1UA2A

Crystal structure of human cdk7
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
299
structure length
286
Chain Sequence
EKLDFLGEGQFATVYKARDKNTNQIVAIKKINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, transferase
molecule keywords Cell division protein kinase 7
publication title The Crystal Structure of Human CDK7 and Its Protein Recognition Properties
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 286
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ua2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ua2A01
4W9XA 4CLIA 2G1TA 4I41A 1JSVA 4R5YA 1OM1A 2VX1A 2Z7SA 5KHWA 2W1EA 4FV1A 4I3ZA 5AP0A 3EQCA 3VO3A 4FV8A 2FUMA 4FZFB 3KMUA 4ITJA 4QPSA 1SNXA 3QTZA 2UZLA 4C4HA 4QYYA 3PWYA 1A48A 4C36A 3PA4A 4IJ9A 1OL5A 4XG6A 2BAKA 4F0GA 5EM5A 4CSVA 4EJNA 4Y5HA 3ORKA 2EVAA 2YM5A 5AAEA 3FZSA 3KRLA 5K4IA 4L8MA 4FKWA 4FSNA 5AA8A 3GCUA 5M07A 1WFCA 5BVOA 4BICA 3VF8A 1I09A 4NU1A 2QURA 3UVQA 1O6LA 4HGLA 3R8VA 5KCVA 3KXXA 2QOCA 4KKGA 4LYNA 4WA9A 4EONA 3VHEA 5AX9A 2R0UA 3QU0A 4MK0A 4G5JA 3KRXA 4HCUA 3IW7A 2VWXA 2EXMA 4KIKA 4LV5A 3SA0A 3R2BA 4WNPA 2VTNA 4FYNA 4YLJA 4AGCA 3CXWA 3R73A 5IUIA 3PPKA 3OWLA 3P78A 5HLWA 4AE9A 3KL8A 4IAZA 5AUVA 3R8ZA 4XV1A 4EOPA 3FMKA 2WNTA 4Y73A 3P9JA 1R0PA 3PE2A 1W98A 3DBCA 4BDGA 3MJ2A 4FK6A 5M06A 5JEBA 5EM7A 5IA5A 4OR5A 3I7BA 3F66A 5EYMA 2WMQA 2F49A 2YWPA 3C9WA 2BKZA 3E64A 4F7NA 5FP5A 5CEPA 1YKRA 4F09A 3HUCA 4FSZA 3OD6X 3TNHA 1JSTA 4GT3A 1U46A 1V0PA 4FTNA 4V01A 4DGGA 5CU0A 2QO9A 4FKJA 4ASEA 5JKGA 2IN6A 5BUEA 2RG5A 4Q5EA 2BZHB 1XO2B 2C68A 4BY9E 5J1WA 1K3AA 2BRBA 3HRFA 2WELA 2RL5A 4XV9A 3JVSA 3A2CA 3OCSA 2Y4PA 4BHZA 4IM0A 1H26A 3F69A 4RIWB 4IZ5A 1YXSA 1HOWA 4EZ3A 3PIYA 4KS8A 5GZ9A 2JC6A 4RLKA 4OBPA 4BGQA 3IS5A 2REIA 5DBXA 3ZO2A 5K5NA 4MXAA 4FKOA 3FLWA 5BVWA 3HDNA 4GYGA 2PMNX 2C5VA 1M17A 3KRWA 2QLUA 5A14A 3Q9WA 2EU9A 3JXWA 3VBTA 3T8OA 5DI1A 4I22A 1ZOGA 3LMGA 5AP3A 3Q9ZA 4BIDA 1FMKA 4AFEA 4DYMA 4QPMA 4U9AA 5BMSA 3UZRA 4CRSA 3FKLA 4HGEA 3T9TA 4YPSA 5FTOA 3EQBA 4CVAA 1WZYA 1NW1A 3TV7A 3BPRA 4RJ5A 5IF1A 3UVRA 2QG5A 2WU7A 4YTIA 3WZUA 4BCFA 2QO7A 1JLUE 4ID7A 3PSDA 4XYFA 4DINA 4O7YA 3HEGA 4H05A 3EFWA 4O81A 4LUDA 3BWFA 1J1BA 3FHRA 5IU2A 2E9PA 4YJOA 4D4VA 5LXMA 4CFFA 5KBRA 3CSVA 2J6MA 3ZMMA 4U80A 2JKMA 2R3IA 5KZIA 4K77A 3RGFA 1ZYLA 2W9ZB 1FVTA 4S34A 4WBOA 3E62A 3UMWA 4BL1A 2G01A 3PP0A 3HAVA 4EC9A 4G34A 3VW8A 1JPAA 2NRYA 4ACHA 5ANGA 2C30A 2WTDA 3DFCB 3GC8A 3QRUA 5AR4A 3UTOA 2BKKA 3SD0A 2W4KA 2WFYA 4W8EA 3SC1A 2CN8A 3TWJA 4AT3A 4WNOA 1P2AA 3HV3A 4MBLA 4UBAA 4PPCA 5EI2A 1PYEA 4NKSA 3EN9A 1WBWA 5I9YA 3UQFA 5H2UA 2F2CB 4QYGA 3V8WA 3P4KA 3PVGA 5KUPA 3NYVA 3Q32A 5CU6A 5TF9A 3EQIA 3DA6A 5AV1A 5C9CA 3U6JA 2J2IB 4IADA 4FEXA 1PKGA 3C4FA 1YDRE 4QP4A 4F1TA 1BUHA 5L2TA 1WBVA 2W5AA 4M14A 4U45A 4RRVA 4CMOA 2JAMA 2PVHA 2Z2WA 4IVCA 3LVPA 5AUTA 4O7WA 4YBJA 5BVKA 3WZKA 4GV1A 3W10A 4RJ3A 4BZDA 3DAEA 4TWPA 5EH0A 3QA0A 3LQ3A 4EOSA 3WF9A 4GUBA 3MVLA 1YOLA 3UG1A 5LMBA 3HUBA 1OKYA 4AN3A 4ACMA 4I20A 3R28A 4IZ7A 2X39A 4QPAA 1YRPA 2X8IA 5HOAA 1UKIA 2VTHA 4NZWB 2W5BA 2YA9A 4YTFA 4QQCA 3MJ1A 4WG5A 5H3QA 4Z3VA 2OIBA 2WMSA 4I92A 3G0EA 5GZAA 5EYCA 3HV7A 3I81A 3ORXA 3FHIA 2OFVA 4FKVA 3DAJA 4BRXA 2QKWB 1OPJA 4ZJIA 3V3VA 5IISA 5GZ8A 3W18A 4OTHA 4FG8A 2C6EA 4FTUA 3ITZA 3VUDA 2CGUA 3LCSA 2UZEA 2XEYA 3KA0A 4GJ3A 5HE3A 3R8MA 4UZHA 3GGFA 3ROYA 1XH6A 3ZFMA 4FX3A 4YJVA 4JBPA 5HG7A 1YWRA 4IE9A 2VTRA 4UWYA 3QTUA 4JR7A 4MBIA 3LZBA 4I5CA 1REKA 2JFLA 3DQWA 3MY0A 4IZYA 4F1OA 4DHFA 3PXQA 2JEDA 5M4IA 1S9IA 2VN9A 4IM2A 3EQRA 2EB2A 3CGOA 2OLCA 4FL3A 2I0VA 2BTRA 2WMUA 3SKCA 1CKIA 4U44A 4EOKA 5I3RA 2XZSA 3AT3A 4RWLA 4KKEA 3BQCA 2F4JA 2YJRA 1RJBA 3QX2A 3W2PA 3L8XA 2BRMA 3H4JA 3I6WA 4BBEA 1J7IA 2WB8A 3MB7A 5E8YA 2QCSA 2X9FA 4AE6A 4UEUA 4J95A 3ZLSA 1CTPE 2ITQA 3A8XA 3VS2A 4ZAUA 3O71A 2HWPA 2W4JA 2HWOA 4X2KA 3UNKA 2O2UA 3GOKA 4EKKA 5E92A 3F9NA 1K2PA 4MNEB 4ZTNA 1P14A 3W32A 3F2NA 4TL0A 2J0JA 2OICA 5ANEA 5HG5A 1H8FA 2ZV7A 3G2FA 4RVTA 5DG5A 5J95A 5L3AA 1G8AA 4PDYA 2QI8A 4IFCA 5JGBA 1YWVA 2X7OA 4H58A 4PDSA 5CXZA 1VEBA 4YNEA 4O6LA 4DFLA 4FKQA 5M56A 5FEEA 2ETRA 3DXNA 4U41A 3QKMA 3PA3A 2J0KA 3E7OA 3DGKA 3ZXZA 3DFAA 4XNEA 4YSJA 3JR1A 3HMMA 3NGAA 2X8DA 4BWXA 2FSLX 2OF4A 4IJPA 4O6EA 1ZMUA 3D9VA 5FGKA 4FTKA 4IAFA 2HY0A 2PUNA 3NEWA 1K9AA 5HORA 3PUPA 3IQ7A 1IA9A 3R8UA 2ZOQA 2NRUA 2OU7A 1BX6A 3A7GA 3QC9A 3CQEA 4FKUA 3MH2A 2J7TA 3EQGA 1M2RA 1XR1A 2YDKA 4QMZA 5LMKC 3D14A 4JAIA 1IA8A 3VQHA 3HGKA 1B6CB 3IK3A 3I60A 1OUYA 2ZMCA 1GAGA 3LFQA 2ZV9A 1HCLA 3WARA 2PPQA 3G33A 3VRZA 3HRBA 4NW5A 2W9FB 3CD8A 3NUNA 5HG9A 2XH5A 3A7HA 3K3IA 5AR5A 2QKRA 3V5TA 4C38A 5G1XA 2RGPA 4ZY6A 5F94A 1J3HA 4PTCA 2BDFA 2CNUA 3UJGA 2Y9QA 3MDYA 2C6OA 4NM3A 3BGPA 3EZRA 3P7CA 4ANQA 4FKSA 1Q8ZA 5AAFA 2RG6A 2A1AB 2HXLA 3PRIA 3QD3A 5JQ8A 3P79A 3ZLXA 5C8MA 4WIHA 1PYXA 1AGWA 4HZRA 3VS7A 3GT8A 3HV4A 3II5A 4YZMA 2C6IA 4FGRA 4HYIA 3P0MA 4OTWA 4X2GA 5AR7A 2YIYA 3OTUA 3S4QA 3QXPA 4GL9A 4F0IA 5FUTA 2VV9A 4FV6A 4EJ7A 4DGMA 3ZO1A 5CALA 3TTIA 3E8DA 4OBQA 2PVJA 2JIUA 3V6RA 4M12A 4V0GB 3P23A 4IW0A 1J7UA 3ZUUA 4HGSA 4EHEA 2W99B 