5CASA

Egfr kinase domain mutant "tmlr" with compound 41a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
324
structure length
299
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 299
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5casA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5casA01
4U42A 1PKDA 2CDZA 2JBOA 2PUPA 3NYXA 5CSVA 4PNKA 5IQCA 4RIXB 5HLNA 3KULA 2WMWA 4TN6A 3NWWA 3LQ8A 4KSQA 2WEIA 4J98A 4EZ3A 4XLIA 4G1WA 5J5SA 1ATPE 4NM3A 3DK6A 4RFYA 4ACHA 1J7LA 4GVJA 4AGWA 1U5RA 2C6LA 4BRXA 4QTDA 4BCPA 3NEWA 3ZRKA 4ZTQA 5HCZA 4IFGA 2BIYA 4JR3A 4XS2A 2BR1A 4D55A 5LVMA 3D83A 4IEBA 4RLKA 3E3PA 3RHXA 1MP8A 3AT2A 2R3LA 2WNTA 4V04A 4CZYB 1IG1A 4DBNA 3DBQA 4YZBA 2QOHA 3P0MA 4XG2A 4IWPA 1Q99A 1IAJA 1JSVA 2VRXA 2WPAA 4RWKA 3BYOA 3EQPA 4BWKA 3I5ZA 2X8IA 4O86A 1ZARA 3NSZA 5E1SA 3E8CA 4ZSEA 5BMSA 4LRKA 4YJUA 4YLKA 2C6OA 4I20A 2IO6A 4GJ3A 4CRSA 5FDXA 4EK3A 4I3ZA 5DMZA 3RKBA 3POOA 3TJDA 4MYGA 1SNXA 5EOBA 4CMOA 1ZRZA 3MWUA 4RVMA 4O0VA 2C3IB 4LG4A 1V0PA 2EWAA 5EHLA 3C4CA 1KWPA 4LMUA 4GSBA 4EH7A 5JGDA 2BRNA 5CENA 4C4HA 5DH3A 3NNXA 4LQMA 2QVSE 4JRNA 4TYEA 3EQFA 1OI9A 5AR3A 4JG8A 4AGDA 5A54A 3ZONA 5AR2A 4YO4A 4Q2AA 4K1BA 4RIWB 4BTJA 2XBJA 4O22A 4AGUA 5ETCA 1FINA 4C8BA 1OIRA 4F9AA 1YWRA 4FV6A 5LVPA 2YABA 3DJ6A 3QZGA 2R3PA 1NXKA 5AR8A 4AX8A 4BN1A 5T68A 2HWPA 4WNPA 5AADA 4JRVA 4BDKA 3DS6A 5JFSA 3QTWA 1YOMA 2XNNA 5LVOA 4UN0C 4FODA 3VUGA 4FKOA 4EH6A 4K2RA 3D5VA 3ZU7A 5A9UA 2QOKA 2YM5A 2ZV7A 3ETAA 3QGWA 5J95A 4BI0A 3T8OA 2F7ZE 4PX6A 4FKWA 3HNGA 4DGNA 2ITZA 4QMXA 4TL0A 4M3QA 4L52A 3FZOA 3FLSA 2R0UA 5AX9A 4ZZOA 4QPMA 4NFMA 4YMJA 2ZV8A 1H27A 4FZFB 3CS9A 4E6AA 2OLCA 3BCEA 3JXWA 2ONLA 5EK7A 5BVNA 4YPDA 4CKIA 4FTJA 5ANKA 1J1BA 1M52A 3NUXA 4FGBA 5CNOA 3ULIA 4CCBA 4ZSLA 4FIGA 4MD8E 4TNDA 5L2QA 3W55A 4AP7A 4JDIA 5KO1A 5L2IA 3LMIA 2UZBA 1V0OA 3QXPA 3RGFA 5BX0A 1YRPA 4QMSA 4J97A 4M12A 5ICPA 4FTNA 3TKIA 3FLWA 5IA3A 2VTIA 3PJ3A 5CQUA 5DPVA 4RZVA 4KS8A 4EQUA 2WTIA 4IC8A 3EFKA 3BE9A 3UO4A 2CNQA 4MNFA 4PWNA 4YBJA 3R1QA 3DXPA 4FZ7A 4USDA 4EKKA 1YQJA 4HOKA 2XEZA 4PL4A 2VX1A 1WMKA 3GNIB 2C5NA 4F9WA 4OT5A 3R8LA 3QBNA 4L01A 3DGKA 5K0KA 4XG4A 5CAOA 3V8SA 3UMXA 3UZRA 3BU6A 1NVRA 2W5BA 3R7OA 4GW8A 3FLZA 3MSSA 3EQHA 3ODYX 5G1XA 3ALNA 4D2VA 4DF3A 3VS0A 3DCVA 1XQZA 4YU2A 2V22A 3UPZA 4KIPA 3S1HA 3WZUA 5I0BA 4GIHA 4PL3A 5CNNA 1P14A 5AP3A 3OCTA 1J7IA 2CNUA 1QPEA 3TV6A 1W84A 1FPUA 2OFUA 3JS2A 4ZLZA 4W8EA 4RIXA 1X8BA 2QCSA 3RPRA 5CSPA 2YJSA 5AUVA 3OBGA 3PPKA 4HNFA 4R78A 2OZAA 2OH0E 2XCHA 4AW2A 1KSWA 3I79A 2PE0A 4DEEA 5K9IA 3N4VA 1WFCA 3I0QA 4BTFA 2ETRA 2R3HA 4FSWA 3HMPA 3Q2MA 2Z7RA 2GDOA 3MFTA 3V8WA 5M53A 4FSRA 4AT4A 4H39A 4UEUA 4IAIA 4ALWA 5HVKA 4O91A 2HENA 2C6TA 2VWXA 3DFAA 3F5UA 3I4BA 4LOOA 1MRYA 3A2CA 3DQWA 3DB6A 3DNEA 3R7GA 1HCLA 1KE7A 4X21A 4AT3A 2PK9A 2JDOA 3NCZA 4RWLA 5A6OA 4P2KA 5E8VA 3VUHA 3WYYA 2VN9A 4M69B 4EBVA 5CEQA 3UOJA 2J0JA 2F9GA 1IASA 4I22A 3FBVA 4D4RA 3REPA 5IUHA 2ITVA 4QMZA 2OKRA 4KD1A 4LM5A 3PLAE 2OXDA 4OBOA 3P5KA 5M57A 1UWHA 4GYGA 3VBYA 1FMOE 2C1BA 3ZLWA 3DJ7A 3MH1A 4JVGA 3QA8A 4F7JA 3FZ1A 1JQHA 1Q41A 4M67A 4P5ZA 5EH0A 2XRWA 4CFMA 3Q9WA 3LFCA 2GS2A 4FR4A 2C5OA 2EVAA 4C33A 3LQ3A 3EHAA 2OF2A 5AM7A 2J0IA 3Q3BA 4CKJA 4X6QC 2XA4A 4EK8A 5HE3A 3U54A 4XV2A 3GU8A 1KE6A 3UPXA 1Q62A 3QRTA 4NCTC 4ZEGA 4XMOA 4DFLA 2BROA 4HVHA 3KRRA 2YLFA 3NS9A 1A06A 3BEGA 4YHFA 3UQCA 3RZFA 4YJVA 1G8AA 3QX4A 4F1TA 4CG9A 2OJFE 3FPQA 4OLIA 1H00A 1KUTA 5HTIA 4FTKA 2UUEA 4BDCA 3QKKA 4IADA 4ZY5A 4HGSA 4CVAA 2PMIA 4DFYA 4RIWA 4HZRA 4RJ6A 5JEBA 3ZFXA 3ULZA 3PY1A 3KVWA 3BHTA 4KBAA 1GOLA 4DLIA 5GIOE 4FKSA 4FNXA 4MF1A 3F2RA 3ELJA 4AGCA 4L7FA 3O50A 3U55A 5C01A 5M4IA 2XKEA 4RX8A 3OEZA 4KBKA 4ENYA 5CEMA 3MPTA 2X2MA 2ZAZA 3KN5A 3QD3A 3G90X 4G16A 4J71A 4C58A 4F9CA 4O7RA 4RWIA 1MQBA 4OAVB 3KRWA 3A99A 2QO9A 4ACDA 1FOTA 2PVYA 4LV8A 3ZM4A 4B7TA 5HVJA 3NLBA 4MCVA 2Z7LA 4JAIA 2BAKA 4WG4A 2PL0A 2W5HA 2J2IB 4IE9A 4XOZA 4XUFA 3VUMA 3KCFA 2YIYA 4FEXA 5DR6A 4IX6A 3QCXA 2PZPA 2QHMA 2R3GA 4JDKA 5J8IA 4FG8A 3VN9A 2ZDTA 4R3CA 3WIKA 1OIYA 1Q3DA 5GJGA 4APPA 5IQEA 2PVKA 3MYGA 3UVPA 3CJFA 3M2WA 2WU7A 3JUHA 4FT5A 4XH6A 4ANMA 2W1GA 3ZO4A 4BBFA 1PMUA 2GTMA 3MIYA 3NNWA 3KF7A 2JKKA 4PTCA 4IB5A 5HBJA 2EB2A 1OB3A 3FMNA 4K33A 3UE4A 4IX3A 3PFQA 3ZS5A 2P33A 2YM7A 3O51A 3HECA 1W0XC 3SDJA 3W8LA 4MQ1A 2WQBA 4BIDA 5A46A 4LYNA 3RMFA 3D5UA 4YZNA 1GAGA 5EI8A 3FEGA 3AXWA 3ANRA 1EH4A 3CLYA 1ZMVA 5ANGA 2B9FA 4D28A 1YWNA 4YSMA 4PY1A 1PMNA 1K3AA 2YJRA 3TTIA 3KCKA 3VUIA 4CNHA 2YDKA 4I4FA 3LCSA 2CKPA 4F08A 5JKGA 4QMYA 2ITOA 2Z2WA 4LRJA 2C0IA 2GHGA 4ITJA 3OWJA 3D14A 3RPOA 1F3MC 4ZJIA 4B8MA 5H2UA 3VWAA 3RAWA 4FEQA 3K5UA 3VF8A 4O0YA 2YACA 2W99B 4FK6A 1H07A 3P7CA 2RFDA 4QP9A 3VC4A 5J1WA 4FBXA 2UW8A 2SRCA 4U45A 4AZFA 1FBNA 3QZHA 3PDTA 3GQLA 3HLLA 5AV2A 2V0DA 4MNEB 4R1YA 3ZHPC 4WNOA 4YTHA 2GHLA 4JR7A 4AN3A 1ZOEA 3ZO3A 2QR8A 4HVIA 4G3DA 4AW5A 3W16A 1WAKA 3DDPA 4BF2A 5CU6A 4UMPA 1JLUE 4CRLA 5M4UA 2OK1A 2QOQA 2WGJA 2ONLC 3AC1A 3EIDA 2GFCA 3EQCA 3Q96A 1KE8A 3QWKA 2BZHB 4U44A 4EK4A 4U3YA 2CGUA 2DUVA 5C8NA 2CLQA 2IW9A 