5CASA

Egfr kinase domain mutant "tmlr" with compound 41a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
324
structure length
299
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 299
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5casA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5casA01
1SVGA 2QOFA 4HVGA 4FNXA 5C8NA 4H39A 3EQIA 3TZMA 2A0CX 2YHVA 3F3UA 3RHKA 3VQHA 4A4XA 4CG8A 3QQUA 3CD3A 2XIXA 2IZTA 1PHKA 4C57A 4DFZE 2PVFA 3ANRA 5L3AA 2JDOA 2E2BA 4B7TA 3SKCA 1OPLA 2R3MA 3ZLSA 3OOMA 5EW3A 3MVJA 2JDSA 3GOKA 2QR8A 4C62A 5M51A 2IZRA 4Z55A 2I0HA 5TKDA 4A9TA 3BU5A 1Y91A 2ZDTA 3VW6A 1GY3A 2J9MA 4FV9A 4NW6A 3I4BA 2QOBA 2C5XA 2R3OA 4Q2AA 2ITOA 2BRMA 5H3QA 4H3QA 4ZZOA 3IOKA 4O0UA 5ACBC 2ITXA 1JKLA 3Q2MA 1KSWA 3OXZA 3DV3A 3VW8A 4I5PA 4DLIA 4EC9A 3IGGA 2ZV7A 3DBFA 3QQHA 3LHJA 5I0BA 4DEEA 1OVEA 4FSQA 5AM7A 5EM7A 3LIJA 2C6KA 3MWUA 3NVMB 1JLUE 3CJFA 4IIRA 3RPYA 3TNHA 5K0XA 3RCDA 1YWVA 3QYWA 4GMYA 4L3PA 4QOXA 3R7OA 1YDSE 4QP8A 4CFFA 2B9JA 5IMXA 2HZNA 2ZV8A 5C9CA 3FMMA 1OKVA 3CEKA 5JZNA 4ANNA 3KCFA 4YPSA 1UA2A 3OOGA 3EN4A 2W99B 3V8SA 3ETAA 1E1VA 3LXPA 3D9VA 4GIHA 4TNDA 3KK8A 4XG9A 4ERKA 4GG7A 2W1EA 4PPCA 2C6LA 4X2KA 4BC6A 3MPTA 3E87A 4D2PA 3GBZA 1BI7A 2OGVA 1XO2B 2PZ5A 3LCKA 3LFCA 4FNYA 4U9AA 5AUVA 5C03A 4RVKA 4YZDA 4G5JA 4CFVA 4F70A 3GQIA 1K3AA 4FSUA 3U6JA 2HXQA 4JDKA 4JQ8A 5GJFA 4K1BA 5CEOA 4EJ7A 3ALOA 1Q41A 4FIEA 3BYSA 3KREA 5J87A 4NIFB 1YW2A 4FKPA 4RVLA 2LGCA 5EI6A 2YABA 4X2FA 5I9UA 3ORTA 2PMOX 3ORPA 2OFVA 4EH5A 4BL1A 4E6AA 3UPZA 1FPUA 4FOCA 1T46A 4CGAA 3LMGA 4FT3A 4ZSGA 4U5JA 1KE7A 4PF4A 4WT6A 3BHHA 3KRWA 4FE2A 2DWBA 1W82A 2A27A 3UIMA 4JT3A 5DMZA 5ICPA 3DQXA 3QZGA 4G2FA 3H4JA 3FKLA 4MYGA 4L68A 3R7VA 3P78A 3S1HA 4AA4A 5HO8A 4DEAA 3NW7A 1L3RE 4LOOA 3RPVA 5CXZA 4YJOA 4BCHA 3RZFA 3Q6WA 4AOTA 3MYGA 3LXLA 3GC8A 3Q60A 5D7VA 5IPJA 3CR0A 4QTDA 1H28A 3V5PA 3ZFXA 2P4IA 4I5MA 2W1GA 4RGJA 4E8AA 5IA1A 2W4JA 2HYYA 4E6QA 2JITA 1OITA 4BTMA 4O2ZA 4Z7HA 5BVNA 3F82A 4WUAA 3D5VA 1NVRA 3E8CA 4P90A 4YZMA 5B2KA 4YURA 4AZEA 2WTKC 3TTJA 2OIQA 3DNDA 2WU6A 2VO0A 4IX4A 2WU7A 4ITJA 2WGJA 5C27A 3UQCA 4C34A 5G1XA 2VWXA 4Y5HA 1ZY4A 1UVRA 2RG5A 1H1SA 2WTIA 3MTLA 4TWNA 2YJRA 1YDRE 5DBXA 3VUIA 4BDDA 5HNIX 2ZB1A 2WD1A 1SYKA 2R0IA 4IBMA 3GNIB 3MW1A 3QQGA 2QOLA 3O8TA 3PXRA 3P7CA 3BHVA 3D7TA 3SOAA 3ZO1A 4ZY6A 3FAAA 5CI7A 4AOIA 2JKQA 2WQMA 4BDKA 2O64A 2IPXA 3F9NA 4FSZA 2BILB 2X8IA 5CI6A 4W9WA 5M4CA 1UU8A 5IQEA 4USEA 4CKIA 1WVYA 2QOHA 5HIEA 4FODA 4O7SA 4QQ5A 5LVPA 2XIRA 2R3LA 3UOKA 3ZLXA 3UIXA 5EOLA 2ACXA 5TOZA 4DEIA 2OIDA 4IWQA 4MWIA 3UZPA 1EH4A 4L7FA 3ZBXA 1QPJA 4O7NA 2PULA 4KUJA 1S9IA 2R7BA 2BHHA 4PTGA 5AR3A 5HX6A 2C0OA 3PVUA 4YMJA 3HP2A 1NA7A 4F7SA 2VTAA 2CKEA 4ZK5A 3WF8A 4I5HA 3WZUA 4FT5A 2VTOA 5CT0A 1VJYA 2Y0AA 4EORA 3ORLA 4QP3A 4FTLA 3F2AA 3C4CA 3GU8A 3ZRLA 5HORA 2Y6MA 4I22A 5LARA 3NSZA 2YIRA 3FKOA 4JR3A 4KAOA 5DEWA 5A9UA 4FYNA 2GNGA 1LP4A 4OT6A 5FBNC 3D5XA 3G0EA 4X3FB 4ANOA 4M69A 3VS6A 5LXMA 4BYJA 5IA2A 3OCTA 2RKUA 5AR5A 1JQHA 2ITUA 4AOJA 3GOPA 5BUJA 4MNEA 4XOYA 4C4GA 4MBIA 2VWWA 2B1PA 2I6LA 2YCFA 1M52A 4L00A 4UXQA 3UC4A 3V5WA 3QKMA 3HYHA 4PPBA 5LMAA 2X39A 2JFLA 4OTPA 5IQGA 2B52A 3EL8A 3ORXA 1B6CB 3VF8A 4F9BA 4R3PA 2PSQA 4QYHA 2YLFA 5I5ZA 3PXFA 5CEPA 4ALVA 1U59A 2VU3A 3OBJA 4EQUA 4DEGA 3H30A 5HHWA 4R5SA 5HTIA 3D2KA 3N51A 4GJ3A 3W2RA 4LOQA 2JBOA 2X8EA 3FL5A 2ETMA 2ITPA 4C38A 3ROYA 3NUSA 1H27A 4ZOGA 4ZJJA 2XNOA 5JT2A 4M7IA 3LQ8A 2O65A 3JY9A 4JG7A 5CSWA 5KBQA 3IW6A 1XKKA 3PY1A 4BI2A 1TQIA 3FQHA 4ASXA 4HGTA 2ZOQA 3QCSA 5AIRA 2RL5A 5GINE 2QG5A 1KOAA 5KMKA 4BWXA 4YHFA 3WI6A 4F99A 3LFEA 4O1OA 3RWPA 4ID7A 1P14A 3OMVA 3Q4TA 4BBFA 4PNKA 3MI9A 2UZNA 4IVBA 3ZDUA 3ZRKA 5D9HA 3W10A 5AFVA 4GYIA 3SXSA 3ZLWA 3F5PA 4A9YA 4CFUA 4YJVA 2EB3A 5LVNA 4O83A 2J2IB 4RJ4A 4I1ZA 4DGLC 4I21A 5KX8A 2ITZA 4CKRA 3BIZA 3ORKA 1XR1A 3UMXA 4BGQA 5KKRB 5M56A 3JYAA 4W4WA 2JAMA 3BLQA 4M0YA 3TTIA 2GQSA 3MH0A 5DA3A 3N4TA 4YHTA 3DBEA 4O27B 4OW8A 2QOCA 2QOQA 4G1WA 2CN8A 3BYOA 3R7YA 2ZAZA 2IVVA 3G6GA 3GXLA 1Q62A 1GZ8A 4Y73A 3EFJA 4FZFB 3PJ3A 5CVFA 3FQEA 2E9OA 4R6VA 2XRWA 3OTVA 3ENMA 3EKNA 1Y8YA 3LZBA 4FG9A 2ITQA 2C68A 3CTJA 3IDBA 4I4FA 2WHBA 2V22A 4OTQA 5AV2A 4NU1A 1UNHA 4YJQA 2F57A 4CRSA 3GT8A 3BEAA 2PVJA 4NUSA 5IUGA 5CT7A 2VTTA 3VVHA 5CF4A 2XIYA 2G2IA 3O51A 5AP5A 3C4FA 4ZSAA 3AD6A 3PSCA 1FMKA 5ANGA 4APPA 3FHRA 3BGPA 4KIQA 2PPQA 2X6DA 2UW6A 4KD1A 5HVKA 2OJGA 4N0SA 2PZPA 3OT3A 4L9IA 4WA9A 3KGAA 4F09A 4ZTMA 5LMKA 2OFUA 3DAKA 1YDTE 2C1AA 2YIQA 3NEWA 3QBNA 4RA5A 5AUWA 3Q5ZA 3Q52A 4UMPA 3A7HA 4JNWA 4C59A 2CNUA 3R9OA 3NIEA 3WILA 3PPZA 5IMEA 2Z8CA 4ENYA 4J7BA 3PPKA 4MBLA 4ZY5A 1V0OA 2XS0A 3VWAA 4BCQA 5J1VA 3IDCA 4KS8A 4DG3E 1PMEA 3F7WA 2QC6A 2UW5A 2Y9QA 2VWIA 4ANQA 2YDIA 2OLCA 4NCTA 4LGGA 4QMOA 4JRNA 4XBUA 3P08A 2UZLA 2WQEA 3P86A 4PTCA 2P55A 4R3RA 3P9JA 5FLFA 4AG8A 3FC1X 3A61A 3S2PA 2W7XA 4J1RA 4MD8E 3RPRA 1CMKE 4WBOA 5D11A 2IO6A 2PVYA 3MH1A 4AF3A 4D58A 1LUFA 3WE4A 4KB8A 3KXXA 4KKHA 4EK5A 3LCSA 1A48A 4Z3VA 2YM5A 3LFAA 2KTYA 4O7RA 3W33A 2CNQA 4BKYA 4BIEA 4DTAA 4YSMA 4XHKB 3T3VA 