4OUCA 3IDBA 3E8CA 4E5AX 2GFSA 4ASDA 3RWQA 4O1PA 3P7AA 4DG0E 2C6MA 3QFVA 3V8SA 5A6OA 4G6NA 5BUJA 3U4WA 4YC3A 1KSWA 3EN6A 3KULB 3M2WA 5EOLA 5ITAA 2PUIA 4IVDA 3HP5A 2XYUA 2VWUA 5F95A 5EI8A 3V04A 3O17A 4AT4A 3K2LA 4TN6A 4L3PA 3OF0A 5C8KA 4JBOA 3ZS5A 5KHXA 2G9XA 4YJNA 4FTRA 4ASXA 3DLZA 2QOFA 3A7FA 3FE3A 4R3RA 2BUJA 3ZXTA 3U54A 3A4OX 4RFZA 1ZYSA 3LQ5A 1IR3A 3HKOA 3TZ9A 4LGGA 1DAWA 1U54B 1E9HA 3TZ7A 3PPZA 2GPHA 4CD0A 3DY7A 1XHAA 4N6ZA 2XS0A 2BROA 2WMRA 4Y85A 4FT7A 3WIGA 3D5UA 4DBNA 3OEFX 3AD6A 5JFXA 4Y5QA 5HICA 4FZ7A 4FIFA 4AW0A 4X6QC 3FI3A 4QP9A 3BHTA 4F6WA 3A4PA 3VUIA 4FSWA 1OL7A 2B54A 3Q3BA 4JAJA 4KNBA 4XCUA 3KXHA 4GU6A 5ANOA 2P2IA 3IW4A 4FOBA 4CZYB 5M44A 1UKHA 5EW8A 2QODA 4JL9A 2GNHA 4KRDA 4FR4A 4EOMA 3NNUA 4FE2A 3KVWA 4WO5A 4BZOA 5LVNA 3LFSA 2OJIA 4ZLZA 3R9RA 3HZTA 4NTSA 4JJRA 3C7QA 4QQJA 4U3YA 5EKOA 5AP7A 4JRNA 1PXNA 3L8VA 1H0WA 3QRJA 5A6NA 4PL3A 2QR8A 2VD5A 4KBCA 2BRGA 3WF5A 3OWPA 3UZTA 4C35A 1T46A 1Q4LA 3BHUA 3DLSA 3OBJA 4NM7A 4C8BA 3OT8A 4JIAA 3ALOA 3VW6A 3E8EA 5AFVA 3ODZX 4WSYA 4FV5A 1CM8A 2UZVA 4PDPA 4O0VA 4QYFA 4FSQA 2UVZA 3GENA 2R4BA 3CR0A 2PSQA 2RKUA 1UVRA 3BEAA 3SQQA 2ETMA 2VTSA 5IQGA 3D5XA 3EL8A 3S3IA 5BX0A 4QMSA 4S30A 2W05A 2GQRA 5CF8A 3O8TA 4GRBA 4NSTA 4O2ZA 3ZSGA 3JY9A 1GZNA 2C6KA 1HCKA 3GCPA 3R0TA 1LPUA 2BVAA 3ORIA 1YWNA 2VWZA 4MH7A 3DB8A 1W84A 2ZVAA 1FVRA 5JRSA 4EWQA 1A9UA 2XBAA 2CNQA 3C50A 2W4OA 4O0RA 5CF5A 3F3ZA 1OIYA 2DYLA 5FXQA 2XNEA 4I6BA 3WE4A 4KBKA 4I23A 1UNHA 3FC2A 3PIZA 3COIA 2WZJA 1Q41A 3U8WA 4YNOA 4NM0A 4CEGA 4ZIMA 4CZTA 3UO4A 2WKMA 3GFWA 4FOCA 3QQFA 4H39A 1PXLA 3JPVA 4QO9A 5H9BA 3AD5A 3EN5A 4GFOA 4X0MA 4TY1A 4LMNA 2QLQA 1IEPA 3R30A 4FF8A 2FH9A 5KMNA 3BBWA 2KULA 2OKRA 3ZUTA 4C4FA 2W1CA 3UPZA 4O7LA 3CTQA 5IUHA 4JBQA 1H27A 5CAOA 2Y4IB 4TPTA 2Z60A 4KIPA 1FMOE 2IPXA 1DAYA 2I1MA 2XM9A 3H30A 4C3RA 4U79A 1PMEA 4KB8A 3EYGA 5BYZA 3TV4A 4ZSAA 3ZTXA 5J7BA 2VNYA 2PZPA 2UW3A 4I4FA 4YO4A 2V7AA 4BKZA 5L8JA 4RWKA 3ET7A 5EI6A 3RKBA 5IDNA 4XRLA 4QD6A 5CANA 4C62A 5DVRA 2IW6A 2UZDA 3D5WA 1TQIA 5HIBA 2Y6OA 5HTCA 4FV0A 3HX4A 3SHEA 4KIOA 3NR9A 3TIYA 4G16A 1FINA 3OBGA 4FG7A 4JBVA 4D5HA 2XIYA 4BCIA 3ZEPA 4RFMA 4PL5A 4KKHA 3Q5IA 4TZRA 5AWMA 3CE3A 4B6LA 3PJ2A 2QQ7A 2PYWA 3NMUF 2W1FA 3MIYA 2IVTA 2YM4A 2I40A 1GOLA 2OJGA 3MPTA 1URCA 3PPJA 2AC3A 4GG5A 4Z7HA 4O7SA 4CQEA 1SMHA 4QMXA 3KXZA 4RJ8A 5HD4A 1MRYA 2PULA 3LFAA 2R2PA 1PRYA 2OJFE 3F5GA 1Q3WA 1ZMVA 3MH1A 4EK6A 4ZY4A 5C4LA 2PZYA 2QOBA 4Y95A 2X6DA 2OF2A 1PF8A 2CKPA 3RBWA 4P5QA 3TNQB 4R3PA 3SRVA 3TT0A 4DGNA 4E7WA 1G5SA 5CNOA 4F9CA 4PF4A 4EH4A 4WUAA 2HW6A 3KGAA 4W4WA 2EWAA 1OL2A 5AP4A 5EHLA 4G17A 1H25A 4FSUA 3O0GA 3D2KA 4QT1A 3R8LA 4W8DA 4J8NA 5HE2A 4XP2A 2OGVA 3ZM4A 3SV0A 3VRYA 1JKKA 2IZUA 4FV9A 5D1JA 4F6SA 1XH9A 2PVYA 3COMA 3IW5A 4M69A 5A9UA 5EHOA 4I94A 3LXNA 3TM0A 2CJMA 3FY2A 5IDPA 2GHLA 2W5HA 3REPA 3H0YA 3SXSA 3OUKA 5M53A 4FV3A 3NVMB 4RIXB 1Z57A 1JKTA 1OIQA 4MQ2A 3KMMA 4ENXA 1PMUA 3LFFA 3KY2A 4LL5A 3BWJA 1LUFA 3MYGA 3VUKA 4RPVA 4ANSA 3VULA 5H8EA 5LVLA 2WIHA 4WUNA 5IEYA 4TWNA 1BL7A 3KQ7A 1WVWA 3A62A 4AN9A 5AR8A 1XBCA 4JRVA 3S2PA 4ALWA 5CVGA 4K9YA 3Q60A 5JGDA 4TYJA 3MESA 3UC4A 4D1SA 4D58A 2ONLC 4AFJA 1H07A 2CCHA 2JLDA 3IDCA 3TUCA 4A4LA 4FZAB 3LCKA 5EDPA 3TKUA 3I0QA 3E8NA 4ASZA 4FSRA 1JNKA 4AS0A 4D2PA 5CAVA 4CFWA 3BYMA 4AOJA 4DFUA 3RNYA 4PV0A 4O82A 4D2VA 4PMMA 4YHTA 4QP1A 5DRDA 3PXZA 3ODYX 2FSOX 2HK5A 2ITNA 3D7ZA 4R5SA 4IB5A 2ERKA 1YVJA 4ACGA 3QTXA 2CKQA 4MXYA 4NJ3A 4NIFA 4N70A 2CKOA 3MIAA 3I7CA 4OT6A 4A9SA 4XLVA 1YI4A 1TKIA 3DU8A 4E4MA 4JDJA 4GK2A 3UO6A 2GS2A 1H24A 2VTQA 5D7VA 3FYJX 4HYSA 4OTQA 4IZAA 2F9GA 2J0MB 3CJFA 5C03A 4O21A 2YM6A 2Z8CA 3LJ2A 4V05A 4M66A 5AMNA 4TWCA 1FOTA 4FNZA 4AAAA 2YISA 1KE6A 1WCCA 5DFPA 4ZMFA 2WEVA 3MY1A 3ZM9A 4Q9ZA 3QQHA 4D1ZA 4OAUC 4MWIA 3ID6C 3UYTA 4AZSA 4C2VA 1XBBA 1ZYJA 3SX9A 4D2WA 2UZTA 4DEIA 5AIRA 3SGCA 3C0IA 3QL8A 2Z7RA 2VWBA 2PUPA 1TVOA 4RX9A 3VS4A 4QP3A 2HXQA 3T9IA 4YC6A 4L42A 3UDBA 2PUUA 1WAKA 2VO6A 1ZZLA 2XCKA 4QNYA 3TJCA 3UC3A 2CKEA 5EKNA 2C3JA 3FLSA 4GKIA 1ZMWA 4PX6A 2H34A 3EMGA 3UVPA 4FNWA 4A07A 1W8CA 4QP6A 5DIAA 3TV6A 4LV8A 5A4QA 2R3MA 5CVHA 5A4TA 3GOPA 3FMMA 3DDPA 4CXAA 3WI6A 2VTMA 4E4LA 3QALE 2BRNA 3R71A 3AC3A 2VUWA 2X2KA 1KOAA 2JKQA 5EW3A 5B2LA 5E8UA 5DR6A 3TDWA 3MVMA 3OC1A 5L8KA 1M2PA 4AWIA 5A4EA 5J79A 1PJKA 3RAWA 2C6DA 3KVXA 3FMNA 4TNDA 3AGMA 1KE5A 2OIDA 4LOQA 4UZDA 5J1VA 3VBWA 3FAAA 4BVUA 5E1EA 4DE4A 3D2IA 2XB7A 2ZDTA 2WQEA 4M68A 4DH3A 4MXZA 3ZBFA 4KUJA 4IANA 5AEPA 5IQIA 3VC4A 4WNMA 3VUHA 3O23A 4DFYA 5C27A 5EYDA 4HOKA 4OBOA 4UMRA 4BDCA 3RHXA 5AUXA 3EB0A 3ELJA 3MFSA 2IW8A 4BCMA 5LMKA 3NRMA 5BQ0A 3FKOA 1OI9A 1B38A 5J87A 4IH8A 1OKVA 4EKLA 1H1RA 2OZOA 3V5LA 3BQRA 4EH2A 5HU9A 2OZAA 2GHGA 3BCEA 3G9LX 5CY3A 4EWHA 3IDPA 3HL7A 5FG8A 4CFVA 2WMVA 1EH4A 2C3KA 5E90A 2J5EA 2FA2A 4BCNA 3SOAA 1O9UA 4M13A 4Z16A 3ZYAA 3WZDA 2JDTA 5D9HA 3ULIA 4O7TA 3ZDIA 2F7XE 4C4GA 2JBOA 4E1ZA 4EI4A 4IB3A 3OXZA 2XRUA 3ERKA 4PRJA 3WF6A 3ZCLA 2Y7JA 3KXNA 3QRKA 1V1KA 3H9RA 5DN3A 2BAJA 4HYHA 2GNLA 5HI2A 3QHWA 1NA7A 2HZ4A 1M2QA 4RC4A 3TI1A 3MVJA 3DXPA 3OG7A 4EK8A 5HO8A 