5M4CA 5CTPA 2JIVA 2JITA 3FE3A 1Y6AA 1Q8UA 2WXVA 3R83A 1GIHA 4BCGA 4C4EA 3B2TA 5M06A 2UZWE 3V8TA 2XB7A 3L9LA 2BUJA 3U51A 4CFUA 5J9ZA 3GCQA 4JX7A 4TTHB 1FMKA 3MW1A 3OG7A 4S31A 1GY3A 3DAEA 4IXPA 2FVDA 5FM3A 1WCCA 2REIA 1QCFA 4IW0A 3GUBA 3DOGA 4HCVA 4WOVA 5JFXA 3FMKA 4BCKA 3IKAA 2VTQA 4C4IA 2I0HA 4FNZA 5IH4A 2BILB 2ERZE 3RM7A 4JQ8A 3V04A 3MS9A 1B39A 3L9PA 2ZVAA 4C59A 4CTBA 4U7ZA 3ZSGA 5CI7A 3UBDA 4PNIA 4GK4A 4H3QA 4XX9A 4BHNA 3LJ1A 5C26A 2ZYBA 4E26A 5CAVA 3HV3A 2HXQA 5KMMA 3GC9A 4FEWA 4FOCA 4D2PA 4QTEA 2AC5A 3UG2A 5F94A 5AEPA 3W8QA 1ZYJA 2P2IA 4YTIA 4ANBA 4Z7HA 2W1CA 3ORZA 4OTFA 5EM7A 5JN2A 3DJ5A 3PRIA 4E4XA 5EM8A 5TF9A 3LM0A 5CAPA 4O0XA 4NW6A 4ARKA 4FSMA 3QL8A 4HYHA 2BFXA 2W4JA 3DK7A 1H08A 5FM2A 3THBA 5CVHA 3RK9A 5L6WL 3NRMA 2YFXA 3F66A 4EHGA 4IVBA 2YAAA 4L3PA 5LMAA 4ENXA 2BTRA 2V7AA 4GJ2A 4ANSA 4J99A 1U59A 4IIRA 2IJMA 2VV9A 4GG7A 4ERKA 3MPMA 5EHOA 4IH8A 3RCDA 4DGGA 3OT3A 3GU4A 4LOPA 4A9UA 4AXAA 4UMRA 3OWKA 2OXXA 3EZRA 3M11A 1YXTA 2BRBA 2VO3A 3KXZA 2E9VA 4L8MA 5GZAA 3FHIA 2ZMCA 3MB6A 4IAAA 3QQHA 4O7NA 2WELA 4S32A 4M8TA 3PA3A 2HZNA 3WOWA 3FMLA 4EH8A 2XKDA 3QD2B 2BAJA 2HWOA 4BCJA 4V0GB 2XKCA 3PUPA 4FKQA 4ZOGA 3RNIA 2LGCA 3U87A 4IAKA 4BHZA 4CFVA 5HX6A 2J50A 4GH2A 4F7LA 3FL4A 3ORMA 4JIKA 4EKLA 3UODA 4LUDA 2HZIA 2I0YA 5DT3A 2OGVA 5E7RA 1R78A 3KRLA 4XBUA 4ASXA 4U97A 5EOLA 5GHVA 3BV2A 5IEYA 3PXRA 3ZCLA 4NYEA 3OEFX 1UKIA 5HI2A 4D4VA 2JEDA 3ID6C 4R6VA 1YDTE 4IVAA 4C62A 4IB1A 4F0FA 1CSNA 3EFJA 4IWDA 4LGDA 4OTIA 4CV9A 5A4QA 5I9ZA 3POZA 3F3TA 3TV4A 4DBXA 4QMPA 5A3XA 4CT2A 4O7VA 4ZAUA 1DM2A 4TRLA 3PP1A 3GQIA 4AA4A 3PE2A 3DZQA 3TUCA 3PJ1A 4L42A 2OJIA 5HZNA 4EEVA 1P2AA 2WTWA 3BRBA 3AGMA 2JFMA 2QOIA 2C5VA 2ZDUA 4BY9E 2ZV9A 4EZ7A 3R9DA 1OL7A 2OU7A 4AF3A 4U40A 3KXNA 3QTQA 3COMA 5A14A 3HGKA 3EQGA 1ZY5A 3L8PA 5FBNC 4X3FB 3EFWA 4MXZA 5D12A 4CLIA 5KMKA 2YM3A 4I23A 2JKMA 3FDNA 2J7TA 3TG1A 2QOBA 4A9YA 5KZIA 2QU5A 4RC4A 3OFMA 2EUFB 4XG8A 2VTRA 3SOAA 3E93A 3V6SA 4CSVA 3FZTA 4R7BA 1PHKA 3C51A 5IDNA 4YHJA 2BDFA 4GRBA 2HK5A 2OICA 3HDMA 2GTNA 4WIHA 4BZNA 2GCDA 1PYXA 1UNLA 3NPCA 4ACCA 3KRJA 4E6QA 2XF0A 3EZVA 3OC1A 5HG7A 1BYGA 1W82A 3DBDA 3QKMA 5FEDA 5AUWA 2BFYA 5M51A 2WEVA 5TKDA 5CF4A 4BBEA 1OMWA 1R0PA 5FBOA 3D2IA 4C3PA 2VO0A 1UKHA 4BGHA 4E4MA 2CGWA 4YNEA 2B9JA 4ZS0A 4AUAA 3R7YA 4ACMA 2F7EE 4RRVA 2C3KA 4EUTA 3ACKA 4CLJA 3TDWA 4RC3A 2HXLA 4N6ZA 4ASZA 1B6CB 3BGQA 4NEUA 2C3LA 5CEIA 3VBQA 4DFNA 3PZHA 2PVLA 3FSFA 1OL5A 3AC8A 3UG1A 3R7UA 4G6LA 5I4NA 3DBEA 2PTKA 2UW7A 3KY2A 3O7LB 4IDVA 3OP5A 4JBOA 3SRVA 3AD5A 2A2AA 3VW8A 4J53A 3FZRA 4H1MA 4Z55A 4L3LA 1R1WA 3OMVA 4TWPA 3JPVA 4LGHA 1O6YA 5H8BA 4FVPA 3FMDA 1JKSA 1Z57A 1Q8ZA 4IWQA 5I9UA 4EQCA 5CWZA 3H0YA 3KC3A 2FSMX 2WMXA 3LFDA 4QQTA 3EN7A 1QMZA 2XK9A 3D15A 3G5DA 4WA9A 4DHFA 4KIKA 3VS1A 3U9CA 2J9MA 4F6SA 3EN5A 3OHTA 4TWCA 3CPCA 3VS5A 2FB8A 4MKCA 5IZFA 2CLXA 1PMEA 4QMUA 4IWOA 4PPCA 5IF1A 1OITA 1OVEA 2W5AA 4QOXA 5CSXA 3QD0A 1AGWA 5M56A 3CY2A 3OT8A 4MAOA 3HP5A 1BI8A 2DYLA 3RWPA 4TWOA 4EJ7A 3HP2A 4C37A 3T9IA 3W2RA 3C13A 3PY3A 2QOCA 3KFAA 4QMQA 3A8XA 3E63A 3SQQA 2VZ6A 2C5XA 4GK3A 3QYZA 3DLSA 5ANOA 3UOHA 3VHEA 4FEUA 4MXOA 3VRZA 3P7AA 3TJCA 1P5EA 3ROYA 4F9YA 1YVJA 1XO2B 2GNIA 3VW6A 2CNVA 4C3FA 3KGAA 4WG5A 3R9OA 1CM8A 2QOOA 2Y4IC 4YUQA 4AFJA 3UQFA 5IPJA 3ITZA 4O7LA 5HIDA 3COHA 4OGRA 3RCJA 2XNPA 3MGYA 2WB8A 3PA5A 2FUMA 4FUXA 3K5VA 3PVUA 4TKSA 5LVLA 4ZZMA 3FI2A 3VJOA 3PLSA 3GU6A 4GT4A 2AUHA 4AA5A 4ACGA 4MWIA 5IQAA 5KX8A 2C47A 5AA8A 2XIZA 4W4XA 4FSTA 3QTIA 4ZJJA 4BCQA 3Q5ZA 5LARA 4O0WA 4P5QA 4AG8A 4L3JA 4BDFA 4WD5A 5IQBA 3PIYA 5KNJA 3KK9A 3UZPA 4LL0A 5AUTA 3MJ2A 2G1TA 3QCQA 4EOQA 1XJDA 1K9AA 3O17A 3QKLA 4HVDA 5I9XA 2QR7A 1U54B 3ATSA 3QLGA 1O9UA 4XEYA 3ZYAA 5HIEA 2I1MA 5CZHA 4A4XA 5L2SA 1OPJA 3R1SA 3A7IA 2RGPA 3R6XA 4L7SA 3G9NA 4TZRA 5EYMA 1PXLA 3HV7A 4WBOA 3U4WA 3CTQA 2EB3A 2ITTA 2WMAA 3ORPA 4JI9A 4RIYB 4ZLYA 1H25A 2R3RA 2RFEA 4LL5A 2G2HA 2OSCA 3NAXA 4GL9A 3OVVA 2FH9A 3B8RA 4G5PA 4NIFA 5DE2A 4FNWA 5AR5A 5HNIX 2WQNA 3ORTA 3TV7A 1JAMA 1JSTA 5I3OA 3ZUUA 3LHJA 4Z3VA 4ANLA 2UV2A 4EOKA 5IQIA 5L4QA 3BGZA 5E8YA 2VO6A 5IH6A 4EH4A 3ZFMA 3FLQA 5H8GA 3QF9A 4NTTA 2BIKB 2HW7A 3Q53A 1XH4A 5L6OA 5ETFA 2JKQA 3TL8A 4M14A 3D7TB 3IW8A 2PYWA 2DWBA 5E4HA 4RMZA 3U9NA 4GKIA 4J52A 4YPSA 4K11A 4IANA 1Q8TA 3SAYA 3FMMA 3DNDA 4FTCA 1M14A 2IN6A 2VTMA 3D94A 3TN8A 2YAKA 3Q9YA 1U46A 2P55A 3AMBA 2CHLA 3F88A 3O8TA 5E91A 2X1NA 1R39A 2JAVA 3ZC5A 3L8SA 3VBWA 5KKRB 2WQMA 5EYKA 1XH6A 3ZEPA 4QQCA 4BVUA 4M68A 2GSFA 3EJ1A 2C30A 2PVJA 3QAME 2R3MA 1YXUA 2EU9A 4FIIA 2R3QA 4RSSA 3VS2A 2BHEA 5BYYA 3HAVA 3OTVA 4KWPA 3NYNA 2CN5A 4JIAA 2Y6OA 2OFVA 3UVRA 5FRIA 3F3ZA 2RL5A 2G01A 3I1AA 1WBTA 5C03A 5EW9A 4KB8A 3KXXA 2Z8CA 3BLQA 3S95A 3WYXA 2C6MA 2QO7A 4IVCA 4HNIA 3E5AA 4DYMA 3HMOA 3T9TA 2IZRA 2OJ9A 1OM1A 4XYFA 1KE9A 4QQJA 2X81A 4C3RA 3V5QA 2WOUA 2WTKC 4X0MA 3BKBA 4M7IA 1LEWA 3PYYA 3RP9A 3ZM9A 2B55A 4M15A 1ZZ2A 4KIQA 3R7IA 4F1OA 3Q5IA 4FA2A 5AMNA 4CZTA 3MI9A 5LJJA 2YCRA 3OD6X 4QP4A 4C7TA 3P9JA 1IA9A 1Q24A 1L3RE 2OJJA 3MPAA 4C4GA 2P3GX 5KBRA 3JY9A 4E6CA 4O21A 4FG7A 2HOGA 