAZA 4C59A 4EEVA 2BR1A 2Y9QA 2EXMA 4FK3A 3WF9A 5E8TA 3LFBA 3Q6UA 3PPZA 3UO5A 2VX0A 5KZ0A 5DT3A 3BIZA 3QRIA 1SYKA 5LWMA 3NW6A 3JXWA 4E6AA 2NO3A 5HE2A 5IKWA 4JX7A 2YFXA 3DNDA 4FVQA 4P2KA 3TT0A 3MFRA 1OKWA 1YDRE 3MBLA 4KS7A 3DBEA 3NUPA 3ENMA 4GIHA 3QTZA 3ZLXA 4F1TA 3VJOA 2JDVA 1OIUA 4YZBA 1H27A 2QG5A 4IHPA 4PUZA 2VTSA 4CZYB 2ZDUA 4BN1A 5DRDA 5EYDA 5HTIA 4KBKA 1CKJA 4EZ5A 4YC8A 2R3FA 2X39A 1XH8A 3HZTA 4F6SA 3L8VA 3UIMA 4BRXA 4WHZA 2O8YA 3G0FA 5IEXA 3KRRA 2W5BA 2PUUA 5I9UA 4O84A 4KIPA 2ZM1A 2PZIA 2WQEA 2CMWA 4UMQA 3PVGA 5CAVA 3SKCA 2YIQA 3OS3A
chains in the Genus database with same CATH superfamily
5B2LA 5DH3A 2C3IB 5LCKA 3AC1A 3LFQA 2UZBA 4X21A 4FSTA 3UQFA 4PDPA 5FTGA 3ELJA 4PPCA 3IW7A 4X2JA 4BVUA 4UYNA 4NTTA 1BKXA 2PZYA 4PL3A 4NJDA 3WZDA 4ERKA 5DR2A 4XUFA 4LV8A 4QTAA 1PXKA 2F57A 1SNXA 4E3CA 4JMQA 4NFNA 2EWAA 1Q97A 4I20A 3TZ7A 4IMYA 3LFAA 5AAGA 2WMTA 3ORIA 4U5JA 2C5VA 5CTPA 1YOLA 5C8MA 3A60A 3QUEA 3EL8A 2GHMA 3HV3A 4CLIA 5DFPA 4AF3A 3QCSA 3QTRA 4G2FA 3KN5A 5KUPA 3RTPA 1FVTA 5LVOA 3R21A 2VX3A 2WELA 4D1XA 1WBPA 3G90X 5IA2A 3MB7A 4OBQA 2C69A 5J8IA 5HLNA 3OT3A 5M4CA 4EZ3A 1WBNA 2DS1A 2A4LA 4FTOA 4IJ9A 3ZC6A 4BTKA 1Q24A 1K3AA 2UVYA 3H10A 3E8CA 4FOCA 3COHA 1YI4A 4K33A 5I3OA 2YABA 4C3PA 4M12A 5H2UA 5C01A 3KRWA 5DT0A 3UMWA 4MD9E 4L8MA 3R02A 4L9IA 2C0TA 1BYGA 5FBOA 1KUTA 2UZEA 3D5VA 3O23A 3UNJA 4JLCA 2HENA 3EQGA 3NPCA 4OT6A 5HE1A 3NW5A 3AT2A 2WMRA 2F9GA 3SOAA 5A9UA 2VTAA 5AAEA 3GU6A 3V6RA 4EKLA 4GK3A 4ACMA 4M3QA 3O7LD 2IPXA 4QYEA 2OIQA 4CV9A 4M66A 4IH8A 4K11A 5HESA 3SLSA 1PMEA 3CQWA 4A7CA 5HD4A 1U5QA 5CU3A 4FKSA 2G9XA 2WQOA 2W4JA 4DHFA 5AP1A 5HI2A 3IDBA 4MYGA 2JITA 4Y46A 2PVFA 2UZLA 5HVKA 2R5TA 1R3CA 3PXZA 4EWQA 4EL9A 2W1DA 4DYMA 4IDVA 5ANJA 4EH9A 1NVQA 5AM7A 5FEDA 5ACKA 5JKGA 