5CASA

Egfr kinase domain mutant "tmlr" with compound 41a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
324
structure length
299
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 92
structure length 299
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5casA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5casA01
2BTRA 4JBPA 2BILB 4QP9A 3DPKA 3MYGA 3HECA 4UN0C 1PHKA 2UV2A 1OL6A 5GJGA 4MK0A 5C8MA 3DLSA 4BGGA 3E7OA 4EZ7A 3LQ8A 4WSYA 5JN2A 2WELA 3UIUA 2GQGA 4XOYA 1JPAA 4D0WA 4OBQA 2XF0A 3UVPA 2ZB1A 3F5PA 4KINA 1UU3A 2ONLC 3EYGA 4E5WA 5D7VA 5IZFA 4E6QA 4RJ8A 1OITA 3QUEA 3HLLA 2FH9A 2VZ6A 4AN3A 4FC0A 4TWPA 4O7TA 4XOZA 4BBEA 4YZDA 5EYCA 4BDEA 3F2NA 4KB8A 4DTBA 4IVBA 2I40A 3NW7A 4KBKA 5EYDA 5EKNA 2J5EA 4FEVA 4NJDA 2IW9A 2XK8A 1XQZA 2IZTA 4X6RA 5HESA 4Z7GA 4OGRA 4TWNA 4II5A 2X2LA 3RHXA 2BRMA 3PXYA 4K18A 4EJ7A 3EFWA 4PTCA 3D14A 2JKMA 4WNMA 4ENXA 3PG3A 2CKOA 3MB6A 2G9XA 3I79A 3NCGA 4O2ZA 3JPVA 3UO4A 5KMIA 4RIYB 2Q0BA 1U4DA 4S34A 4QTAA 4ZSJA 5BVFA 4KIOA 4FNWA 3R01A 4FICA 1FVTA 3P5KA 3UC3A 2NP8A 3OY1A 4EWQA 4CMUA 3QRKA 2B55A 4F99A 4YJRA 3MDYA 3PSBA 4M15A 1Q8UA 3F5XA 3RINA 2WOTA 2ETKA 4RGJA 5HBHA 2X8EA 4A9RA 2QO2A 3I6WA 2W4KA 3PIZA 3GC7A 2PE2A 2VWYA 1GZNA 5DR9A 4QYYA 1XH4A 4OAUC 2H8HA 3CPBA 4NZWB 3R9NA 2CGWA 2H9VA 4EOLA 3F7WA 3R73A 3HV6A 4D9TA 1PW2A 2JBPA 4D2PA 1BMKA 4C38A 2I6LA 2X4FA 4XG9A 4ACCA 1PKDA 4I4EA 1YDSE 2A4LA 2Z02A 2PZ5A 5HLNA 4IX4A 2C30A 2J0IA 3EYHA 5DT3A 4TXCA 4ZEGA 1OUKA 5HVJA 1KE7A 4DFBA 3WZKA 4ZS4A 3COMA 2B9FA 1IRKA 2QR8A 3IPHA 2G2HA 3NEWA 2UW6A 1GJOA 4M69B 4AT4A 4C61A 2E2BA 4AT5A 5IF1A 4XG2A 2HK5A 2JBOA 3O8PA 4QPMA 4XRJA 4BDGA 1YRPA 4Q2AA 5EKOA 4O7ZA 4YBKA 5J87A 3RM6A 4NCTC 3D2KA 1F5QA 3VQUA 4BHZA 3II5A 4O91A 3UYSA 3R04A 3U4UA 4MCVA 2G2FA 2W7XA 3U9NA 3PVWA 4I3ZA 2C1BA 3UIXA 3G9LX 3OWJA 3VRZA 2C47A 4C4FA 2OF2A 3JY0A 4NFNA 5AUTA 4JX7A 4F9CA 1TQIA 4BTFA 3R8PA 4I0SA 3WZUA 4CZYB 4ANMA 3DAJA 3DJ7A 1YXVA 1KSWA 4LV8A 4FTIA 4NYEA 2P2HA 3F69A 2YWPA 5A14A 3MFTA 4JDJA 5CQUA 5BYZA 5IA1A 4C62A 3R7OA 4TYHB 2C3KA 3PLSA 5LWNA 4QMLA 4QQCA 2QI8A 4D4VA 3OHTA 3DKCA 4NKSA 2HYYA 5IEXA 5TKDA 1H1RA 2IJMA 2G15A 5DRDA 1Q97A 5AADA 1M2QA 1P2AA 5FP6A 4KD1A 5FXQA 1GIHA 1R39A 2UZEA 3I7BA 3HMOA 2BALA 4G3EA 2XCHA 1LEZA 2UZLA 3CE3A 3V6SA 1BX6A 3QTWA 5AJQA 4DBNA 4FTLA 3LCKA 4FV3A 4ASDA 5L6OA 3HV4A 4DTAA 4FIFA 2O8YA 4YZNA 5JFXA 2LAVA 4BR3A 3AC2A 3MS9A 3BHVA 2ITZA 2UZVA 2R0IA 2WMWA 4JAIA 4WNOA 4FTCA 4AZSA 4FKPA 5AMNA 4ZSGA 4R7BA 3BHHA 1SNXA 2ETMA 3PY1A 5ANEA 4J8MA 3CTJA 2WKMA 3QGWA 4FVQA 4JLCA 2X7GA 3ROYA 2B0QA 4PY1A 2CN8A 2Y7JA 3BGZA 2CSNA 4GK4A 3AT4A 4YLLA 3WIKA 4GH2A 4ONAA 4TYIA 4TZRA 4MKCA 2I1MA 2PE1A 3EJ1A 4Y46A 2JAMA 3GGFA 1LP4A 3ITZA 3EFLA 3SOAA 1F3MC 4PMPA 4ORKA 2OJFE 5M4IA 2X2MA 2XEZA 2ITUA 4IC8A 