4L67A 3OY1A 3E64A 2J5FA 3HRCA 3VS6A 4A06A 3NVKI 1XH8A 5K5NA 4FSUA 2W9ZB 4JDJA 4O84A 1J91A 3QC4A 5IH5A 3LXPA 1PXIA 4I6BA 2UW4A 4MX9A 3E7OA 2HELA 5AP5A 3M42A 3SXFA 4QNYA 4QP3A 3DV3A 3QXOA 5EI2A 2ZB0A 2ZB1A 3V5TA 1H1WA 4ONAA 4UWYA 4JT3A 4Q9SA 4XJ0A 1BL6A 5EM6A 3A7FA 5M55A 2PMNX 4QMWA 1NVQA 4YHTA 4C0TA 3EWHA 3G6GA 4CZUA 1XHAA 2BTSA 5JSMA 3LLAA 4JXFA 3MH2A 3QC9A 4MBIA 1OPLA 3V5LA 3I6WA 1Y91A 1YOJA 3OOMA 4FKTA 3OROA 4FZ6A 4S34A 4I5CA 3BWJA 3WF5A 3KA0A 2XNEA 3SVVA 3QFVA 3UNZA 3EH9A 4QP1A 3GCSA 2YM6A 4FSQA 3KEXA 4EHEA 1GIIA 1H1PA 4CMTA 2QLQA 4RJ7A 1WZYA 3FWQA 5EM5A 5A6NA 3FXXA 4ZSAA 3CE3A 5H9BA 5LMBA 2W96B 2WHBA 4N57A 2NO3A 5CZIA 5EYCA 3N4UA 4YNOA 4GK2A 3DB8A 4BI2A 3HL7A 3GT8A 3LZBA 3MFUA 2HYYA 3H9RA 3EN9A 5H3QA 1VR2A 3OY3A 2GS6A 3LXLA 4QMTA 2X8EA 4ZTHA 1YI4A 2QODA 3SG8A 1UNHA 3I0OA 3Q6UA 3GBZA 5HORA 2PZRA 5HO8A 3UO6A 3PVBA 4IZAA 4P7EA 3LFAA 2X0GA 3A7HA 3DLZA 4HCTA 5TE0A 5J1VA 3GCVA 2QC6A 3RM6A 4C02A 4YJTA 2ITUA 2P4IA 4E6DA 4NJ3A 5IUGA 3AT4A 4F9BA 1LEZA 1BX6A 3HKOA 5JMSA 3FUPA 3VJNA 4CFXA 3NZ0A 4RIYA 1TVOA 3CKXA 1BI7A 4LV5A 4R8QA 3V5PA 4FNYA 4AOJA 3KXGA 4K18A 2OI4X 3SKCA 2NNWB 3C4ZA 4O6EA 3BBTB 2V7OA 1UWJA 3TNHA 4IJPA 4DGOA 2BKKA 1NW1A 3UO5A 3KK8A 2R5TA 2PZ5A 3UJGA 1Q61A 2HY81 3FC2A 1QPCA 3R02A 3ZBXA 4Z16A 2VWZA 1I44A 2C0TA 3BX5A 4F99A 1TQIA 3F2AA 3MJ1A 4FIHA 3CSVA 3LFFA 3D7TA 3OCGA 3DKOA 1Q3WA 3E92A 4LI5A 4DH5A 5E90A 1YHSA 2UW9A 3ENMA 4RFZA 3TACA 4DH1A 4BWPA 1XR1A 4KINA 2R7BA 5EFQA 2XNOA 4F64A 1W98A 4M13A 2GQRA 4JL9A 1LUFA 4S30A 4WUAA 3CTJA 3Q32A 4NM7A 3GB2A 4RA4A 1OUYA 3NUNA 4TT7A 3TTJA 1STCE 4IQ6A 4IX5A 4QTCA 1ZYDA 5C8MA 4G3EA 3PSDA 4IZ7A 3E7VA 4H1JA 5EW8A 2GFSA 2VGPA 2XBAA 3QUPA 3V51A 5K4JA 4C38A 4HYSA 3PWYA 5HU9A 3IOKA 2Z7QA 3EYHA 5B2LA 2C68A 5AIRA 1T46A 3CQEA 2R7IA 4HGLA 4QT1A 4I24A 5D41A 1P4OA 2ITYA 3RWQA 5HG9A 4PPBA 4IX4A 4KSPA 3GFWA 5ETIA 2I6LA 2YN8A 3A4OX 3COIA 2EXMA 3MH0A 3OBJA 4KABA 4RVTA 1JKLA 5DR2A 3R28A 2BMCA 5F20A 3HZTA 5EG3A 4Y85A 1OKZA 4NL0A 2NRYA 2W05A 1KV2A 5LCJA 3Q4TA 1DI8A 4IB0A 2XYUA 1RJBA 4R7HA 4DGMA 4F6UA 2IVVA 2X2KA 1M17A 2PMOX 5AP6A 1WBPA 5HNGA 2JLDA 2KULA 2WFYA 4O27B 5HOAA 3NAYA 3C0HA 3MA6A 4IAZA 3MY0A 3QTZA 3D5XA 5IA0A 2ZJWA 1ZZLA 4NSTA 2ACXA 2VGOA 3WZEA 3BHVA 3GI3A 1XKKA 4Y5HA 3PJ8A 1Q8YA 5I9WA 5M07A 3EFLA 4BDBA 2Y7JA 4I21A 3IK3A 4QD6A 4ZMEA 1DS5A 1Z9XA 2IZUA 2I0EA 1L8TA 2A27A 5EQYA 2ESMA 2XM9A 3TIYA 3S0OA 5EKOA 1VYWA 4PP9A 4QP2A 3QQUA 4PTEA 4QMMA 1CKPA 5JQ5A 3RK5A 2HCKA 5DFPA 5EDPA 5EQEA 1OUKA 5AR4A 3UYSA 2F2UA 4I0SA 4A9SA 3PWDA 4DG0E 4W4WA 1URCA 2UZLA 2PULA 3DAKA 2VTJA 4EOMA 3H4JA 3MV5A 4AOIA 3L9MA 3R21A 3W10A 2W4KA 3AMAA 3KN6A 3R00A 4W9XA 1H8FA 5D10A 3CPBA 4QMVA 1RQQA 2ZM4A 4F0IA 4OTRA 4AZSA 2UVYA 1LP4A 5IQFA 3DTWA 3JYAA 2PE2A 4D9UA 4HGTA 3W2PA 4FYOA 2WQEA 5IEXA 5HBHA 4GU9A 2ZM1A 2OF4A 3CY3A 3RI1A 3BLHA 4I94A 4YLJA 5IA2A 2UZVA 2Z7SA 4TYIA 4X2FA 3R7EA 3SA0A 4FIJA 3NX8A 3KQ7A 4OTHA 1JPAA 4QYFA 2ITXA 4GKHA 2YITA 1H01A 3QQKA 2BHHA 3UYTA 2NP8A 3KMMA 5BVKA 4CYJA 2F7XE 4XBRA 4D58A 2Q0BA 4MBJA 3F9NA 1JNKA 3IDPA 4JAJA 1VZOA 4E5WA 4WNKA 5AV3A 2VTAA 1GNGA 5JRSA 4G9CA 3LCTA 3NUUA 3LFQA 1ZAOA 5GZ9A 4FSZA 3KREA 3TZ8A 4USFA 4Z7GA 2JDVA 2FYSA 1H4LA 4K77A 4WG3A 2BRMA 4ZP5A 3ROCA 4FKRA 5DN3A 4O6LA 4KKGA 3VS7A 2PWLA 3PPZA 3IS5A 3UTOA 3UNKA 4DC2A 4F65A 4O7YA 4WKQA 4B9DA 1SMHA 3FV8A 5E8SA 4KRDA 1ZYSA 2XH5A 4Y72A 3IQ7A 3TNWA 3TT0A 2CKQA 2XNMA 4ALVA 3PVWA 1XBCA 5IA1A 2OWBA 3EYGA 4L46A 4TYJA 3Q52A 3QUEA 1WBNA 2XZSA 4RJ4A 3VQHA 4PTGA 5HCXA 3PXFA 3OS3A 1IA8A 3GU5A 3FMJA 3NW6A 4O0SA 4WO5A 3W33A 5IQGA 3IECA 3T3UA 2OW3A 4XLVA 5HO7A 3BWFA 2IG7A 3G15A 1J1CA 3UIXA 3LIJA 2XKFA 3V01A 4HVSA 2X4FA 5K4IA 3I81A 5HTCA 4XG6A 4ZTNA 4DITA 3AC2A 4BDIA 5C4KA 1S9JA 4UWCA 1VYZA 2W7XA 3R9RA 2B9IA 4OTPA 4DEIA 3MY5A 4ZY6A 5TO8A 5DR9A 2XNBA 3NYOA 2RKUA 1IAHA 4ORKA 3ACJA 4IM3A 3ZBFA 2X6DA 5DT4A 2BAQA 2JD5A 4M69A 4MVFA 3QRIA 1OKYA 2B1PA 4E4LA 3R2YA 3DKFA 2VTSA 5JT2A 2C1AA 5BUJA 2GNGA 4Y46A 5HD4A 4I5PA 4II5A 3U8WA 1ZXEA 3AOXA 2W17A 5DEYA 3TNIA 3ZSIA 2QG7A 5BVEA 3WBLA 5JQ8A 1ZOGA 1G5SA 3HYHA 2GNLA 3QCYA 5HBEA 3VO3A 3E88A 4I92A 4RX5A 5GIPE 1DI9A 1PXNA 2X9EA 5DRBA 5H8EA 3ERKA 5KMJA 5CAUA 2PUNA 3DY7A 1WVWA 3N4TA 2R3KA 4O82A 3DBFA 3W18A 3FZPA 5GZ8A 5IISA 3LFEA 4RLLA 4HYIA 2Q0NA 4GFGA 3P78A 2V62A 4GMYA 4ITHA 3LLTA 4DFBA 5DNRA 3OWLA 1WVYA 4MXYA 1OIQA 1OL6A 1Q8WA 3CC6A 2W06A 4BIEA 2PVHA 4RWJA 4EYJA 3NNVA 5M44A 4PMSA 5AWMA 4F7SA 1JVPP 2WQOA 3UMWA 2HIWA 2PVFA 4L45A 5ITAA 4UB7A 1P4FA 1VJYA 4FOBA 4D5HA 2PVRA 5KBQA 5JFVA 4FTRA 4K8AA 2XCKA 4P90A 4C57A 2O65A 4G3CA 2YCFA 3UP7A 4EONA 4EOJA 4FV5A 4I5HA 5IU2A 3ZO1A 4JBPA 3FY0A 2IPXA 1WBSA 2CGVA 4NKSA 1ND4A 2UW5A 4U8ZA 4AOTA 1H1SA 4FG9A 2ITQA 4PF4A 2QLUA 3RALA 3CP9A 4PDSA 2YEXA 4Y8DA 3FYKX 1SVHA 3C4XA 5F95A 4BTMA 1NT2A 2YM8A 3FAAA 3R0TA 4XNEA 2VAGA 3BELA 3K2LA 5D11A 5AJQA 4DEHA 1XH7A 5J9YA 3ET7A 2PVNA 4TWNA 2X7FA 4TYHB 3QRJA 5F4NA 1FGKA 3R9HA 2C5YA 4BCOA 2VNYA 3UGCA 5J87A 5BPYA 3JVSA 4OW8A 5G6VA 5HVYA 5LXMA 4L43A 1UU8A 3MTFA 4D4YA 2IVSA 4L6QA 4RFMA 4G31A 5HLPA 2BRGA 2ERKA 3K3IA 4BDDA 3I60A 2G9XA 1XH5A 