3DLSA 5LVOA 3RINA 3IOPA 2FH9A 4O0VA 3UYSA 4D5HA 2XA4A 1JVPP 4BYIA 4HCUA 1H1PA 2UW4A 2VRXA 2XRUA 3W18A 4BZNA 4NTTA 4XYFA 3F61A 1WFCA 5E4HA 2PMLX 5CS6A 3ELJA 5AJQA 4K8AA 3RM6A 2BKZA 2C47A 3KMMA 4RWKA 5DRBA 3TCPA 3LFNA 4PRJA 5FTQA 4HZRA 4L3JA 3OROA 5CZIA 2FB8A 3NRMA 3QTZA 4JAJA 2C5NA 5FXQA 5DI1A 3WIKA 5A6OA 5DHJA 3GU7A 4B99A 4MD7E 4RQKA 4V05A 4QP9A 4EH2A 5A4CA 1P4FA 4BDAA 5CXHA 5F20A 3OHTA 2WMSA 1K2PA 5FD2A 2JGZA 4MH7A 1PRYA 5TR6A 3PXZA 3KN5A 4HNFA 4OT5A 2CGXA 5D41A 4BFMA 4CTBA 5LMBA 4Y85A 5TT7A 1KE6A 2BAJA 3NUAA 1HCKA 3R04A 5HOAA 4EOSA 4MXYA 4L8MA 3GFWA 3FQSA 3EH9A 5GZAA 3GCUA 5C8KA 2O0UA 4ANMA 3U51A 3PJ1A 2ETRA 3EFLA 4D1ZA 4NKAA 3MVMA 3FWQA 4OBPA 2OSCA 4W9XA 2JAVA 5DNRA 1UU7A 4FV6A 3K3JA 5HVJA 3DJ6A 3G51A 4TN6A 2A4LA 5BPYA 3MFRA 5I9XA 4D2TA 5M4UA 4FOBA 3V5LA 4XG6A 4FVQA 4PPAA 2V7OA 3CPBA 4G6LA 4E4XA 2WFYA 4RJ6A 4C3PA 4JDHA 4YLJA 3ORZA 5AUUA 4GCJA 3NS9A 3L8SA 3OXIA 3A4OX 2WTVA 3RM7A 3Q9XA 3K5UA 4K2RA 4Y95A 1PMVA 3KKVA 4D5KA 5A4TA 4G5PA 3QWJA 4ZSLA 4R7BA 1YQJA 4M14A 4F7LA 3C4WA 2WMRA 5GNKA 2GNLA 3TNQB 1U5QA 2WB8A 3I0QA 4MXCA 1I44A 3FPMA 4GVJA 5ITAA 4C2VA 4I94A 3EN7A 3V5JA 3QCXA 4DYMA 1XH7A 2JC6A 3PIYA 2J5FA 4O0TA 4RA4A 2FUMA 2UW3A 5ANIA 4C58A 5CAOA 2O2UA 3PA4A 3EOCA 2V5QA 3AC3A 3ZMMA 4F9WA 1WBTA 5JEBA 5KMLA 5GZ8A 4B8MA 3CE3A 3DXPA 4IM2A 4CT2A 4GU6A 2GHGA 4UBAA 3RK5A 4ACMA 4TT7A 2YZAA 4DEBA 3U8WA 3HECA 5EKOA 4QMUA 4R77A 3QQFA 2W1CA 4O6LA 3VS2A 2VV9A 3NYVA 3ZDIA 2CKQA 1QMZA 4EZ7A 1XBBA 3CJGA 4F9AA 1B39A 2GNFA 2JBPA 1FVVA 3L9MA 5CNOA 5FP6A 2ZYBA 3EQCA 4TWPA 4CZYB 4C4HA 5JGBA 4L46A 3OFMA 4C7TA 2Z02A 3AC2A 3GC9A 3UNZA 3GB2A 5GJDA 2BPMA 3W2QA 4S34A 4F0IA 5HG8A 4GEOA 5IUIA 4DFLA 3CD8A 3E8EA 3DKCA 4GFMA 3QL8A 3VS0A 2WQOA 3LOKA 4RSSA 4ZLYA 5JFXA 4YNEA 3VBTA 4DTKA 4ALWA 1X8BA 3VS3A 3NYNA 2XM8A 3VS4A 1QCFA 4L53A 2VO6A 1OUYA 4CFXA 4AS0A 4USFA 5C4KA 2H8HA 2C5OA 3UVQA 1Q5KA 4FGBA 4AZSA 3RAHA 2AC5A 4O6EA 4CMOA 1F0QA 2ONLC 5CAQA 4AT3A 4IWDA 3DK7A 4JBVA 5HNGA 2C6EA 3UGCA 2HY0A 3AT3A 3BV2A 2WIPA 4J97A 5DVRA 5K4IA 5EM8A 4C4FA 4IADA 1IR3A 2PUPA 3U9CA 5M55A 1BX6A 1U4DA 3JVRA 2R64A 4RC4A 3N9XA 3ZM9A 1IAHA 4FNZA 4IDVA 4D28A 2C6DA 1LEWA 2CGVA 3BBTB 3KF7A 3QRKA 3THBA 4GRBA 1YWNA 5JFVA 3R8PA 4JQEA 5AA8A 4TYHB 2QO7A 2CHLA 4UWYA 4BKZA 2PMNX 1WCCA 3R1QA 4ENXA 3W8LA 4N4SA 4DGGA 2J4ZA 2XNNA 3ANQA 4XOZA 2W5HA 4F08A 3LKMA 3V04A 3PXYA 2PUNA 3KULA 4NSTA 4UXLA 3DBDA 3RALA 4A9RA 3RBWA 4D4YA 3IQ7A 4WSYA 1QPCA 4NKSA 4NFNA 2QOOA 1I09A 2EB2A 4IVDA 4RIXB 3RTPA 5I9YA 4V04A 3UZRA 4DBXA 3IW5A 3COHA 4TYGA 4C4JA 4G3EA 4AWIA 4X21A 2ITWA 4XG8A 4U79A 5AP1A 4HGEA 3R9DA 4HYIA 3UQFA 4CFMA 1WBPA 4KIKB 4F9CA 3Q04A 4IE9A 4FKLA 3Q9WA 5HE3A 3ZCLA 3QHWA 4PP9A 2YM3A 4ACHA 3KXGA 3QKLA 4FC0A 3OWPA 1MUOA 2ESMA 4PMSA 5JH6A 1BKXA 2OF2A 3EN9A 4R78A 1YWRA 1XBAA 2VGOA 2IW8A 4BHNA 1JKTA 5HCXA 1JAMA 4PUZA 4XUFA 4WNMA 5ANOA 4D55A 3QQKA 4J8NA 3OP5A 1H4LA 3R6XA 2C5YA 4F1TA 2DQ7X 2QONA 4ZS0A 1BL7A 2WMAA 5HE1A 4RZWA 2PVLA 3QA0A 3FC2A 4FL2A 3AQVA 3EIDA 4GYGA 4I4EA 1OL6A 3M1SA 4IM3A 5HIBA 3V6SA 4M68A 3NZ0A 4F6UA 2OXYA 4S30A 3AT2A 2XIZA 4BCGA 4O7VA 4EYMA 5IA3A 2OIBA 4DFBA 4G34A 1GAGA 4LQMA 5E92A 4GS6A 5HU9A 1OZ1A 2H96A 4IB5A 4FK3A 2QG7A 1UNLA 3UP7A 1FBNA 1OL7A 5J5SA 4IZ7A 3EWHA 4AACA 3KMUA 4RX8A 5JRQA 4UMRA 2PVKA 2XM9A 4EOJA 2YA9A 4KBKA 4C0TA 4FK6A 3QA8A 2X4FA 3DS6A 3QUPA 2CKOA 3EQRA 3IKAA 4RIWB 4WO5A 2Z7SA 5BX0A 4YSJA 3IW4A 2WELA 4JJRA 3QZHA 4FEQA 2OJJA 4KS7A 3A2CA 4IHPA 2QODA 1REKA 4RVTA 4U3YA 3RKBA 4BDEA 1MP8A 3MGYA 5IEXA 2F2UA 4AU8A 4EBWA 1ZAOA 1DAWA 1ZYLA 2BAQA 3WYXA 4BDCA 3QWKA 4JAIA 4EWHA 1A06A 3FSKA 5JQ8A 4L7SA 4D9UA 5KHXA 2UZOA 1H01A 3KVWA 3R7EA 5CF8A 2RFEA 3TM0A 2WMUA 1L8TA 3Q9YA 4GW8A 4MVFA 5FWKK 2CCIA 4QMSA 3CSVA 2HIWA 3FHIA 4RC2A 4C02A 2IZUA 3LJ1A 5HLNA 3D4QA 4J71A 1ZMVA 3VQUA 4NCTC 2JEDA 3VAPA 1E9HA 4CV8A 5FTOA 3GCQA 2JLDA 3PJ8A 3TKHA 3LQ3A 4U97A 2GS6A 2W4KA 4YNOA 1OECA 4EK6A 3WF7A 5CVHA 5HICA 4HVIA 2GDOA 2EUFB 1W7HA 3C4ZA 4IB0A 3RNIA 1GZOA 4NM5A 4FSMA 4AGWA 3QD2B 1GZNA 1Q8TA 2XBAA 5CU3A 5HLWA 3ZC6A 2J90A 2I7QA 2GTNA 4XLIA 3D2IA 4Z16A 4BZOA 3BE2A 3DBCA 4FIJA 4IEBA 2VO7A 3NNWA 4IZ5A 2XF0A 4KNBA 4U3ZA 5KZIA 2G2FA 1M2QA 3KY2A 4UMUA 1KE5A 4E1ZA 1HCLA 3I79A 2I0VA 4AW1A 1KE9A 1R1WA 4J99A 4G3GA 4EWQA 3FV8A 4L67A 4QPSA 4R5YA 1CKPA 4U41A 4DBNA 2BZKB 4E20A 5HTBA 4XG2A 2YEXA 2R0UA 3LFQA 2VTHA 4NFMA 1FGKA 3QRIA 3TEIA 3UJGA 2B55A 4DH5A 3QRUA 4BY9E 3WF5A 3IONA 5D7AA 2ITNA 1UWJA 3ATTA 3ZSGA 2W05A 3U54A 4M84A 1MRYA 4CV9A 4M97A 4AP7A 5LCKA 2WOUA 4OR5A 4E6DA 3FMEA 3C0HA 5ETCA 2X2LA 5CAPA 3G15A 4E4LA 2XKCA 4QTBA 1H26A 2YIWA 3O96A 3RK7A 2WAJA 4KABA 3ERKA 4QP7A 4RWIA 3OY3A 5AX3A 1RJBA 5CEQA 5JZJA 3VBYA 4FI1A 3COIA 2WNTA 5KCVA 4QYGA 3TNPC 2XCKA 2ITYA 4S32A 3RAKA 3AC1A 3VBXA 3EB0A 4FV3A 2YITA 3HV7A 2QU6A 3KU2A 4GK3A 3LE6A 1KV1A 3R00A 4QTCA 3TNIA 3BKBA 3DDPA 4AAAA 4OAVB 4ZS4A 4U42A 2J51A 5AUTA 4OTIA 1LR4A 5HBJA 3HDMA 3HLLA 4GU9A 4KRDA 3DLZA 4TYJA 3VIDA 2R3GA 5HE2A 5AA9A 5J9ZA 5CQUA 5IH6A 3KMWA 3CCNA 2WZJA 5IA5A 4YC6A 4LUDA 3DFCB 4DLJA 5K5NA 3M42A 3O71A 2A1AB 4GSBA 4KWPA 4RBLA 4RX9A 2PYWA 1RW8A 2PU8A 