1O9UA 3D94A 4IAIA 1PMNA 4FZFB 3RCJA 3SW4A 3UP2A 1VJYA 3OF0A 2X1NA 3MIYA 2XEYA 3O8PA 5EI8A 5J9YA 2CNUA 2FA2A 4I6HA 3NUXA 3ZEWA 4A9RA 3COKA 4FSRA 3MESA 3HRFA 2CGWA 1W2DA 1MQ4A 3W2PA 3BLAA 2YDJA 3LMIA 4EH5A 5DN3A 4FTQA 2BRGA 3F2RA 2QOOA 3BGPA 4GVJA 4H58A 2IW6A 3Q6WA 4FSZA 4L42A 4W8DA 3ORPA 5L6WL 2PHKA 4ACCA 3ORKA 4BWPA 4E26A 3A7GA 4NK9A 2OBJA 2QOCA 3BPRA 3SA0A 3QUPA 4IB3A 2R9SA 4XOYA 3DCVA 4MH7A 4NW5A 1FQ1B 5FXQA 3UYTA 3WILA 4AXDA 5HBEA 3TIYA 3JVSA 1B38A 2WTIA 4BGQA 3V5TA 3GCUA 3EQCA 4FV1A 1Q62A 5G6VA 1Q8TA 4Y95A 2WMWA 5F94A 3VO3A 3ORMA 2H34A 2WEVA 2JKKA 3WI6A 3L8SA 3W32A 3PY1A 3AC8A 2EB3A 4FBXA 2WOUA 2BTRA 3UIUA 4FZ6A 2OJIA 1XR1A 4JRNA 1OVEA 4I5HA 5CI7A 1VEBA 4IWQA 2OZAB 4NH1A 2W96B 4CKIA 4GV1A 3WOWA 3E7VA 4DC2A 3LM0A 4YGAA 1XWSA 3LJ0A 5L2TA 3ZFXA 3W0MA 3MWUA 2SRCA 4WRGA 4MBLA 1ZY4A 3TJDA 4C33A 4RWKA 2B7AA 5HVYA 4OR5A 4OTGA 3FLSA 3BCEA 3R1QA 4E8AA 1OGYA 4HYSA 4EC9A 5EFQA 2HCKA 3G6GA 4O2ZA 3QXOA 3E62A 3W0NA 1L3RE 5AAFA 1YOMA 1H28A 3SX9A 2WMSA 3DZQA 3M2WA 4IC7A 3TTJA 5L2IA 4YMJA 2X7FA 2XK4A 4FC0A 5E1EA 3R9HA 4QD6A 1WVYA 4C2VA 2X6EA 4W4XA 4Y83A 4LOOA 1S9IA 3NIZA 3SD0A 4ANLA 3QCYA 5M44A 4FIFA 4J99A 3RPRA 5CNNA 5EM5A 1J7IA 1Y91A 3D15A 1W0XC 3IK3A 4FVPA 3V5LA 4JL9A 3S00A 3G51A 1M7QA 3N9XA 2AYPA 3SAYA 3SXSA 4TL0A 3P0MA 4FKLA 1HCLA 1Q3DA 1PXNA 2V22A 5CNOA 5E90A 1ZZLA 3RJCA 4A06A 3C4FA 5JZNA 4N70A 1RJBA 5AJQA 3QZHA 4YP8A 3R7OA 2WPAA 3EKKA 3F82A 5M57A 1YWNA 5HBHA 4I6BA 3BGQA 3UQGA 5K4IA 2QOIA 2XNPA 2HZ4A 4TXCA 4OTHA 2ITZA 3FXWA 5AP2A 1I09A 3FMNA 4EK4A 5DEWA 3TJCA 4V0GA 3LHJA 4UALA 1R0PA 2Z02A 2IG7A 4C4EA 1UU3A 4ZY4A 4AW2A 1IAHA 3SXFA 1OM1A 1DI9A 4G6NA 3TMOA 3L9MA 3UZTA 4AZEA 3UPXA 4J95A 5CSXA 4CFVA 3NX8A 1W8CA 4BKZA 4DHJA 4DEGA 2ITOA 1JSUA 3OCBA 1BMKA 5DR9A 5JMSA 3CQEA 3RZBA 