3HUCA 3SLSA 3HV6A 4I93A 4J8MA 2VD5A 3FQHA 2WKMA 1WBOA 3L9NA 2E9UA 3DXQA 1MRUA 3P1AA 2WZJA 2VU3A 4RX7A 4BTKA 4YP8A 4QP7A 2XMYA 3DFCB 3OW3A 3RK7A 3VRYA 4USEA 3R63A 4JBVA 1NVSA 1BUHA 3D0EA 1OIUA 3DKCA 3PIZA 5C27A 3RZBA 3Q2JA 2OBJA 4IAYA 2W1ZA 4NFNA 2Y6MA 4I6HA 3VVHA 3IOPA 3EQDA 5L2TA 2OG8A 3E8DA 5GINE 2C69A 1XBAA 3FMEA 4FIFA 3Q4CA 4YJNA 2VUWA 5HCYA 3PPJA 5J5TA 2XS0A 2QU6A 3QHWA 4KKEA 3MVHA 4FE2A 3NNUA 4DH8A 2CSNA 4FV3A 4JQEA 4PQNA 4L44A 3KULB 3F5PA 3TZ7A 2R3IA 3QU0A 5FXQA 3BQCA 3MDYA 3IW4A 2X39A 3KXMA 3MB7A 4MBLA 4MNEA 3W32A 4APCA 4DEDA 5E8TA 2JGZA 5JFWA 1PKGA 2X7OA 2CGXA 1RE8A 2JIIA 5HICA 3AG9A 4PDPA 2FSTX 4RJ5A 4YZCA 4E5BA 1JKTA 4U80A 4NUSA 4B4LA 4CFWA 3LE6A 4O7TA 1GZNA 2O5KA 4PUZA 2VTTA 5CSHA 2OIQA 3O7LD 5IDPA 4E7WA 4Q5HA 5DA3A 4FZDB 2O64A 4PRJA 4RA5A 3ZZEA 4AT5A 5A4CA 4HCUA 4D2SA 3QWJA 3NR9A 3DU8A 5AP7A 3R73A 4J8NA 3FY2A 3RPYA 2WOTA 5KMOA 3PZEA 3Q04A 1R0EA 2VX0A 2ZV2A 4MD9E 3V5JA 1TQMA 3N51A 5AFVA 3I7CA 3UNJA 3ZLYA 4UWBA 4XV3A 5JH6A 3ALOA 4RQKA 4EWHA 4PP7A 2P2HA 4RG0A 2KTYA 2X9FA 3FKNA 5HU3A 4HJOA 3MIAA 4D9TA 4RPVA 2J0LA 5LWNA 3EKNA 4LUEA 1K2PA 2I7QA 4MTAA 4QNAA 5LQFA 4BBMA 4C4JA 1SVEA 4CXAA 4CD0A 1SZMA 4FT0A 2AYPA 4QPAA 3LMGA 2VWIA 3NGAA 4AZTA 1UU3A 4HGEA 2UVXA 3NUPA 3PJ2A 4MXCA 3UIUA 2BZKB 3KMWA 3MH3A 2UZDA 3OUKA 3PP0A 4G6NA 1YKRA 4U43A 4B6LA 1BKXA 4I0TA 4ANNA 4DGLC 5CVFA 4E5AX 5AUUA 4ZY4A 3MVLA 2IWIA 5LMKA 1T45A 3F3WA 3QQLA 3BE2A 4BYIA 3QALE 2GMXA 4DCAA 5HE0A 5BQ0A 5B7VA 4DG2E 4Y5QA 4EOPA 2B54A 3QTXA 5CXZA 4G3FA 3ZLSA 3AC5A 4X2KA 4GEOA 4BDAA 3EQBA 1E1XA 4U41A 4XOYA 1Y8GA 3KL8A 4L68A 2F57A 2WMUA 3QLFA 5AV1A 3T3VA 3QRUA 1MRVA 2R3OA 2C6IA 3C4EA 2QONA 4C61A 4TYGA 1UNGA 4AN9A 3GOPA 3C7QA 3TXOA 3AGLA 2LAVA 4D0WA 2ZM3A 1REJA 5CEPA 1H1QA 1PXKA 4PDYA 5DYJA 4W4VA 4E1ZA 1ZY4A 3DAJA 3HA6A 1XWSA 3OXIA 3Q9ZA 4BDGA 5AAGA 1A9UA 2WTCA 3COKA 1M7NA 4OBQA 4UBAA 5HKMA 4I0RA 4EOLA 4PL5A 4E8AA 1M2PA 4FL1A 2FO0A 2C0OA 2YISA 4QQ5A 5IMXA 3AQVA 4OTWA 4EORA 4Q9ZA 2J51A 1FGIA 4EWQA 4O7ZA 3F5XA 4V0GA 5LWMA 3O71A 1JBPE 3O23A 3PA4A 4F7NA 3VBVA 3ZC6A 2RIOA 3FI8A 3C5IA 5GNKA 3PIXA 4GT3A 2V55A 5B2KA 5HQ0A 3LKMA 4D1SA 3MBLA 3G9LX 4BB4A 3R7VA 5BVOA 4B99A 3RPSA 2BCJA 5CF6A 3TM0A 4FT7A 3CXWA 5HO6A 3WILA 5ANDA 4MHAA 3HA8A 2E9PA 4QYHA 4IACA 3FLYA 2BPMA 4W4YA 4EZ5A 2W1FA 5D7VA 3R22A 4P4CA 5JGBA 4CV8A 3TDVA 4RT7A 1LPUA 4XRLA 4YC6A 3EMGA 4J7BA 4FIEA 4MK0A 5KHWA 2GPHA 3AD6A 4CT1A 5FP5A 2BDJA 4AACA 4D4SA 4IZ5A 4F70A 3TNQB 3NUYA 4IJ9A 4GT5A 1URWA 2GNFA 3WIGA 4BGGA 5AA9A 4MWHA 4C34A 4X3FA 3BHYA 1PXOA 4WRGA 4E3CA 4YR8A 3WI6A 3ZLXA 5IMEA 3I6UA 3NW7A 5HG8A 4NTSA 2XRUA 3R30A 4O38A 4JQ7A 4K6ZA 3S4QA 5CSWA 3WZDA 5BNJA 4NCTA 2XJ2A 5HX8A 2YIXA 5C4LA 3L8VA 2HW6A 2VTNA 4FSNA 4WBBB 5K3YA 4BKZA 2B4SB 3V6RA 1H0VA 5AR7A 5CAQA 3G33A 4K9YA 4U5JA 2OXYA 3PE1A 4FTOA 4LRMA 1ZOHA 2OZAB 4N6YA 5AAFA 4FV2A 4X2JA 1SNUA 3O2MA 2R2PA 4FX3A 4NKAA 4DEGA 3TI1A 3ZMMA 3BPRA 3GOKA 3NUAA 2VWVA 4QP6A 4EK5A 1QPDA 3R2BA 4L00A 4O0UA 4AS0A 3QQJA 4QMOA 3JY0A 4J96A 5CY3A 3WF6A 1KV1A 4UV0A 2ZOQA 1Z5MA 2IZTA 4UALA 3LW0A 4DG3E 5CS6A 2O8YA 3A60A 4X3JA 4XG9A 4NU1A 3RVGA 5FTOA 4FGRA 3FXZA 1OL2A 3OWPA 3H9OA 3A4PA 4O81A 4MD7E 2UW6A 2O0UA 3GC8A 4O2PA 4GU6A 3ZOSA 3OOGA 2C6KA 4F63A 4XV9A 3VAPA 2H6DA 3UQGA 3SV0A 5HE2A 5FXSA 3WF9A 4H58A 5T6KA 3JR1A 4ALUA 2XEYA 3CGFA 4FUYA 4R1VA 3IDBA 4L9IA 4ZK5A 1F0QA 4BI1A 4CMUA 4O7SA 2F2CB 3GCUA 3OTUA 4BCMA 4OBPA 5AX3A 4D2TA 5IA5A 2QOFA 3VHKA 4C36A 1SM2A 3L1SA 5AP0A 4GFOA 2YZLA 5BYLA 4F09A 4CG8A 3UC3A 3EN6A 1IR3A 4U6RA 2OIBA 3AD4A 1RDQE 3BU5A 4GUEA 3VUDA 5JRQA 3R8MA 3ZFYA 5EYDA 4PMPA 1NY3A 4C2WA 3R8ZA 4YZ9A 3SOCA 3H9FA 2XVDA 4ZZNA 2BDWA 5BVWA 4ANQA 5HNBA 3EB0A 2VWYA 4UXLA 3BZ3A 1DAWA 5D9HA 3VULA 2R3JA 4PDOA 1PW2A 4FKPA 4I6FA 1ZMUA 4G34A 5L2WA 5ACBC 3ZH8A 3NCGA 4IC7A 2F4JA 4TPTA 1E9HA 2ETMA 3ZUVA 2R3FA 1BMKA 3F3UA 3SX9A 2PVMA 4Y83A 1H0WA 3R01A 2QKRA 4J1RA 3GC7A 5AIKA 3EQIA 5CVGA 1H26A 3TEIA 3PXZA 1GJOA 5KUPA 3GP0A 4EL9A 3MESA 1G3NA 3QD4A 3A8WA 3BHHA 4CFNA 3TKHA 4N0SA 2WTJA 1MQ4A 2HY0A 4UXQA 5LCKA 2PUIA 5ANIA 4NT4A 3IW5A 4MF0A 1HOWA 3WE4A 4AW1A 3RPVA 4U3ZA 4KA3A 2CMWA 3UVQA 3UP2A 1QPJA 1ZYCA 3HEGA 3EQRA 3QTSA 2VWBA 1OBGA 4UMQA 3HAMA 4GG5A 4FTUA 2GQGA 4NM0A 1CTPE 2J0KA 3LM5A 4ASEA 5DT0A 2G15A 2NRUA 2QOLA 3HMNA 4Z9LA 4EOOA 2QG5A 3R1YA 4G9RA 3P7BA 3RAKA 5I9VA 3NMUF 1PRYA 3PXKA 4V01A 5AV0A 1U54A 3HUBA 5JK3A 4ITIA 5DBXA 3RBWA 2VWUA 3W2QA 3G2FA 3PXQA 4YO6A 3KU2A 2OJGA 4XHKB 3BBWA 4RQVA 5KHXA 5L3AA 3DQXA 4JNWA 5DEWA 1CDKA 3C4FA 4DEAA 5BUIA 3G0EA 2B7AA 2EXEA 4DFUA 2AC3A 5LMKC 4GUBA 5DOSA 5ACKA 2GQSA 3EN4A 1Y57A 2CPKE 4AAAA 4RGJA 3F69A 5ANJA 3FXWA 1H24A 1R3CA 3ORKA 2W1DA 5I3RA 1V1KA 4C35A 5J7HA 3DT1A 4PMTA 4O1OA 5IUIA 4DH7A 4QYYA 4BDHA 4RJ3A 3VBXA 4WSQA 4ZLOA 3H0ZA 3QGYA 3S2PA 2I0VA 1ZMWA 4RVLA 3C5UA 5DWRA 5DGZA 4DINA 4OT6A 5BYZA 5AM6A 1G8SA 2DQ7X 1OZ1A 4FL3A 5ANEA 4O1PA 3S00A 3TKUA 3G0FA 4FEVA 3OF0A 4NWMA 4ZSJA 4FV7A 3FMHA 2W1EA 3F7WA 3KB7A 4CQEA 4IBMA 5FTGA 3F82A 2RG5A 3EOCA 3VBTA 2R0IA 4ID7A 5K5XA 3DDQA 4S2ZA 4FYNA 4H3PA 5A4TA 4JBQA 5E92A 3KKVA 2J6MA 4UY9A 3B2WA 4XG7A 3MA3A 