4EH7A 4KAOA 2YJRA 3DJ5A 4IADA 2XNEA 2RFDA 2WMTA 2R64A 3VUDA 1E1XA 4EUTA 4EBVA 2CNUA 3IOPA 4GW8A 4CFXA 1ND4A 2ZAZA 4M3QA 4F64A 5A4EA 5J79A 5KMLA 3QHRA 2ITYA 5CT0A 1WBTA 4JBOA 4TY1A 4AA5A 3L8PA 1ZARA 4YC3A 5IMEA 2R3GA 5DR6A 5HHWA 3RCDA 4QMUA 4ZSEA 3BQCA 4JIKA 4QTEA 4UEUA 2WTIA 2YERA 5ANOA 4FTQA 4E4NA 3HMIA 2E9PA 2ZV9A 3EQBA 4X3FC 3A60A 4JR3A 4M69A 5ANIA 3EL7A 4BTMA 1YW2A 1Q41A 3ORTA 3OWLA 3WZEA 4IDVA 4EH6A 4IX3A 4TW9A 3U6JA 3QTZA 5J9LA 3MW1A 4F08A 1ZMVA 2PY3A 3HL7A 1R1WA 3QLFA 2C5YA 3E63A 1ZMWA 1SVHA 5EM5A 3C9WA 3KN5A 2RIOA 1U59A 5K5NA 5G1XA 4BCOA 2UW9A 2WMAA 5IH5A 2C3IB 4NCTA 2J2IB 4QYGA 3I5NA 5AP2A 1M14A 2E9NA 4BDBA 4M97A 4DBXA 1GIIA 3DT1A 4KKHA 4X2NA 1BYGA 2OIBA 3ODZX 4B4LA 4A9UA 3H9FA 4A07A 4XH6A 4RFMA 1SYKA 5DGZA 4TYHA 2QG5A 2OZAA 3PXZA 3I5ZA 3Q5IA 3D2IA 4LUEA 4EQUA 4E93A 5DNRA 1LR4A 3Q9ZA 3WOWA 5M4FA 3U6HA 2R3KA 4RRVA 2ZB0A 4IW0A 3F9NA 3LFCA 2Z7QA 5FM2A 4PTEA 4EC8A 3FL4A 2VTRA 3UOHA 2EXMA 3QQLA 4USEA 5I9XA 4A9TA 4LL0A 3PFQA 3DFAA 3ELJA 4ALWA 4PV0A 2PULA 5K5XA 2OJGA 2PMOX 4JVGA 3PJ2A 3ULZA 4AWIA 2PUUA 4D2TA 4D4RA 2WFYA 5JFWA 1PXMA 1URCA 2YEXA 4BI2A 3UPZA 1Q61A 5B0XA 3R9HA 4FSMA 5HEZA 4Z3VA 4D2VA 4EKLA 3OT3A 3PJCA 4C2VA 4RLKA 4RMZA 1RQQA 1GNGA 4S33A 3FMKA 5KX8A 3D4QA 4BCIA 2BZKB 3G15A 2CGUA 4L46A 5HCYA 5CI6A 5KKRC 4DCEA 4IZAA 4E6AA 1J3HA 2BCJA 4RJ5A 4W4YA 4HW7A 5IU2A 2PTKA 3C4XA 3F3TA 4FZ6A 2GFCA 2OKRA 3QC9A 3VBQA 4ZTNA 4F6UA 3RZBA 5M56A 2VO3A 3NUXA 4B8LA 3PA5A 2V55A 4DN5A 3SRVA 3TKIA 3ZSHA 4NTSA 3VW8A 2JGZA 3NR9A 4CYIA 3FMNA 3BZ3A 2WAJA 4I21A 4EHEA 3ZCLA 3VHKA 4DYMA 2ESMA 2C0TA 3ZONA 5ETCA 4KNBA 5FWKK 2XJ1A 3ZLYA 1OBDA 1CM8A 3NRMA 2XYUA 4XNEA 1VYZA 4R3PA 4PDSA 4HCUA 5AM6A 2Z60A 4F09A 4ZAUA 2A1AB 2I7QA 5EQEA 2I0HA 4V0GB 4LL5A 1Y6AA 3O96A 2XIRA 4NWMA 2HZIA 5HG5A 3ZHPC 1UWHA 4G9CA 4GU6A 4XRLA 1K3AA 4O2PA 3RPSA 2PVYA 3SW4A 5T68A 4EWHA 1DI9A 2PPQA 3FSFA 4EH5A 2YFXA 5FEQA 4RJ6A 3CKWA 3KK8A 3TDVA 3DKOA 2P4IA 2VTAA 3OUNB 2C6OA 3OMVA 4IZ7A 5IEVA 4QMTA 4LYNA 5H2UA 4QQ5A 3QHWA 4YZBA 4ITIA 3FMLA 3CS9A 4Z9LA 4DEAA 1ZYSA 3NNVA 3VS7A 3ZUUA 3L8VA 2AUHA 3SA0A 3FMJA 1Q8TA 3FEGA 3TV7A 4CCUA 2R0UA 1M7NA 3PIYA 1CTPE 5DE2A 3VUHA 1Y8YA 1FMKA 1ZLTA 4WSQA 4WRGA 3HGKA 5DIAA 4FZAB 2GQRA 3PVGA 5CSHA 4PPAA 4RVLA 4FTRA 2WEVA 4O0YA 5AR4A 3R8MA 5C8NA 5KE0A 4JNWA 4CVAA 2SRCA 2CNVA 1WBOA 4W4XA 4L67A 3TUCA 2C68A 5DOSA 3FYJX 4CKRA 4DF3A 2W1DA 3ZSGA 3QC4A 4U42A 5TE0A 4IHPA 3ZH8A 4CRSA 2FUMA 5KZIA 3C4WA 2JAVA 5I3RA 1UVRA 4XS2A 3W16A 4CLIA 1WAKA 4JT3A 3QL8A 3R1NA 4G6LA 3GI3A 4PL4A 2BDWA 1WBVA 4RVKA 5GIOE 1E1VA 2VTTA 1PKGA 2IN6A 1Q3DA 4YBJA 3R7IA 4ZSLA 5FTOA 3NLBA 5AR3A 2YIQA 2YN8A 4WNPA 3R2YA 3G6HA 5CX9A 4YO6A 4X6QC 1ZMUA 2PZIA 2RG5A 4RFYA 4H1MA 4R7HA 3FQHA 2E9VA 4YC6A 2EVAA 2HWOA 4C3FA 4MXAA 4MNFA 1DS5A 3QLGA 3L9PA 4PX6A 