2XJ2A 2XALA 3R8ZA 4GFGA 5ANIA 4IM2A 4MK0A 1U54A 2OGVA 4HZRA 4FZAB 5HD7A 3LFSA 3M11A 2XVDA 3CY2A 4QP3A 3GC0A 4UWBA 2C68A 4FG7A 4UYAA 4LYNA 4W4YA 1XHAA 1ZOHA 2WKMA 5HIDA 3DY7A 4E4NA 3DOGA 5JQ8A 4D5KA 3PXQA 3TDWA 2FH9A 4LGDA 4J96A 4J1RA 3GCPA 3AKLA 3QWJA 3A7IA 5LVPA 3DS6A 2C6EA 3IECA 4RIXB 2OG8A 4RRVA 4IX4A 5CZIA 4FNZA 4FNWA 4BCIA 4C34A 2XNGA 3P78A 4AUAA 4B6LA 3BBTB 3UC3A 4FX3A 4GFOA 4O4EA 4I94A 4EHEA 4AT4A 3EQDA 4ALVA 1CDKA 2J50A 2UZTA 2CJMA 4Y85A 1E1VA 4FIHA 3BQRA 3LFDA 5IDPA 4O6EA 4RA5A 2LGCA 4RJ3A 5FDPA 3LM5A 4I0TA 1Q61A 2BDFA 2GNGA 2IJMA 4RX7A 4U79A 2CNVA 4ZTLA 1JNKA 5CQWA 2FB8A 3PA5A 3KREA 4EWHA 5C27A 3FQSA 4PL5A 3DBDA 4TWNA 5BYLA 3RGFA 3FMMA 3HP5A 3HV4A 4LV5A 5EM7A 5EYCA 1A48A 2C47A 2O65A 3WZJA 3HX4A 4AW5A 3R71A 2RF9A 1YOJA 2CHLA 2J7TA 5E8VA 2B9HA 4C4HA 4QNAA 1W2CA 2WHBA 3FMLA 4UXQA 3LXKA 3ET7A 5L6PA 3T3UA 4PNKA 2B0QA 4I6LA 3VS6A 2WOTA 3KU2A 3R1YA 4ANNA 3T8OA 2ETRA 1PW2A 5LXMA 3EYGA 5A6NA 4UMPA 4J98A 4D5HA 2BPMA 1M2QA 3DKOA 3FAAA 5ETFA 5KKRB 3GC9A 3ROCA 3D5UA 4X3FB 1J3HA 1ERKA 2OJGA 2CKQA 2W4KA 4JQ8A 3PLSA 4MAOA 3FPQA 1REKA 5H8GA 3NIEA 1KOBA 2V62A 3FY0A 1PXMA 1JAMA 2YM4A 5JFWA 5EK7A 4UZHA 1UKHA 3KFAA 3HMIA 4O4CA 4RJ4A 4FR4A 3RALA 2XBAA 1JWHA 3HA6A 2REIA 3C1XA 4J7BA 2VTRA 4E5BA 5IQCA 2JDTA 5LOHA 4CKJA 3IPHA 4U43A 4RLKA 3LFCA 4FG8A 4GG7A 4R7HA 4V01A 2VTMA 3BLRA 3GP0A 4WG3A 4AN9A 1ZYSA 3F3VA 3OEZA 3ZBFA 4IFGA 1APME 3QU0A 4G16A 3R7EA 3WARA 1TQMA 2QHMA 3WZKA 3MJ2A 2XRWA 2W0JA 3PRIA 3IW4A 2WTCA 1F3MC 2X8DA 3MI9A 4YPSA 5AR4A 5T3QA 2QR8A 4PNIA 4BICA 5CAQA 4WO5A 2IWIA 4F78A 4UWCA 1GIJA 1PXOA 3GENA 1F5QA 3UG2A 4LL5A 2I0HA 3Q4ZA 5E8WA 2X6DA 4GL9A 4YR8A 4AAYA 3EFKA 4CFWA 1M17A 2V0DA 5AP7A 2ITNA 3ZDUA 3QGYA 4U45A 5LMAA 3WZEA 2RIOA 4A4XA 4I93A 4D4SA 4RZVA 3EN5A 3K5VA 4KIOA 