2Z02A 2YDJA 3HVCA 5CU2A 3E8EA 4O0RA 5HE1A 1GZOA 1SYKA 3PG3A 2RF9A 4DN5A 3BEAA 2B0QA 1TKIA 1M2RA 2JC6A 4JX3A 2H9VA 4UMTA 5AP1A 2Y4IB 2QD9A 2W1IA 3QTUA 5AUZA 3R71A 4CGAA 3RTPA 4J95A 4K0YA 3DA6A 4OTQA 5M09A 5EW3A 4H36A 5C1QB 3F6XA 4OAUC 4DA5A 3QTRA 1APME 4FV9A 4V05A 1XH9A 1NA7A 1GZ8A 3NYVA 4I6QA 3PRFA 4AE6A 2CCIA 2CJMA 5E8XA 5J7BA 1J7UA 1W8CA 2A0CX 3NDMA 3BYUA 3CKWA 3PXYA 2VTOA 1CMKE 3LXNA 4MXAA 2YIQA 3U6IA 3P08A 4AE9A 3F3VA 1O6KA 4PPAA 5GJFA 3W1FA 2IVTA 4FK3A 2A19B 3QA0A 4YJQA 3PSBA 4X6RA 1PF8A 4QYGA 4TW9A 4GCJA 3M1SA 4BL1A 4YURA 4X3FC 3AT3A 1FVTA 3CGOA 4QRCA 3NVMB 1PXJA 1B38A 4FTIA 3SXSA 4EH5A 4R77A 2GHMA 2OZOA 4YJOA 4DCEA 4IZYA 3F61A 3W2OA 3H30A 2WMQA 4CYIA 4EYMA 3GFEA 2VNWA 4NK9A 3FLNC 2Z60A 2YM4A 3C0IA 4AZWA 4CEGA 4EHVA 4UZDA 4EOIA 3BLRA 2QNJA 5IA4A 3VNTA 1YXXA 2YZAA 2JDSA 4X2NA 4BFMA 1UU7A 3FSKA 3BYMA 3HMIA 4NH1A 5LVNA 1Q4LA 2XK7A 3W2SA 2UZNA 3CIKA 4FKLA 4F0GA 5A4LA 4B8LA 3RAIA 2UVZA 2VTPA 4G2FA 2RFSA 3MY1A 1GZKA 3JVRA 3LCDA 3LVPA 3UC4A 3ZO2A 1AQ1A 3K54A 5KMLA 4E73A 4FKIA 4ZTSA 3U6HA 5KMIA 5HG5A 3OUNB 4EOSA 4G17A 2XJ0A 5HHWA 4UYNA 3RJCA 4B0GA 5BVDA 4LGGA 3GCPA 5C9CA 3HRFA 5AV4A 5AP4A 3BHUA 4YBKA 2H8HA 3UOKA 4FTTA 2C3JA 4BCHA 4UYAA 5K0XA 4MXXA 2R4BA 5AP2A 4C4FA 4D2WA 1W7HA 2YCSA 4A4OA 3ODZX 5TOZA 4HVGA 5CU0A 2J5EA 4M97A 1YXSA 4FTQA 1UV5A 4E93A 5FXRA 1F5QA 2FSLX 4AZVA 4FV8A 4ZS4A 2WTKB 4H05A 3PG1A 5IG1A 4CFFA 2YA9A 4MQ2A 2JDRA 3SC1A 4BGQA 1WVXA 5CU4A 4YC3A 1O6LA 5IQDA 3EL7A 3HMMA 5CU3A 5FTQA 4YLLA 4D2RA 4DLJA 3KXHA 2R64A 5LOHA 5KZ0A 4HYUA 4AU8A 4I1ZA 2UZOA 4U0IA 4FKVA 4IM0A 2XK8A 1FVRA 2F49A 2PMLX 3E62A 4GS6A 1OECA 4KRCA 2A4LA 3RINA 4WSYA 3IW7A 5FP6A 1ZWSA 1QL6A 4FF8A 4AQCA 4QMNA 5L8KA 3TZMA 4XCUA 2JFLA 3IW6A 3LFSA 4I41A 3O96A 3ORIA 2FA2A 3FYJX 3LJ0A 2RFNA 2YCQA 3I5NA 3QYWA 2WMTA 3EL8A 3SW7A 3MFRA 3ZZWA 3RAHA 2O63A 4ANOA 1KOAA 3OW4A 3CTHA 5CYIA 2GNHA 3QCSA 5CEOA 5B0XA 3CCNA 3ZXTA 2H34A 3DK3A 2NPQA 2W1HA 5IEVA 3D2KA 5HTBA 1YDSE 4QTAA 4JLCA 2E9OA 2IZSA 3OCSA 2WMRA 3DKGA 5EDQA 3ATTA 4X7QA 1YOLA 2A1AB 4UMUA 4KNBA 3R9NA 5L8JA 3ZUTA 5CALA 3ORNA 4KBCA 5F9EA 4QO9A 2VO7A 5TT7A 3MFSA 3P86A 2PSQA 3ZRLA 3GC0A 5FQDC 2YHVA 1I09A 2GNJA 2YLEA 4U9AA 3SXRA 4BC6A 2QKWB 1W83A 4FTMA 5TR6A 4YSJA 3AMYA 1JOWB 2YDIA 3Q4UA 5HESA 2DS1A 3TWJA 4D0XA 1Q5KA 3FQSA 3QRKA 4QMLA 5HD7A 3R8UA 3U4UA 3GU7A 1PXMA 1Q97A 4OTGA 2ITNA 1YDRE 5FLFA 4BZOA 4WHZA 4EHZA 3QHRA 2J0MB 2XK3A 4QP8A 4YJRA 4EBWA 3TUDA 2QURA 4FICA 2BRHA 4Y95A 2XP2A 3DTCA 3H10A 4HPUE 3SRVB 2C6EA 2IW8A 4RVKA 1YI3A 2Y4PA 3SW4A 3U6JA 3H3CA 3WF8A 4ZTRA 5AUXA 3II5A 3EKKA 3R1NA 4BIBA 4FKGA 3UZTA 3NIZA 2B53A 4R5YA 4EH9A 2UZUE 3FZSA 5BUEA 3ORXA 3FC1X 4IDTA 3LMHA 4GFMA 2CN8A 4JG7A 3Q9XA 4DFZE 2YERA 3F2NA 4IM2A 4AFEA 2XK4A 3LCKA 3FI3A 4NW5A 4X2GA 2C4GA 4GV1A 4WRSA 4DTBA 4KIKB 4UZHA 1M7QA 3PVGA 2FGIA 2WIHA 4NJDA 3UOLA 3BV3A 2R9SA 4IAFA 4DAWA 1OPKA 3FI4A 2WMVA 3ZXZA 3E87A 2JDTA 1PMVA 5J9LA 3FHRA 3PSCA 2ITPA 2OIDA 3RHKA 4JDHA 3QUDA 5E9EA 4L53A 4YTCA 4UX9A 5A4EA 4DEBA 3QQGA 4KUJA 2B52A 2H96A 4ZSGA 4BICA 3PJCA 3DZOA 5E1EA 3E8NA 2Y0AA 4R7IA 4A4LA 4XP2A 5HIBA 2WIPA 1UA2A 3BU3A 3MTLA 3Q6WA 4W9WA 3VUTA 5FG8A 5KKRC 4R3RA 1PJKA 4RIOA 4D1ZA 5B2MA 3IDCA 1RW8A 2XUUA 2Y9QA 3PY0A 3UDBA 2BZIB 3BYSA 1J3HA 4LFIA 2W0JA 4S33A 2FSOX 4G3GA 4BR3A 3ZSHA 4QPSA 2WU6A 3CD3A 2BVAA 3C50A 2HZ4A 3GXLA 3IONA 3QZFA 4FKJA 3CD8A 3P4KA 4WUNA 4BDEA 3DXNA 3GEQA 4FMQA 3L8XA 2I40A 3MVJA 2WD1A 4YZDA 2BALA 2YWPA 2XIRA 4N4SA 2XYNA 3V5WA 4U79A 5AUYA 4DT8A 4AW0A 2XIYA 2X7GA 4JS8A 4AWIA 5CF8A 3TUBA 5CANA 5C8KA 4LMNA 4A07A 4FKUA 5L6PA 4A7CA 5EKNA 3VUKA 3VQUA 2PPQA 2QI8A 3D5WA 3ZDIA 1YWVA 3GGFA 3R04A 2ITWA 2YIWA 4YZMA 5I9YA 3HRBA 2GS7A 2WTVA 4I4EA 3VS4A 4E20A 4QTBA 4RJ8A 1Y6BA 1DAYA 4YC8A 4CCUA 3CQWA 4FVQA 3KF4A 4YGAA 4EC8A 4GIIA 3TNPC 4LOQA 4U81A 5CF5A 4EK6A 5JZNA 1MUOA 2IVUA 1YXVA 3WF7A 4ZMFA 2W9FB 3FKOA 1A48A 4FC0A 5ETAA 3F7ZA 5FGKA 3NUSA 3QQFA 4FTAA 5CEKA 4HZSA 3TCPA 5L8LA 5KCVA 4FV0A 4G5JA 4DTAA 3A7GA 2G2FA 3BQRA 4HPTE 4NIFB 4EQMA 3KRXA 4FT3A 1SVGA 3UIMA 4OUCA 1U4DA 2JBPA 3WARA 4CQGA 1REKA 2ETKA 3WE8A 5DG5A 3GENA 3OXTA 1HCKA 2XJ1A 3CR0A 1U5QA 5EDRA 2WMBA 3ZTXA 3DPKA 3BIZA 3Q4ZA 3C4WA 3ANQA 2YIRA 1OKVA 3A61A 5D1JA 3P23A 4O83A 1UVRA 3W2CA 4KS7A 5FEEA 2UZTA 3CQUA 4D1XA 3LPBA 3G6HA 2B9HA 2CKEA 3LCOA 2O2UA 3LXKA 4IFCA 4A9RA 4IHPA 2UW3A 4ERWA 4KAOA 4JG6A 2WO6A 3P79A 5D7AA 3N9XA 1ZLTA 3HX4A 3A7JA 3LFBA 4FVRA 2W4OA 5BMMA 5DVRA 3ZEWA 1PY5A 2ZMDA 4XP0A 5CX9A 4EH3A 1GIJA 1JWHA 3UIBA 4FI1A 5M08A 2VX3A 2XIKA 4WT6A 5FWKK 2E2BA 4H3BA 3NIEA 4XV1A 4R5SA 2IW6A 4FV4A 4GYIA 2C6DA 4M84A 1WBVA 2HZ0A 3R8VA 4AA0A 5CT7A 4GVAA 4TNBA 1OL1A 3O0GA 4FSYA 2QO2A 2VTHA 5CT0A 5EHYA 3LOKA 4O7WA 1UU9A 3HDNA 4M0ZA 2OO8X 3LFNA 3SGCA 2X2LA 4XG3A 3SG9A 3IPHA 1BL7A 3FL5A 4BCNA 5T3QA 2PY3A 2EXCX 4BYJA 4OTDA 2PU8A 3WZJA 1YHVA 3AC4A 4DTKA 5BVFA 2WMSA 2UW0A 4CTCA 5E8UA 3FJQE 2UZEA 4YJSA 3O8UA 2P0CA 2RG6A 4AN2A 5KE0A 1OGUA 4BDJA 1IRKA 1WBWA 4ZJVA 3A62A 3NW5A 5IKWA 5J79A 1YI6A 2O3PA 2PZYA 4FTLA 2VWWA 2JAMA 2OH4A 4DE4A 2XIXA 4Y73A 4XP3A 4E4NA 1FQ1B 2WAJA 1OKWA 5JGAA 4RZWA 3OCBA 4AZEA 