2W5HA 3ANRA 3MI9A 5DI1A 3U9CA 3HV5A 3IOKA 2XK9A 3GU5A 3SHEA 2WMQA 3E88A 3QQFA 1QL6A 3LMIA 2QQ7A 3V5TA 1G5SA 4U43A 2G2IA 3OP5A 2XIXA 5BVNA 4DGMA 2JD5A 4RIOA 1IEPA 3A7GA 4CGAA 4EK6A 3AG9A 4U45A 4CV8A 3A7IA 3PVBA 1KE8A 3ZMMA 1XBAA 2HZ4A 5HE1A 1ZYJA 5K4JA 5CSXA 5GZ9A 1WFCA 3ENHA 1OIQA 4FUXA 1ZY5A 4FUYA 3MY0A 2QOLA 2V22A 2UZOA 4BCKA 2VWZA 2Q83A 5FXRA 5E4HA 3HV7A 4MNEA 2GNGA 1SZMA 5E1EA 2HXLA 5JZNA 2PVLA 3QUPA 3T3UA 3VS4A 4P2KA 5I9YA 3GFWA 1IA8A 2WQNA 1Q8ZA 4PPCA 4O83A 4U3ZA 3R7YA 4BCPA 4RZVA 1TQMA 2XZSA 4AU8A 4BDKA 2UW8A 4FSWA 4QP8A 4GS6A 5A54A 3B2TA 3BBTB 2C6TA 3F2RA 3FI2A 5EK7A 3KXZA 4FZFB 4WT6A 3RNIA 4L7FA 2ITNA 2XKFA 1PMNA 4L00A 5L6WL 2XBAA 5FBOA 2R3IA 4N70A 4YNEA 5M55A 4BDHA 2BUJA 5ITAA 5GIPE 2JFMA 4FEQA 4XUFA 4LMUA 2VX3A 2WPAA 2F9GA 3COHA 4ZZMA 3BYMA 4MNEB 5IQFA 3ID6C 4PDOA 4FSZA 5CS6A 4EOKA 1B6CB 4OT5A 3I60A 1NT2A 1JQHA 3OWPA 4FTOA 3NVMB 3BE2A 1BI7A 4ZTSA 4I94A 3N4VA 4YU2A 1A9UA 4G6NA 3LVPA 2ETRA 3VUMA 1OUYA 3F61A 3H0YA 1ZY4A 1O6LA 4HVDA 3S1HA 1UNLA 4YZCA 4QYFA 3CEKA 3R0TA 5L2QA 3VVHA 3F82A 4QMWA 4EOIA 4CKJA 3LCSA 2W1IA 2HCKA 2YABA 2R3OA 3R28A 3PA4A 4O6EA 2R5TA 4HZRA 1J91A 3LZBA 3FKNA 2CGVA 4FKGA 2HWPA 4FT3A 3MH0A 2C6IA 3ZUTA 2C5XA 4DITA 4NKAA 4IX5A 1Q3WA 5EM6A 5EW3A 4MD9E 3KXHA 4GV1A 1OKZA 1BL6A 2ZVAA 3DK3A 1KUTA 4R77A 4F7NA 3FY0A 1Q8YA 3KF7A 3QQUA 3TUDA 3E8CA 1PMEA 4KIKA 5AUZA 3FKOA 3WILA 3SD0A 5CAVA 4DGGA 4O38A 3COKA 4BHNA 2VAGA 4I5CA 4P7EA 5DFPA 1BUHA 4F7JA 5AA9A 4GT5A 3KRLA 4L45A 3RWPA 4FT9A 4DH3A 5ANDA 3EL8A 4FG9A 3SG8A 3QALE 2VWUA 2YAAA 5K0KA 3R7GA 1MRYA 4YTHA 5GZAA 1H25A 1OL5A 3FXWA 1QCFA 4YNOA 1UWJA 3ZO3A 5C01A 3UOJA 4IQ6A 3MA3A 4BZDA 2RKUA 3OEFX 1F0QA 3KY2A 3FV8A 4L9IA 2YIYA 4FK3A 5JZJA 4HCTA 4IBMA 3LFFA 5M08A 4GFGA 4USFA 4LOOA 4EYJA 1REKA 4L3LA 4CZTA 5TT7A 5ANKA 3CQEA 4JIAA 3WI6A 4E5BA 2IZSA 1XBCA 3MVMA 2BR1A 2CJMA 4RIWB 3QF9A 3Q9WA 4FKSA 2R3MA 5H9BA 2OG8A 2QC6A 2W05A 2X9EA 3QTXA 3O71A 3ODYX 5CT7A 2XK4A 3RWQA 4AN9A 3ZM9A 3NIEA 4IIRA 3QZGA 4J7BA 3P7AA 2ACXA 4EL9A 1V0OA 1L3RE 3AT3A 3RMFA 4AA4A 5IA2A 5JEBA 4Y5HA 2XIZA 3OCTA 3ORZA 2BKKA 5A4CA 4DFYA 1Z57A 4GG5A 3GXLA 2R3FA 5DYJA 3U4WA 3NUUA 3BHUA 4YLJA 3GCVA 4O1OA 5CVFA 4ZTHA 2QU6A 2W99B 4GRBA 1AQ1A 2WU6A 4HNFA 2GNFA 4Y5QA 4ZTRA 4N0SA 5HU3A 3GP0A 3LFBA 4M7IA 5C27A 4EHVA 2WIHA 4X2FA 2YDJA 3MGYA 4QQTA 5HU9A 2GMXA 4FA2A 3K3JA 5CF6A 1YXXA 5BNJA 2BHHA 3UQFA 1WCCA 2QODA 3HV3A 3C0IA 3OT8A 4LOPA 2YACA 3VIDA 4QMNA 4DFUA 3JUHA 5D10A 5LMBA 1OI9A 3PXFA 2Y4IB 3F3VA 5LMKA 4AAAA 4KS8A 3MH2A 3CR0A 3SC1A 2IVUA 3UDBA 2XUUA 3KU2A 4ASXA 2PU8A 1XHAA 4GIHA 4QD6A 2JKKA 4QMVA 2OICA 3NAYA 4QTBA 4EH3A 4CYJA 4CCBA 3KVXA 5EYMA 3W2PA 1TVOA 3FZTA 2QHNA 4M14A 4DFXE 3E3PA 2X81A 4NM3A 2X1NA 5AR5A 4W4VA 3WF8A 2WO6A 4K77A 3F2AA 4MTAA 4TNBA 5HGIA 4U7ZA 5DRBA 4F63A 4FEXA 