4BR3A 2R3LA 3NNXA 3D9VA 3ZFMA 3LCSA 3Q5IA 4CZTA 2Z7QA 2PWLA 5EH0A 5HO8A 4MBJA 2C4GA 4CV8A 5AUVA 4YUQA 2PUPA 4O82A 4AFEA 2O2UA 3ENHA 1YWVA 1H26A 4J97A 4F9YA 4MXYA 4FEXA 4BCHA 5IQIA 3SG8A 5BV3A 2BHHA 3A4PA 3MVMA 5A3XA 3NVMB 4O7VA 2EXCX 4YZNA 2X0OA 4WD5A 5AM6A 3RI1A 3AD6A 3FXXA 4D2RA 3R7IA 4EBVA 2QOBA 5JGBA 1FVVA 3DDQA 3O0GA 2XA4A 1ZYCA 4FT3A 4I22A 4PDSA 3VS0A 3WZUA 3ETAA 2ONLC 4BYIA 4EK3A 4DDGA 4H3BA 4GYIA 4NJ3A 3G9LX 3W0QA 4EH2A 4NL0A 3PYYA 4RT7A 3C0IA 3DU8A 2RL5A 5HVJA 3ZONA 4CYJA 4NEUA 3MY0A 4IZ5A 1GZNA 4QMLA 3RMFA 5AV4A 3QRUA 1NXKA 3Q9WA 5AIKA 3E63A 2ITXA 3EYHA 3K2LA 2YM8A 2R3IA 2WFYA 1JKLA 1NVRA 3Q04A 4OBPA 5CYIA 1YXSA 4RFZA 2PSQA 2OFVA 3TWJA 2XNEA 4EI4A 3EJ1A 3KULB 2ZV7A 3R9DA 4FTTA 3QALE 4TZRA 5AP4A 2DYLA 3EN7A 1H07A 4O0XA 3TEIA 3Q5ZA 5FWKK 1RW8A 3FBVA 4JAJA 3LCKA 4LUEA 1JLUE 4R3RA 5IUIA 5M4FA 3GU5A 5HU9A 4LRJA 5DBXA 3ZUVA 4PMMA 1FMOE 3DXNA 5D41A 5M51A 2XYUA 3TNQB 2JDSA 2XNMA 4QYFA 4RIYB 4ASZA 3OFMA 4KA3A 2C0IA 4TKSA 4RA4A 4K9YA 2VWXA 4JBVA 4PF4A 1NY3A 3QKKA 3R30A 2XK7A 2WIHA 4TWCA 2BKZA 1GZ8A 2JFMA 5EYKA 3VUHA 3R1NA 3S4QA 4BB4A 4H3PA 4U0IA 1KSWA 4XP0A 1IR3A 4PX6A 3LLAA 4USEA 3F5GA 4UV0A 4EYMA 4ANMA 3VHEA 2R3QA 4CD0A 5KMKA 4EUUA 2ZDTA 3UIXA 2H96A 4GJ3A 5EI2A 2EXEA 4NKSA 3IDCA 1IA9A 3HA8A 4DFYA 4FEVA 3N4UA 3MY1A 4CSVA 3VF8A 1UNGA 3DNEA 1ZY5A 3E3BX 4HPTE 3EWHA 4L44A 4OUCA 5IU2A 4Q5EA 2ZOQA 4RQVA 3WE4A 4QO9A 3DJ5A 2X4FA 4YTHA 4BWKA 5D10A 4F0FA 2XJ1A 2VTHA 2W9FB 1KWPA 3LQ8A 1XH9A 4M69B 5HCXA 3UOLA 4C35A 5A54A 4AZVA 3GU8A 5AUUA 1GOLA 3BI6A 4X2GA 1XH7A 2OK1A 4ZJJA 2R3JA 3BLQA 4R1YA 3AD4A 2RKUA 3D5XA 3DAJA 4ITIA 4RSSA 5J7HA 2CLQA 3JS2A 5L2WA 5BVOA 4KSPA 5D7AA 2CKEA 3AC4A 1P2AA 4ZLYA 1ZARA 2C5YA 3AC5A 5B2MA 2XH5A 4RQKA 4JVGA 5I9XA 2F7XE 3DBCA 4IWOA 4H1MA 1FGIA 4MXAA 