4ZTLA 3C1XA 2Y8OA 1TQPA 4M0YA 4EI4A 3BI6A 4BCIA 2WTDA 1VEBA 4F1MA 3C9WA 4ZIMA 4D5KA 2X4ZA 3C0GA 3RNYA 2YWVA 4JJRA 5FUTA 1JKKA 5IQHA 3V3VA 4Q5EA 4ASDA 2X8DA 4KKHA 5HEZA 1LR4A 1H28A 4PMMA 4MH7A 2PHKA 3AC3A 5GJDA 2E9NA 5EQPA 4DT9A 1ERKA 3IO7A 1YW2A 5AAEA 4OR5A 2QQ7A 3I7BA 4MEDA 3ZDUA 2G2IA 3O8PA 5CI6A 2Q83A 2HAKA 2BZJA 3G51A 3S3IA 1FVVA 4IVDA 1KE5A 2XK6A 3BYVA 4I5MA 3CBLA 3VF9A 1E1VA 3R8PA 3HV5A 4W8DA 3LAUA 5DI1A 3BGPA 3F5GA 3LJ2A 1PXPA 2PZIA 4BCFA 2JKOA 3HV4A 4NM5A 5DRDA 1KOBA 2BKZA 4BZDA 3VIDA 2J4ZA 2PE1A 2R3NA 4FV1A 5FEQA 4ZXTA 4TYHA 3VS3A 3FPMA 4RC2A 4EH2A 2VTLA 4JOAA 4O2ZA 3LQ5A 2JIUA 1CKJA 5DLSA 5HGIA 3ENHA 3QZIA 3SD0A 3KMUA 4FT9A 3K3JA 3FQEA 4R3PA 2QHNA 4RBLA 5EI6A 3TZ9A 1AD5A 3ZRMA 4FZAB 4BKYA 5HLWA 3QX2A 4YJPA 4F6WA 3FKLA 3D7ZA 2PUUA 4TXCA 3E3BX 4DH3A 4G6OA 3DBCA 1ZYLA 4PV0A 4EJNA 2X6EA 4EUUA 4KIOA 3TIZA 5KMNA 5DIAA 3OZ6A 3OXZA 1BLXA 3MN3A 3PTGA 2CKOA 3IGOA 1M2QA 1H1RA 3IG7A 4O96A 3WZKA 3CEKA 5M4FA 5I5ZA 4IMYA 5FD2A 4C2VA 5FDPA 3CJGA 4TY1A 5E8WA 4CKRA 1IEPA 2GU8A 1OBDA 5CASA 3SHEA 4RX9A 3IGGA 5DHJA 1PYEA 5CXHA 4BWXA 4EC9A 2XM8A 3KVXA 1XBBA 5CLPA 2XNGA 4F4PA 3D4QA 5CQWA 4M66A 5JZJA 4BKJA 4ZTMA 2J90A 2V5QA 3B8QA 3MVMA 4DFXE 1Y8YA 4FL2A 5E8ZA 4NZWB 4O0TA 1S9IA 1JSUA 5F1ZA 4A9TA 4QYEA 3Q60A 4WNMA 4HW7A 1CKIA 4XRJA 3ORLA 3D9VA 1V0BA 4YTFA 2CCHA 4IB3A 4N70A 2RSVA 1YHWA 3GVUA
chains in the Genus database with same CATH superfamily
4U42A 1PKDA 2CDZA 2JBOA 2PUPA 3NYXA 5CSVA 4PNKA 5IQCA 4RIXB 5HLNA 3KULA 2WMWA 4TN6A 3NWWA 3LQ8A 4KSQA 2WEIA 4J98A 4EZ3A 2AEGA 4XLIA 4G1WA 5J5SA 1ATPE 4NM3A 3DK6A 4RFYA 4ACHA 1J7LA 4GVJA 4AGWA 1U5RA 1W2CA 2C6LA 4BRXA 4QTDA 4BCPA 3NEWA 3ZRKA 4ZTQA 5HCZA 4IFGA 2BIYA 4JR3A 4XS2A 2BR1A 4D55A 5LVMA 2XARA 3D83A 4IEBA 4RLKA 3E3PA 3RHXA 1MP8A 3AT2A 2R3LA 2WNTA 4V04A 2NYAA 4CZYB 1IG1A 4DBNA 4BJJA 3DBQA 4YZBA 2QOHA 3P0MA 4XG2A 4IWPA 1Q99A 1IAJA 1JSVA 2VRXA 2WPAA 4RWKA 3BYOA 3EQPA 4BWKA 3I5ZA 3VONA 2X8IA 4O86A 1ZARA 3NSZA 5E1SA 3E8CA 4ZSEA 5BMSA 4LRKA 4YJUA 4YLKA 2C6OA 4I20A 2IO6A 4GJ3A 4CRSA 5FDXA 4EK3A 4I3ZA 5DMZA 3RKBA 3POOA 3TJDA 4MYGA 1SNXA 5EOBA 4CMOA 1ZRZA 3MWUA 4RVMA 4O0VA 2C3IB 4LG4A 1V0PA 2EWAA 5EHLA 3C4CA 1KWPA 4LMUA 4GSBA 4EH7A 5JGDA 2BRNA 5CENA 4C4HA 5DH3A 3NNXA 4LQMA 2QVSE 4JRNA 4TYEA 3EQFA 1OI9A 5AR3A 4JG8A 4AGDA 5A54A 3ZONA 5AR2A 4YO4A 4Q2AA 4K1BA 4RIWB 4DHZA 4BTJA 2XBJA 4O22A 4AGUA 5ETCA 1FINA 4C8BA 1OIRA 4F9AA 1YWRA 4FV6A 5LVPA 2YABA 3DJ6A 3QZGA 2R3PA 1NXKA 5AR8A 4AX8A 4BN1A 5T68A 2HWPA 4WNPA 5AADA 4JRVA 4BDKA 3DS6A 5JFSA 3QTWA 1YOMA 2XNNA 5LVOA 4UN0C 4FODA 3VUGA 4FKOA 4EH6A 4K2RA 3D5VA 3ZU7A 5A9UA 2QOKA 2YM5A 2ZV7A 3ETAA 3QGWA 5J95A 4BI0A 3T8OA 2F7ZE 4PX6A 4FKWA 3HNGA 4DGNA 2ITZA 4QMXA 4TL0A 4M3QA 4L52A 3FZOA 3FLSA 2R0UA 5AX9A 4ZZOA 1W2DA 4QPMA 4NFMA 4YMJA 2ZV8A 1H27A 4FZFB 3CS9A 4E6AA 2OLCA 3BCEA 3JXWA 2ONLA 5EK7A 5BVNA 4YPDA 4CKIA 4FTJA 5ANKA 1J1BA 1M52A 3NUXA 4FGBA 5CNOA 4DHIB 3ULIA 4CCBA 4ZSLA 4FIGA 4MD8E 4TNDA 5L2QA 3W55A 4AP7A 4JDIA 5KO1A 5L2IA 4O4EA 2UZBA 1V0OA 3QXPA 3LMIA 3RGFA 5BX0A 1YRPA 4QMSA 4J97A 4M12A 5ICPA 4FTNA 3TKIA 3FLWA 5IA3A 2VTIA 3PJ3A 5CQUA 5DPVA 4RZVA 4KS8A 4EQUA 2WTIA 4IC8A 3EFKA 3BE9A 3UO4A 2CNQA 4MNFA 4PWNA 4YBJA 3R1QA 3DXPA 4FZ7A 4USDA 4EKKA 1YQJA 4HOKA 2XEZA 4PL4A 2VX1A 1WMKA 3GNIB 2C5NA 4F9WA 4OT5A 3R8LA 3QBNA 4L01A 3DGKA 5K0KA 4XG4A 5CAOA 3V8SA 3UMXA 3UZRA 3BU6A 1NVRA 2W5BA 3R7OA 4GW8A 3FLZA 3MSSA 3EQHA 3ODYX 5G1XA 3ALNA 4D2VA 4DF3A 3VS0A 3DCVA 1XQZA 4YU2A 2V22A 4QDVA 3UPZA 4KIPA 3S1HA 3WZUA 5I0BA 4GIHA 4PL3A 5CNNA 1P14A 5AP3A 3OCTA 1J7IA 2CNUA 1QPEA 3TV6A 1W84A 1FPUA 2OFUA 3JS2A 4ZLZA 4W8EA 4RIXA 1X8BA 2QCSA 3RPRA 5CSPA 2YJSA 5AUVA 3OBGA 3PPKA 4HNFA 4R78A 2OZAA 2OH0E 2XCHA 4AW2A 1KSWA 3I79A 2PE0A 4DEEA 5K9IA 3N4VA 1WFCA 3I0QA 4BTFA 2ETRA 2R3HA 4FSWA 3HMPA 3Q2MA 2Z7RA 2GDOA 3MFTA 3V8WA 5M53A 4FSRA 4AT4A 4H39A 4UEUA 4IAIA 4ALWA 5HVKA 4O91A 2HENA 2C6TA 2VWXA 3DFAA 3F5UA 3I4BA 4LOOA 1MRYA 3A2CA 3DQWA 3DB6A 3DNEA 3R7GA 1HCLA 1KE7A 4X21A 4AT3A 4JMQA 2PK9A 2JDOA 3NCZA 4RWLA 5A6OA 4P2KA 5E8VA 3VUHA 3WYYA 2VN9A 4M69B 4EBVA 5CEQA 3UOJA 2J0JA 2F9GA 1IASA 4I22A 3FBVA 4D4RA 3REPA 5IUHA 2ITVA 4QMZA 2OKRA 4KD1A 4LM5A 3PLAE 2OXDA 4OBOA 3P5KA 5M57A 1UWHA 4GYGA 3VBYA 1FMOE 2C1BA 3ZLWA 3DJ7A 3MH1A 4JVGA 3QA8A 4F7JA 3FZ1A 1JQHA 1Q41A 4M67A 4P5ZA 5EH0A 2XRWA 4CFMA 3Q9WA 3LFCA 2GS2A 4FR4A 2C5OA 2EVAA 4C33A 3LQ3A 3EHAA 2OF2A 5AM7A 2J0IA 3Q3BA 4CKJA 4X6QC 2XA4A 4EK8A 5HE3A 3U54A 4XV2A 3GU8A 1KE6A 3UPXA 1Q62A 3QRTA 4NCTC 4ZEGA 4XMOA 4DFLA 2BROA 4HVHA 3W0PA 3KRRA 2YLFA 3NS9A 1A06A 3BEGA 4YHFA 3UQCA 3RZFA 4YJVA 1G8AA 3QX4A 4F1TA 4CG9A 2OJFE 3FPQA 4OLIA 1H00A 1KUTA 5HTIA 4FTKA 2UUEA 4BDCA 3QKKA 4IADA 4ZY5A 4HGSA 4CVAA 2PMIA 4DFYA 4RIWA 4HZRA 4RJ6A 5JEBA 3ZFXA 3ULZA 3PY1A 3KVWA 3BHTA 4KBAA 1GOLA 4DLIA 5GIOE 4FKSA 4FNXA 4MF1A 3F2RA 3ELJA 4AGCA 4L7FA 3O50A 3U55A 5C01A 5M4IA 2XKEA 4RX8A 3OEZA 4KBKA 4ENYA 5CEMA 3MPTA 2X2MA 2ZAZA 3KN5A 3QD3A 3G90X 4G16A 4J71A 4C58A 4F9CA 4O7RA 4RWIA 1MQBA 4OAVB 3KRWA 3A99A 2QO9A 4ACDA 1FOTA 2PVYA 4LV8A 3ZM4A 4B7TA 5HVJA 2X0PA 3NLBA 4MCVA 2Z7LA 