3K5UA 4K0YA 4YUQA 3VF8A 3EQIA 3W32A 4J95A 5EI8A 4C58A 3N4UA 1YXTA 3A7FA 2J0MB 4UALA 3REPA 4AZEA 4MXCA 4D1SA 1VJYA 5L6PA 4DT8A 2CN5A 3MY5A 4WRSA 4CSVA 4CRLA 3GU4A 2GNHA 4O27B 1FQ1B 2UVYA 4O1PA 3LCTA 5I9UA 4BKYA 2OF4A 2C5VA 4DGLC 2GU8A 5JGDA 5KMMA 4P90A 4WOVA 3VF9A 3L1SA 3NYNA 4I5PA 1FPUA 4GT4A 4KSPA 5FEEA 5I4NA 4IANA 3HKOA 1ERKA 4AX8A 5I9WA 5L8KA 3HUCA 4W8DA 5AAEA 4O7YA 1G3NA 4IVDA 3FLZA 2Y0AA 3O8TA 1I09A 2O65A 3BU3A 3NYOA 1R0PA 4LV5A 1TKIA 4JI9A 2EB2A 3O0GA 1NW1A 2OO8X 1QPEA 3PZEA 2Y8OA 5EDRA 1QPCA 2F4JA 4J99A 4YLKA 1LUFA 5CVHA 1XH5A 4KKEA 5HCXA 4AA0A 4QMZA 2KTYA 5C8KA 4NM5A 4D5HA 3DZQA 4ITHA 5KCVA 4AE6A 4XG6A 2J0KA 2PE0A 4GU9A 4KIPA 3PPJA 4L44A 3VJOA 3VBVA 3NDMA 4UMRA 3HRFA 3MPAA 4CFUA 2UZTA 3PY3A 3ZO4A 1REJA 2BDFA 3C7QA 3DJ6A 4OTQA 3ZC6A 4D28A 2XK7A 1OM1A 2B1PA 4ZTMA 2ITQA 3KCKA 3RAKA 3OXIA 4IXPA 1R0EA 3MFUA 3E92A 3Q4CA 2QVSE 5DA3A 2XK6A 4I5MA 4U5JA 2F7EE 2JITA 4U81A 4GKHA 1PXJA 3VULA 1UKIA 2QOQA 4QP7A 3DTCA 4G5JA 2ITVA 2B9JA 4YSJA 4JOAA 3A7HA 3A99A 3ZLSA 2ZYBA 2XCKA 4KSQA 4D1ZA 4E4MA 5J5SA 2QKRA 3CD3A 2JC6A 3Q4UA 3VC4A 5HBJA 1IASA 3TDWA 2NNWB 3OS3A 5BUJA 2AC3A 3G6GA 3LFSA 4M67A 1ZXEA 4FF8A 4ACMA 3BV2A 4NT4A 2R3QA 5CTPA 2X7OA 4RJ4A 5EH0A 4ZSAA 4AFEA 3EH9A 3HP5A 3WZJA 1XWSA 4BWKA 3DCVA 1W84A 3R1YA 1XR1A 5DH3A 4IC7A 2ITXA 3LFEA 2WMSA 2EU9A 3P79A 4W8EA 5GJDA 1Q24A 5I9VA 1P4OA 2PMNX 1TQPA 3KQ7A 3O51A 3FZPA 4I1ZA 3OW3A 4K1BA 4FYNA 5IA5A 1O6YA 3SG9A 4M0ZA 2VWBA 2RL5A 4EC9A 2OXYA 1YXUA 1KV1A 2FB8A 3BYVA 3RPOA 4O0RA 4ANLA 3D7ZA 2FSOX 2OGVA 4E26A 2Z7LA 3RNYA 4XMOA 4ITJA 3CGFA 5HICA 4BN1A 3MVJA 5IA4A 3EKNA 4J1RA 3ZO2A 1PXOA 4DH1A 5K9IA 2EUFB 3BLQA 3L9MA 3PJ8A 3NUSA 1HCKA 3POOA 1OVEA 1JKKA 3V04A 2JKOA 3UMWA 5IMXA 4I4FA 4EHZA 5TO8A 5IA0A 3NUPA 3P23A 3OZ6A 3VWAA 1H27A 2PVJA 3BYSA 4RT7A 2Y6MA 4F65A 4PTGA 4YTCA 4O86A 1P4FA 2R4BA 2YLFA 2IVTA 4V0GA 5AX3A 5HNGA 4JXFA 3V5PA 2BRGA 2PVRA 3VO3A 3W1FA 4GK2A 3AGLA 3TZ7A 3ETAA 3OWKA 4C4GA 2PHKA 4RVTA 3SKCA 4UBAA 4C4HA 3OEZA 1YWRA 2ZJWA 4I6FA 4M13A 1SVEA 2P3GX 3PY0A 3WYYA 3ZSIA 4ID7A 3PUPA 1H0VA 4GUBA 5EM7A 3R30A 4LGDA 3LFNA 4OW8A 4UX9A 1Q5KA 2CCIA 4HGEA 4ZIMA 5JK3A 3NGAA 4KRCA 5CYIA 3H3CA 4HVSA 3JS2A 2GFSA 3P4KA 3AMAA 1LPUA 5LVLA 2QOOA 1GZKA 2J90A 2HIWA 4IWPA 3G9NA 4WKQA 2PZYA 4Y73A 4F6WA 4BF2A 3QD4A 5HIDA 2B9IA 2XKCA 4BIDA 5T3QA 4F7LA 5AP7A 3S00A 3DBFA 5F94A 1OPKA 3PXQA 3PJ3A 5EOLA 4TWCA 1Y91A 4DEBA 5TF9A 3IK3A 4C59A 5C26A 1J1CA 3U6IA 2OLCA 1JNKA 3MSSA 3NMUF 2XNOA 2YITA 2BZHB 1U5RA 2JDTA 2WTJA 3PIXA 3QQJA 4CMTA 4B0GA 3NWWA 3SX9A 4K33A 2XM9A 4MXXA 5HX6A 2RF9A 4NSTA 5F95A 4FIJA 3QCSA 2I0YA 3D15A 3H30A 3KA0A 4RG0A 4CFFA 4D2RA 4F1TA 3TNQB 5BUIA 4ANQA 4WNKA 3DDPA 4YGAA 3WBLA 2X7FA 3OFMA 1ZOGA 4O0UA 1J7UA 1PXKA 3WZDA 4AG8A 1VYWA 1YHSA 3BRBA 2H6DA 3KFAA 3QZIA 4CEGA 