3BI6A 2FYSA 4PY1A 5HX8A 4I0TA 3NAYA 5HCZA 4QTEA 4V04A 3RAKA 4JQEA 4IACA 4HVDA 3CTJA 5H8GA 2ITWA 3W8LA 3MB6A 2X9EA 5GHVA 2A27A 2C5XA 2CSNA 2PZRA 3F7ZA 5M55A 3EWHA 1BI8A 1MUOA 2OI4X 2PMIA 3CP9A 3EN7A 4HPUE 4K1BA 1H0VA 4CCBA 5EOBA 3VS0A 3U55A 3P7BA 3AC5A 3PVWA 4FL1A 2ZDUA 2ZV2A 3EIDA 3FMJA 3QC4A 4IVAA 1IG1A 4ENYA 4FSMA 4JOAA 2HAKA 5FRIA 5H8BA 2JDVA 2P3GX 4BCJA 3WE8A 4HVGA 4BDAA 3BLQA 4ZLOA 5ICPA 1OBGA 1NVSA 4DTAA 3KXMA 5K4JA 3LFNA 2EUFB 1YOJA 4FSTA 4ZS4A 4O1OA 2V5QA 3ZO4A 2WIPA 3CKXA 4L43A 2R3QA 3HDMA 4ZS0A 5HESA 2OWBA 3E7VA 2ITXA 4Q9SA 5DPVA 5KKRC 2ITVA 1WMKA 1M52A 2BAQA 3ZUVA 5IA1A 2C47A 2BALA 4ZP5A 4I1ZA 4J53A 2I0HA 3AD4A 4AZTA 3U51A 4UN0C 3FMHA 4BCPA 2GHMA 1ZY5A 2X1NA 4LI5A 2VGPA 5JQ5A 3CPBA 4FMQA 4NCTA 3MPAA 2X7FA 4BTJA 4C4JA 4C4EA 1OGUA 2XCHA 1W83A 2GMXA 3TKIA 4DCEA 4FVQA 4YZDA 3RJCA 2PE1A 2GCDA 2R0IA 4D2SA 2PVKA 4IVBA 2X6EA 3DKOA 4BF2A 2GDOA 1GNGA 3LM5A 4QMVA 5D7AA 3K5UA 1WBSA 1O6YA 1YHSA 4BI0A 3FQSA 1JBPE 4L01A 4KAOA 4UWBA 3TACA 5L2QA 4O0TA 4RIYB 5HBEA 4M0YA 4AZFA 4D9TA 2GSFA 3Q6UA 4EOJA 4A9YA 5C01A 3BYOA 3LOKA 1WBOA 4DGOA 2CPKE 3DK3A 5LQFA 3UOKA 2JBPA 3F6XA 4RC3A 1WBNA 4Q5HA 2VTIA 4G3GA 4YZCA 5CU2A 2G15A 3BELA 5AP5A 3S95A 2VX3A 4D9UA 3FBVA 4NL0A 3HMIA 4YSMA 4YUQA 1FPUA 2ZJWA 5EYKA 3VS1A 1CKJA 3JUHA 2OH4A 3KN5A 3FZRA 3QCYA 3WZJA 4CFMA 4HGTA 3F7WA 4CGAA 4O0WA 3FLNC 4FTCA 3V51A 1YI3A 4RVMA 4O96A 3POOA 3L9LA 4YZBA 3AT4A 3QZFA 4CKJA 2H9VA 5CENA 1SVEA 3RAIA 3B8RA 3AOXA 4G9CA 4FI1A 3NSZA 4FYOA 4L46A 1ZYCA 4FGBA 2GNIA 4WKQA 2FSTX 3ZFXA 5AR3A 3UP7A 2RFSA 4AOTA 2VU3A 4F7LA 4YURA 3I79A 4FEUA 3QWKA 2X4ZA 3FL5A 5FEQA 1FGKA 3Q4TA 4FK3A 3BE2A 4IWOA 1E1XA 4BIBA 3BV2A 1R78A 5B7VA 4ACCA 4EK5A 4DF3A 4CV8A 1P5EA 4CYIA 4I6HA 3RPVA 3UOHA 3DTCA 4MHAA 3UODA 3BKBA 4QMYA 2AC5A 5GJFA 3DJ5A 2C0TA 4J8MA 2XP2A 3AMAA 3QTQA 4RZVA 4QMLA 3GNIB 4QMMA 2WQNA 5JSMA 3W2QA 4I5MA 1BLXA 3QBNA 4UALA 5HTBA 5TKDA 5C8NA 3AC2A 4J52A 3KF4A 1BL6A 3DT1A 2GNGA 4C02A 2QHNA 3DJ6A 3MH0A 1PMNA 3H3CA 3PSCA 5CLPA 3NUPA 5F4NA 3O7LB 5E7RA 4KSQA 3NS9A 4EUTA 4JX3A 3AC4A 3F82A 4CMUA 4IWPA 3RZBA 4J97A 1L3RE 4M0ZA 2NNWB 2E9NA 3LM0A 2UUEA 4Z55A 3RPRA 4ALVA 1OIUA 4LG4A 3LCTA 5DR9A 3O96A 4J7BA 3NNVA 4X6RA 4FIGA 3QYZA 5HE1A 4CT1A 3PDTA 3AC1A 2YEXA 3D5VA 2HYYA 4HVIA 1KV1A 3BLRA 4M69B 4XHKB 2LAVA 4M84A 4O0XA 3UYSA 4AF3A 3D7TA 1ERKA 2WTJA 2IZRA 2J5FA 5B2MA 4YLKA 5LARA 4K6ZA 5DMZA 2O3PA 4P2KA 3SLSA 3QCSA 1APME 2Y6MA 4I93A 3ZOSA 4AOIA 4MNFA 2C5OA 4EQCA 4RX8A 4NUSA 1GIHA 4CKIA 5D41A 2XJ2A 4MBJA 4FKGA 5CZIA 3CC6A 3CD3A 3H9FA 4QP8A 5L2WA 2F2UA 3NIEA 1J91A 3O50A 3PG3A 5HU3A 3SG9A 2V55A 3RVGA 2HELA 3U4UA 4E5WA 3Q9XA 3WOWA 3OCGA 5M4UA 2F7ZE 4QMUA 4F9BA 3U6IA 3M42A 2ZMDA 4L67A 3DKCA 5M09A 5TR6A 1Y8GA 4K33A 4DEBA 4R3CA 3FUPA 3OXTA 3EL7A 3FZOA 2WU6A 4IB0A 5LCKA 3LFCA 4X3FC 3R22A 4FSYA 3RPOA 3TG1A 2IWIA 4IX4A 2X8EA 5HTIA 1ZZ2A 2Q0BA 3AXWA 3FJQE 3GCQA 4PTEA 4O7ZA 2ONLA 3F3VA 2YM8A 5AJQA 1PMVA 5FDXA 5IA4A 2C5NA 4I4EA 3R7GA 4RGJA 4YHJA 4RMZA 1XBAA 2BFXA 4YJQA 4UXLA 4F99A 4O7VA 2J9MA 4FUYA 3A7JA 2YM3A 4O0SA 4JDIA 3TCPA 4QMWA 3OY3A 3OOMA 4O27B 2J50A 4HVHA 1H4LA 4C58A 2GNFA 3FWQA 1WBTA 3ATTA 4FTLA 4M3QA 2R3LA 3NW5A 1DI8A 3FMEA 5HGIA 4F63A 3T3UA 3BU3A 2NPQA 5DWRA 4A06A 4BCHA 2F57A 4J1RA 5I9XA 3VUTA 3D94A 3W55A 1H1PA 1UNGA 4A7CA 4G6OA 4AZEA 4MXOA 4LMUA 2ITYA 5I9UA 3C51A 2WTIA 3PIXA 3R00A 3R1QA 5J5TA 4RSSA 4WOVA 3QTRA 4X2JA 4MD9E 2YAKA 4DH1A 2CN5A 4DITA 4ERKA 2B1PA 5DA3A 1QCFA 3EFKA 4H3QA 4GW8A 4XOZA 4AXAA 3B2TA 3RK5A 1KE8A 3VBYA 3NDMA 3OEZA 2PZ5A 4O83A 1CDKA 3JS2A 2HZ0A 4ZJVA 3C4WA 3R01A 4JG6A 3FYKX 1XH7A 1ZY4A 3RHKA 4RQVA 1YOMA 3EKKA 1YHVA 3B2WA 3M1SA 4JQ8A 3NLBA 4RFYA 3DS6A 5CS6A 5E8VA 3HMOA 5AV2A 4D4YA 1OL6A 3DDQA 1OKZA 3QZGA 5JGAA 4E6AA 3TUBA 3OXIA 4S2ZA 5LOHA 4F7SA 3QLFA 1NT2A 1PXKA 4XOYA 4E6CA 3GC9A 3OCBA 2FVDA 3GI3A 3MFTA 4BWKA 3LQ8A 2YN8A 5I4NA 3OS3A 3EQPA 5JN2A 2X81A 2IZSA 4UY9A 4L9IA 4CLJA 4FKLA 1YQJA 2ZYBA 4KRCA 4O7RA 4QYEA 2QC6A 4DEGA 3IGOA 3JY0A 3E88A 5KMIA 3PXYA 4MYGA 2QOIA 4P5ZA 3ALNA 2E9VA 5AM7A 4EBWA 2B53A 2CLQA 5BYLA 1H28A 4Y83A 1UU9A 2OFUA 1SM2A 3PXRA 3KU2A 4JG8A 3OW3A 3OHTA 4YZNA 5EM6A 2P55A 3OFMA 3BZ3A 5AV0A 1MQBA 2GTMA 3ZU7A 5CF4A 1OIRA 4RIWA 4FBXA 5IEXA 3C0GA 3UQGA 5EHYA 2H96A 3LFEA 5HE0A 2B0QA 3LHJA 3R9DA 3WILA 4KIKB 4W4YA 4AP7A 4I24A 5I9VA 3EFJA 1ATPE 2PVNA 3W2RA 3RM6A 4N4SA 3UIUA 5AADA 4BR3A 2XNMA 4FTTA 2YABA 5L2SA 4NCTC 2QOKA 4TYHA 1IASA 3EH9A 4TWOA 4E5BA 4GIHA 4BDBA 2VRXA 1KUTA 2X7GA 3FZPA 4R77A 3OWKA 3GC0A 4GMYA 4DFBA 1CSNA 5GINE 2XNOA 4FVRA 3GCVA 2PWLA 5CEIA 3IKAA 3KRJA 1UV5A 2V0DA 4NK9A 2OSCA 1M7QA 3HYHA 4APCA 4F1MA 5CEOA 2VWVA 5FM2A 3Q2MA 4AU8A 4EH8A 3PSBA 2C1AA 4XMOA 5C26A 4EH3A 3MV5A 3IGGA 4XX9A 5IUGA 2R3RA 2BTSA 5EDRA 1PXPA 4ZTHA 5JT2A 4JG7A 2XBJA 4DLJA 5CASA 2ZB1A 4U6RA 4JVGA 4M15A 3R9OA 4DG3E 3KREA 5F20A 4ZEGA 4ORKA 1GZOA 4Y72A 2XKEA 1FVVA 2YZAA 4HCTA 4QTAA 5K3YA 3MS9A 2W17A 2GU8A 4RA4A 4BFMA 5D11A 3Q04A 4ZTRA 1P4OA 4FV7A 4B7TA 3DTWA 4BDDA 4F4PA 3G6GA 4BZNA 3NUXA 5AUYA 4CNHA 4QMNA 4FZ6A 5IEVA 2VWYA 2R3HA 3LAUA 3QGWA 3E93A 3IW6A 3QTIA 3ZSHA 4U40A 4B0GA 5EK7A 3R7YA 4C3PA 4PWNA 