4JAIA 2BAKA 4WG4A 2PL0A 2W5HA 2J2IB 4IE9A 4XOZA 4XUFA 3VUMA 3KCFA 2YIYA 4FEXA 5DR6A 4IX6A 3QCXA 2PZPA 2QHMA 2R3GA 4JDKA 5J8IA 4FG8A 3VN9A 2ZDTA 4R3CA 3WIKA 1OIYA 1Q3DA 5GJGA 4APPA 5IQEA 2PVKA 3MYGA 3UVPA 3BLAA 3CJFA 3M2WA 2WU7A 3JUHA 4FT5A 4XH6A 4ANMA 2W1GA 3ZO4A 4BBFA 1PMUA 2GTMA 3MIYA 3NNWA 3KF7A 2JKKA 4PTCA 4IB5A 5HBJA 1TFFA 2EB2A 1OB3A 3FMNA 4K33A 3UE4A 4IX3A 3PFQA 3ZS5A 2P33A 2YM7A 3O51A 3HECA 1W0XC 3SDJA 3W8LA 4MQ1A 2WQBA 4BIDA 5A46A 4LYNA 3RMFA 3D5UA 4YZNA 1GAGA 5EI8A 3FEGA 3AXWA 3ANRA 1EH4A 3CLYA 1ZMVA 5ANGA 2B9FA 4D28A 1YWNA 4YSMA 4PY1A 1PMNA 1K3AA 2YJRA 3TTIA 3KCKA 3VUIA 4CNHA 2YDKA 4I4FA 3LCSA 2CKPA 4F08A 5JKGA 4QMYA 2ITOA 2Z2WA 4LRJA 2C0IA 2GHGA 4ITJA 3OWJA 3D14A 3RPOA 1F3MC 4ZJIA 4B8MA 5H2UA 3VWAA 3RAWA 4FEQA 3K5UA 3VF8A 4O0YA 2YACA 2W99B 4FK6A 1H07A 3P7CA 2RFDA 4QP9A 3VC4A 5J1WA 4FBXA 2UW8A 2SRCA 4U45A 4AZFA 1FBNA 3QZHA 3PDTA 3GQLA 3HLLA 5AV2A 2V0DA 4MNEB 4R1YA 3ZHPC 4WNOA 4YTHA 2GHLA 4JR7A 4AN3A 1ZOEA 3ZO3A 2QR8A 4HVIA 4G3DA 4AW5A 3W16A 3TYKA 1WAKA 3DDPA 4BF2A 5CU6A 4UMPA 1JLUE 4CRLA 5M4UA 2OK1A 2QOQA 2WGJA 2ONLC 3AC1A 3EIDA 2GFCA 3EQCA 3Q96A 1KE8A 3QWKA 2BZHB 4U44A 4EK4A 4U3YA 2CGUA 2DUVA 5C8NA 2CLQA 2IW9A 5M4CA 5CTPA 2JIVA 2JITA 3FE3A 1Y6AA 1Q8UA 2WXVA 3R83A 3W0RA 1GIHA 4BCGA 4C4EA 3B2TA 5M06A 2UZWE 3V8TA 2XANA 2XB7A 3L9LA 2BUJA 3U51A 4CFUA 5J9ZA 3GCQA 4JX7A 4QEBA 4TTHB 1FMKA 3MW1A 3OG7A 4S31A 1GY3A 3DAEA 4IXPA 2FVDA 5FM3A 1WCCA 2REIA 1QCFA 4IW0A 3GUBA 3DOGA 4HCVA 4WOVA 5JFXA 3FMKA 4BCKA 3IKAA 2IF8A 2VTQA 4C4IA 2I0HA 4FNZA 5IH4A 2BILB 2ERZE 3RM7A 4JQ8A 3V04A 3MS9A 1B39A 3BL7A 3L9PA 2ZVAA 3NFGB 4C59A 4CTBA 4U7ZA 3ZSGA 5CI7A 3UBDA 4PNIA 4GK4A 4H3QA 4XX9A 4BHNA 3LJ1A 5C26A 2ZYBA 4E26A 5CAVA 3HV3A 2HXQA 5KMMA 3GC9A 4FEWA 4FOCA 4D2PA 4QTEA 2AC5A 3UG2A 5F94A 5AEPA 3W8QA 1ZYJA 2P2IA 4YTIA 4ANBA 4Z7HA 2W1CA 3ORZA 4OTFA 5EM7A 5JN2A 3DJ5A 3PRIA 3O5AA 4E4XA 5EM8A 5TF9A 3LM0A 5CAPA 4O0XA 4NW6A 4ARKA 4FSMA 3QL8A 4HYHA 2BFXA 2W4JA 3DK7A 1H08A 5FM2A 3THBA 5CVHA 3RK9A 5L6WL 3NRMA 2YFXA 3F66A 4EHGA 4IVBA 2YAAA 4L3PA 5LMAA 4ENXA 2BTRA 2V7AA 4GJ2A 4ANSA 4J99A 1U59A 4IIRA 2IJMA 2VV9A 4GG7A 4ERKA 3MPMA 5EHOA 4IH8A 3RCDA 4DGGA 3OT3A 3GU4A 4LOPA 4A9UA 4AXAA 4UMRA 3OWKA 2OXXA 3EZRA 3M11A 1YXTA 2BRBA 2VO3A 3KIOC 3KXZA 2E9VA 4L8MA 5GZAA 3FHIA 2ZMCA 3MB6A 4IAAA 3QQHA 4O7NA 2WELA 4S32A 4M8TA 3PA3A 2HZNA 3WOWA 3FMLA 4EH8A 2XKDA 3QD2B 2BAJA 2HWOA 4BCJA 4V0GB 2XKCA 3PUPA 4FKQA 4ZOGA 3RNIA 2LGCA 3U87A 4IAKA 4BHZA 4CFVA 5HX6A 2J50A 4GH2A 4F7LA 3FL4A 3ORMA 4JIKA 4EKLA 3UODA 4LUDA 2HZIA 2I0YA 5DT3A 2OGVA 5E7RA 1R78A 3KRLA 4XBUA 4ASXA 4U97A 5EOLA 5GHVA 3BV2A 5IEYA 3PXRA 4O4FA 3ZCLA 4NYEA 3OEFX 1UKIA 5HI2A 4D4VA 2JEDA 3ID6C 4R6VA 1YDTE 4IVAA 4C62A 4IB1A 4F0FA 1CSNA 3EFJA 4IWDA 4LGDA 4OTIA 4CV9A 5A4QA 5I9ZA 3POZA 3F3TA 3TV4A 4DBXA 4QMPA 5A3XA 4CT2A 4O7VA 4ZAUA 1DM2A 1XMMA 4TRLA 3PP1A 3GQIA 4AA4A 3PE2A 3DZQA 3TUCA 3PJ1A 4L42A 2OJIA 5HZNA 4EEVA 1P2AA 2WTWA 3BRBA 3AGMA 2JFMA 2QOIA 2C5VA 2ZDUA 4BY9E 2ZV9A 4EZ7A 3R9DA 1OL7A 2OU7A 4AF3A 4U40A 3KXNA 3QTQA 3COMA 5A14A 3HGKA 3EQGA 1ZY5A 3L8PA 5FBNC 4X3FB 3EFWA 4MXZA 5D12A 4CLIA 5KMKA 2YM3A 4I23A 2JKMA 3UDSA 3FDNA 2J7TA 3TG1A 3W0MA 2QOBA 4A9YA 5KZIA 2QU5A 4RC4A 3OFMA 2EUFB 4XG8A 2VTRA 3SOAA 3E93A 3V6SA 4CSVA 3FZTA 4R7BA 1PHKA 3C51A 5IDNA 4YHJA 2BDFA 4GRBA 2HK5A 2OICA 3HDMA 2GTNA 4WIHA 4BZNA 2GCDA 1PYXA 1UNLA 3NPCA 4ACCA 3KRJA 4E6QA 2XF0A 3EZVA 3OC1A 5HG7A 1BYGA 1W82A 3DBDA 3QKMA 5FEDA 5AUWA 2BFYA 5M51A 2WEVA 5TKDA 5CF4A 4BBEA 1OMWA 1R0PA 5FBOA 3D2IA 4C3PA 2VO0A 1UKHA 4BGHA 4E4MA 3AKKA 2CGWA 4YNEA 2B9JA 4ZS0A 4AUAA 3R7YA 4ACMA 2F7EE 4RRVA 2C3KA 4EUTA 3ACKA 4CLJA 3TDWA 4RC3A 2HXLA 4N6ZA 4ASZA 1B6CB 3BGQA 4NEUA 2C3LA 5CEIA 3VBQA 4DFNA 3PZHA 2PVLA 3FSFA 1OL5A 3AC8A 3UG1A 3R7UA 4G6LA 5I4NA 3DBEA 2PTKA 2UW7A 3KY2A 3O7LB 4IDVA 3OP5A 4JBOA 3SRVA 3AD5A 2A2AA 3VW8A 4J53A 3FZRA 4H1MA 4Z55A 4L3LA 1R1WA 3OMVA 4TWPA 3JPVA 4LGHA 1O6YA 5H8BA 4FVPA 3FMDA 1JKSA 1Z57A 1Q8ZA 4IWQA 5I9UA 4EQCA 5CWZA 3H0YA 3KC3A 2FSMX 2WMXA 3LFDA 4QQTA 3EN7A 1QMZA 2XK9A 3D15A 3G5DA 4WA9A 4DHFA 4KIKA 3VS1A 3U9CA 2J9MA 4F6SA 3EN5A 3OHTA 4TWCA 3CPCA 3VS5A 2FB8A 4MKCA 5IZFA 2CLXA 1PMEA 4QMUA 4IWOA 4PPCA 5IF1A 1OITA 1OVEA 2W5AA 4QOXA 5CSXA 3QD0A 1AGWA 5M56A 3CY2A 3OT8A 4MAOA 3HP5A 1BI8A 2DYLA 3RWPA 4TWOA 4EJ7A 3HP2A 4C37A 3T9IA 3W2RA 3C13A 3PY3A 2QOCA 3KFAA 4QMQA 3A8XA 3E63A 3SQQA 2VZ6A 2C5XA 4GK3A 3QYZA 3DLSA 5ANOA 3UOHA 3VHEA 4FEUA 4MXOA 3VRZA 3P7AA 3TJCA 1P5EA 3ROYA 4F9YA 1YVJA 1XO2B 2GNIA 3VW6A 2CNVA 4I6LA 4C3FA 3KGAA 4WG5A 3R9OA 1CM8A 2QOOA 2Y4IC 4YUQA 4AFJA 3UQFA 5IPJA 3ITZA 4O7LA 2A98A 5HIDA 3COHA 4OGRA 3RCJA 2XNPA 3MGYA 2WB8A 3PA5A 2FUMA 4FUXA 3K5VA 3PVUA 4TKSA 5LVLA 4ZZMA 3FI2A 3VJOA 3PLSA 3GU6A 4GT4A 2AUHA 4AA5A 4ACGA 4MWIA 5IQAA 5KX8A 2C47A 4AXCA 5AA8A 2XIZA 4W4XA 4FSTA 3QTIA 4ZJJA 4BCQA 3Q5ZA 5LARA 4O0WA 4P5QA 4AG8A 4L3JA 4BDFA 4WD5A 5IQBA 3PIYA 5KNJA 3KK9A 3UZPA 4LL0A 5AUTA 3MJ2A 2G1TA 3QCQA 4EOQA 1XJDA 1K9AA 3O17A 3QKLA 4HVDA 5I9XA 2QR7A 1U54B 3ATSA 3QLGA 1O9UA 4XEYA 3ZYAA 5HIEA 2I1MA 3W0SA 5CZHA 4A4XA 1ST4A 5L2SA 