2VTSA 4MQ1A 5EDPA 4DG3E 3QTSA 3I0QA 3IW8A 3I1AA 4BYJA 1RDQE 4CFWA 2C4GA 5BVDA 4MVFA 1JLUE 4UWBA 4E8AA 3ZO1A 2W06A 4MQ2A 2F2CB 4PQNA 4F9AA 2WEIA 3CLYA 5IH6A 3GNIB 4F9WA 3DXPA 2ITOA 4CFMA 4IM2A 2R3LA 1S9JA 3QKLA 4J53A 4RBLA 2WB8A 4YHJA 3VS1A 2YCRA 4E7WA 3Q53A 3UZTA 3EN9A 1YOLA 3HMMA 2VTPA 4R3CA 4RIXA 1KOBA 1Q8WA 2X6EA 3O7LB 4FKRA 5B2KA 3TNPC 4EH2A 2HAKA 4LGHA 3MPMA 3OCGA 2QR7A 1BKXA 5E91A 2IW8A 4RZWA 4O84A 4CFNA 4WUAA 5AAFA 3VN9A 4CLJA 4BB4A 3EFJA 3AMBA 3O7LD 4FV8A 4CD0A 5EM8A 4H36A 1T46A 1J1BA 2NO3A 2V7AA 3DLZA 5JFSA 3RZFA 4W9WA 5L2WA 5CEOA 3DU8A 2W96B 5L3AA 3C4EA 3CY3A 5FQDC 3S2PA 3ZS5A 2XVDA 5A9UA 4YJQA 5M09A 2A27A 5AM7A 4MD8E 3SXRA 3HDMA 2JDVA 1WBPA 4AGWA 4C3RA 3KK9A 3QQKA 4G9RA 3FUPA 1MRVA 5EHLA 5BVOA 3IECA 2QNJA 1XKKA 1OPJA 3KMMA 5C9CA 2J0LA 2EWAA 3KULA 4GEOA 4JR7A 2EXCX 4LFIA 5HORA 4B9DA 3C5IA 3PTGA 4AT3A 2O0UA 4IWDA 4AOTA 3DKGA 3DS6A 4X3FA 5TR6A 5HKMA 3NZ0A 2QOKA 3EB0A 3WIGA 5IUGA 3CQWA 4Q9ZA 3NYXA 5ICPA 1OIRA 1NY3A 3B8RA 4I6HA 5CXZA 5M4CA 4AN2A 3KB7A 1EH4A 1E9HA 3QKKA 4EH9A 1OECA 4NH1A 4XBRA 1KE5A 1ATPE 2AC5A 4FBXA 5CAOA 4FZ7A 5AUUA 4H3BA 3V01A 2JKQA 2C0IA 5A4TA 3D7TB 2YISA 3W2OA 3QRJA 3CD8A 4DINA 5E8TA 5DVRA 3F66A 1JSUA 3PG1A 2VX1A 4HYUA 4HVGA 3TKUA 4C02A 3QWKA 4QMYA 4HYSA 4QMMA 4ZY5A 4GYIA 2OWBA 3EQPA 4QTCA 4D1XA 3AOXA 1UU7A 2IZRA 2OK1A 3VRYA 4PP9A 4R3RA 2KULA 1H07A 4JBVA 1GOLA 4BCJA 1Q4LA 5B2MA 3R7EA 2HW7A 3DDQA 2C6LA 1FVRA 2OIDA 4TWOA 5LCKA 3Q4TA 4L6QA 5D1JA 4TN6A 2W17A 4PMTA 4GJ3A 1H4LA 5TOZA 3UIBA 1OIYA 2WNTA 3RBWA 3RK9A 2QLUA 5KKRB 4FOBA 4ZS0A 4PF4A 1XJDA 2A0CX 4I23A 4U79A 3FYKX 3NX8A 3OVVA 3HMNA 3V3VA 2ITTA 3UC4A 2CPKE 3I0OA 4DC2A 4UB7A 2ZMDA 2IW6A 4MWHA 4QNYA 4QP2A 2BHEA 1ZZLA 1U54B 2FVDA 3FI3A 4QP1A 4DFZE 3HP2A 3Q6WA 5D41A 5IUIA 3C0HA 4XP2A 4ZMEA 3R1QA 4R6VA 3TG1A 4E3CA 2ZV2A 3EMGA 3EOCA 3IDBA 4FV7A 1QMZA 4PL5A 2I0VA 4K6ZA 1H1WA 3THBA 3ZEWA 2ZDUA 5CNOA 2VO0A 2R3RA 3CKXA 4DH7A 2YDKA 4JRNA 5IH4A 4V01A 3C50A 1JSTA 4D55A 4FTKA 5IISA 5F1ZA 4MF0A 5J1WA 3EHAA 3E8DA 1ZWSA 4BDFA 5J9ZA 3IW4A 1VEBA 5E8VA 3ZXTA 4BTJA 4RX7A 4UYAA 3NUAA 3JXWA 4MEDA 2YM3A 4PNIA 4E6DA 1OL2A 2R3NA 3LFAA 2OJJA 3WF5A 5LVMA 1S9IA 5FXSA 4O22A 2GDOA 2PMIA 4QMOA 4E4LA 4L53A 5C4KA 2WMRA 5EI6A 4CNHA 3EIDA 4FKTA 4N4SA 4BI0A 3ORIA 3A4PA 3QCQA 5LOHA 2C3LA 3NVKI 3MA6A 3ANQA 4UMQA 5FTQA 3V5LA 3BBWA 3ZLWA 4F9YA 1IA9A 4ALVA 3HDNA 1IAJA 4I92A 5E8UA 3H0ZA 2O64A 2X6DA 5K0XA 4ZY4A 3LE6A 3Q4ZA 4U40A 3KGAA 3R8VA 3W8QA 4DFLA 5CU0A 3BU6A 3TM0A 4J96A 4FT5A 1YI6A 3OXTA 4G17A 3OOGA 1AD5A 4H39A 3PA3A 3RK7A 5EFQA 4AP7A 3PSDA 1G8AA 3QD2B 4Z7HA 5J95A 3VS3A 4EBWA 4YJVA 4BKJA 3ZBFA 4L52A 5B7VA 4EOQA 4J8NA 5DBXA 4U41A 3MJ2A 2WMXA 3BX5A 5CU2A 3ZEPA 4BZOA 3S0OA 4FIEA 3W2RA 4O7NA 3VNTA 3I81A 5AX9A 3PWDA 2YIXA 4FVPA 2H34A 3T9IA 2C6DA 1PXPA 5BPYA 