5B0XA 2UZOA 5ANIA 4YMJA 3DBFA 4ONAA 3W2CA 2PZIA 3OROA 4ARKA 5IQEA 3TZMA 3FL4A 4YLLA 5HX6A 1ZAOA 3BHHA 3FLYA 2OH0E 2OXXA 3TXOA 5HCXA 4O38A 4DGLC 1P4FA 3GQIA 1REJA 3KEXA 3L8SA 4K18A 5GIOE 4R8QA 3PTGA 2RIOA 2WO6A 2XIZA 4G3CA 5L6PA 5I9ZA 3ZZEA 5J5SA 3TNPC 3CTHA 3Q52A 4PQNA 3RPYA 5KMLA 3NCGA 4IDVA 1RW8A 2R3NA 5TE0A 2ZB0A 5IQCA 4IAKA 3R8PA 3A60A 3Q9YA 1PXJA 2JD5A 3R1NA 4IQ6A 3OY1A 3L9PA 5JFSA 4NYEA 4DFXE 3CKWA 4YJSA 4C33A 2YIWA 2IVVA 3O8UA 3TNWA 3CBLA 4QTDA 3DV3A 4H3BA 5M57A 3F5UA 3LJ0A 2OG8A 3Q96A 4YP8A 5CZHA 3PXKA 5G6VA 4AW2A 4R6VA 4G3EA 3ZBXA 4KSPA 1H1QA 4K2RA 5JZNA 4XP0A 4E26A 3R7UA 4EC8A 5CX9A 1XH4A 3R83A 3UIBA 4W9WA 3MTFA 2R3PA 2PHKA 4L44A 4HYUA 4MAOA 5HNGA 4E3CA 4JQ7A 4FIHA 4GVJA 5BVNA 1VR2A 2SRCA 2R5TA 3GU8A 4LUEA 3R7EA 4IXPA 2PVFA 4JLCA 3F2AA 3W33A 3R6XA 4XG4A 5E8XA 4AA0A 3Q5ZA 3G9NA 4EZ5A 3AGLA 5HO7A 1SZMA 3I0OA 1NXKA 2A0CX 3P1AA 2YWVA 1V0OA 2VO0A 3ZC5A 2CDZA 5CQUA 2B52A 3OP5A 4I0SA 1SVHA 3QUEA 4AT5A 3D0EA 3UIXA 3AQVA 3BV3A 3ACKA 4W4VA 3GQLA 4WRSA 3ZZWA 4BHNA 4KIQA 4C37A 2ITPA 1CMKE 3E92A 4JX7A 5L4QA 5AV4A 1UU7A 4XG2A 3GP0A 4DT8A 3CY3A 2QU5A 4ZZOA 1ZWSA 4YJRA 3L9NA 4BN1A 3KKVA 2PE0A 2UW5A 3BX5A 3EYHA 3PJ8A 3KMWA 4QYHA 4L52A 1DM2A 4GK3A 4AACA 3HA6A 3G6HA 3R7IA 2E9UA 2J4ZA 1YXXA 2XK3A 3OMVA 4XP3A 1YXTA 5CSVA 2X4FA 4CG9A 1Q8TA 4E6DA 5HIEA 2P4IA 3ORZA 4UYAA 5AP6A 2UZUE 3LPBA 4UMUA 5HQ0A 4GEOA 4GYIA 4GUEA 4AQCA 4W4XA 2W06A 4FKIA 2XK4A 3FPMA 5AM6A 4C59A 4F9YA 2WPAA 3L9MA 4NFMA 5CEQA 4E4NA 2WEIA 4MNEA 5HEZA 2IG7A 4OTFA 3PFQA 2O65A 5L6OA 2YIRA 4CFNA 5J7HA 4F70A 3EN4A 1DI9A 3BU6A 3VS3A 4J71A 2EXEA 2W1HA 4C2WA 2WOUA 4X2FA 4U0IA 4UMQA 4S33A 3TDVA 4KBAA 5FQDC 3MW1A 3DK6A 4FIIA 4KINA 1LEWA 2O0UA 2RSVA 3IW8A 5CAQA 2WAJA 5BVFA 4Q2AA 4QP2A 4BB4A 3MA3A 2PL0A 4ZTLA 1VYZA 4M67A 4Y46A 2Q83A 4XS2A 2R7IA 1QPEA 1ZLTA 2YITA 1YDTE 3BE9A 3TJDA 5IZFA 2W1ZA 2XM8A 4JXFA 4BDIA 1Y91A 4ZSEA 1PXOA 4EBVA 4EORA 2RFDA 4DH8A 3RP9A 4QMQA 4DTBA 3LFBA 3F3TA 3QTWA 4FKRA 3ZRKA 3S00A 2OXDA 5DNRA 3I6UA 4OLIA 4XRJA 3TTJA 5IA0A 3TUDA 3ZSIA 3Q4UA 4LQMA 4I5HA 4A4XA 5EQEA 3I5ZA 3D7TB 1VZOA 3R04A 4GG7A 3ZONA 5DE2A 3R1YA 5HZNA 3IECA 3MA6A 3NYXA 3FI8A 2YLFA 3KFAA 4QRCA 3VIDA 2Z7LA 4GU9A 3BHYA 3EHAA 5K9IA 4QTBA 3IOPA 4AGWA 3VBQA 2VTPA 4DT9A 3NZ0A 5AUUA 3ZRLA 3QD4A 2UW8A 4Z9LA 3VJNA 1A06A 1TQPA 5E8SA 3VAPA 4AN2A 2EXCX 4D0WA 4AW5A 3DKGA 5A4LA 5CEMA 2GQSA 3C5IA 2R3GA 4BTMA 1H08A 3FY0A 3POZA 2WMTA 3SAYA 4BCOA 4U8ZA 4AA5A 3HP2A 3IONA 3QTSA 4XJ0A 4IAIA 4C0TA 5J8IA 2ZM4A 5HKMA 4C3FA 4PMPA 2QOQA 3P08A 4U5JA 4KA3A 4FEVA 1M14A 1AD5A 4QTCA 3CPCA 4LRMA 3DNDA 4CV9A 4IX3A 5E9EA 3VNTA 3WF8A 3GU6A 5ETAA 4YJUA 1F3MC 3ZDUA 4V0GA 2JGZA 5JFVA 2B9FA 3LIJA 4BDKA 2CCIA 3CY2A 3D4QA 3NUYA 3OZ6A 3UNZA 4C7TA 5CT0A 4O7NA 3NX8A 2WTKB 3IO7A 4RVKA 5FBOA 4BDFA 4LGHA 2E2BA 3OOGA 4EK4A 4D28A 4LL0A 2WTVA 4OT5A 1MRVA 4IX5A 4UXQA 5IH5A 4MF0A 4DH5A 5L8LA 4R7HA 4ZY5A 4DBXA 1OZ1A 1OBDA 3KULA 3OVVA 2FB8A 2OJJA 1KE7A 1KOBA 3PY0A 3MWUA 4G31A 3RK9A 1BKXA 4L7SA 3F3WA 5ETCA 1U59A 3MPMA 5CXHA 3E5AA 4MEDA 2C0IA 1NVQA 3ACJA 3UZPA 1GZ8A 4O91A 4L68A 3CQWA 3RCDA 3RMFA 4F64A 4X3FA 4UX9A 2I7QA 5J9LA 2X2MA 3NUUA 3LXPA 4HPTE 4IX6A 4P4CA 3VUGA 4K0YA 4CTBA 4USFA 4MQ1A 4OTIA 1SYKA 1U54A 2QOHA 4AZWA 3VN9A 1F5QA 2GFCA 3OCTA 5HVKA 3QD2B 5FTGA 4QQTA 1JKSA 4I6QA 4EHVA 4ZSGA 2HOGA 4BTFA 1STCE 1NY3A 2WHBA 4ZMEA 3RALA 1XQZA 3ANQA 3P5KA 4JIKA 1LR4A 4NJDA 1Y6AA 1ZRZA 3Q4CA 3BYUA 5HHWA 2XJ0A 1Q3DA 4TYIA 4ITHA 4JT3A 2LGCA 2XK6A 3ZC6A 2W7XA 2XA4A 5CWZA 5KNJA 3R9NA 4LRJA 3KB7A 3ORMA 1BMKA 4F0FA 2XKCA 4PNKA 4YHFA 4GT5A 4FUXA 3QHRA 5M51A 4L7FA 2VTAA 4YC8A 4NH1A 1LEZA 3EKNA 3NW6A 4EK3A 1VJYA 5CT7A 3ANRA 3LCDA 3R7VA 4G2FA 4II5A 1WVYA 4TYEA 3CQUA 1Q97A 1W7HA 2DS1A 2Y8OA 4BCKA 1JWHA 5EW9A 1J7LA 1CKPA 4DEEA 2WGJA 2XNGA 4KWPA 5T6KA 4GFMA 4IC7A 3LJ1A 4MTAA 1Y8YA 4LM5A 3PVBA 4WRGA 4XV2A 1ZYDA 2BRHA 3VVHA 4RJ6A 2WMWA 2YFXA 5IH6A 2XYNA 1Q8WA 2JIIA 5FWKK 1YXVA 1H1SA 4K11A 1ZARA 5GNKA 3BIZA 3RI1A 5K0XA 4WT6A 5I9WA 4CYJA 4AG8A 4ANBA 3R7OA 4D5KA 5DR2A 4ZK5A 4QQ5A 4DCAA 4NKAA 4MD8E 4YTHA 5FP6A 4BYJA 2BHEA 3R1SA 5LMAA 4GFGA 2Q0NA 2R3OA 3AG9A 1O6KA 4FTAA 3EQDA 1PY5A 3NAXA 4IWDA 5DT4A 5B2KA 4BTKA 1XJDA 4XV3A 2PMOX 5CEKA 2QVSE 2IJMA 3H0ZA 2XK8A 1V0BA 3EQFA 2UVYA 4ZJJA 3ULZA 3NUAA 1JVPP 4LGDA 2WMXA 4C61A 2H6DA 3V8TA 5CU3A 4TYHB 3KCKA 3PZHA 4FTMA 2DWBA 3EQHA 4AUAA 2BIKB 4YR8A 1ZOHA 1QPDA 3NVKI 1XH5A 2ESMA 3RK7A 5JH6A 3NPCA 3BHVA 1SNUA 5GJDA 3GBZA 1G3NA 1PW2A 3F3UA 4RWJA 3B8QA 4UWCA 4FIEA 2PVMA 2IO6A 5HG8A 3TEIA 3LXKA 3MY5A 1Q8YA 2BDWA 5BNJA 5CAUA 3Q4ZA 3R63A 4NFNA 4NTTA 4U42A 1YHWA 1FQ1B 4A4OA 1I44A 3MI9A 3QA8A 3QZHA 4MCVA 3DZQA 4BDEA 3FKNA 5J9ZA 2BIYA 4FG9A 3DK7A 3TL8A 3FXZA 3GC7A 5T3QA 3QCQA 3SOCA 1B39A 2VTTA 4Y8DA 2QD9A 4XBRA 1R1WA 3C5UA 3GEQA 1BYGA 4K8AA 4F9AA 1FBNA 4EH9A 1RE8A 3C13A 2YIQA 4ZTSA 4RLLA 5ETFA 5FBNC 2C3IB 3RWPA 2XIXA 4DEHA 4RA5A 1QPCA 1R3CA 3AMYA 4G3FA 4E6QA 5JK3A 3VF9A 4L00A 4D2RA 2C5YA 5IKWA 2GS7A 2OK1A 3E63A 1TQMA 4KS7A 1W0XC 2EB3A 4NEUA 5DT3A 5LJJA 4BCGA 3A8WA 4U81A 5AP1A 4ITIA 4EL9A 2QG7A 2WXVA 4C57A 4YPDA 3F5PA 5KO1A 1URWA 4FT9A 1OPLA 2C1BA 