1OPJA 3R1SA 3A7IA 2RGPA 3R6XA 4L7SA 3G9NA 4TZRA 5EYMA 1PXLA 3HV7A 4WBOA 3U4WA 3CTQA 2EB3A 2ITTA 2WMAA 3ORPA 4JI9A 4RIYB 4ZLYA 1H25A 2R3RA 2RFEA 4LL5A 2G2HA 2OSCA 3NAXA 4GL9A 3OVVA 2FH9A 3B8RA 4G5PA 4NIFA 5DE2A 4FNWA 5AR5A 5HNIX 2WQNA 3ORTA 3TV7A 1JAMA 1JSTA 5I3OA 3ZUUA 3LHJA 4Z3VA 4ANLA 2UV2A 4EOKA 5IQIA 5L4QA 3BGZA 5E8YA 2VO6A 5IH6A 4EH4A 3ZFMA 3FLQA 5H8GA 3QF9A 4NTTA 2BIKB 2HW7A 3Q53A 1XH4A 5L6OA 5ETFA 2JKQA 3TL8A 4M14A 3D7TB 3IW8A 2PYWA 2DWBA 5E4HA 1OGYA 4RMZA 3U9NA 4GKIA 4J52A 4YPSA 4K11A 4IANA 1Q8TA 3SAYA 3W0OA 3FMMA 3DNDA 4FTCA 1M14A 2IN6A 2VTMA 3D94A 3TN8A 2YAKA 3Q9YA 4O4BB 1U46A 2IEWA 2P55A 2CHLA 3AMBA 3F88A 3O8TA 5E91A 5BV3A 2X1NA 1R39A 2JAVA 3ZC5A 3L8SA 3VBWA 5KKRB 2WQMA 5EYKA 1XH6A 3ZEPA 4QQCA 4BVUA 4M68A 2GSFA 3EJ1A 2C30A 2PVJA 3QAME 2R3MA 1YXUA 2EU9A 4FIIA 2R3QA 4RSSA 3VS2A 2BHEA 5BYYA 3HAVA 3OTVA 4KWPA 3NYNA 2CN5A 4JIAA 2Y6OA 2OFVA 3UVRA 5FRIA 3F3ZA 2RL5A 2G01A 3I1AA 1WBTA 5C03A 5EW9A 4KB8A 3KXXA 2Z8CA 3BLQA 3S95A 3WYXA 2C6MA 2QO7A 4IVCA 4HNIA 3E5AA 4DYMA 3HMOA 3T9TA 2IZRA 2OJ9A 1OM1A 4XYFA 1KE9A 1W2FA 2X81A 4QQJA 3V5QA 2WOUA 4C3RA 2WTKC 4X0MA 3BKBA 4M7IA 1LEWA 3PYYA 3RP9A 3ZM9A 2B55A 4M15A 1ZZ2A 4KIQA 3R7IA 4F1OA 3Q5IA 4FA2A 5AMNA 4CZTA 3MI9A 5LJJA 2YCRA 3OD6X 4QP4A 4C7TA 3P9JA 1IA9A 1Q24A 1L3RE 2OJJA 3MPAA 4C4GA 2P3GX 5KBRA 3JY9A 4E6CA 4O21A 4FG7A 2HOGA 4L67A 3OY1A 3E64A 2J5FA 3HRCA 3VS6A 4A06A 3NVKI 1XH8A 5K5NA 4FSUA 2W9ZB 4JDJA 4O84A 1J91A 3QC4A 5IH5A 3LXPA 1PXIA 4I6BA 2UW4A 4MX9A 3E7OA 2HELA 5AP5A 3M42A 3SXFA 4QNYA 4QP3A 3DV3A 3QXOA 5EI2A 2ZB0A 2ZB1A 3V5TA 1H1WA 4ONAA 4UWYA 4JT3A 4Q9SA 4XJ0A 1BL6A 5EM6A 3A7FA 5M55A 4O4CA 2PMNX 4QMWA 1NVQA 4YHTA 4C0TA 3EWHA 3G6GA 4CZUA 1XHAA 2BTSA 5JSMA 3LLAA 4JXFA 3MH2A 3QC9A 4MBIA 1OPLA 3V5LA 3I6WA 1Y91A 1YOJA 3OOMA 4FKTA 3OROA 4FZ6A 4S34A 4I5CA 3BWJA 3WF5A 3KA0A 2XNEA 3SVVA 3QFVA 3UNZA 3EH9A 4QP1A 3GCSA 2YM6A 4FSQA 3KEXA 4EHEA 1GIIA 1H1PA 4CMTA 2QLQA 4RJ7A 1WZYA 3FWQA 5EM5A 5A6NA 3FXXA 4ZSAA 3CE3A 5H9BA 5LMBA 2W96B 2WHBA 4N57A 2NO3A 5CZIA 5EYCA 3N4UA 4YNOA 4GK2A 3DB8A 4BI2A 3HL7A 3GT8A 3LZBA 3MFUA 2HYYA 3H9RA 3EN9A 5H3QA 1VR2A 3OY3A 2GS6A 3LXLA 4QMTA 2X8EA 4ZTHA 1YI4A 2QODA 1VLRA 3SG8A 1UNHA 3I0OA 3Q6UA 3GBZA 5HORA 2PZRA 5HO8A 3UO6A 3PVBA 4IZAA 4P7EA 3LFAA 2X0GA 3A7HA 3DLZA 4HCTA 5TE0A 5J1VA 3GCVA 2QC6A 3RM6A 4C02A 4YJTA 2ITUA 2P4IA 4E6DA 4NJ3A 5IUGA 3AT4A 4F9BA 1LEZA 1BX6A 3HKOA 5JMSA 3FUPA 3VJNA 4CFXA 3NZ0A 4RIYA 1TVOA 3CKXA 1BI7A 4LV5A 4R8QA 3V5PA 4FNYA 4AOJA 3KXGA 4K18A 2OI4X 3SKCA 2NNWB 3C4ZA 4O6EA 3BBTB 2V7OA 1UWJA 3TNHA 4IJPA 4DGOA 2BKKA 1NW1A 3UO5A 3KK8A 2R5TA 2PZ5A 3UJGA 1Q61A 2HY81 3FC2A 1QPCA 3R02A 3ZBXA 4Z16A 2VWZA 1I44A 2C0TA 3BX5A 4F99A 1TQIA 3F2AA 3MJ1A 4FIHA 3CSVA 3LFFA 3D7TA 3OCGA 3DKOA 1Q3WA 3E92A 4LI5A 4DH5A 5E90A 1YHSA 2UW9A 3ENMA 4RFZA 3TACA 4DH1A 4BWPA 1XR1A 4KINA 2R7BA 5EFQA 2XNOA 4F64A 1W98A 4M13A 2GQRA 4JL9A 1LUFA 4S30A 4WUAA 3CTJA 3Q32A 4NM7A 3GB2A 4RA4A 1OUYA 2X0OA 3NUNA 4TT7A 3TTJA 1STCE 4IQ6A 4IX5A 4QTCA 1ZYDA 5C8MA 4G3EA 3PSDA 4IZ7A 3E7VA 4H1JA 5EW8A 2GFSA 2VGPA 2XBAA 3QUPA 3V51A 5K4JA 4C38A 4HYSA 3PWYA 5HU9A 3IOKA 2Z7QA 3EYHA 5B2LA 2C68A 5AIRA 1T46A 2R7IA 3CQEA 4HGLA 4QT1A 4I24A 5D41A 1P4OA 2ITYA 3RWQA 5HG9A 4PPBA 4IX4A 4KSPA 3GFWA 5ETIA 2I6LA 2YN8A 3A4OX 3COIA 2AQXA 2EXMA 3MH0A 3OBJA 4KABA 4RVTA 1JKLA 5DR2A 3R28A 2BMCA 5F20A 3HZTA 5EG3A 4Y85A 1OKZA 4DHJA 4NL0A 4DDIA 2NRYA 2W05A 1KV2A 5LCJA 3Q4TA 1DI8A 4IB0A 2XAMA 2XYUA 1RJBA 4R7HA 4DGMA 4F6UA 2IVVA 2X2KA 1M17A 2X0QA 2PMOX 5AP6A 1WBPA 5HNGA 2JLDA 2KULA 2WFYA 4O27B 5HOAA 3NAYA 3C0HA 3MA6A 4IAZA 3MY0A 3QTZA 3D5XA 5IA0A 2ZJWA 1ZZLA 4NSTA 2ACXA 2VGOA 3WZEA 3BHVA 3GI3A 1XKKA 4Y5HA 3PJ8A 1Q8YA 5I9WA 5M07A 3EFLA 4BDBA 2Y7JA 4I21A 3IK3A 4QD6A 4ZMEA 1DS5A 1Z9XA 2IZUA 2I0EA 1L8TA 2A27A 5EQYA 2ESMA 2XM9A 3TIYA 3S0OA 5EKOA 1VYWA 4PP9A 4QP2A 3QQUA 4PTEA 4QMMA 1CKPA 5JQ5A 3RK5A 2HCKA 5DFPA 5EDPA 5EQEA 1OUKA 5AR4A 3UYSA 2F2UA 4I0SA 4A9SA 3PWDA 4DG0E 4W4WA 1URCA 2UZLA 2PULA 3DAKA 2VTJA 4EOMA 3H4JA 3MV5A 4AOIA 3L9MA 3R21A 3W10A 2W4KA 3AMAA 3KN6A 3R00A 4W9XA 1H8FA 5D10A 3CPBA 4QMVA 1RQQA 2ZM4A 4F0IA 4OTRA 4AZSA 2UVYA 1LP4A 5IQFA 3DTWA 3JYAA 2PE2A 4D9UA 4HGTA 3W2PA 4FYOA 2WQEA 5IEXA 5HBHA 4GU9A 2ZM1A 2OF4A 3CY3A 3RI1A 3BLHA 4I94A 4YLJA 5IA2A 2UZVA 2Z7SA 4TYIA 4X2FA 3R7EA 3SA0A 4FIJA 3NX8A 3KQ7A 4OTHA 1JPAA 4QYFA 2ITXA 4GKHA 2YITA 1H01A 3QQKA 2BHHA 3UYTA 2NP8A 3KMMA 5BVKA 4CYJA 2F7XE 4XBRA 4D58A 2Q0BA 4MBJA 3F9NA 1JNKA 3IDPA 4JAJA 1VZOA 4E5WA 4WNKA 5AV3A 2VTAA 1GNGA 5JRSA 4G9CA 3LCTA 3NUUA 3LFQA 1ZAOA 5GZ9A 4FSZA 3KREA 3TZ8A 4USFA 4Z7GA 3NFFB 2JDVA 2FYSA 1H4LA 4K77A 4WG3A 2BRMA 4ZP5A 3ROCA 4FKRA 5DN3A 4O6LA 4KKGA 3VS7A 2PWLA 3PPZA 1G8JA 3IS5A 3UTOA 3UNKA 4DC2A 4F65A 4O7YA 4WKQA 4B9DA 1SMHA 3FV8A 5E8SA 4KRDA 1ZYSA 2XH5A 4Y72A 3IQ7A 3TNWA 3TT0A 2CKQA 2XNMA 4ALVA 3PVWA 1XBCA 5IA1A 2OWBA 3EYGA 4L46A 4TYJA 3Q52A 3QUEA 1WBNA 2XZSA 4RJ4A 3VQHA 4PTGA 5HCXA 3PXFA 3OS3A 1IA8A 3GU5A 3FMJA 3NW6A 4O0SA 4WO5A 3W33A 4FJVA 3IECA 5IQGA 3T3UA 2OW3A 4XLVA 5HO7A 3BWFA 2IG7A 3G15A 1J1CA 3UIXA 3LIJA 2XKFA 3V01A 4HVSA