2XP2A 3FY0A 4EONA 4CYJA 4S31A 2R3KA 3SXRA 3TG1A 4I5CA 3CGOA 5M06A 4XP3A 4L43A 3SC1A 3NWWA 4E3CA 4F7NA 4FV8A 4HVHA 4RWJA 3FE3A 4H3PA 3ZZEA 4AZTA 4D1XA 5L2WA 2YWVA 3DY7A 3Q4UA 4JVGA 1H25A 3L9LA 4WNOA 5C8MA 3FI2A 4OBOA 1GIIA 1MQBA 3SAYA 4QMVA 3QC4A 5CLPA 4QNAA 3HMOA 4FTIA 3BHUA 4CZUA 1YHVA 2FGIA 5DT4A 3NCZA 1Q3WA 3A7GA 3BU3A 4M13A 4XNEA 5I3RA 1IAJA 1R0PA 4II5A 2OZAB 4ZEGA 3QU0A 4EQMA 3G2FA 2VD5A 3PSDA 4I24A 4LYNA 5AP4A 3C51A 4HYUA 4XS2A 2WMVA 3L9PA 2X8DA 2GMXA 2WTWA 1JPAA 4QP2A 1OUKA 2OK1A 3E88A 4AT4A 2OZOA 1FINA 2X2KA 3RI1A 1ND4A 5IQDA 2Q0NA 3ZONA 1PW2A 4QPMA 3QTRA 5IEVA 3E62A 4G9RA 4E5WA 2VO3A 4FKWA 2YCQA 4LGDA 4CXAA 4BCPA 4D4RA 4IJPA 5ETFA 1J1BA 2R3PA 4PQNA 4HVSA 4F7JA 4EHGA 4ITHA 2JDTA 3DJ5A 4ANBA 4BGHA 3SXFA 5BUIA 4RIYB 3VS1A 1QPEA 3ZXTA 3FMNA 5K3YA 1SZMA 2WTCA 5AV1A 1Y6BA 1W0XC 3DTCA 3SG8A 3NUYA 4FIGA 4KINA 4EKLA 3RNYA 5H8BA 2P0CA 4AZFA 5F95A 3Q2JA 4E6CA 2B9FA 3MTFA 1ZXEA 4X3FC 1WVWA 1OM1A 2I1MA 3SRVA 2DS1A 2UW7A 1GIJA 3R9RA 4EK4A 4Y5QA 5BYZA 3WOWA 4D9TA 5J9YA 2VNYA 3DB8A 4O7LA 4EOQA 3GCPA 4G16A 3I6WA 1STCE 4YGAA 4XBRA 3TUBA 4X6RA 3IO7A 2OXDA 3AMYA 2F4JA 3VC4A 3TDWA 3WZJA 5C4LA 2JD5A 1JOWB 2YWPA 3W2OA 4BICA 5CAVA 3UODA 5HESA 4EBVA 1FQ1B 4LRKA 2FVDA 2XKDA 2BAKA 4QQJA 5HCYA 1OKWA 3U4UA 3WF6A 3OEZA 5K4JA 4LRMA 2XEYA 4IC7A 3F5UA 1PY5A 5EI8A 4G9CA 4JLCA 4FVPA 4EHZA 2XYUA 5F9EA 2ONLA 3PUPA 2X81A 4QMYA 4RMZA 3TIYA 4EUUA 2CCHA 1Q8YA 3OWJA 3QD0A 4EH3A 2WTKB 3R7UA 3HUBA 4QMLA 4E4NA 2BDJA 4W8DA 4UN0C 3FL4A 4RVMA 3ACJA 2PY3A 2EXMA 4TWCA 5J95A 2PZRA 3ULZA 3R83A 3GP0A 3W1FA 1OIQA 3KB7A 4FL3A 3AD5A 3A8XA 4GL9A 3EQDA 2W1IA 4I6FA 5BVDA 3HAMA 4BCMA 2C0IA 2ZMDA 3V5TA 3G6HA 5CY3A 3ALNA 2X2MA 2BHEA 4X2NA 2HWPA 2GCDA 3C5UA 3D94A 1Q8WA 2CMWA 4IFGA 1YOMA 2J0MB 3ZFYA 1OKYA 4C35A 3UOLA 3SDJA 3U87A 5T6KA 3NW5A 4O21A 4WBBB 4NJDA 4IB1A 2BZHB 2W1DA 4QMTA 3OW3A 2HELA 4QP6A 2XYNA 2ZJWA 2G2HA 4JR7A 2VTIA 3FSFA 3D0EA 1O9UA 2UZEA 4JOAA 4AW2A 3TJDA 1URCA 2C3KA 2BKKA 1XJDA 3LCDA 4FSWA 2UVZA 3L8XA 5IF1A 4QYEA 4BF2A 3KF4A 5KKRC 4R8QA 3R73A 4H1JA 2BFYA 5EK7A 4A07A 4DINA 4YTIA 3WZEA 2BMCA 3VBWA 2XEZA 4J53A 4O7WA 3UNKA 5LQFA 4OTRA 1Q3DA 2ZM1A 2QKRA 4F63A 5T3QA 3V3VA 3AC5A 5IG1A 2BRNA 2C69A 4P5QA 1NXKA 3OD6X 3QX4A 3GEQA 3TV7A 3Q53A 2YDJA 5IH4A 1Z9XA 1UU9A 2OH4A 3IGOA 3ZSHA 2QO9A 5EQEA 2CPKE 3FDNA 2W1HA 3KCKA 1UWHA 2BIKB 3GGFA 2FSMX 4XEYA 5HG5A 4YBKA 2QNJA 3TKUA 3E92A 1KE8A 1ZYSA 4ACDA 3W2SA 5CF6A 2WXVA 3BLRA 3UO4A 3SW4A 4FVRA 4WSQA 5DEYA 5JFSA 4IM0A 3AGLA 4ZP5A 4OLIA 4AX8A 4NW5A 2PK9A 2QOKA 2BDWA 4RIWA 5K0KA 4YJSA 3VBQA 4ZZNA 3AOXA 3PWYA 1T45A 4UYNA 2XVDA 3C50A 1G8AA 2BRBA 5DT0A 4O7ZA 1RDQE 1U54B 1XHAA 3NUXA 2JKKA 4I41A 5CZHA 4IFCA 5AMNA 3UIUA 2VAGA 3PA3A 1G5SA 2XKEA 4EH9A 5IQCA 5CYIA 4I0TA 1J91A 2GS2A 2R3JA 5H9BA 3O50A 3MPAA 4EOOA 4GVAA 3OXTA 4JIAA 3LMHA 4BTJA 1WBOA 4PDYA 3GU6A 4AN9A 3QAME 4ACGA 4EUTA 4LOPA 2J5EA 4EOPA 2WMBA 3R8UA 3LXKA 3KVXA 5HKMA 2OBJA 5L8LA 2PE2A 4TRLA 4G3DA 4BDJA 3F88A 3L8PA 4BR3A 4ZTSA 3F5XA 4ANSA 2B9IA 3BYVA 3A7JA 2FO0A 2JFMA 5E8WA 1ZZLA 4UZHA 3RP9A 2HW7A 5KMJA 2I0YA 3H9FA 1Q4LA 4YP8A 4D2RA 3BE9A 3WE8A 3POOA 1NVQA 3FZPA 4AQCA 2GFCA 3PPJA 5EYDA 5E1EA 3VN9A 4P4CA 3UYTA 4CT1A 3CP9A 1AD5A 5A6NA 3KL8A 2H6DA 1ZY5A 3COMA 5EH0A 4TYIA 3JUHA 2B7AA 5B0XA 3MPMA 3V51A 4QMNA 4DFYA 5KMOA 3I7BA 3JVSA 5AIKA 1BLXA 4NJ3A 4EH4A 5IDNA 2PWLA 1Y6AA 1M2RA 3BBWA 3I5NA 4IAIA 4Y72A 4UB7A 4OAUC 3A7FA 3ZUTA 3FMJA 4KKEA 5L2IA 5LOHA 1ZWSA 4ZSEA 1Y57A 2P3GX 2QI8A 1XQZA 2PVHA 5JQ5A 2QLUA 4AFJA 3HMPA 2UZDA 4ASZA 5AV4A 1VR2A 3CY2A 4JS8A 4XCUA 1NT2A 2GTMA 3KXNA 4FIHA 1G3NA 4K18A 1NVSA 4FTAA 3HL7A 3I0OA 4YLKA 3IS5A 2JKMA 2QO2A 4FV7A 1H1WA 2O8YA 5FDPA 1RQQA 4FF8A 5HNBA 3VRYA 4D4VA 4C8BA 5CSVA 3UNJA 4E5BA 4YO4A 1YXSA 4L01A 2XK3A 3H9OA 4WOVA 3NVKI 2ZM3A 3PP0A 4Z7GA 4J96A 2XB7A 4L44A 1E1XA 2J0LA 2YCRA 2EWAA 5ANKA 4GKIA 5EQYA 5FDXA 4DFUA 4FV5A 3FKNA 2V55A 3KC3A 5AUXA 4EZ5A 2VGPA 4U6RA 2YN8A 3UG2A 4CMUA 3G9LX 5M57A 4NIFA 3FYKX 4B8LA 1DI9A 3EQFA 4FYOA 4OUCA 2KULA 5AAEA 3F5GA 3FI8A 4BN1A 5A54A 3V8WA 4TNBA 3ZM4A 3PVBA 3S3IA 3NNVA 1CKIA 2GPHA 4IWOA 4OTHA 2A2AA 5M07A 5AX9A 4I93A 5JGDA 4IB3A 4FKVA 3DA6A 4BZDA 3ORNA 5CTPA 4IJ9A 3UP2A 2CDZA 5I9ZA 1ZARA 4BCKA 4NYEA 4LV8A 3BQCA 1YOJA 3O2MA 5EHYA 4FTJA 1OPJA 3PIZA 3WF9A 4HYSA 2WPAA 3WZKA 3L1SA 4R1YA 2Q0BA 2ZV2A 3V01A 4ASDA 4TPTA 5L6WL 4DGOA 2GU8A 1ZYCA 3HX4A 3FLNC 5L6OA 2VTPA 4BCJA 3MA3A 4BIBA 5KO1A 4EH8A 5HLPA 1DAYA 3BQRA 1ZYDA 1MRVA 4BDBA 2Z2WA 3BI6A 3I5ZA 4U7ZA 3IPHA 4KBCA 5HG7A 3VUKA 4FZAB 4MXAA 4U80A 4XRLA 3F2RA 4H36A 4YTCA 1GZKA 4PTEA 4O7TA 4FKIA 4IAZA 5BUEA 4MNFA 5AUZA 4DEDA 2YM8A 1V1KA 5BVFA 1VYWA 2XH5A 3GQLA 3NUPA 3U55A 5I3OA 1J7IA 4NM0A 2FSTX 3DKOA 3HEGA 3HMNA 5CU6A 3TV6A 4PX6A 1M2PA 1VZOA 1OIUA 2PHKA 4EHVA 4DA5A 3G90X 4FKGA 4FZ6A 2IVTA 4LM5A 5FQDC 4E26A 3OS3A 3QRTA 5DLSA 3HA6A 2XJ2A 4BTFA 4XV1A 4WKQA 1WMKA 1OIRA 3H10A 3QCQA 3DZOA 2QVSE 5K9IA 4GIIA 4RFMA 2W06A 3S00A 2VX1A 3R1YA 4FUYA 4X0MA 4CYIA 2HXLA 1UU3A 3ZBFA 2OJ9A 2BZIB 2UW8A 2CN5A 3D14A 1GNGA 3NR9A 2R3IA 5ETIA 2O5KA 4XRJA 4FZ7A 3NNXA 3DDQA 3EZRA 4MEDA 4IX5A 