2YCRA 3MFUA 2WTCA 3UQCA 4G9RA 4NW6A 3NYNA 3MFRA 3U9NA 4EOIA 3FXWA 3DB6A 4TYGA 2JITA 3C4EA 4PPAA 3K3JA 4WHZA 5DT0A 2P2HA 2XMYA 4UB7A 3TZ8A 2C0OA 3SG8A 4CFUA 5GJGA 5ACKA 4C34A 4XEYA 2OBJA 3EJ1A 3PLAE 4ZSLA 4U7ZA 4PTGA 5HVYA 2WTWA 1R39A 5E8WA 4RG0A 4R1VA 4YO6A 3NW7A 4FTJA 4JS8A 4WD5A 1PHKA 1Q99A 4YBKA 3IPHA 4ANLA 2VTJA 4RIXA 4KD1A 3SW7A 2X2LA 5I3OA 1KV2A 1PXMA 3A7IA 2B9JA 4QP7A 2E9OA 1XWSA 4OGRA 5AP2A 1J1CA 2RFEA 3COKA 3IG7A 4M97A 4OW8A 3NCZA 3K5VA 2ZV8A 1PKDA 5EM8A 3PRFA 2WD1A 5KKRB 4CG8A 2XUUA 2W0JA 3WZEA 4L6QA 4RQKA 3LE6A 3D83A 5ETIA 5FTQA 4YJPA 3HRCA 4QMPA 4X7QA 4O86A 4F6UA 4RT7A 2QHMA 2ITTA 3DBQA 3SRVB 3VS5A 1ND4A 2ITUA 1KWPA 3GU5A 4GH2A 3FQEA 4XG3A 4PP9A 5LWMA 2BCJA 5E4HA 2O63A 2J51A 4AA4A 4N57A 3NNWA 5A46A 4CMTA 5AUZA 3UIMA 5JFWA 5KMOA 5GIPE 4F65A 4DTKA 2FO0A 3BBTB 4FV4A 4FTOA 4XG9A 3FPQA 3UBDA 4BBFA 2QO2A 3V6SA 4D4RA 5BVDA 5IMXA 3LKMA 5E91A 4B99A 5DOSA 4EHGA 2XNNA 5BPYA 4IIRA 4MX9A 4EHZA 2J90A 3VQUA 4OTPA 1E1VA 2XIRA 4ANNA 1IAJA 3HMNA 1JAMA 5BVEA 3V5QA 4DFZE 1WBPA 1F0QA 4FICA 4IWQA 5HVJA 5JRQA 2VWIA 5HLNA 3LXLA 3FEGA 4R7BA 3VHKA 3N51A 4EOOA 3RNIA 5IA2A 4FEWA 3QRTA 3HA8A 5M08A 3QKKA 4EQUA 4NT4A 3QCXA 4IC8A 4ZXTA 3MVHA 4D1XA 2R7BA 3ENMA 4G1WA 4XG7A 3DAKA 3QWJA 2QOLA 5FXSA 2B55A 4FNYA 4PMTA 3UPXA 1X8BA 1UU3A 2P33A 5HCYA 4R7IA 3DOGA 4BKYA 4R78A 3SVVA 3NIZA 3Q53A 2YAAA 5CI6A 5K0KA 4EH6A 2CNVA 4LFIA 5D12A 5A4CA 4HZSA 5CSHA 2XEZA 4BWPA 3TN8A 3HECA 1GY3A 3PG1A 4D4SA 1YW2A 3VUMA 3D15A 4YZ9A 4ANMA 3CEKA 2BHHA 2CGXA 3KXGA 3ORNA 3RINA 3ZEWA 1M7NA 5CYIA 4AGDA 2CGVA 3BU5A 5T68A 4ACDA 4EZ7A 3F5XA 4XG8A 4L3JA 3L8PA 2PVRA 3N9XA 4NIFB 1L8TA 3PJCA 4PL4A 1T45A 2XKDA 3K54A 4CTCA 1YI6A 3QQJA 3ORTA 2BDJA 3N4UA 3PY1A 3DXQA 4EYMA 2PE2A 4IAYA 2CGWA 4N0SA 5EDQA 1Q8UA 3FZTA 2AUHA 5CF6A 3TIZA 1Y6BA 4RBLA 4B9DA 3ENHA 4E8AA 3EOCA 3E3PA 4O22A 4RX7A 3ATSA 4BI2A 5LCJA 2WQMA 4FT3A 3PP1A 3UMXA 4RZWA 4E4XA 1GIJA 3QZIA 4UYNA 3KK9A 3BEGA 4L45A 1GJOA 5CSWA 4EH5A 2V22A 5DHJA 4S32A 2YJSA 3THBA 1FGIA 1U5RA 4GVAA 2A19B 1IRKA 4GJ2A 4I0RA 4O0UA 3SXRA 4PP7A 5IMEA 1Q5KA 1UU8A 2C3LA 2WQBA 2IVSA 4WG3A 1U4DA 2J0IA 1OVEA 2C6TA 2ACXA 4E73A 3UG2A 4QNAA 5HO6A 1YXUA 4ERWA 2VTLA 2R3KA 2Z02A 4HCVA 4DC2A 4X3JA 4Z7GA 5IQFA 5K5XA 2G2IA 4FT0A 3UNJA 3ROCA 2C6LA 3FMDA 3OUNB 4N6YA 1OECA 3MSSA 5ANDA 4CFXA 1H00A 1OMWA 2I0YA 2VNWA 2VAGA 4GCJA 1OL1A 3FSKA 2GS6A 3RM7A 2YHVA 3QRIA 2B9HA 3PVUA 5CU4A 4I21A 3LFDA 3G0FA 3RZFA 4I6FA 3WYYA 5IG1A 3QF9A 2CLXA 5CQWA 1ZOEA 5AX3A 3G51A 5FEDA 3VBVA 4FT5A 4ALUA 1YDSE 5J9YA 5M4CA 1U5QA 4DEAA 1Z9XA 3A61A 5CSPA 4IM3A 3E87A 3VWAA 5C1QB 3I4BA 4IFGA 4U43A 4DEDA 5IQBA 3W1FA 2JKOA 4S31A 2YZLA 3C4ZA 2UZWE 2JKKA 5FD2A 1BI7A 3GXLA 5D10A 1QMZA 2YDIA 2WQOA 2PTKA 3FV8A 4GT4A 4USDA 2JDRA 5IH4A 2XK9A 3CIKA 3BYVA 5FDPA 5C4KA 3N4VA 2C4GA 3V01A 2BR1A 3QD0A 2ERZE 2Y4IC 2J0LA 4ZSJA 3RTPA 4X3FB 2ITOA 3HLLA 2YLEA 2XIKA 3ZHPC 4F7JA 3DZOA 3W16A 3ZH8A 2W1GA 3CGFA 2P0CA 2BILB 2OZAB 2HZNA 2W96B 4QOXA 4TXCA 1VYWA 4XBUA 3FDNA 1OKWA 3F88A 3W2SA 3W8QA 4FA2A 4AGUA 5IA3A 5IQAA 4MXCA 4X2NA 4DN5A 3QQLA 3G15A 3DKFA 5M4FA 2ZM3A 2JDSA 2CMWA 3MGYA 5HNIX 3T3VA 2UW9A 4XH6A 2I6LA 5E1SA 2W1DA 4G3DA 2C69A 2B4SB 4H1MA 4UMPA 2X0GA 4FTIA 5FM3A 4LRKA 3LMIA 5JZJA 1MRUA 3QYWA 3BYSA 5F1ZA 5KZ0A 3IOKA 3LLTA 3COHA 3LCOA 4EEVA 4KABA 4ZLYA 3SXFA 3QAME 3FI2A 5AUWA 4CQGA 1JQHA 2JAVA 4H36A 3O8PA 2V62A 3LMHA 2UZNA 4I5PA 2WMBA 3MBLA 3VBXA 2RF9A 4FL2A 2XRWA 4U3ZA 4FVPA 4APPA 4FEQA 4ZZMA 3GUBA 4UV0A 3ZLWA 4E93A 5A54A 4B8LA 2QU6A 5HBHA 2OW3A 4LOOA 5LVOA 2O5KA 3AT2A 1UA2A 1Q61A 4BDHA 3C4XA 5DLSA 3PYYA 4PUZA 4TT7A 3HAMA 3PE1A 4FKTA 4TRLA 1Q24A 4FIJA 4PPBA 3S0OA 2BMCA 2UW0A 4HJOA 2YCSA 1QL6A 3GFEA 3LW0A 4DH7A 2RFNA 3FZ1A 5FLFA 2DUVA 5CI7A 3F61A 1RDQE 3W2OA 2NO3A 3V5WA 4CKRA 4O2PA 3PJ3A 5L2IA 3UE4A 2GTNA 4A9UA 1LP4A 5TO8A 2V7OA 4IB1A 4TTHB 3ZO3A 5KMMA 1Q62A 3KC3A 4D0XA 3G5DA 4B4LA 2O64A 4G6LA 4YTCA 5BYYA 3O7LD 3FQHA 3PLSA 2G2FA 2IW9A 1OB3A 5HLPA 5I5ZA 5JMSA 5DGZA 3PY3A 4DLIA 3QUPA 3EZVA 4BYIA 2XF0A 4QMTA 4RIYA 3I1AA 5KMKA 4L53A 4CT2A 4JI9A 1H01A 2VX0A 4BDJA 2NP8A 3C1XA 4OAVB 2QNJA 4IMYA 2PMLX 4FKPA 3DBEA 3FI4A 3R2YA 5CNNA 5CAPA 3KCFA 5EG3A 4MD7E 4XLIA 4C4IA 2HCKA 3E3BX 2VO7A 1GZKA 4AX8A 4CCUA 5HIDA 2BPMA 4J96A 4MKCA 4R1YA 3FLQA 3DNEA 4GS6A 4E20A 3KRRA 4X21A 2HIWA 1RQQA 4P7EA 4YJTA 3R21A 3CS9A 1SVGA 3R02A 2BZJA 5LWNA 3ORLA 1MQ4A 2HZIA 5AA9A 3H9OA 3I5NA 3MTLA 4BCQA 1S9JA 3JVRA 2YACA 3P86A 4FZDB 4MVFA 4GKHA 2ZAZA 1JSUA 2O8YA 4HNIA 3Q6WA 1MP8A 4ZTQA 2A2AA 4D55A 4ZZNA 2R3FA 3O51A 3FXXA 5EQYA 4FV2A 5A3XA 3QQGA 3SW4A 4J98A 2JFMA 2BZIB 3O2MA 4YGAA 5TOZA 4G5PA 4MF1A 2ETKA 4F9WA 4RX5A 5IPJA 3UOJA 2HW7A 2PU8A 4EH7A 4USEA 4FTQA 4OTDA 5DH3A 5KE0A 3U9CA 2UZBA 3EFLA 3KN6A 4P90A 2UW6A 2H8HA 3TKHA 4GSBA 4ANOA 2JIVA 4JDKA 4ZTMA 5KBQA 5DYJA 3C0HA 5HD7A 4D2TA 2R9SA 1R0EA 4J99A 1JOWB 3RCJA 3CJGA 3NYOA 1PXIA 2I0EA 2FSMX 5E8ZA 1G8SA 4FC0A 3FMLA 4M8TA 2GNJA 3R9HA 3ETAA 3LLAA 2DQ7X 2QONA 2YIXA 3BRBA 4HNFA 5CSXA 3AC8A 3V5PA 5LVPA 2VTOA 1H1WA 1OPKA 1GIIA 3GCSA 1AQ1A 4GK4A 5IQHA 1W82A 4OTGA 2FGIA 2WOTA 3QKLA 1UNLA 5DEWA 5ANKA 3DJ7A 4DG2E 3N4TA 