3W2SA 3FJQE 4FV9A 4UWYA 1JKSA 2ERZE 2O63A 2W9ZB 3ORPA 4FSTA 4FSYA 4R5SA 3ZBXA 4XG3A 3KREA 3IW5A 4LUDA 2CCHA 4ZTQA 4CTBA 1ZAOA 3W33A 4DFNA 1DAYA 2VN9A 3RP9A 2GNLA 2UZDA 2ZMCA 3FC2A 4RFZA 4GIIA 4JL9A 4NIFB 4OTGA 5E90A 3DBQA 4AUAA 3LCOA 2B53A 3FQSA 4FL2A 4LM5A 2WMVA 5IA3A 3ERKA 1U46A 3ORMA 4GJ2A 3WF6A 4FKIA 2PZPA 3EWHA 3UMXA 2GSFA 1GIJA 3O8UA 4DE4A 2GS7A 2C69A 3K54A 2UZUE 3LMGA 4FV6A 3M42A 2UZNA 4YP8A 5C03A 3R63A 2DQ7X 5J8IA 3LFDA 4BDAA 2RG6A 4DCAA 3R83A 3TUBA 4FTMA 5DMZA 4OAVB 2UUEA 4WUNA 5CZIA 4M12A 4L3JA 1IG1A 2CKEA 3CP9A 3DNEA 4MHAA 3UOLA 3F7ZA 2UVXA 2XRUA 4YZ9A 3BWFA 3KEXA 3TTIA 3LJ1A 4BWXA 4EK8A 3I4BA 3E3BX 4NUSA 2B4SB 5FP5A 5ANGA 3U87A 2PVNA 3CIKA 1Q62A 2ERKA 3BQRA 4BKZA 4F0IA 5CEIA 3MVLA 3FWQA 1WZYA 1FGKA 4XHKB 3C5UA 2QD9A 3E8EA 3G0FA 3GU6A 1NVRA 4AXAA 1H1SA 3AC4A 2VO7A 5HBEA 4G2FA 3GQIA 4I22A 4H3QA 3U8WA 4X2JA 4TYGA 4EOJA 3AD6A 3NCZA 2VTLA 4KBCA 2FSTX 4NIFA 2J9MA 2OI4X 2WIPA 4GK3A 5LMKC 4FE2A 2W1FA 4OR5A 4QPSA 3D5UA 4XYFA 4NEUA 4OLIA 4YJSA 4AZVA 4BDCA 3COIA 4C7TA 4FVRA 4S31A 5CF5A 3NSZA 5CENA 1JKTA 4GKIA 3AC5A 3VBTA 4HPTE 2HW6A 2RSVA 4BC6A 3QTQA 3ZM4A 4EZ3A 1PY5A 3RAIA 2PYWA 4B7TA 3CCNA 3JVSA 3OG7A 4JQ7A 2GS6A 2VV9A 3P08A 2VTQA 3R8UA 3ACJA 3MTLA 4ANBA 2R7BA 3PYYA 3CXWA 3MPTA 3ZZEA 5KNJA 5FLFA 4AW0A 5AP5A 3IO7A 2W1EA 3GC9A 2VWWA 3QYWA 5J5TA 2BROA 3RALA 5HCZA 4UZDA 4ZK5A 3ALNA 2PUNA 3F6XA 3IONA 2RFSA 3ORNA 4O7WA 4GT3A 3HEGA 1WVYA 3QYZA 4QP4A 3OF0A 1MP8A 5ETIA 3MWUA 4OUCA 1CKJA 2BIKB 4FKUA 5H3QA 3UOKA 5HD4A 4X21A 5HQ0A 2OFVA 3OXZA 4Y95A 5E8XA 3BV3A 3C0GA 4P4CA 2UW3A 3RAWA 3IDCA 4IWQA 4PL3A 2F49A 3K5VA 3MIYA 3DBDA 3HUBA 3R9DA 5IDNA 5IQGA 3LLAA 2XIYA 3GCUA 5AP0A 2JIUA 2UW0A 3C4CA 2GCDA 3QXOA 1NA7A 3VUKA 3PLAE 4RQKA 5J7HA 4EI4A 2IO6A 3PXKA 4FV5A 5HTIA 4DT9A 3E62A 2C5NA 4NL0A 1IR3A 1VR2A 2FSMX 3P86A 3NYVA 4QPAA 5M44A 3D5XA 1R3CA 2XKDA 2XMYA 2OXXA 3IDPA 2P33A 3MH3A 4QOXA 4V04A 5AIKA 4CFVA 2BAJA 3QX4A 4ENYA 2WQOA 4HYIA 3GUBA 3G0EA 4XV9A 4BI1A 2WQBA 5I3OA 3H10A 4BIBA 4UWCA 1OL1A 2HZNA 4LGGA 4XLIA 2VD5A 4FTAA 5J9YA 5JSMA 3OUKA 4YC8A 3ZDIA 1JBPE 3QXPA 1YHVA 2WTKB 3RVGA 3UQCA 4BFMA 5CVGA 3R02A 3A61A 3NPCA 4IM0A 5DWRA 4LMNA 2Y4PA 4OTDA 1JOWB 3W55A 1URWA 3EN6A 5HLWA 3SVVA 2A2AA 4IVCA 5AUXA 3UNKA 1UA2A 2WTCA 5LQFA 2YIWA 3B2WA 4DG0E 3BWJA 3OD6X 2OXDA 5CEMA 1FGIA 3NS9A 4D58A 2F7ZE 5CU3A 3C4ZA 4EOMA 4DGOA 5D12A 4UMTA 2GS2A 5D7AA 5LCJA 4RJ7A 3F88A 3RM7A 2IWIA 2OJ9A 3TIYA 5IQHA 1XBBA 2CMWA 1NVQA 2HENA 3TL8A 4DEEA 4RVMA 1FMOE 5B2LA 1RE8A 5CY3A 4NM7A 4UXLA 5LARA 5BYYA 4J52A 5IPJA 4KWPA 4LG4A 3GCPA 4RC3A 4CT2A 2E9UA 2XM8A 3A62A 4H58A 3S95A 2BAQA 4USDA 3S3IA 3OTVA 5E8SA 4KBAA 3PZHA 4FZDB 4I0RA 4N6YA 2V0DA 5HD7A 3WYXA 3NNUA 4M84A 4O6LA 3KKVA 2JDSA 2YAKA 4UYNA 1FVVA 2QOFA 1V0PA 4IEBA 3AD4A 2G01A 3HZTA 2OFUA 