4RIOA 4YU2A 2YIXA 2VNWA 2XJ0A 4GH2A 4GFOA 4KSPA 4JG8A 4Q9SA 3W8QA 2C3LA 5AR4A 3ZU7A 2HENA 3LCTA 4FT0A 3CQWA 1JBPE 2W5BA 3KRRA 4YTHA 2R3NA 3C13A 3H9RA 3QUDA 4QT1A 2C6TA 4KA3A 4GKHA 3DXQA 3CPCA 3EQHA 4YJNA 4K33A 3R8LA 2X7GA 2NPQA 3RGFA 3VJOA 4KIPA 3MN3A 4PWNA 4IWPA 2CKPA 4X3FA 5AP3A 4OGRA 3HKOA 4PDOA 3DB6A 2W1ZA 3QQLA 4EK3A 2HY81 2Y7JA 4LL0A 4YBJA 4FNWA 1H8FA 2SRCA 2ERZE 2JDVA 3B2TA 4CMTA 5I9VA 1W8CA 2R9SA 3MIYA 3QTQA 5HG9A 1RE8A 4FEVA 4O22A 3F3TA 2O63A 3K3IA 1QL6A 2B4SB 3CKWA 4FTCA 4ZSJA 5L2QA 5AV3A 3DKFA 4NEUA 1REJA 2WO6A 1JKSA 1H08A 3F2NA 2E9VA 4FUXA 4DG2E 3GCSA 5ANJA 2CLXA 4FR4A 1H07A 3VBVA 5GIOE 2EXEA 1TKIA 3F7ZA 3WYYA 1F5QA 2QU5A 3HV3A 3TDVA 4QMXA 3OC1A 4H58A 2ZVAA 3POZA 4G3FA 5HBHA 5FG8A 1CDKA 1SVEA 5DR9A 1H00A 2XMYA 5CNNA 4CTCA 3QTWA 4RX7A 3FPQA 3N4VA 4MCVA 4FV1A 2F7XE 2WKMA 4UY9A 4CFNA 4LRJA 3RCJA 3R0TA 4LGHA 4W4XA 3R8MA 4EOLA 1P5EA 1IEPA 3ZUVA 4X2JA 4JRVA 5DIAA 5B2MA 3HMMA 5C1QB 4EEVA 2YIYA 2UW0A 5J1WA 2HOGA 4JXFA 4RX5A 1U46A 3U6HA 3SGCA 2CSNA 2OI4X 4BWPA 1SNXA 3L8VA 3TZ8A 2IVUA 2QD9A 5AWMA 3SV0A 4M3QA 3ZOSA 4O84A 4XG3A 4FTMA 2J0KA 5H8GA 5BMMA 1PMNA 4NTSA 3BPRA 3QGWA 3A4PA 3FZ1A 3JR1A 3ODZX 3Q6UA 1FVRA 3QLGA 4OTWA 3W2CA 4H1MA 2YM6A 2Y4IB 4IACA 1ZMWA 2BUJA 4HGSA 5DH3A 3RVGA 1F3MC 4YHJA 4CSVA 4YO6A 5EDQA 1YVJA 3W2PA 1PXLA 4C2WA 5CASA 4UZDA 3WIGA 4WG4A 3HRFA 2OJFE 3ET7A 4M69B 4RQVA 5IQIA 3ITZA 3OBGA 4FSTA 3UBDA 2RIOA 4LUEA 4AN2A 2UUEA 3EHAA 3QTUA 5DOSA 4FTOA 5IEYA 3R21A 5LVLA 3EFKA 5HTCA 1Q8UA 2F49A 2VTJA 3UG1A 3AG9A 1GOLA 4HW7A 4DH7A 3AGMA 1PF8A 4MNEB 4IC8A 3P79A 3Q3BA 4QYYA 2PTKA 4M12A 2J6MA 1PXNA 3LFBA 5J8IA 4AA0A 4A9UA 5KMNA 3MESA 3KQ7A 2C5VA 3AMBA 4CQGA 4BDGA 5JK3A 2VX3A 1NY3A 1V0PA 2IJMA 2QKWB 2XUUA 4MKCA 4YZNA 2BCJA 4UALA 1R39A 3FLWA 3RMFA 4PV0A 2ZMCA 4MTAA 4ARKA 2VWBA 4L45A 2UW9A 5AUYA 5KE0A 4CD0A 4DGMA 1GJOA 2OWBA 2YFXA 3FJQE 4RPVA 5D1JA 5BNJA 3QGYA 4GJ2A 4O1PA 4QRCA 3CTHA 2ETKA 4CLIA 3MY1A 4LMNA 2GFSA 2YLEA 4L42A 4TY1A 4O0YA 2BROA 3R2BA 1IRKA 2B53A 1R78A 4XMOA 2J0IA 3QQJA 3TJCA 1W83A 4QPAA 1XBCA 3G5DA 3ZS5A 1YRPA 3HRCA 5TF9A 4ZAUA 5ANEA 4KKGA 3ZEWA 2X9EA 4FKQA 4MXZA 4GG5A 3S95A 4G17A 4FKSA 2B0QA 4B6LA 2B54A 1KWPA 4EOIA 1WBNA 2ZB0A 3JPVA 2HZIA 3NNUA 2QQ7A 4I92A 3ORIA 1PYEA 1OL1A 4S2ZA 5L2SA 3CGFA 3LFDA 3PLAE 3OCBA 1Y8GA 2CNVA 4NM3A 4C37A 1OKZA 4DT8A 2VWUA 3NX8A 1J7UA 2YCSA 4R3CA 1MQ4A 3LLAA 3ZO3A 4TTHB 3W32A 3OCSA 5HO6A 3ZRMA 3QHRA 1G8SA 2WEVA 2JIIA 2CJMA 3DQWA 5IZFA 3BX5A 2OH0E 4JX7A 5E8YA 3HP5A 3FUPA 3I81A 3MH2A 2XNBA 4BCFA 3MJ1A 1ZRZA 3PA5A 4YJTA 3WZDA 2WMXA 2R7IA 4M0ZA 3OUNB 5A14A 2W17A 4FIFA 4BDFA 4NL0A 4FSRA 4O0SA 3QTXA 4Q9ZA 4K11A 4FT9A 2FYSA 4FTNA 3MA6A 2JDRA 4M15A 1JSUA 3CXWA 4FL1A 4WNPA 3VUGA 5CEKA 5FTGA 3UOJA 4BCIA 1B38A 2W9ZB 3ZSIA 4B0GA 2WMQA 4XV9A 4JG6A 3LXNA 4RFZA 4DE4A 5AP6A 5EYMA 5F1ZA 4XH6A 4C4IA 1TQPA 4GV1A 4MK0A 2I40A 1H0VA 4WUNA 2QLQA 5H8EA 3QZIA 5DE2A 3FXZA 5KMMA 3M11A 4EI4A 2Q83A 3EL7A 2XK8A 3E64A 4C33A 2YJSA 4O38A 3NMUF 4IZYA 3BV3A 2IVSA 4ZTHA 3F3WA 4D4SA 4I6BA 4FG8A 4RZVA 4BDHA 1Z5MA 4JDIA 4WRSA 5AP7A 4W4VA 5T68A 4MF0A 4PMTA 3BRBA 3E63A 4USDA 5L8KA 2FSOX 3LM0A 5CU0A 3EN6A 2W1FA 2FA2A 2XIKA 2NO3A 5FXRA 3UTOA 3GFEA 1O6LA 3HV5A 5A3XA 5CU4A 2X6EA 3PJ2A 5BVWA 4F64A 5IUHA 1OBDA 5KBRA 4WIHA 5CEIA 5M44A 4ORKA 1Q99A 3OF0A 4QMWA 1J1CA 2R3RA 2WTJA 5FM3A 2X7OA 3NPCA 3ZTXA 5HU3A 2UZBA 3BWFA 3E7OA 4XJ0A 4QMZA 2Y4PA 4K9YA 3TACA 4MBJA 5DGZA 3LPBA 5IA4A 4FZDB 4V0GB 3F6XA 3Q4CA 3C9WA 4R1VA 4EH6A 2UZUE 1OI9A 2OICA 3O23A 2H9VA 4FKRA 4YJRA 4A7CA 4C61A 4AXAA 3MVHA 4XV2A 5HZNA 3C7QA 5IU2A 3Q96A 4PDSA 3TL8A 1ZOGA 3NW6A 4J52A 4DHFA 3TV4A 1IASA 2AYPA 2RSVA 4MX9A 5FBOA 4CCUA 3PSBA 4FTUA 4RLKA 3CTQA 2GHMA 3AC4A 2EXCX 3VHEA 4FV4A 1K9AA 3MV5A 4L3LA 4D0XA 4F0FA 4ONAA 5K5XA 2HCKA 3BGQA 4UMQA 5IQBA 2OW3A 1DM2A 1MRUA 4YUQA 3QKKA 4FMQA 5E8VA 3RPSA 4BKJA 3S0OA 2CGUA 3FMLA 3SOCA 4RLLA 2XBJA 4H3BA 1XH5A 5E7RA 2PVRA 4ASEA 3GC7A 2F9GA 4P2KA 2PL0A 4XP0A 3TXOA 2XNMA 3VUTA 2WEIA 1WBSA 2C30A 3LVPA 2OF4A 2OG8A 4WNKA 4NH1A 3MJ2A 5JRSA 3R2YA 4UEUA 2X1NA 3PFQA 2HZ4A 3LMIA 1TQMA 2VTMA 3CQUA 4MHAA 1J7LA 2RG6A 3FLYA 3D5WA 3PDTA 4KSQA 3SLSA 2V7AA 2VWZA 4AGDA 4YLLA 1PYXA 3A7IA 4IDTA 3LJ2A 3P7BA 4RWLA 4JX3A 2BTRA 3LW0A 3ODYX 2RGPA 5AR2A 4E7WA 5HX8A 4FTQA 3I7CA 2R4BA 2WTDA 3MFSA 4DH8A 2F2CB 1OIYA 4R7IA 2OU7A 5C01A 3OEFX 4HGLA 3HDNA 3CLYA 3R1SA 4BTKA 3D7ZA 5EM6A 2P33A 4IQ6A 2C6OA 3SG9A 1ZLTA 2UV2A 3EQPA 5EW8A 3KRJA 2IW6A 2R2PA 4IAFA 3EZVA 3VUDA 4DF3A 2XK4A 2XKFA 4APCA 3CY3A 5DT3A 2BZJA 5FRIA 4EZ3A 1W84A 4HPUE 1JSVA 5FM2A 4HPTE 3TI1A 5EYCA 4HVDA 1ZZ2A 3Q5IA 3E3PA 3FYJX 2P2IA 4PMMA 2BRHA 3NDMA 3E93A 3R63A 4TYHA 1Q8ZA 5E8UA 3VS7A 1PXJA 3G33A 4Z9LA 1OL5A 1R0EA 3H3CA 3ZZWA 3WARA 4IX6A 4LMUA 5HGIA 5JGAA 4LFIA 3R28A 4EH7A 2DYLA 5EHOA 3AT4A 1YI4A 1ZYJA 2YM4A 4QYFA 4RIXA 1BMKA 3R71A 1ERKA 4BCNA 3O7LD 5A4LA 4ZJVA 4U40A 3FZSA 5FEEA 2XCHA 5E8TA 4HNIA 3PY3A 3PG3A 3V8TA 3H0ZA 4D0WA 3DPKA 4LL5A 4AFEA 3RJCA 2C1BA 4TW9A 4U44A 4XV3A 3QLFA 4UV0A 4ZTLA 2YAKA 4Y8DA 4AE6A 5BYLA 5L6PA 1H24A 4ITIA 2NNWB 5LVMA 3HZTA 4KIKA 2RF9A 4GUBA 3PVWA 4K0YA 