3C4CA 3NUSA 4HW7A 2OJ9A 3KF7A 3NWWA 2VWWA 3CLYA 4BI1A 4IBMA 3PWDA 3QXOA 2GQGA 3PJ1A 3PZEA 3FC1X 4ZOGA 5ANJA 3UGCA 4RIOA 4GIIA 3BGZA 2IZTA 2BZKB 3L1SA 4JNWA 5L6WL 3U87A 4HVSA 4A9RA 5AV3A 4IDTA 1XH8A 4FNXA 4NM5A 2BFYA 3WIKA 2PVLA 2QR7A 3MH3A 5F9EA 3QLGA 4TW9A 2OXYA 4CRLA 4NWMA 4BBMA 1Y57A 3F2RA 2UW4A 3NNXA 2XKFA 4BIEA 2ITZA 3H10A 4AZVA 5FXRA 4QMOA 3S1HA 3DPKA 5I0BA 2OIQA 3GB2A 3PXFA 3QQKA 2Z7QA 3DBDA 4M7IA 3OT3A 2AYPA 3PA5A 4XUFA 1NVRA 3U6HA 2WTKC 5CVFA 3TNIA 5KMJA 3WBLA 4EQMA 1Z5MA 4RC2A 1UWHA 3OWJA 4B8MA 2JDOA 3MN3A 4A9TA 3VS6A 4DFNA 2YCFA 3UOLA 5AR2A 3UO5A 3ZFYA 5DEYA 2HENA 2R64A 4F08A 3Q2JA 2XJ1A 4H3PA 2B7AA 1OUKA 2VGOA 3DQXA 2G2HA 4EUUA 5BUIA 1XKKA 2YDJA 5LVMA 3WF7A 3G90X 2YERA 4WG4A 4IAAA 2XNBA 3A99A 2VZ6A 4FODA 4MWHA 5HNBA 3OTVA 2ZM1A 1JKLA 2KTYA 5AAGA 3RAHA 2QOOA 3ORPA 4RJ7A 4JDHA 3HMPA 5EFQA 4LOPA 4WBBB 5TT7A 4AW1A 4TKSA 2UW7A 3JYAA 4CZUA 2XK7A 3QUDA 4RVLA 4PMSA 3HVCA 2WMAA 3OW4A 4BGHA 3DCVA 3BGQA 2F7EE 2VO3A 3AMBA 3SDJA 2W1IA 4DAWA 2OO8X 5AIKA 4BC6A 3HV6A 4EOLA 2YM7A 3HNGA 4WSQA 3WYXA 2A4LA 3QQUA 1WVXA 4EYJA 3M11A 4JR3A 4YU2A 4TNBA 3GU4A 3KK8A 4BGGA 5DRBA 2B9IA 4U97A 4BKJA 2UV2A 3V5JA 1KE9A 4DA5A 4WNKA 5CTPA 5ACBC 3QGYA 2HY81 4O84A 4L3LA 1QPJA 5E8TA 1IAHA 3GVUA 2PK9A 1UWJA 3FSFA 1ZXEA 4IHPA 4RJ4A 3QX4A 4O0YA 5BMMA 3HV5A 3VJOA 4IEBA 2R3JA 3CCNA 4OTRA 5KX8A 4MXXA 3ZLYA 2CHLA 3GU7A 4PDOA 2XVDA 5EQPA 3RPSA 5IQDA 2PY3A 3FLZA 4RWIA 4UMTA 1DS5A 3BLHA 2XNPA 4EOQA 5HBJA 2Y0AA 3ZRMA 4PNIA 1OITA 2YCQA 4H1JA 2IVUA 2UVXA 3UP2A
chains in the Genus database with same CATH superfamily
4W9XA 4CLIA 2G1TA 4I41A 1JSVA 4R5YA 1OM1A 2VX1A 2Z7SA 5KHWA 2W1EA 4FV1A 4I3ZA 5AP0A 3EQCA 3VO3A 4FV8A 2FUMA 4FZFB 3KMUA 4ITJA 4QPSA 1TZDA 1SNXA 3QTZA 2UZLA 4C4HA 4QYYA 3PWYA 1A48A 4C36A 3PA4A 4IJ9A 1OL5A 4XG6A 2BAKA 4F0GA 5EM5A 4CSVA 4EJNA 4Y5HA 3ORKA 2EVAA 2YM5A 5AAEA 3FZSA 3KRLA 5K4IA 4L8MA 4FKWA 4FSNA 5AA8A 3GCUA 5M07A 1WFCA 5BVOA 4BICA 3VF8A 1I09A 4NU1A 2QURA 3UVQA 1O6LA 4HGLA 3R8VA 5KCVA 3KXXA 2QOCA 4KKGA 4LYNA 4WA9A 4EONA 3VHEA 5AX9A 2R0UA 3QU0A 4MK0A 4G5JA 3KRXA 4HCUA 3IW7A 2VWXA 2EXMA 4KIKA 4LV7A 4DHIB 4LV5A 3SA0A 3R2BA 4WNPA 2VTNA 4FYNA 4YLJA 4AGCA 3CXWA 3R73A 5IUIA 3PPKA 3OWLA 3P78A 5HLWA 4AE9A 3KL8A 4IAZA 5AUVA 3R8ZA 4XV1A 4EOPA 3FMKA 2WNTA 4Y73A 3P9JA 1R0PA 3PE2A 1W98A 3DBCA 4BDGA 3MJ2A 4FK6A 5M06A 5JEBA 5EM7A 5IA5A 4OR5A 3I7BA 3F66A 5EYMA 2WMQA 2F49A 2YWPA 3C9WA 2BKZA 3E64A 4F7NA 5FP5A 5CEPA 1YKRA 4F09A 3HUCA 4FSZA 3OD6X 3TNHA 1JSTA 4GT3A 1U46A 1V0PA 4FTNA 4V01A 4DGGA 5CU0A 2QO9A 4FKJA 4ASEA 5JKGA 2IN6A 5BUEA 2RG5A 4Q5EA 2BZHB 1XO2B 2C68A 4BY9E 5J1WA 1K3AA 2BRBA 3HRFA 2WELA 2RL5A 4XV9A 3JVSA 3A2CA 3OCSA 2Y4PA 4BHZA 4IM0A 1H26A 3F69A 4RIWB 4IZ5A 1YXSA 1HOWA 1VLRA 4EZ3A 3PIYA 4KS8A 5GZ9A 2JC6A 4RLKA 4OBPA 4BGQA 3IS5A 2REIA 5DBXA 3ZO2A 5K5NA 4MXAA 4FKOA 3UDTA 3FLWA 5BVWA 3HDNA 4GYGA 2PMNX 2C5VA 1M17A 3KRWA 2QLUA 5A14A 3Q9WA 2EU9A 3JXWA 3VBTA 3P5JC 3T8OA 5DI1A 4I22A 1ZOGA 3LMGA 5AP3A 3Q9ZA 4BIDA 1FMKA 4AFEA 4DYMA 4QPMA 4U9AA 5BMSA 3UZRA 4CRSA 3FKLA 4HGEA 3T9TA 4YPSA 3NFFB 5FTOA 3EQBA 4CVAA 1WZYA 1NW1A 3TV7A 3BPRA 4RJ5A 5IF1A 3UVRA 2QG5A 2WU7A 4YTIA 3WZUA 4BCFA 2QO7A 1JLUE 4ID7A 3PSDA 4XYFA 4DINA 4O7YA 3HEGA 4H05A 3EFWA 4O81A 4LUDA 3BWFA 1J1BA 3FHRA 5IU2A 2E9PA 4YJOA 4D4VA 5LXMA 3NFGB 4CFFA 5KBRA 3CSVA 2J6MA 3ZMMA 4U80A 2JKMA 2R3IA 5KZIA 4K77A 3RGFA 1ZYLA 2W9ZB 1FVTA 4S34A 4WBOA 3E62A 3UMWA 4BL1A 2G01A 3PP0A 3HAVA 4EC9A 4G34A 3VW8A 1JPAA 2NRYA 4ACHA 5ANGA 2C30A 2WTDA 3DFCB 3GC8A 3QRUA 5AR4A 3UTOA 2BKKA 3SD0A 2W4KA 2WFYA 4W8EA 3SC1A 2CN8A 3TWJA 4AT3A 4WNOA 1P2AA 3HV3A 4MBLA 4UBAA 4PPCA 5EI2A 1PYEA 4NKSA 3EN9A 1WBWA 5I9YA 3UQFA 5H2UA 2F2CB 4QYGA 3V8WA 2ZFYA 3P4KA 3PVGA 5KUPA 3NYVA 3Q32A 5CU6A 5TF9A 3EQIA 4DHJA 3DA6A 5AV1A 5C9CA 3U6JA 2J2IB 4IADA 4FEXA 1PKGA 3C4FA 1YDRE 4QP4A 4F1TA 1BUHA 5L2TA 1WBVA 2W5AA 4M14A 4U45A 4RRVA 4CMOA 2JAMA 2PVHA 2Z2WA 4IVCA 3LVPA 5AUTA 4O7WA 4YBJA 5BVKA 3WZKA 4GV1A 3W10A 4RJ3A 4BZDA 3DAEA 4TWPA 5EH0A 3QA0A 3LQ3A 4EOSA 3WF9A 4GUBA 3MVLA 1YOLA 3UG1A 5LMBA 3HUBA 1OKYA 4AN3A 4ACMA 4I20A 3R28A 4IZ7A 2X39A 4QPAA 1YRPA 2X8IA 5HOAA 1UKIA 2VTHA 4NZWB 2W5BA 2YA9A 4YTFA 4QQCA 3MJ1A 4WG5A 5H3QA 4Z3VA 2OIBA 2WMSA 4I92A 4AXDA 3G0EA 5GZAA 5EYCA 3HV7A 3I81A 3ORXA 3FHIA 2OFVA 4FKVA 3DAJA 4BRXA 2QKWB 1OPJA 4ZJIA 3V3VA 5IISA 5GZ8A 3W18A 4OTHA 4FG8A 2C6EA 4FTUA 3ITZA 4DDIA 3VUDA 2CGUA 3LCSA 2UZEA 2XEYA 3KA0A 4GJ3A 5HE3A 3R8MA 4UZHA 3GGFA 3ROYA 1XH6A 3ZFMA 4FX3A 4YJVA 4JBPA 5HG7A 1YWRA 4IE9A 2VTRA 4UWYA 3QTUA 4JR7A 4MBIA 3LZBA 4I5CA 1REKA 2JFLA 3DQWA 3MY0A 4IZYA 4F1OA 4DHFA 3PXQA 2JEDA 5M4IA 1S9IA 2VN9A 4IM2A 3EQRA 2EB2A 3CGOA 2OLCA 4FL3A 2I0VA 2BTRA 2WMUA 3SKCA 1CKIA 4U44A 4EOKA 5I3RA 2XZSA 3AT3A 4RWLA 4KKEA 3BQCA 2F4JA 2YJRA 1RJBA 3QX2A 2XAMA 3W2PA 3L8XA 2BRMA 3H4JA 3I6WA 4BBEA 1J7IA 2WB8A 3MB7A 5E8YA 2QCSA 2X9FA 4AE6A 4UEUA 4J95A 3ZLSA 1CTPE 2ITQA 3A8XA 3VS2A 4ZAUA 3O71A 2HWPA 2W4JA 2HWOA 4X2KA 3UNKA 2O2UA 3GOKA 4EKKA 5E92A 3F9NA 1K2PA 4MNEB 4ZTNA 1P14A 3W32A 3F2NA 4TL0A 2J0JA 2OICA 5ANEA 5HG5A 1H8FA 2ZV7A 3G2FA 4RVTA 5DG5A 5J95A 5L3AA 