4PMSA 3TZMA 5KUPA 3IQ7A 2BIYA 3FQEA 4AQCA 5M57A 4A4OA 1Y8GA 3LOKA 3RKBA 3ZZWA 5KMNA 5GHVA 3LPBA 2CGXA 4UY9A 3HAMA 3VUIA 1B38A 5CWZA 3UG1A 2UW5A 3RGFA 2I0EA 1FBNA 1HCLA 2XS0A 3JYAA 4MBLA 4J98A 3VJNA 4DLJA 1M2PA 5AV4A 5A3XA 5AFVA 3FMHA 5AP6A 3KMWA 5CF4A 1H28A 4BDDA 4DG2E 4IH8A 5CU4A 2E9OA 4O81A 4AF3A 4R78A 1H1QA 3W8LA 3R9RA 3MIAA 2WTVA 4O7SA 2YM4A 2W1ZA 2VTOA 4IAFA 5JGBA 5IQEA 4GYGA 5HTBA 4IB1A 5IQBA 4FKOA 1UU8A 4YTFA 5LWMA 3ZUVA 4M0YA 1BL7A 1OKYA 1O6KA 3BEAA 3TCPA 2X0GA 1PXLA 4IWOA 1A06A 4DGNA 4AOJA 2QLQA 5D11A 4RIWA 3FBVA 1GAGA 2VTNA 4XBUA 2OH0E 3RJCA 3IKAA 3ZYAA 2Z2WA 4AZWA 5CAUA 4B6LA 4EH4A 3BELA 1YOJA 4IAIA 5D9HA 3TNIA 5FUTA 2P2IA 4TYEA 3A2CA 5CSVA 3TZ8A 3SLSA 4G3FA 3D5WA 3WE4A 4ZLOA 3T8OA 4IMYA 5EOBA 2H96A 2WMUA 3IW7A 2R3HA 5HNIX 3MESA 5AEPA 4RQVA 1YKRA 2IVSA 3LXLA 3QAME 4CXAA 2PUPA 1OBGA 4IAKA 3WF7A 4Y8DA 3V5JA 3H9OA 3CGOA 1Y57A 4OBPA 3UVQA 1M2RA 2VWVA 3SW7A 5CI7A 1YI3A 5EW9A 2BRBA 3QTRA 4WG5A 3W10A 5HX8A 3ZRLA 1P5EA 1O9UA 3P1AA 3U54A 2GTMA 4NW5A 3UO6A 4F0GA 3FLQA 3DBEA 2P0CA 4FODA 4FNXA 4DEGA 4FEWA 5ETFA 1WBWA 3ENMA 4O0TA 3L8SA 3DA6A 3RTPA 2QONA 4BWPA 4C0TA 3QRUA 5HE2A 5DT0A 2R9SA 2W5AA 3SRVB 3UQGA 3EQFA 4W9XA 1YXSA 4G6OA 2XP2A 4YHFA 4FNZA 3DXNA 1M17A 2J51A 3OY3A 3D9VA 4LRKA 1I44A 2PUIA 3Q5ZA 4XG7A 5CSPA 2YCFA 5LVOA 1AGWA 3LXKA 4TTHB 4B8MA 2GPHA 4JX3A 4O0WA 5DHJA 3A7JA 3TV4A 3ZFYA 2VX0A 2Z8CA 5HG8A 1YWVA 3GT8A 2XYNA 3V8TA 4FKLA 3SXFA 4FTUA 1U5QA 3P9JA 3RPVA 5EYKA 4D0XA 4DTKA 1OPLA 2UW4A 5LVPA 1YHWA 4MBJA 3QCXA 3C51A 3BU5A 5KBRA 1YOMA 2J6MA 4GMYA 5CAQA 5FTGA 1CMKE 4L3PA 2UZWE 2GNJA 3DV3A 3LIJA 2B54A 5JRQA 3QU0A 2PK9A 1APME 3KRWA 4ZOGA 4I20A 4IFGA 3KC3A 3MBLA 3QUDA 2IZUA 4FIIA 4RSSA 4EQMA 4YJNA 3P78A 3TWJA 2VTHA 1XH9A 3C13A 3FMEA 4FV0A 1SMHA 4MXOA 3JY9A 5AR8A 2OW3A 2Z7RA 3FPQA 1W82A 3MJ1A 3E93A 5BUEA 3RPYA 3GCSA 4QQJA 1YDRE 4OTHA 5BMSA 1J7IA 3GENA 3EQHA 1XH8A 4FTNA 2WMBA 1U54A 5BVEA 4ERWA 4FSUA 3QRTA 4JS8A 3LM0A 4IJ9A 4P5QA 4ACDA 4K11A 3PPKA 3FLWA 5BVKA 2YHVA 5FBNC 2QHMA 3KVWA 3L9LA 4R8QA 2B9HA 3BGQA 3W2CA 1UNHA 4Y72A 3LLTA 3RHKA 1PJKA 3EKKA 3GC0A 3NUYA 4FG8A 4IZYA 1SM2A 4ANNA 4GVAA 5KO1A 5BYLA 3K3IA 4YJOA 2IPXA 2JDOA 3P0MA 4OTIA 4BCMA 2FSLX 2V62A 5CU6A 3FXZA 4E73A 5M07A 4QMXA 3AXWA 4XLVA 1CDKA 4S32A 5LJJA 4YSMA 3BLHA 4I6BA 2WXVA 5LVNA 3KN6A 3O50A 2HZ0A 2ZV8A 2VGOA 3VUGA 4QP6A 5H8BA 3ZLXA 1W7HA 2OH4A 2R7IA 3QQHA 4HPUE 4ACHA 1IAHA 3AD5A 3P7CA 4PWNA 4JG6A 1CKIA 4U8ZA 1GZ8A 3MFSA 3LFQA 3RAHA 4XCUA 4EEVA 3LW0A 4F9BA 2R3PA 2C3JA 3ZRMA 3UPXA 3DBCA 5I9ZA 3DB8A 1M7QA 5IQIA 2XRWA 1RW8A 3EQGA 1YVJA 4RLLA 4PUZA 5M53A 2C6KA 2Q0NA 5AR2A 3TNWA 3LXPA 4RJ3A 4QTDA 5J1VA 3CJFA 4BZNA 4DHFA 5KHWA 5C4LA 4O0VA 2B7AA 4TKSA 5HE3A 2WTKC 3ORXA 4FV1A 3AMYA 2G1TA 2BFXA 5AV0A 3CTQA 5DN3A 4F6SA 5HTCA 4U97A 4JQ8A 3UP2A 