4O7RA 3TZ8A 3VNTA 4OAUC 1W98A 1UNHA 2W4OA 3QD3A 3PIYA 4K2RA 1JKTA 2VUWA 2X2KA 2XIRA 3HRBA 1PMVA 3LXNA 5BMSA 4GKIA 5ANEA 2BIKB 5DG5A 4RWJA 4QEBA 4M67A 1H25A 4UBAA 5F1ZA 3DK6A 3FZ1A 3KK9A 2YACA 1FMKA 1TKIA 2XIXA 2ZMDA 1JKSA 3ZSGA 3DT1A 4KIKA 4TYHA 2W9ZB 1JSTA 3HV7A 5E8XA 1YI6A 1YHWA 3FMJA 4QMSA 5IQGA 2GS2A 3CTQA 3QBNA 3U9NA 3TNWA 4HVDA 4EK6A 4D2SA 2Y6MA 3PE1A 5L2QA 3OW4A 4QTBA 1VYWA 3LKMA 4WNKA 2WTWA 1WBTA 4ZS4A 4HCTA 4ZSGA 3MH0A 2PE0A 4U44A 5FEEA 2DQ7X 3OY1A 2BIYA 3MVJA 2H6DA 3R6XA 3PP0A 1Y6AA 2FGIA 2UZWE 3HMPA 3IOPA 4QMZA 4RPVA 5CU2A 4C4FA 4WNOA 3UYSA 2VX1A 3AMBA 3MH1A 3QA8A 4AXFA 2IF8A 4NIFB 3F3TA 3QQJA 3CS9A 1W84A 3VWAA 3P79A 3F7WA 1WZYA 1V1KA 3LFNA 3RKBA 3UC4A 1URCA 3QC9A 3H9OA 3TYKA 5DPVA 3R8PA 4N57A 1HCKA 4YURA 4CG8A 3TKIA 3C51A 3EHAA 4RC3A 4ZXTA 4X6RA 4WUAA 4LFIA 4CLJA 3JPVA 4MX9A 4RIOA 5DYJA 5EM6A 4CXAA 2F2UA 5GIPE 5TKDA 1MRYA 5EDQA 1H1QA 3GOKA 3CKWA 4HVGA 4EOQA 2G01A 4TW9A 4EONA 4BHNA 5I9VA 2O0UA 3QQUA 3FI2A 2OJFE 1OBDA 4QMOA 4RX5A 5LMBA 4AZWA 5IEVA 3PPJA 4WG5A 3C7QA 3VQHA 3ZO2A 2FO0A 3OBJA 1OB3A 5GZ8A 3ZZEA 2PY3A 2PVYA 2YAAA 2W7XA 5KMIA 4Y5HA 4R7IA 1KOAA 4AAAA 3RPVA 2UW4A 3D83A 3QXPA 4HGSA 4IDTA 4UEUA 2JAVA 2VWVA 3UIBA 4MNFA 4YJOA 5T6KA 1YWRA 4EHVA 2BRHA 4I21A 5K3YA 1BI7A 2ETMA 1PKGA 4ZS0A 4FTIA 5HOAA 1Q99A 4Z7GA 3ULIA 3BV2A 3DZOA 3F3WA 3PJ2A 3PSBA 4IC8A 4XG9A 1WVXA 4AN2A 4DLIA 3UDBA 2BRBA 4C4IA 4DDIA 3TTIA 2P0CA 1OL2A 4PDYA 4G3GA 4JT3A 3QTXA 4QP6A 2AC5A 3VUMA 4KS8A 5F4NA 1GZKA 4GVAA 4DITA 4YZMA 3EQFA 4W8EA 4FV6A 5ETCA 5I9YA 5CAPA 5M07A 3FUPA 5JQ5A 2E9VA 5J1WA 2ITUA 2P55A 2R3RA 3W33A 2BFXA 2E9UA 3S1HA 2W1FA 4J8MA 4CT2A 3BZ3A 4NTSA 5AP5A 3H30A 5F20A 1U5RA 2JC6A 2ZMCA 2B9IA 4XG8A 1JPAA 2X9FA 2ITTA 1O6YA 1J7UA 3ZSIA 4D1ZA 2VTIA 2XK8A 3EN9A 4IB1A 4XCUA 4JBQA 2XIYA 