5AAGA 2VUWA 4FTKA 3GI3A 4QP1A 3D15A 1PKDA 4MQ2A 2G1TA 3HV6A 3K2LA 2GQGA 3UIBA 4AE9A 3OWKA 5CU2A 3NUNA 3P4KA 3P23A 4BCOA 5M09A 4BI0A 2LAVA 1M14A 2I0EA 2VTLA 3F3ZA 5HO7A 3MB6A 4QMPA 5L4QA 3UZTA 1Q61A 4ZTQA 4AZWA 5DR2A 3VUHA 3AMAA 4FICA 3BCEA 1YXUA 4IMYA 4JBPA 4FEWA 3EQGA 4DG0E 1PXPA 5DN3A 4DH3A 3RK9A 4DH1A 4F65A 3PXKA 2P2HA 3EN5A 4EOMA 1A9UA 3NYXA 3C4EA 5JMSA 2QHNA 1CM8A 4O0RA 4C3FA 5A4EA 1YXVA 5LWMA 3IDPA 5HIDA 4H05A 1UNGA 3I60A 1YOLA 3BWJA 2PUUA 3I1AA 4YZ9A 4E93A 2VWYA 2VX0A 2IZSA 4G31A 3RPOA 3VNTA 1BUHA 4BBEA 4IW0A 3HRBA 3FMDA 4XP2A 2DUVA 4TZRA 5EHLA 5FXSA 5IH5A 5HVYA 3PZHA 3TWJA 3HA8A 4ZMEA 2XK9A 2BDFA 1UKIA 5DPVA 4GT3A 4MXOA 2XK6A 3LCOA 3W16A 2NP8A 4I0SA 5E8ZA 1GIHA 3FI3A 2VTQA 1WVXA 3P0MA 3BHYA 4FV0A 4IANA 4QO9A 3QXPA 4QTEA 1Q24A 3TUCA 3UO5A 4O86A 2GNJA 4RT7A 3KULB 3NLBA 4TKSA 4GT4A 5CENA 3ZUUA 4PL3A 3M2WA 4FEXA 2HZ0A 2NRUA 4QNYA 3MSSA 2UZVA 2Y6OA 3W55A 4RC3A 4E4MA 1SNUA 4RJ7A 3C5IA 4O0XA 1Z57A 4OTDA 3JS2A 1YXTA 1IA8A 2BVAA 2NRYA 3EYGA 4FIIA 5FEQA 3CQEA 4I3ZA 3GU5A 4QQCA 4U43A 3GVUA 2ERKA 1AGWA 3C1XA 2QURA 3OWLA 4C36A 2YISA 5HD4A 4ZXTA 2AC3A 3SHEA 4EL9A 5KHWA 2C6IA 3FZOA 3E7VA 4IXPA 4UWCA 4HJOA 3QCYA 1XH6A 5L2TA 4M66A 5ANDA 3UOHA 4A9SA 4FT7A 4IAAA 2XNGA 5CSXA 5DWRA 4M8TA 3MFUA 5GIPE 3VS5A 2VTRA 2OKRA 3KFAA 3CS9A 3QX2A 4G6NA 4LV5A 5CX9A 5EG3A 2VZ6A 4JI9A 3SQQA 4PMPA 5M4FA 4OBQA 2Z60A 5JKGA 4F6WA 5E1SA 2G9XA 3COKA 4TWOA 4U45A 2QOIA 2VWVA 4CKJA 1PXMA 5GHVA 2YZLA 2A19B 3O17A 2OO8X 4AT5A 1ZOEA 4GT5A 4KBAA 4CEGA 5JSMA 4AGCA 4ALUA 1LPUA 3MDYA 5E91A 5FGKA 4ZY4A 2IWIA 3I6UA 4V01A 4EHEA 3MVLA 3TN8A 3UVPA 2RFDA 2OXXA 3CC6A 1SM2A 1OMWA 3HMIA 4FTRA 5EYKA 5AV0A 3DK6A 2X4ZA 3G0FA 3K54A 3F3VA 2GS7A 3QFVA 3Q9ZA 1S9JA 3QALE 2QHMA 3HGKA 3K5VA 4MWHA 5AM6A 5BQ0A 3PWDA 4XLVA 5LCJA 2UVXA 3EKKA 3ZXZA 3FMKA 2Z7LA 3BEGA 4IH8A 3GU4A 4PNIA 5CALA 4HOKA 1SMHA 2O3PA 3SVVA 3LFFA 1V0BA 1YHWA 3UQGA 4BDIA 4CFWA 4DTBA 3T9TA 4NM7A 3DAEA 3PE2A 3WBLA 1M17A 4ANLA 3JY0A 4UMTA 4L6QA 1WBWA 4JL9A 1H0WA 5DFPA 3T9IA 4JQ7A 3QZFA 1HOWA 3VHKA 3ZC5A 2R3HA 1FGIA 4O0WA 3OG7A 4JIKA 3TUDA 5CAUA 5HI2A 4YZCA 4ERWA 4F4PA 2JIVA 3GCVA 3SX9A 3BU6A 4W8EA 3PVGA 2HW6A 4TL0A 5AAFA 5D10A 1OBGA 5CQWA 4F1OA 3R8VA 4D1SA 4RG0A 4N6ZA 3T8OA 3TKIA 5B2LA 3RZBA 3PP1A 2XNEA 4BHZA 5EFQA 3FEGA 4YC3A 4Y83A 4DCAA 3DXNA 1JSTA 3QYZA 3PZEA 1ZMUA 4V0GA 3BZ3A 3TIZA 4P7EA 3QD3A 3VJNA 4FBXA 2F7EE 2YM7A 3FMHA 5DRDA 1XH9A 4WHZA 3D5UA 3HV4A 4DAWA 1APME 4WG3A 3FLZA 2XZSA 1DI8A 2UZTA 5FP5A 1OB3A 2PE0A 3PJCA 4CZTA 5KUPA 2IW9A 2R5TA 3P1AA 4N57A 5EDRA 4BRXA 5DR6A 5J7BA 3MH3A 3REPA 3KXZA 3OTUA 1XH8A 3KXHA 2GNIA 3B8QA 2G15A 5F4NA 4JDJA 3OCGA 4RRVA 4K6ZA 4DFXE 3A60A 4DFNA 3R01A 2CLQA 3KK9A 3LFSA 4BWKA 4CCBA 4FV2A 4NK9A 1WZYA 4AA5A 5J79A 4CLJA 3SW7A 4DN5A 1IG1A 4IZAA 4YC8A 1VYZA 1PXIA 5H2UA 5BMSA 3S4QA 4MXXA 4S33A 5M08A 3R7GA 2E9UA 5IA0A 3BELA 2RFNA 2OZAA 4IVCA 3ZHPC 4RJ8A 5TO8A 3FY2A 3QXOA 2RFSA 3TNWA 3R30A 1XWSA 2PVMA 3R7IA 4EJNA 4U81A 1OGUA 2C0TA 1YI6A 3DOGA 3MFTA 4J95A 4FTTA 4PP7A 1U5RA 2YACA 2W5AA 3NIZA 4JBOA 3U4WA 5JFWA 4ZMFA 4XX9A 4RFYA 2W9FB 4A4LA 3H0YA 4O96A 3CIKA 3FLSA 3OW4A 1FOTA 5CVGA 5M53A 1ATPE 1P4OA 4BI1A 5LJJA 5M4IA 5DG5A 4RIYA 1W98A 4EK8A 3SA0A 1QPDA 2H34A 2E9PA 5E9EA 2PZYA 4BIDA 2J0JA 4A4OA 4NZWB 5D12A 3Q4ZA 3II5A 2ZDUA 4Q5EA 4FKJA 4I23A 5EW9A 4B4LA 4QMQA 4YZBA 3U9NA 4EYJA 5J9LA 3F69A 4HCVA 5AADA 3SD0A 3VULA 4ZTNA 3FZTA 1PXOA 3KRXA 2REIA 3ACKA 2WIHA 5CSHA 5FEDA 5IDPA 1CSNA 2X9FA 3O0GA 4FKTA 3ORMA 5E90A 4FSYA 5ETAA 1JWHA 1NW1A 5BVKA 5IQAA 2QR7A 3PTGA 3E8DA 4R7HA 4ZZMA 4O7YA 2W96B 3LM5A 3LLTA 3TZ9A 5AR8A 4MD9E 5TE0A 4C4EA 4ZIMA 4I0RA 3UVRA 5KMIA 3BYMA 4CVAA 3L9NA 1KUTA 3AXWA 4WG5A 4PY1A 4X2GA 1O6YA 5GJGA 2R3FA 3OZ6A 4MAOA 1UV5A 2EVAA 4IVAA 3QUEA 5CWZA 3UMWA 4AUAA 4Q5HA 1VEBA 4O91A 4BGGA 4D2VA 1YXXA 4EOKA 2J50A 1OPKA 4K77A 3E5AA 3R02A 3DBQA 3CBLA 3UPXA 5IQHA 4I20A 3EFWA 3ROCA 3BHTA 1DS5A 3AC8A 3PRIA 1YHSA 4XG7A 2GNHA 4YPDA 1KOBA 4YR8A 3ULIA 2J7TA 4GUEA 3E3BX 4BBMA 3GUBA 3TZ7A 5EQPA 3R9HA 3NYOA 4YJPA 3MS9A 3IW7A 3NGAA 4N6YA 3D83A 4L52A 3B2WA 3ATSA 5CF5A 4DC2A 1IA9A 1JNKA 3TT0A 5AP0A 3IK3A 2WMWA 3OUKA 4MQ1A 4QP4A 5IQFA 4XG4A 4UX9A 5G6VA 2GHLA 1UKHA 1PKGA 2Z7RA 3D7TB 2PZIA 3FXXA 3FZRA 3MIAA 5EOBA 2BR1A 5HD7A 4IAKA 3R8ZA 5EDPA 2Y4IC 2BALA 2JIUA 4GK2A 3ID6C 3OT8A 3KEXA 1XH4A 5CSPA 5AEPA 4C3RA 3A8WA 4WRGA 2E9NA 1BYGA 3LQ5A 4AN3A 5E8XA 3KRLA 4I6HA 5FUTA 4F1MA 4HZSA 3DJ7A 3ENHA 3IG7A 4QTAA 3DZQA 3SRVB 5EKNA 2WMTA 2PUIA 1CTPE 5JN2A 4ZJIA 2HAKA 4X6QC 2VTNA 4ZTRA 3VF9A 3AD4A 1PJKA 4D2WA 4DGNA 3IW8A 4PL4A 2OJIA 4BVUA 4EKKA 4G6OA 2CGWA 3VO3A 2HK5A 4QD6A 2C4GA 5DYJA 4HYHA 3FXWA 1P2AA 3PG1A 3KXMA 4FSNA 3O8PA 3UDBA 4CG9A 5HBEA 4RJ5A 3DGKA 3G9NA 3OY1A 3MBLA 5KNJA 2VTSA 5AR7A 2C6MA 4P5ZA 4D2SA 3N4UA 5EM5A 4KIOA 4F0GA 4N70A 3BGZA 4GK4A 2ITTA 4FKUA 5HEZA 3EMGA 4TYEA 1FVTA 4AW5A 5I9WA 3Q32A 5A46A 4Y46A 3QC9A 5B7VA 4MF1A 3DU8A 3MY0A 4YTFA 3PRFA 3ZLYA 1U54A 5BVOA 1J3HA 3KN6A 5HE0A 2V62A 3EYHA 5HQ0A 1M7QA 5I4NA 4ACCA 3A62A 4J98A 4QMMA 4WD5A 2WQBA 4LG4A 4EC8A 4FGRA 3DT1A 2BIYA 3NUUA 2JKOA 3R1NA 4AGUA 4CNHA 3DKGA 