1G8AA 4PDYA 2QI8A 4IFCA 5JGBA 1YWVA 2X7OA 4H58A 4PDSA 5CXZA 1VEBA 4YNEA 4O6LA 4DFLA 4FKQA 5M56A 5FEEA 2ETRA 3DXNA 4U41A 3QKMA 3PA3A 2J0KA 3E7OA 3DGKA 3ZXZA 3DFAA 4XNEA 4YSJA 3JR1A 3HMMA 3NGAA 2X8DA 4BWXA 2FSLX 2OF4A 4IJPA 4O6EA 1ZMUA 3D9VA 5FGKA 4FTKA 4IAFA 2HY0A 2PUNA 3NEWA 1K9AA 5HORA 3PUPA 3IQ7A 1IA9A 3R8UA 2ZOQA 2NRUA 2OU7A 1BX6A 3A7GA 3QC9A 3CQEA 4FKUA 3MH2A 2J7TA 3EQGA 1M2RA 1XR1A 2YDKA 4QMZA 5LMKC 3D14A 4JAIA 1IA8A 3VQHA 3HGKA 1B6CB 3IK3A 4AXFA 3I60A 1OUYA 2ZMCA 1GAGA 3LFQA 2ZV9A 1HCLA 3WARA 2PPQA 3G33A 3VRZA 3HRBA 4NW5A 2W9FB 3CD8A 3NUNA 5HG9A 2XH5A 3A7HA 3K3IA 5AR5A 2QKRA 3V5TA 4C38A 5G1XA 2RGPA 4ZY6A 5F94A 1J3HA 4PTCA 2BDFA 2CNUA 3UJGA 2Y9QA 3MDYA 2C6OA 4NM3A 3BGPA 3EZRA 3P7CA 4ANQA 4FKSA 1Q8ZA 5AAFA 2RG6A 2A1AB 2HXLA 3PRIA 3QD3A 5JQ8A 3P79A 3ZLXA 5C8MA 4WIHA 1PYXA 1AGWA 4HZRA 3VS7A 3GT8A 3HV4A 3II5A 4YZMA 2C6IA 5BV3A 4FGRA 4HYIA 3P0MA 4OTWA 4X2GA 5AR7A 2YIYA 3OTUA 3S4QA 3QXPA 4GL9A 4F0IA 5FUTA 2VV9A 4FV6A 4EJ7A 4DGMA 3ZO1A 5CALA 3TTIA 3E8DA 4OBQA 2PVJA 2JIUA 3V6RA 4M12A 4V0GB 3P23A 4IW0A 1J7UA 3ZUUA 4HGSA 4EHEA 2W99B 4OUCA 3IDBA 3E8CA 4E5AX 2GFSA 4ASDA 3RWQA 4O1PA 3P7AA 4DG0E 2C6MA 3QFVA 3V8SA 5A6OA 4G6NA 5BUJA 3U4WA 4YC3A 1KSWA 3EN6A 3KULB 3M2WA 5EOLA 5ITAA 2PUIA 4IVDA 3HP5A 2XYUA 2VWUA 5F95A 5EI8A 3V04A 3O17A 4AT4A 3K2LA 4TN6A 4L3PA 3OF0A 5C8KA 4JBOA 3ZS5A 5KHXA 2G9XA 4YJNA 4FTRA 4ASXA 3DLZA 2QOFA 3A7FA 3FE3A 4R3RA 2BUJA 3ZXTA 3U54A 3A4OX 4RFZA 1ZYSA 3LQ5A 1IR3A 3HKOA 3TZ9A 4LGGA 1DAWA 1U54B 1E9HA 3TZ7A 3PPZA 2GPHA 4CD0A 3DY7A 1XHAA 4N6ZA 2XS0A 2BROA 2WMRA 4Y85A 4FT7A 3WIGA 3D5UA 4DBNA 3OEFX 3AD6A 5JFXA 4Y5QA 5HICA 4FZ7A 4FIFA 4AW0A 4X6QC 3FI3A 4QP9A 3BHTA 4F6WA 3A4PA 3VUIA 4FSWA 1OL7A 2B54A 3Q3BA 4JAJA 4KNBA 4XCUA 3KXHA 4GU6A 5ANOA 2P2IA 3IW4A 4FOBA 4CZYB 5M44A 1UKHA 5EW8A 2QODA 4JL9A 2GNHA 4KRDA 4FR4A 4EOMA 3NNUA 4FE2A 3KVWA 4WO5A 4BZOA 5LVNA 3LFSA 2OJIA 1W2CA 4ZLZA 3HZTA 3R9RA 4NTSA 4JJRA 3C7QA 4QQJA 4U3YA 5EKOA 5AP7A 4JRNA 1PXNA 3L8VA 1H0WA 3QRJA 5A6NA 4PL3A 2QR8A 2VD5A 4KBCA 2BRGA 3WF5A 3OWPA 3UZTA 4C35A 1T46A 1Q4LA 3BHUA 3DLSA 3OBJA 4NM7A 4C8BA 3OT8A 4JIAA 3ALOA 3VW6A 3E8EA 5AFVA 3ODZX 4WSYA 4FV5A 1CM8A 2UZVA 4PDPA 4O0VA 4QYFA 4FSQA 2UVZA 3GENA 2R4BA 3CR0A 2PSQA 2RKUA 1UVRA 3BEAA 3SQQA 2ETMA 2VTSA 5IQGA 3D5XA 3EL8A 3S3IA 5BX0A 4QMSA 4S30A 2W05A 2GQRA 5CF8A 3O8TA 4GRBA 4NSTA 4O2ZA 3ZSGA 3JY9A 1GZNA 2C6KA 1HCKA 3GCPA 3R0TA 1LPUA 2BVAA 3ORIA 1YWNA 2VWZA 4MH7A 3DB8A 1W84A 2ZVAA 1FVRA 5JRSA 4EWQA 1A9UA 2XBAA 2CNQA 3C50A 2W4OA 4O0RA 5CF5A 3F3ZA 1OIYA 2DYLA 5FXQA 2XNEA 4I6BA 3WE4A 4KBKA 4I23A 1UNHA 3FC2A 3PIZA 3COIA 2WZJA 1Q41A 3U8WA 4YNOA 4NM0A 4CEGA 4ZIMA 4CZTA 3UO4A 2WKMA 3GFWA 4FOCA 3QQFA 4H39A 1PXLA 3JPVA 4QO9A 5H9BA 3AD5A 3EN5A 4GFOA 4X0MA 4TY1A 4LMNA 2QLQA 1IEPA 3R30A 4FF8A 2FH9A 5KMNA 3BBWA 2KULA 2OKRA 3ZUTA 4C4FA 2W1CA 3UPZA 4O7LA 3CTQA 5IUHA 4JBQA 1H27A 5CAOA 2Y4IB 4TPTA 2Z60A 4KIPA 1FMOE 2IPXA 1DAYA 4QDEA 2I1MA 2XM9A 3H30A 4C3RA 4U79A 1PMEA 4KB8A 3EYGA 5BYZA 3TV4A 4ZSAA 3ZTXA 5J7BA 2VNYA 2PZPA 2UW3A 4I4FA 4YO4A 2V7AA 4BKZA 5L8JA 4RWKA 3ET7A 5EI6A 3RKBA 5IDNA 4XRLA 4QD6A 5CANA 4C62A 5DVRA 2IW6A 2UZDA 3D5WA 1TQIA 5HIBA 2Y6OA 5HTCA 4FV0A 3HX4A 3SHEA 4KIOA 3NR9A 3TIYA 4G16A 1FINA 3OBGA 4FG7A 4JBVA 4D5HA 2XIYA 4DDGA 4BCIA 3ZEPA 4RFMA 4PL5A 4KKHA 3Q5IA 4TZRA 5AWMA 3CE3A 4B6LA 3PJ2A 2QQ7A 2PYWA 3NMUF 2W1FA 3MIYA 2IVTA 2YM4A 2I40A 1GOLA 2OJGA 3MPTA 1URCA 3PPJA 2AC3A 4GG5A 4Z7HA 4O7SA 4CQEA 1SMHA 4QMXA 3KXZA 4RJ8A 5HD4A 1MRYA 2PULA 3LFAA 2R2PA 1PRYA 4AXCA 2OJFE 3F5GA 1Q3WA 1ZMVA 3MH1A 4EK6A 4ZY4A 5C4LA 2PZYA 2QOBA 2X0PA 4Y95A 3W0PA 2X6DA 2OF2A 1PF8A 2CKPA 3RBWA 4P5QA 3TNQB 4R3PA 3SRVA 3TT0A 4DGNA 4E7WA 1G5SA 5CNOA 4F9CA 4PF4A 4EH4A 4WUAA 2HW6A 3KGAA 4W4WA 2EWAA 1OL2A 5AP4A 5EHLA 4G17A 1H25A 4FSUA 3O0GA 3D2KA 4QT1A 3R8LA 4W8DA 4J8NA 5HE2A 4XP2A 2OGVA 3ZM4A 3SV0A 3VRYA 1JKKA 2IZUA 4FV9A 5D1JA 4F6SA 1XH9A 2PVYA 3COMA 3IW5A 4M69A 5A9UA 5EHOA 4I94A 3LXNA 3TM0A 2CJMA 3FY2A 5IDPA 2GHLA 2W5HA 3REPA 3H0YA 3SXSA 3OUKA 5M53A 4FV3A 3NVMB 4RIXB 1Z57A 1JKTA 1OIQA 4MQ2A 3KMMA 4ENXA 1PMUA 3LFFA 3KY2A 4LL5A 3BWJA 1LUFA 3MYGA 3VUKA 4RPVA 4ANSA 3VULA 5H8EA 5LVLA 2WIHA 4WUNA 5IEYA 4TWNA 1BL7A 3KQ7A 1WVWA 3A62A 4AN9A 5AR8A 1XBCA 4JRVA 3S2PA 4ALWA 5CVGA 4K9YA 3Q60A 5JGDA 4TYJA 3MESA 3UC4A 2XALA 4D1SA 4D58A 2ONLC 4AFJA 1H07A 2CCHA 2JLDA 3IDCA 3TUCA 4A4LA 1ST0A 4FZAB 3LCKA 5EDPA 3TKUA 3I0QA 3E8NA 4ASZA 4FSRA 1JNKA 4AS0A 4D2PA 5CAVA 4CFWA 3BYMA 4AOJA 4DFUA 3RNYA 4PV0A 4O82A 4D2VA 4PMMA 4YHTA 4QP1A 5DRDA 3PXZA 3ODYX 2FSOX 2HK5A 2ITNA 3D7ZA 4R5SA 4IB5A 2ERKA 1YVJA 4ACGA 3QTXA 2CKQA 4MXYA 4NJ3A 4NIFA 4N70A 2CKOA 3MIAA 3I7CA 4OT6A 4A9SA 4XLVA 1YI4A 1TKIA 3DU8A 4E4MA 4JDJA 3AKKA 4GK2A 3UO6A 2GS2A 1H24A 2VTQA 5D7VA 3FYJX 4HYSA 4OTQA 4IZAA 2F9GA 2J0MB 3CJFA 5C03A 4O21A 2YM6A 2Z8CA 3LJ2A 4V05A 4M66A 5AMNA 4TWCA 1FOTA 4FNZA 4AAAA 2YISA 1KE6A 1WCCA 5DFPA 4ZMFA 2WEVA 3MY1A 3ZM9A 4Q9ZA 3QQHA 4D1ZA 4OAUC 4MWIA 3ID6C 3UYTA 4AZSA 4C2VA 1XBBA 1ZYJA 3SX9A 4D2WA 2UZTA 4DEIA 2X0QA 5AIRA 3SGCA 3C0IA 1G8KA 3QL8A 2Z7RA 2VWBA 2PUPA 1TVOA 4RX9A 3VS4A 4QP3A 2HXQA 