5FUTA 2CGXA 3D14A 4CMTA 4K18A 2XANA 4D9TA 2G2IA 4FGRA 4I5PA 2J0IA 4EJ7A 4PMTA 3A7JA 4BL1A 1VZOA 4MEDA 3V3VA 4AX8A 3IW8A 1Q8UA 3OCSA 5D1JA 3E8NA 3VBVA 4IADA 1UWJA 3PG3A 2XAOA 4EKKA 5A4QA 4U42A 4EHGA 2PMOX 2O3PA 5HX8A 1Y57A 2QOKA 4QMMA 4MWIA 5HE3A 1YXUA 4MNEA 3Q9ZA 5J1VA 4X2NA 3GUBA 4C38A 4D28A 2J5EA 4YJSA 2DWBA 2UZNA 4YHFA 2XS0A 5JFSA 1IASA 3FMEA 3ITZA 5AV2A 2VO7A 3JVRA 2PE1A 5J95A 4YHJA 4FT0A 2JGZA 4FSMA 4QMPA 2PUNA 3Q9YA 2IVTA 2HXQA 2J0LA 3NUNA 5L8KA 3LVPA 1DAYA 3KVWA 2VRXA 3QCXA 4XG6A 4AQCA 4AW0A 4BIDA 3ZDIA 4UB7A 5FLFA 3HKOA 5J5SA 4PP9A 4L67A 4BTFA 3HNGA 4C0TA 3MPTA 4R3CA 1ST4A 4NWMA 2BROA 2FSTX 5CS6A 4MWHA 3R28A 4R1VA 3TI1A 1KV2A 4YSMA 3GQLA 3WF5A 1J1BA 3GC8A 2B54A 2HW6A 4V04A 4EOLA 1YKRA 5IUGA 4ORKA 1OITA 4CGAA 2C0OA 4DEHA 3DGKA 3FKOA 4LMUA 1STCE 3U4UA 5KMOA 3NEWA 5C8KA 2Y7JA 1XMMA 5M4IA 3PTGA 4U97A 5AUXA 5F95A 2KTYA 3WE8A 3M42A 3DPKA 5AR3A 2VO3A 3TUCA 3CIKA 3NUSA 3W0SA 2UW7A 3QX2A 5JK3A 4O0RA 3VJNA 4BBEA 2R3OA 4PPBA 3RBWA 2W1ZA 2CKPA 3ML1A 1XMLA 2IVVA 5IQFA 3Q3BA 4OTWA 4F64A 1Z57A 3BV3A 2QOQA 3EN4A 4DFLA 5BVDA 5CALA 2OU7A 5IH5A 2WQBA 4HNFA 2QONA 2HY0A 4LQMA 4PDOA 4ITHA 3P7AA 4FTAA 4BTJA 3KGAA 3QKLA 3V5JA 4AACA 4YZDA 3V6SA 4F99A 3VS4A 4JJRA 3A7FA 4PY1A 2CGVA 4AZTA 1JKKA 3HMMA 1P5EA 4BIBA 4S34A 3BE2A 4E1ZA 2VWYA 4FGBA 3DQWA 3ZZWA 5H3QA 3FEGA 3PWYA 4V05A 4BCNA 3JY0A 3IKAA 3BHUA 4FKRA 4UX9A 4HGLA 3W16A 2IEWA 3ZM9A 4DHIB 2B55A 3O50A 3I1AA 3KKVA 4KWPA 4GEOA 4G5PA 3NLBA 5ACBC 3U6IA 1P4FA 3M1SA 4DEAA 4ZIMA 2X0QA 4U3YA 3RHXA 2BUJA 2J9MA 4O1OA 2BTSA 2WMAA 4YZ9A 4JDJA 5HU3A 5C8NA 3EQRA 4RIWA 3L9LA 4FL2A 3F2NA 1OKYA 4M68A 3VUKA 3BEGA 4GT4A 3FY2A 1ZMVA 3QUDA 2C6MA 5FQDC 3GGFA 1KE9A 3IW6A 4GT5A 3G2FA 4S33A 1TVOA 2ZJWA 2CPKE 3P7CA 2A0CX 2X2LA 3O8TA 5L2SA 4BCJA 4OLIA 1OKZA 