3T3UA 4DITA 2BRGA 3HUCA 3IECA 1PMUA 2YAAA 3P7AA 3R22A 3RAWA 3PIXA 5C26A 5LWNA 3DTWA 3LJ0A 2VN9A 3QTSA 3KA0A 1BL6A 5GZ9A 5IKWA 2C3IB 3R9NA 2IG7A 4X3JA 3ZFMA 4F9YA 3BLHA 4HCTA 3ZO4A 4BB4A 5BYYA 1H1RA 3DNEA 4NWMA 3DCVA 4U0IA 4ZLZA 5IISA 4OTFA 2EU9A 1BI8A 4DCEA 4UWBA 4O2PA 4CRLA 4U8ZA 1O6KA 2ZM4A 2XNPA 4A06A 4JBQA 2UZWE 1Q97A 2W4OA 2YDKA 2F7ZE 2X7FA 3UO6A 2ITVA 3GC0A 4AZVA 2Z7QA 4FG7A 3RHXA 3E8NA 2WQNA 5A4QA 3HAVA 5J5TA 4I6QA 1YI3A 4PL5A 4UYAA 3EQBA 4NT4A 5F94A 4KRCA 3P5KA 4W4YA 5E8SA 3RAIA 3O7LB 3V6RA 4FEUA 4DEHA 5J7HA 1OL2A 2FSLX 2R3QA 2GQRA 2B9HA 4B9DA 1SVHA 1WAKA 3QD4A 5AP2A 3RWQA 3PLSA 4M67A 3LAUA 4GFGA 2QCSA 2BTSA 4LI5A 5CEMA 4F6SA 3DK3A 3ZO2A 4E5AX 3QTIA 3F66A 1URWA 3NAXA 3PY0A 4DT9A 1PXKA 3CKXA 4EQCA 5L8JA 3C0IA 5KZ0A 2XK7A 2G01A 4CQEA 1CKJA 2X0GA 4QQTA 4FA2A 2Y8OA 3MY5A 3OVVA 1M7NA 4ZLOA 2C3JA 3O8UA 2ZV9A 3ZYAA 4AW0A 2W0JA 2PE1A 1AQ1A 3B8RA 3PE1A 3MB7A 4FKOA 3VUMA 4RJ3A 4IAYA 2UVYA 3UC3A 3PYYA 4O82A 2YERA 4J8MA 3ZH8A 1R3CA 1H1QA 2V0DA 3V5QA 2GSFA 5LMKC 1TVOA 3JXWA 4OTGA 4O81A 3UE4A 3C0GA 1JKKA 1WBVA 3DFAA 3FI4A 3NCGA 3VRZA 3FLQA 3QRJA 4PDPA 5EI2A 3HNGA 5ACKA 3FBVA 3A99A 2AUHA 1LEZA 3GENA 5BVEA 2PVNA 2XJ1A 3QF9A 3ZEPA 4YJUA 3U6IA 2IN6A 3BYUA 3HVCA 3NAYA 3C4XA 1KV2A 3EJ1A 4TXCA 5CANA 4X7QA 1YKRA 4G3CA 4FX3A 4IX3A 4E73A 5HCZA 3DAJA 1FMOE 2BFXA 2HWOA 2WOTA 3PXQA 1ZOHA 2PMIA
chains in the Genus database with same CATH superfamily
1SVGA 2QOFA 4HVGA 4FNXA 5C8NA 4H39A 3EQIA 3TZMA 2A0CX 2YHVA 3F3UA 3RHKA 3VQHA 4A4XA 4CG8A 3QQUA 3CD3A 2XIXA 2IZTA 1PHKA 4C57A 4DFZE 2PVFA 3ANRA 5L3AA 2JDOA 2E2BA 4B7TA 3SKCA 1OPLA 2R3MA 3ZLSA 3OOMA 5EW3A 3MVJA 2JDSA 3GOKA 2QR8A 4C62A 5M51A 2IZRA 2AQXA 4Z55A 3W0RA 2I0HA 5TKDA 4A9TA 3BU5A 1Y91A 2ZDTA 3VW6A 1GY3A 2J9MA 4FV9A 4NW6A 3I4BA 2QOBA 2C5XA 2R3OA 4Q2AA 2ITOA 2BRMA 5H3QA 4H3QA 4ZZOA 3IOKA 4O0UA 5ACBC 2ITXA 1JKLA 3Q2MA 1KSWA 3OXZA 3DV3A 3VW8A 4I5PA 4DLIA 4EC9A 3IGGA 2ZV7A 3DBFA 3QQHA 3LHJA 5I0BA 4DEEA 1OVEA 4FSQA 5AM7A 5EM7A 3LIJA 2C6KA 3MWUA 3NVMB 1JLUE 3CJFA 4IIRA 3RPYA 3TNHA 5K0XA 3RCDA 1YWVA 3QYWA 4GMYA 4L3PA 4QOXA 3R7OA 1YDSE 4QP8A 4CFFA 2B9JA 5IMXA 2HZNA 2ZV8A 5C9CA 3FMMA 1OKVA 3CEKA 5JZNA 4ANNA 3KCFA 4YPSA 1UA2A 3OOGA 3EN4A 2W99B 3V8SA 3ETAA 1E1VA 3LXPA 3D9VA 4GIHA 4TNDA 3KK8A 4XG9A 4ERKA 4GG7A 2W1EA 4PPCA 2C6LA 4X2KA 4BC6A 4DHIB 3MPTA 1TZDA 3E87A 4D2PA 3GBZA 1BI7A 2OGVA 1XO2B 2PZ5A 3LCKA 3LFCA 4FNYA 4U9AA 5AUVA 5C03A 4RVKA 4YZDA 4G5JA 4CFVA 4F70A 3GQIA 1K3AA 4FSUA 3U6JA 2HXQA 4JDKA 4JQ8A 5GJFA 1W2CA 4K1BA 5CEOA 4EJ7A 3ALOA 1Q41A 4FIEA 3BYSA 3KREA 5J87A 4NIFB 1YW2A 4FKPA 4RVLA 2LGCA 5EI6A 2YABA 4X2FA 5I9UA 3ORTA 2PMOX 3ORPA 2OFVA 4EH5A 4BL1A 4E6AA 3UPZA 1FPUA 4FOCA 1T46A 4CGAA 3LMGA 4FT3A 4ZSGA 4U5JA 1KE7A 4PF4A 4WT6A 3BHHA 3KRWA 4FE2A 2DWBA 1W82A 2A27A 3BLAA 3UIMA 4JT3A 5DMZA 5ICPA 3DQXA 3QZGA 4G2FA 3H4JA 3FKLA 4MYGA 4L68A 3R7VA 3P78A 3S1HA 4AA4A 5HO8A 4DEAA 3NW7A 1L3RE 4LOOA 3RPVA 5CXZA 4YJOA 4BCHA 3RZFA 3Q6WA 4AOTA 3MYGA 3LXLA 3GC8A 3Q60A 5D7VA 5IPJA 3CR0A 2XARA 4QTDA 1H28A 3V5PA 3ZFXA 2P4IA 4I5MA 4AXDA 2W1GA 4RGJA 4E8AA 5IA1A 2W4JA 3P5JC 2HYYA 4E6QA 2JITA 1OITA 4BTMA 4O2ZA 4Z7HA 5BVNA 3F82A 4WUAA 3D5VA 1NVRA 3E8CA 4P90A 4YZMA 5B2KA 4YURA 4AZEA 2WTKC 3TTJA 2OIQA 3DNDA 2WU6A 2VO0A 4IX4A 2WU7A 4ITJA 2WGJA 5C27A 3UQCA 4C34A 5G1XA 2VWXA 4Y5HA 1ZY4A 1UVRA 2RG5A 1H1SA 2WTIA 3MTLA 4TWNA 2YJRA 1YDRE 5DBXA 3VUIA 3BL9A 4BDDA 5HNIX 2ZB1A 2WD1A 1SYKA 2R0IA 4IBMA 3GNIB 3MW1A 3QQGA 2QOLA 3O8TA 3PXRA 3P7CA 3BHVA 3D7TA 3SOAA 3ZO1A 4ZY6A 3FAAA 5CI7A 4AOIA 2JKQA 2WQMA 4BDKA 2O64A 2IPXA 3F9NA 4FSZA 2BILB 2X8IA 5CI6A 4W9WA 5M4CA 1UU8A 5IQEA 4USEA 4CKIA 1WVYA 2QOHA 5HIEA 4FODA 4O7SA 4QQ5A 5LVPA 2XIRA 2R3LA 3UOKA 3ZLXA 3UIXA 5EOLA 2ACXA 5TOZA 4DEIA 2OIDA 4IWQA 4MWIA 3UZPA 1EH4A 4L7FA 3ZBXA 1QPJA 4O7NA 2PULA 4KUJA 1S9IA 2R7BA 2BHHA 4PTGA 5AR3A 5HX6A 2C0OA 3PVUA 4YMJA 3HP2A 1NA7A 4F7SA 2VTAA 2CKEA 4ZK5A 3WF8A 4I5HA 3WZUA 4FT5A 2VTOA 5CT0A 1VJYA 2Y0AA 4EORA 3ORLA 4QP3A 4FTLA 3F2AA 3C4CA 3GU8A 3ZRLA 5HORA 2Y6MA 4I22A 5LARA 3NSZA 2YIRA 3FKOA 4JR3A 4KAOA 5DEWA 5A9UA 4FYNA 2GNGA 1LP4A 4OT6A 5FBNC 3D5XA 3G0EA 4X3FB 4ANOA 4M69A 3VS6A 5LXMA 4BYJA 5IA2A 3OCTA 2RKUA 5AR5A 1JQHA 2ITUA 4AOJA 3GOPA 5BUJA 4MNEA 4XOYA 4C4GA 4MBIA 2VWWA 2B1PA 2I6LA 2YCFA 1M52A 4L00A 4UXQA 3UC4A 3V5WA 3QKMA 3HYHA 4PPBA 5LMAA 2X39A 2JFLA 4OTPA 5IQGA 2A98A 2B52A 3EL8A 3ORXA 1B6CB 3VF8A 4F9BA 4R3PA 2PSQA 4QYHA 2YLFA 5I5ZA 3PXFA 5CEPA 4ALVA 1U59A 2VU3A 3OBJA 4EQUA 4DEGA 3H30A 5HHWA 4R5SA 5HTIA 3D2KA 3N51A 4GJ3A 3W2RA 4LOQA 2JBOA 2X8EA 3FL5A 2ETMA 2ITPA 4C38A 3ROYA 3NUSA 1H27A 4ZOGA 4ZJJA 2XNOA 5JT2A 4M7IA 3LQ8A 2O65A 3JY9A 4JG7A 5CSWA 5KBQA 3IW6A 1XKKA 3PY1A 4BI2A 1TQIA 3FQHA 4ASXA 4HGTA 2ZOQA 3QCSA 5AIRA 2RL5A 5GINE 2QG5A 1KOAA 5KMKA 4BWXA 4YHFA 3WI6A 4F99A 3LFEA 4O1OA 3RWPA 4ID7A 1P14A 3OMVA 3Q4TA 4BBFA 4PNKA 3MI9A 2UZNA 4IVBA 3ZDUA 3ZRKA 5D9HA 3W10A 5AFVA 4GYIA 3SXSA 3ZLWA 3F5PA 4A9YA 4CFUA 4YJVA 2EB3A 5LVNA 4O83A 2J2IB 4RJ4A 4I1ZA 4DGLC 4I21A 5KX8A 2ITZA 4CKRA 3BIZA 3ORKA 1XR1A 3UMXA 4BGQA 5KKRB 5M56A 3JYAA 4W4WA 2JAMA 3BLQA 