3T9IA 4YC6A 4L42A 3UDBA 2PUUA 1WAKA 2VO6A 1ZZLA 2XCKA 4QNYA 3TJCA 3UC3A 2CKEA 5EKNA 2C3JA 3FLSA 4GKIA 1ZMWA 4PX6A 2H34A 3EMGA 3UVPA 4FNWA 4A07A 1W8CA 4QP6A 5DIAA 3TV6A 4LV8A 5A4QA 2R3MA 5CVHA 5A4TA 3GOPA 3FMMA 3DDPA 4CXAA 3WI6A 2VTMA 4E4LA 3QALE 2BRNA 3R71A 3AC3A 2VUWA 2X2KA 1KOAA 2JKQA 5EW3A 5B2LA 5E8UA 5DR6A 3TDWA 3MVMA 3OC1A 5L8KA 1M2PA 4AWIA 5A4EA 5J79A 1PJKA 3RAWA 2C6DA 3KVXA 3FMNA 4TNDA 3AGMA 1KE5A 2OIDA 4LOQA 4UZDA 5J1VA 3VBWA 3FAAA 4BVUA 5E1EA 4DE4A 3D2IA 3ML1A 2XB7A 2ZDTA 2WQEA 4M68A 4DH3A 4MXZA 3ZBFA 4KUJA 4IANA 5AEPA 5IQIA 3VC4A 4WNMA 3VUHA 3O23A 4DFYA 5C27A 5EYDA 4HOKA 4OBOA 4UMRA 4BDCA 3RHXA 5AUXA 3EB0A 3ELJA 3MFSA 2IW8A 4BCMA 5LMKA 3NRMA 5BQ0A 3FKOA 1OI9A 1B38A 5J87A 4IH8A 1OKVA 4EKLA 1W2FA 1H1RA 2OZOA 3V5LA 3BQRA 4EH2A 5HU9A 2OZAA 2GHGA 3BCEA 3G9LX 5CY3A 4EWHA 3IDPA 3HL7A 5FG8A 4CFVA 2WMVA 1EH4A 2C3KA 5E90A 2J5EA 2FA2A 4BCNA 3SOAA 1O9UA 4M13A 4Z16A 3ZYAA 3WZDA 2JDTA 5D9HA 3ULIA 4O7TA 3ZDIA 2F7XE 4C4GA 2JBOA 4E1ZA 4EI4A 4IB3A 3OXZA 2XRUA 3ERKA 4PRJA 3WF6A 3ZCLA 1TFFA 2Y7JA 3KXNA 3QRKA 1V1KA 3H9RA 5DN3A 2BAJA 4HYHA 2GNLA 5HI2A 3QHWA 1NA7A 2HZ4A 1M2QA 4RC4A 3TI1A 3MVJA 3DXPA 3OG7A 4EK8A 5HO8A 3BI6A 2FYSA 4PY1A 5HX8A 4I0TA 3NAYA 5HCZA 4QTEA 4V04A 3RAKA 4JQEA 4IACA 2A98A 4HVDA 3CTJA 5H8GA 2ITWA 3W8LA 3MB6A 2X9EA 5GHVA 2A27A 2C5XA 2CSNA 1XMMA 2PZRA 3F7ZA 5M55A 3EWHA 1BI8A 1MUOA 2OI4X 2PMIA 3CP9A 3EN7A 4HPUE 4K1BA 1H0VA 4CCBA 5EOBA 3VS0A 3U55A 3P7BA 3AC5A 3PVWA 4FL1A 2ZDUA 2ZV2A 3EIDA 3FMJA 3QC4A 4IVAA 1IG1A 4ENYA 4FSMA 4JOAA 2HAKA 5FRIA 5H8BA 2JDVA 2P3GX 4BCJA 3WE8A 4HVGA 4BDAA 3BLQA 4ZLOA 5ICPA 1OBGA 1NVSA 4DTAA 3KXMA 5K4JA 3LFNA 2EUFB 1YOJA 4FSTA 4ZS4A 4O1OA 2V5QA 3ZO4A 2WIPA 3CKXA 4L43A 2R3QA 3HDMA 4ZS0A 5HESA 2OWBA 3E7VA 2ITXA 4Q9SA 5DPVA 5KKRC 2ITVA 1WMKA 1M52A 2BAQA 3ZUVA 5IA1A 2C47A 2BALA 4ZP5A 4I1ZA 4J53A 2I0HA 3AD4A 4AZTA 3U51A 4UN0C 3FMHA 4BCPA 2GHMA 1ZY5A 2X1NA 4LI5A 2VGPA 5JQ5A 3CPBA 4FMQA 4NCTA 3MPAA 2X7FA 4BTJA 4C4JA 4C4EA 1OGUA 2XCHA 1W83A 2GMXA 3TKIA 4DCEA 4FVQA 4YZDA 3RJCA 2PE1A 2GCDA 2R0IA 4D2SA 2PVKA 4IVBA 2X6EA 3DKOA 4O4DA 4BF2A 2GDOA 1GNGA 3LM5A 4QMVA 5D7AA 3BLAA 3K5UA 1WBSA 1O6YA 1YHSA 4BI0A 3FQSA 1JBPE 4L01A 4KAOA 4UWBA 3TACA 5L2QA 4O0TA 4RIYB 5HBEA 4M0YA 4AZFA 4D9TA 2GSFA 3Q6UA 4EOJA 4A9YA 5C01A 3BYOA 3LOKA 1WBOA 4DGOA 2CPKE 3DK3A 5LQFA 3UOKA 2JBPA 3F6XA 4RC3A 1WBNA 4Q5HA 2VTIA 4G3GA 4YZCA 5CU2A 2G15A 3BELA 5AP5A 3S95A 2VX3A 4D9UA 3FBVA 4NL0A 3HMIA 4YSMA 4YUQA 1FPUA 2ZJWA 5EYKA 3VS1A 1CKJA 3JUHA 2OH4A 3KN5A 3FZRA 3QCYA 3WZJA 4CFMA 4HGTA 3F7WA 4CGAA 4O0WA 3FLNC 4FTCA 3V51A 1YI3A 4RVMA 4O96A 3POOA 3L9LA 4YZBA 3AT4A 3QZFA 4CKJA 2H9VA 5CENA 1SVEA 3RAIA 3B8RA 3AOXA 4G9CA 4FI1A 3W0OA 3NSZA 4FYOA 4L46A 1ZYCA 4FGBA 2GNIA 4WKQA 2FSTX 3ZFXA 5AR3A 3UP7A 2RFSA 4AOTA 2VU3A 4F7LA 4YURA 3I79A 4FEUA 3QWKA 2X4ZA 3FL5A 5FEQA 1FGKA 3Q4TA 4FK3A 3BE2A 4IWOA 1E1XA 4BIBA 3BV2A 1R78A 5B7VA 4ACCA 4EK5A 4DF3A 4CV8A 1P5EA 4CYIA 4I6HA 3RPVA 3UOHA 3DTCA 4MHAA 3UODA 3BKBA 4QMYA 2AC5A 5GJFA 3DJ5A 2C0TA 4J8MA 2XP2A 3AMAA 3QTQA 4RZVA 4QMLA 3O5AA 3GNIB 4QMMA 2WQNA 5JSMA 3W2QA 4I5MA 1BLXA 3QBNA 4UALA 5HTBA 5TKDA 5C8NA 3AC2A 4J52A 3KF4A 1BL6A 3DT1A 2GNGA 4C02A 2QHNA 3DJ6A 3MH0A 1PMNA 3H3CA 3PSCA 5CLPA 3NUPA 5F4NA 3O7LB 5E7RA 4KSQA 3NS9A 4EUTA 4JX3A 3AC4A 3F82A 4CMUA 4IWPA 3RZBA 4J97A 1L3RE 4M0ZA 2NNWB 2E9NA 3LM0A 2UUEA 4Z55A 3RPRA 4ALVA 1OIUA 4LG4A 3LCTA 5DR9A 3O96A 4J7BA 3NNVA 4X6RA 4FIGA 3QYZA 5HE1A 4CT1A 3PDTA 3AC1A 2YEXA 3D5VA 2HYYA 4HVIA 1KV1A 3BLRA 4M69B 4XHKB 2LAVA 4M84A 4O0XA 3UYSA 4AF3A 3D7TA 1ERKA 2WTJA 2IZRA 2J5FA 5B2MA 4YLKA 5LARA 4K6ZA 5DMZA 2O3PA 4P2KA 3SLSA 3QCSA 1APME 2Y6MA 4I93A 3ZOSA 4AOIA 4MNFA 2C5OA 4QEBA 4EQCA 4RX8A 4NUSA 1GIHA 4CKIA 5D41A 2XJ2A 4MBJA 4FKGA 5CZIA 3CC6A 3CD3A 3H9FA 4QP8A 5L2WA 2F2UA 3NIEA 1J91A 3O50A 3PG3A 5HU3A 3SG9A 2V55A 3RVGA 2HELA 3U4UA 4E5WA 3Q9XA 3WOWA 3OCGA 5M4UA 2F7ZE 4QMUA 4F9BA 3U6IA 3M42A 2ZMDA 4AXEA 4LDTA 4L67A 3DKCA 5M09A 5TR6A 1Y8GA 4K33A 4DEBA 4R3CA 3FUPA 3OXTA 3EL7A 3FZOA 2WU6A 4IB0A 5LCKA 3LFCA 4X3FC 3R22A 4FSYA 3RPOA 3TG1A 2IWIA 4IX4A 2X8EA 5HTIA 1ZZ2A 2Q0BA 3AXWA 3FJQE 3GCQA 4PTEA 3PUFC 2ONLA 3F3VA 2YM8A 4O7ZA 5AJQA 1PMVA 5FDXA 5IA4A 2C5NA 4I4EA 3R7GA 4RGJA 4YHJA 4RMZA 1XBAA 2BFXA 4YJQA 4UXLA 4F99A 3AKJA 2J9MA 4O7VA 4FUYA 3PFYA 3A7JA 2YM3A 4O0SA 4JDIA 3TCPA 4QMWA 3OY3A 3OOMA 4O27B 2J50A 4HVHA 1H4LA 4C58A 2GNFA 3FWQA 1WBTA 3ATTA 4FTLA 4M3QA 2R3LA 3NW5A 1DI8A 3FMEA 5HGIA 4F63A 3T3UA 3BU3A 2NPQA 5DWRA 4A06A 4BCHA 2F57A 4J1RA 5I9XA 3VUTA 3D94A 3W55A 1H1PA 1UNGA 4A7CA 4G6OA 4AZEA 4MXOA 4LMUA 2ITYA 5I9UA 3C51A 2WTIA 3PIXA 3R00A 3R1QA 5J5TA 4RSSA 4WOVA 3QTRA 4X2JA 4MD9E 2YAKA 4DH1A 2CN5A 4DITA 4ERKA 2B1PA 5DA3A 1QCFA 3EFKA 4H3QA 4GW8A 4XOZA 4AXAA 3B2TA 3RK5A 1KE8A 3VBYA 3NDMA 3OEZA 2PZ5A 4O83A 1CDKA 3JS2A 2HZ0A 4ZJVA 3C4WA 3R01A 4JG6A 3FYKX 1XH7A 1ZY4A 3RHKA 4RQVA 1YOMA 3EKKA 1YHVA 3B2WA 3M1SA 4JQ8A 3NLBA 4RFYA 3DS6A 5CS6A 5E8VA 3HMOA 5AV2A 4D4YA 1OL6A 3DDQA 1OKZA 3QZGA 5JGAA 4E6AA 3TUBA 3OXIA 4S2ZA 5LOHA 4F7SA 3QLFA 4O4FA 1NT2A 1PXKA 4XOYA 4E6CA 3GC9A 3OCBA 2FVDA 3GI3A 1G8JA