3UBDA 5JZJA 3QFVA 3TM0A 4X2FA 1CKIA 3FDNA 3C9WA 2I6LA 3Q2MA 1W2FA 2RFSA 2GS6A 2ETKA 4FSQA 3WIGA 1K9AA 4LOPA 1I44A 3KN6A 3NSZA 3NZ0A 4WSYA 3ZO4A 4CQEA 4S31A 3ZBXA 3FZOA 3RZFA 5I0BA 4MQ2A 1G5SA 3QC4A 4O7NA 4O1PA 5K9IA 4LL0A 3PUFC 3T9TA 4IAYA 2R3GA 3QHRA 3OD6X 4AA0A 3LZBA 1OPKA 5HG7A 3P5KA 4BWXA 4C2WA 5HO7A 4G31A 3R01A 4O38A 3UNZA 5CENA 4WA9A 1YQJA 3Q60A 2YM3A 4FTCA 2WTKC 3SHEA 1CTPE 1YXVA 2YJSA 1H1RA 3ROYA 4BCQA 3I0OA 1AGWA 2UW5A 4BDBA 2C1BA 4H3QA 3QTIA 3CD8A 5CVFA 3II5A 4TRLA 3QKMA 3UZRA 2EUFB 3H4JA 3I5ZA 2Y0AA 4GFMA 5AP0A 1JVPP 5EG3A 3ANQA 2E9OA 3R2BA 3ZEPA 4DFUA 2PTKA 4RJ8A 4ZMFA 5FGKA 2A19B 1KE8A 4I6FA 5GNKA 4ZZNA 4O0UA 5CLPA 2I1MA 4EZ7A 4DH8A 4HVIA 4J71A 2VTNA 2HZIA 3W2CA 1V0OA 4XV9A 4N6YA 1YXTA 2BALA 4L7SA 4M8TA 4RVMA 3AMYA 3ZXZA 4AWIA 1OIRA 2F49A 4IX5A 1PHKA 3UE4A 3LLTA 4FF8A 4DGLC 3PFYA 3GBZA 3TV6A 5IISA 2QVSE 5JRQA 4QTCA 3NNWA 2J51A 3HV5A 2CGUA 2CCIA 3OWPA 2YIWA 1SM2A 1PKDA 1QPCA 2VTQA 3V5WA 3QLGA 4OT5A 2WMUA 4G6LA 4BKJA 1O6LA 5CI6A 4OTPA 2WZJA 4JG7A 4YNEA 4FIEA 3VRZA 3W8QA 3P23A 3AKKA 2OW3A 2A2AA 2GS7A 3FV8A 1KE7A 3P9JA 3AGMA 5CEQA 4ZLOA 5FG8A 3F61A 2VZ6A 2O64A 3FMHA 3PZEA 1WFCA 3R7UA 3U55A 3MYGA 3TL8A 4FTUA 5AADA 2VU3A 2Z60A 4YHTA 4C4GA 2PUIA 1IAJA 2X0GA 4DEBA 1OL7A 2UV2A 2YERA 3BHVA 3KB7A 5JN2A 2QU5A 1GAGA 2XNOA 3NYOA 3PSDA 5E92A 1KE6A 4XP2A 1CMKE 3NNVA 4O0SA 3UZPA 1XJDA 4GKHA 2Q0BA 3BHHA 4AS0A 2X7OA 3C5IA 2QOLA 3ODYX 4XNEA 3MFSA 3HVCA 2OXXA 3KXNA 4C58A 4TNBA 3UO4A 1ZYDA 1UU9A 5GZ9A 4G3CA 2XKDA 4ZEGA 3OXZA 4YJQA 2X7GA 3HV6A 3CJFA 4ZSAA 3LFFA 5DVRA 4W4WA 4ERWA 1YXXA 4ZMEA 2YCRA 3CC6A 3DTCA 2NRUA 4M7IA 2W1CA 2VWBA 3PJCA 3TDVA 4U6RA 4F1MA 4NUSA 5CEOA 3VBQA 4EH3A 3MSSA 3EOCA 1LR4A 2XK3A 4FTMA 4II5A 5GHVA 4F0IA 4J53A 4MF0A 3UODA 4FV3A 5FM2A 5CAOA 3HAVA 5EHLA 