4M0YA 3TTIA 2GQSA 3MH0A 5DA3A 3N4TA 4YHTA 3DBEA 4O27B 4OW8A 2QOCA 2QOQA 3PUFC 4G1WA 2CN8A 3BYOA 3R7YA 2ZAZA 2IVVA 3G6GA 3GXLA 1Q62A 1GZ8A 4Y73A 3EFJA 4FZFB 3PJ3A 3BL7A 5CVFA 3FQEA 2E9OA 4R6VA 2XRWA 3OTVA 3ENMA 3EKNA 1Y8YA 3LZBA 4FG9A 2ITQA 2C68A 3CTJA 3IDBA 4I4FA 2WHBA 2V22A 4OTQA 5AV2A 4NU1A 1UNHA 4YJQA 2F57A 4CRSA 3GT8A 3BEAA 2PVJA 4NUSA 5IUGA 5CT7A 2VTTA 3VVHA 5CF4A 2XIYA 2G2IA 3O51A 5AP5A 3C4FA 4ZSAA 3AD6A 3PSCA 1FMKA 5ANGA 4APPA 3FHRA 3BGPA 4KIQA 2PPQA 2X6DA 2UW6A 4KD1A 5HVKA 2OJGA 4N0SA 2PZPA 3OT3A 4L9IA 4WA9A 3KGAA 4F09A 4ZTMA 5LMKA 2OFUA 3DAKA 1YDTE 2C1AA 2YIQA 3NEWA 3QBNA 4RA5A 5AUWA 3Q5ZA 3Q52A 4UMPA 3A7HA 4JNWA 4C59A 2CNUA 3R9OA 3NIEA 3WILA 3PPZA 5IMEA 2Z8CA 4ENYA 4J7BA 3PPKA 4FRFA 4MBLA 4ZY5A 1V0OA 2XS0A 3VWAA 4BCQA 5J1VA 3IDCA 4KS8A 4DG3E 1PMEA 3F7WA 2QC6A 2UW5A 2Y9QA 2VWIA 4ANQA 2YDIA 2OLCA 4NCTA 4LGGA 4QMOA 4JRNA 4XBUA 3P08A 2UZLA 2WQEA 3P86A 4PTCA 2P55A 4R3RA 3P9JA 5FLFA 4AG8A 3FC1X 3A61A 3S2PA 2W7XA 4J1RA 4MD8E 3RPRA 1CMKE 4WBOA 5D11A 2IO6A 2PVYA 3MH1A 4AF3A 4D58A 1LUFA 3WE4A 4KB8A 3KXXA 4KKHA 4EK5A 3LCSA 1A48A 4Z3VA 2YM5A 3LFAA 2KTYA 4O7RA 3W33A 2CNQA 4BKYA 4BIEA 4DTAA 4YSMA 4XHKB 3T3VA 3DLSA 5LVOA 3RINA 3IOPA 2FH9A 4O0VA 3UYSA 4D5HA 2XA4A 1JVPP 4BYIA 4HCUA 1H1PA 2UW4A 2VRXA 2XRUA 3W18A 4BZNA 4NTTA 4XYFA 3F61A 1WFCA 5E4HA 2PMLX 5CS6A 3ELJA 5AJQA 4K8AA 3RM6A 2BKZA 2C47A 3KMMA 4RWKA 5DRBA 3TCPA 3LFNA 4PRJA 5FTQA 4HZRA 4L3JA 3OROA 5CZIA 2FB8A 3NRMA 3QTZA 4JAJA 2C5NA 5FXQA 5DI1A 3WIKA 5A6OA 5DHJA 3GU7A 4B99A 4MD7E 4RQKA 4V05A 4QP9A 4EH2A 5A4CA 1P4FA 4BDAA 5CXHA 5F20A 3OHTA 2WMSA 1K2PA 5FD2A 2JGZA 4MH7A 1PRYA 5TR6A 3PXZA 3KN5A 4HNFA 4OT5A 2CGXA 5D41A 4BFMA 4CTBA 5LMBA 4Y85A 5TT7A 1KE6A 2BAJA 3NUAA 1HCKA 3R04A 5HOAA 4EOSA 4MXYA 4L8MA 3GFWA 3FQSA 3EH9A 5GZAA 3GCUA 5C8KA 2O0UA 4ANMA 3U51A 3PJ1A 2ETRA 3EFLA 4D1ZA 4NKAA 3MVMA 3FWQA 4OBPA 2OSCA 4W9XA 2JAVA 5DNRA 1UU7A 4FV6A 3K3JA 5HVJA 3DJ6A 3G51A 4TN6A 2A4LA 5BPYA 3MFRA 5I9XA 4D2TA 5M4UA 4FOBA 3V5LA 4XG6A 4FVQA 4PPAA 2V7OA 3CPBA 4G6LA 4E4XA 2WFYA 4RJ6A 4C3PA 4JDHA 4YLJA 3ORZA 5AUUA 3AKJA 4GCJA 3NS9A 3L8SA 3OXIA 3A4OX 2WTVA 2AEGA 3RM7A 3Q9XA 3K5UA 4K2RA 4Y95A 1PMVA 3KKVA 4D5KA 5A4TA 4G5PA 3QWJA 4ZSLA 4R7BA 1YQJA 4M14A 4F7LA 3C4WA 2WMRA 5GNKA 2GNLA 3TNQB 1U5QA 1G8KA 2WB8A 3I0QA 4MXCA 1I44A 3FPMA 4GVJA 5ITAA 4C2VA 4I94A 3EN7A 3V5JA 3QCXA 4DYMA 1XH7A 2JC6A 3PIYA 2J5FA 4O0TA 4RA4A 2FUMA 2UW3A 5ANIA 4C58A 5CAOA 2O2UA 3PA4A 3EOCA 2V5QA 3AC3A 3ZMMA 4F9WA 1WBTA 5JEBA 5KMLA 2X0OA 5GZ8A 4B8MA 3CE3A 3DXPA 4IM2A 4CT2A 4GU6A 2GHGA 4UBAA 3RK5A 4ACMA 4TT7A 2YZAA 4DEBA 3U8WA 3HECA 5EKOA 4QMUA 4R77A 3QQFA 2W1CA 4O6LA 3VS2A 2VV9A 3NYVA 3ZDIA 2CKQA 1QMZA 4EZ7A 1XBBA 3CJGA 4F9AA 1B39A 2GNFA 2JBPA 1FVVA 3L9MA 5CNOA 5FP6A 2ZYBA 3EQCA 4TWPA 4CZYB 4C4HA 5JGBA 4L46A 3OFMA 4C7TA 2Z02A 3AC2A 3GC9A 3UNZA 3GB2A 5GJDA 2BPMA 3W2QA 4S34A 4F0IA 5HG8A 4GEOA 5IUIA 4DFLA 3CD8A 3E8EA 3DKCA 4GFMA 3QL8A 3VS0A 2WQOA 3LOKA 4RSSA 4ZLYA 5JFXA 4YNEA 3VBTA 4DTKA 4ALWA 1X8BA 3VS3A 3NYNA 2XM8A 3VS4A 1QCFA 4L53A 2VO6A 1OUYA 4CFXA 4AS0A 4USFA 4DHJA 5C4KA 2H8HA 2C5OA 3UVQA 1Q5KA 4FGBA 4AZSA 3RAHA 2AC5A 4O6EA 4CMOA 1F0QA 2ONLC 5CAQA 4AT3A 4IWDA 3DK7A 4JBVA 5HNGA 2C6EA 3UGCA 2HY0A 3AT3A 3BV2A 2WIPA 4J97A 5DVRA 5K4IA 5EM8A 4C4FA 4IADA 1IR3A 2PUPA 3U9CA 5M55A 1BX6A 1U4DA 3JVRA 2R64A 4RC4A 3N9XA 3ZM9A 1IAHA 4FNZA 4IDVA 4D28A 2C6DA 1LEWA 2CGVA 3BBTB 3KF7A 3QRKA 3THBA 4GRBA 1YWNA 5JFVA 3R8PA 4BJJB 4JQEA 5AA8A 4TYHB 2QO7A 2CHLA 4UWYA 4BKZA 2PMNX 1WCCA 3R1QA 4ENXA 3W8LA 4N4SA 4DGGA 2J4ZA 2XNNA 3ANQA 4XOZA 2W5HA 4F08A 3LKMA 3V04A 3PXYA 2PUNA 3KULA 4NSTA 4UXLA 3DBDA 3RALA 4A9RA 3RBWA 4D4YA 3IQ7A 4WSYA 1QPCA 4NKSA 4NFNA 2QOOA 1I09A 2EB2A 4IVDA 4RIXB 3RTPA 5I9YA 4V04A 3UZRA 4DBXA 3IW5A 3COHA 4TYGA 4C4JA 4G3EA 4AWIA 2XANA 4X21A 1XMMA 2ITWA 4XG8A 4U79A 5AP1A 4HGEA 3R9DA 4HYIA 3UQFA 4CFMA 1WBPA 4KIKB 4F9CA 3Q04A 4IE9A 4FKLA 3Q9WA 5HE3A 3ZCLA 3QHWA 4PP9A 2YM3A 4ACHA 3KXGA 3QKLA 4FC0A 3OWPA 1MUOA 2ESMA 4PMSA 5JH6A 1BKXA 2OF2A 3EN9A 4R78A 1YWRA 1XBAA 2VGOA 2IW8A 4BHNA 1JKTA 3W0NA 5HCXA 1JAMA 4PUZA 4XUFA 4WNMA 5ANOA 4D55A 3QQKA 4J8NA 3OP5A 1H4LA 3R6XA 2C5YA 4F1TA 2DQ7X 2QONA 4ZS0A 1BL7A 2WMAA 4LV7A 5HE1A 4RZWA 2PVLA 3QA0A 3W0PA 3FC2A 4FL2A 3AQVA 3EIDA 4GYGA 4I4EA 1OL6A 3M1SA 4IM3A 5HIBA 3V6SA 4M68A 3NZ0A 4F6UA 2OXYA 4S30A 3AT2A 2XIZA 4BCGA 4O7VA 4EYMA 5IA3A 2OIBA 4DFBA 4G34A 1GAGA 4LQMA 5E92A 4GS6A 5HU9A 1OZ1A 2H96A 4IB5A 4FK3A 2QG7A 1UNLA 3UP7A 1FBNA 1OL7A 5J5SA 4IZ7A 3EWHA 4AACA 3KMUA 4RX8A 5JRQA 4UMRA 2PVKA 2XM9A 4EOJA 2YA9A 4KBKA 4C0TA 4FK6A 3QA8A 2X4FA 3DS6A 3QUPA 2CKOA 3EQRA 3IKAA 4RIWB 4WO5A 2Z7SA 5BX0A 4YSJA 3IW4A 2WELA 4JJRA 3QZHA 4FEQA 2OJJA 4KS7A 3A2CA 4IHPA 2QODA 1REKA 4RVTA 4U3YA 3RKBA 4BDEA 1MP8A 3MGYA 5IEXA 2F2UA 4AU8A 4EBWA 1ZAOA 1DAWA 1ZYLA 2BAQA 3WYXA 4BDCA 3QWKA 4JAIA 4EWHA 1A06A 3FSKA 5JQ8A 4L7SA 4D9UA 5KHXA 2UZOA 1H01A 3KVWA 3R7EA 5CF8A 2RFEA 3TM0A 2WMUA 1L8TA 3Q9YA 4GW8A 4MVFA 5FWKK 2CCIA 4QMSA 3CSVA 2HIWA 3FHIA 4RC2A 4C02A 2IZUA 3LJ1A 5HLNA 3D4QA 4J71A 1ZMVA 3VQUA 4NCTC 2JEDA 3VAPA 1E9HA 4CV8A 