4D1SA 5BVKA 3UDSA 1OL1A 3FI3A 5KHXA 3FYKX 4F9CA 3EQBA 3C4ZA 4O0YA 4YJPA 2XCHA 3UVPA 4DTBA 2HY81 2YM7A 4NW6A 1IEPA 2IZTA 2QO2A 2RG5A 2VGPA 2YIYA 3F6XA 2PU8A 1GNGA 1V0PA 2UW8A 3OY3A 3V01A 5B7VA 3KXMA 2C6TA 2GNFA 2R4BA 2WTJA 4PTGA 4XLVA 2A1AB 5M53A 3U4WA 4DG0E 4E6QA 5AA8A 1KV1A 3GNIB 2VTPA 1RE8A 2W05A 3REPA 5IQEA 2XJ0A 2ITQA 1MRUA 3FLYA 5KNJA 3ATTA 4F7SA 3B2TA 2B1PA 4P4CA 4GIIA 2IVUA 4FNYA 4ALWA 4W9XA 4L7FA 4B4LA 2FSLX 3RPYA 4EH6A 3MB6A 4FZ7A 4RC2A 3LCTA 3RWPA 4EK8A 2XF0A 3NYVA 3QQGA 4FT7A 2VNYA 4RMZA 1A06A 3NNUA 2YLEA 4RJ5A 3SC1A 4LM5A 4ZLZA 1YHSA 1LEWA 4C02A 3BL7A 3E8DA 4CFXA 2XNBA 5HTBA 4BDJA 5FEQA 2YDIA 2ZV2A 3MJ1A 2RG6A 2Y4IB 2X81A 4OTDA 4Y72A 5B0XA 4BDEA 5E4HA 3D0EA 1JOWB 2XM9A 1CM8A 3BYUA 4BZDA 5FM3A 3VW8A 1YRPA 2ITWA 3NDMA 5KCVA 3UP7A 2IN6A 4QP9A 4GCJA 5AP6A 4UY9A 2BZIB 3F5UA 4O4FA 5AWMA 4FKOA 1BX6A 4AW1A 4LMNA 4H39A 4D58A 2PVRA 5IMEA 2Z7SA 1PXLA 4JIKA 5D11A 5DE2A 4BCGA 4GUEA 3ZHPC 5JH6A 2R64A 1PYEA 4FUXA 4FUYA 3PRFA 3I79A 3FLWA 3MN3A 3RPOA 3C4XA 2GTNA 3HRCA 2GCDA 1ZMWA 3UOKA 3GB2A 4C36A 4I41A 4ZSEA 4A9SA 4EH7A 1S9JA 4CFUA 3GFEA 2W1HA 3O96A 2W1EA 3BBWA 4G3EA 4XV2A 2WU7A 3LCDA 5JGDA 4AZFA 4C3RA 3AC2A 2WMVA 1WMKA 5EW9A 1SZMA 3GU7A 5HHWA 4F70A 4DTAA 2ZM3A 4RG0A 3AT3A 4GMYA 4JXFA 4NSTA 1NT2A 2OZAA 2O5KA 4IAAA 3NYXA 3PP1A 4BZNA 4XG4A 3EFLA 3KRJA 4HYUA 2QLQA 3I7CA 2J90A 3FKNA 3QD0A 5JRSA 5D7VA 5DWRA 1ZRZA 4GS6A 4WBOA 5CSWA 4BCFA 3KRLA 3LPBA 4XV1A 5BVFA 3C4WA 4JQEA 4BKYA 1IG1A 4P90A 4DFXE 4HVHA 3QGWA 2WAJA 4IFCA 1FVRA 4ZTHA 4C61A 3CLYA 3E64A 3NAXA 1PRYA 1P4OA 2ONLA 2OKRA 3QTUA 3I6WA 5AUWA 3B2WA 4EOSA 5E8UA 3V8TA 1J91A 3F7ZA 3DTWA 4FKGA 3DLSA 5TE0A 3FXZA 4AXEA 3R22A 4FIJA 4NT4A 2J6MA 3RHKA 5EYMA 1W82A 3EZVA 2ZVAA 4FIGA 3VIDA 3FC2A 3AT4A 3QQLA 4O6LA 3OUKA 5IEYA 4G34A