5FTOA 3GCQA 2JLDA 3PJ8A 3TKHA 3LQ3A 4U97A 2GS6A 2W4KA 4YNOA 1OECA 4EK6A 3WF7A 5CVHA 5HICA 4HVIA 2GDOA 2EUFB 1W7HA 3C4ZA 4IB0A 3RNIA 1GZOA 4NM5A 4FSMA 4AGWA 3QD2B 1GZNA 1Q8TA 2XBAA 4O4FA 5CU3A 5HLWA 3ZC6A 2J90A 2I7QA 2GTNA 4XLIA 3D2IA 4Z16A 4BZOA 3BE2A 3DBCA 4FIJA 4IEBA 2VO7A 3NNWA 4IZ5A 2XF0A 4KNBA 4U3ZA 5KZIA 2G2FA 1M2QA 3KY2A 4UMUA 1KE5A 4E1ZA 1HCLA 3I79A 2I0VA 4AW1A 1KE9A 1R1WA 4J99A 4G3GA 4EWQA 3FV8A 4L67A 4QPSA 4R5YA 1CKPA 4U41A 4DBNA 2BZKB 4E20A 5HTBA 4XG2A 2YEXA 2R0UA 3LFQA 2VTHA 4NFMA 1FGKA 3QRIA 3TEIA 3UJGA 2B55A 4DH5A 3QRUA 4BY9E 3WF5A 3IONA 5D7AA 2ITNA 1UWJA 3ATTA 3ZSGA 2W05A 3U54A 4M84A 1MRYA 4CV9A 4M97A 4AP7A 5LCKA 2WOUA 4OR5A 4E6DA 3FMEA 3C0HA 5ETCA 2X2LA 5CAPA 3G15A 4E4LA 2XKCA 4QTBA 1H26A 2YIWA 3O96A 3RK7A 2WAJA 4KABA 3ERKA 4QP7A 4RWIA 3OY3A 5AX3A 1RJBA 5CEQA 5JZJA 2XALA 4AXCA 3VBYA 4FI1A 3COIA 2WNTA 5KCVA 4QYGA 3O5AA 3TNPC 2XCKA 2ITYA 4S32A 3RAKA 3AC1A 3VBXA 3EB0A 4FV3A 2YITA 3HV7A 2QU6A 3KU2A 4GK3A 3LE6A 1KV1A 3R00A 4QTCA 3TNIA 3BKBA 3DDPA 4AAAA 4OAVB 4ZS4A 4U42A 2J51A 5AUTA 4OTIA 1LR4A 5HBJA 3HDMA 3HLLA 4GU9A 4KRDA 3DLZA 4TYJA 3VIDA 2R3GA 5HE2A 5AA9A 5J9ZA 5CQUA 5IH6A 3KMWA 3CCNA 2WZJA 5IA5A 4YC6A 4LUDA 3DFCB 4DLJA 5K5NA 3M42A 3O71A 2A1AB 4GSBA 4KWPA 4RBLA 4RX9A 2PYWA 1RW8A 2PU8A 2XP2A 3FY0A 4EONA 4CYJA 4S31A 2R3KA 3SXRA 3TG1A 4I5CA 3CGOA 5M06A 4XP3A 4L43A 3SC1A 3NWWA 4E3CA 4F7NA 4FV8A 4HVHA 4RWJA 3FE3A 4H3PA 3ZZEA 4AZTA 4D1XA 4AQKA 5L2WA 2YWVA 3DY7A 3Q4UA 4JVGA 1H25A 3L9LA 4WNOA 5C8MA 3FI2A 4OBOA 1GIIA 1MQBA 3SAYA 4QMVA 3QC4A 5CLPA 4QNAA 3HMOA 4FTIA 3BHUA 4CZUA 1YHVA 2FGIA 5DT4A 3NCZA 1Q3WA 3A7GA 3BU3A 4M13A 4XNEA 5I3RA 3NFGB 1IAJA 1R0PA 4II5A 2OZAB 4ZEGA 3QU0A 4EQMA 3G2FA 2VD5A 3PSDA 4I24A 4LYNA 5AP4A 3C51A 4HYUA 4XS2A 2WMVA 3L9PA 2X8DA 2GMXA 2WTWA 1JPAA 4QP2A 1OUKA 2OK1A 3E88A 4AT4A 2OZOA 1FINA 2X2KA 3RI1A 1ND4A 5IQDA 2Q0NA 3ZONA 1PW2A 4QPMA 3QTRA 5IEVA 3E62A 4G9RA 4E5WA 2VO3A 4FKWA 2YCQA 4LGDA 4CXAA 4BCPA 4D4RA 4IJPA 5ETFA 1J1BA 2R3PA 4PQNA 4HVSA 4F7JA 4EHGA 4ITHA 2JDTA 3DJ5A 4ANBA 4BGHA 3SXFA 5BUIA 4RIYB 3VS1A 1TFFA 1QPEA 3ZXTA 3FMNA 5K3YA 1SZMA 2WTCA 5AV1A 1Y6BA 1W0XC 3DTCA 3SG8A 3NUYA 4FIGA 4KINA 4EKLA 3RNYA 5H8BA 2P0CA 4AZFA 5F95A 3Q2JA 4E6CA 2B9FA 3MTFA 1ZXEA 2X0PA 4X3FC 1WVWA 1OM1A 2I1MA 3SRVA 2DS1A 2UW7A 1GIJA 3R9RA 4EK4A 4Y5QA 5BYZA 3WOWA 4D9TA 5J9YA 2VNYA 3DB8A 4O7LA 4EOQA 3GCPA 4G16A 3I6WA 1STCE 4YGAA 4XBRA 3TUBA 4X6RA 3IO7A 2OXDA 3AMYA 2F4JA 3VC4A 3TDWA 3WZJA 5C4LA 2JD5A 1JOWB 2YWPA 3W2OA 4BICA 5CAVA 3UODA 5HESA 4EBVA 1FQ1B 4LRKA 2FVDA 2XKDA 2BAKA 4QQJA 5HCYA 1OKWA 3U4UA 3WF6A 3OEZA 5K4JA 4LRMA 2XEYA 4IC7A 3F5UA 1PY5A 5EI8A 4G9CA 4JLCA 4FVPA 4EHZA 2XYUA 5F9EA 2ONLA 3PUPA 2X81A 4QMYA 4RMZA 3TIYA 4EUUA 2CCHA 1Q8YA 3OWJA 3QD0A 4EH3A 2WTKB 3R7UA 3HUBA 4QMLA 4E4NA 2BDJA 4W8DA 4UN0C 3FL4A 4RVMA 3ACJA 2PY3A 2EXMA 4TWCA 5J95A 2PZRA 3ULZA 3R83A 3GP0A 3W1FA 1OIQA 3KB7A 4FL3A 3AD5A 3A8XA 4GL9A 3EQDA 2W1IA 4I6FA 5BVDA 3HAMA 4BCMA 2C0IA 2ZMDA 3V5TA 3G6HA 5CY3A 3ALNA 2X2MA 2BHEA 4X2NA 2HWPA 2GCDA 3C5UA 3D94A 1Q8WA 2CMWA 4IFGA 1YOMA 2J0MB 3ZFYA 1OKYA 4C35A 3UOLA 3SDJA 3U87A 5T6KA 3NW5A 4O21A 4WBBB 4NJDA 4IB1A 2BZHB 2W1DA 4QMTA 3OW3A 2HELA 4QP6A 2XYNA 2ZJWA 2G2HA 4JR7A 2VTIA 3FSFA 3D0EA 1O9UA 2UZEA 4JOAA 4AW2A 3TJDA 1URCA 2C3KA 2BKKA 1XJDA 3LCDA 4FSWA 2UVZA 3L8XA 5IF1A 4QYEA 4BF2A 3KF4A 5KKRC 4R8QA 1W2FA 3R73A 4H1JA 2BFYA 5EK7A 4A07A 4DINA 4YTIA 3WZEA 2BMCA 3VBWA 2XEZA 4J53A 4O7WA 3UNKA 5LQFA 4OTRA 1Q3DA 2ZM1A 2QKRA 4F63A 5T3QA 3V3VA 3AC5A 5IG1A 2BRNA 2C69A 4P5QA 1NXKA 3OD6X 3QX4A 3GEQA 3TV7A 3Q53A 4DHZA 2YDJA 5IH4A 1Z9XA 1UU9A 2OH4A 3IGOA 3ZSHA 2QO9A 5EQEA 2CPKE 3FDNA 2W1HA 3KCKA 1UWHA 2BIKB 3GGFA 2FSMX 4XEYA 5HG5A 4YBKA 2QNJA 3TKUA 3E92A 1KE8A 1ZYSA 4ACDA 3W2SA 5CF6A 2WXVA 3BLRA 3UO4A 3SW4A 4FVRA 4WSQA 3UDTA 5DEYA 5JFSA 4IM0A 3AGLA 4ZP5A 4OLIA 4AX8A 4NW5A 2PK9A 2QOKA 2BDWA 4RIWA 5K0KA 4YJSA 3VBQA 4ZZNA 3AOXA 3PWYA 1T45A 4UYNA 2XVDA 3C50A 1G8AA 2BRBA 5DT0A 4O7ZA 1RDQE 1U54B 1XHAA 3NUXA 2JKKA 4I41A 5CZHA 4IFCA 5AMNA 3UIUA 2VAGA 3PA3A 1G5SA 2XKEA 4EH9A 5IQCA 5CYIA 4I0TA 1J91A 2GS2A 2R3JA 5H9BA 3O50A 3MPAA 4EOOA 4GVAA 3OXTA 4JIAA 3LMHA 4BTJA 1WBOA 4PDYA 3GU6A 4AN9A 3QAME 4ACGA 4EUTA 4LOPA 2J5EA 4EOPA 2WMBA 3R8UA 3LXKA 3KVXA 5HKMA 2OBJA 5L8LA 2PE2A 4TRLA 4G3DA 4BDJA 3F88A 3L8PA 4BR3A 4ZTSA 3F5XA 4ANSA 2B9IA 3BYVA 3TYKA 3A7JA 2FO0A 2JFMA 5E8WA 1ZZLA 4UZHA 3RP9A 2HW7A 5KMJA 2I0YA 3H9FA 1Q4LA 4YP8A 4D2RA 3BE9A 3WE8A 3POOA 1NVQA 3FZPA 4AQCA 2GFCA 3PPJA 5EYDA 5E1EA 3VN9A 4P4CA 3UYTA 4CT1A 3CP9A 1AD5A 5A6NA 3KL8A 2H6DA 1ZY5A 3COMA 5EH0A 4TYIA 3JUHA 2B7AA 5B0XA 3MPMA 3V51A 4QMNA 4DFYA 5KMOA 3I7BA 3JVSA 5AIKA 1BLXA 4NJ3A 4EH4A 5IDNA 2PWLA 1Y6AA 1M2RA 3BBWA 3I5NA 4IAIA 4Y72A 4UB7A 4OAUC 3A7FA 3ZUTA 3FMJA 4KKEA 5L2IA 5LOHA 1ZWSA 4ZSEA 1Y57A 2P3GX 2QI8A 1XQZA 2PVHA 5JQ5A 2QLUA 4AFJA 3HMPA 2UZDA 4ASZA 5AV4A 1VR2A 3CY2A 4JS8A 4XCUA 1NT2A 2GTMA 3KXNA 4FIHA 3UDZA 1G3NA 4K18A 1NVSA 4FTAA 3HL7A 3I0OA 4YLKA 3IS5A 2JKMA 2QO2A 4FV7A 1H1WA 2O8YA 5FDPA 1RQQA 4FF8A 5HNBA 3VRYA 4D4VA 4C8BA 5CSVA 3UNJA 4E5BA 4YO4A 3W0QA