5L2IA 3QGYA 3R8ZA 5AUWA 1ZOEA 4A06A 1OZ1A 3KXGA 3FE3A 2VTJA 3E64A 1KV2A 3LXNA 5L4QA 2XNMA 3FZRA 4KUJA 3BYOA 3PRFA 3VAPA 3SGCA 4MX9A 4AW1A 4DA5A 5M4UA 3D5VA 2GHLA 5E8ZA 1KWPA 5HOAA 3ZOSA 3TXOA 4IAYA 1ZYLA 3ZU7A 4BCFA 1OL7A 3RI1A 3TT0A 5CANA 3ACKA 3KRRA 3E8NA 3HAVA 3M1SA 3N9XA 4TT7A 4IB5A 4ZJIA 2AYPA 3QA8A 2HXQA 4EOSA 3V8SA 5JKGA 1H26A 3KMUA 2X8DA 5CZHA 1JWHA 2PL0A 3HRBA 4F4PA 5EQYA 3DAKA 4A9SA 2B52A 3C4FA 2V7OA 4FK6A 4AGUA 1MRUA 3D7TA 4EH8A 3ATSA 3AQVA 3PXRA 3QTUA 3Q9YA 3UIMA 3FI8A 3GBZA 2WTDA 4D4SA 5DG5A 1SVGA 2WTWA 4FKVA 2WHBA 4RPVA 3W2QA 5AWMA 4ALUA 5ETAA 1NVSA 4JBQA 5EG3A 4UMUA 4OBOA 2W9FB 4ZTLA 3SAYA 4EORA 4MAOA 5AP1A 2BZJA 2OSCA 2QOIA 3BE9A 1Z5MA 4TL0A 4WHZA 4X3FB 3R8LA 4NU1A 2PVHA 4I6QA 4MWIA 3OOMA 3LQ3A 3N4TA 3CJGA 4K9YA 4FSRA 5CLPA 4U6RA 5CAPA 4IZ5A 5AA8A 3UP7A 3HA6A 4HVIA 3QA0A 4LQMA 2QO7A 4IAZA 4MBIA 2P55A 3IW6A 3LMHA 3E5AA 3OBJA 3M11A 4D2WA 4RX8A 2YA9A 2BMCA 2PMLX 1FINA 4IB3A 4GL9A 4ZLZA 4BCGA 4FYOA 3R22A 1R78A 4NFMA 2OBJA 4YJUA 5H8EA 4BVUA 1JAMA 5A46A 2XH5A 4EUUA 2HELA 4WBOA 3FZOA 3C1XA 3RK5A 3TN8A 3OCSA 3D94A 5H8GA 4LI5A 4DAWA 4Y85A 3H4JA 4RIXB 5LMAA 1MQ4A 4A7CA 3ZTXA 2W4JA 3HA8A 4PRJA 2BVAA 5CNNA 1DAWA 3UTOA 5AP4A 4A9YA 4GFOA 4DEDA 4QYHA 1PYXA 4IVAA 5CQWA 3G90X 4ARKA 3R7UA 5L2SA 3LJ0A 3Q9XA 4HNIA 3LJ2A 4RX5A 2YLEA 3UGCA 4DH5A 2Y9QA 2NRYA 4UV0A 1PMVA 4I41A 3MN3A 4U80A 2CNQA 3WE8A 4ACGA 4G3CA 1Z9XA 3BLRA 2V5QA 2GTNA 3FZ1A 2GHGA 3CQUA 3VS0A 3JVRA 4Y83A 4FTTA 2PSQA 4IJPA 3EFKA 4G34A 4F0FA 3UZPA 5EI2A 4QYEA 3HRCA 2F57A 1PMUA 2XB7A 3H9RA 1WBSA 4A4XA 2C5OA 4RIYA 3FXXA 4F1OA 3FZSA 3QRIA 3LAUA 3TKHA 4S30A 3DZOA 3A8XA 4K8AA 3Q3BA 4M68A 4QRCA 3JR1A 3R21A 3P7BA 4CMOA 5DEWA 3FSKA 1GZOA 4MXZA 2YJSA 5JRSA 1H00A 4FOCA 4E4XA 4CG8A 3V51A 3Q6UA 4FI1A 3WARA 3GFEA 4NTTA 4UMPA 3F3UA 5HIEA 3FPMA 5HIBA 4BDIA 3O23A 4MH7A 2W1HA 3HNGA 3R71A 4RWIA 3SXSA 2XNPA 4R5YA 4AGDA 1VZOA 3POZA 4Q5EA 3EQRA 4BGQA 4TNDA 2VU3A 2VUWA 3ZXZA 5BX0A 1PXNA 4FKWA 4C35A 2ITWA 4AE9A 3TNHA 4XX9A 2RFEA 4H1JA 1YDTE 4FGRA 5EQPA 4ASZA 4FR4A 2JFLA 3NIZA 4CG9A 5FGKA 1QPDA 2XEYA 4KRDA 5AUYA 2OZOA 2ZDTA 5HO8A 4CQEA 1UV5A 2QKWB 5A6OA 2VGPA 3G2FA 1G8SA 2CKQA 1W0XC 3OCBA 3RCJA 3PWYA 2C0OA 1OKWA 1CSNA 3FDNA 2DYLA 3CTHA 2Y6OA 5FDXA 2UVZA 4EJNA 2F7XE 2PZRA 3Q32A 4KABA 4XP3A 4NK9A 5L8JA 3DXQA 4XG4A 4M8TA 4XV3A 2FYSA 4EQCA 4X0MA 5HO7A 2FGIA 4ANOA 3KRXA 3M2WA 2QCSA 3U51A 4OTRA 4KIKB 5GINE 5IUHA 3EN7A 3EZVA 3PDTA 2XBJA 2CHLA 1H24A 2ZM4A 4HGSA 4GVJA 5I5ZA 3DGKA 5E92A 4JJRA 4JDKA 3ZFMA 4BICA 3DTWA 3FMDA 4WO5A 3VUTA 2WOUA 4UXQA 3MB7A 3MY1A 5E7RA 5G6VA 1PXIA 5JQ8A 3UO5A 4BYIA 4WBBB 3FHRA 3UNZA 4OTWA 1OB3A 3TZ9A 5JT2A 2J4ZA 1XH6A 3L8XA 4ANSA 5KMOA 4BBMA 4B99A 2IG7A 4O7RA 4E6CA 4MYGA 3HX4A 4X2KA 2RFNA 3U55A 2WZJA 3TEIA 4AOIA 3SDJA 4RWJA 4N57A 4IAAA 5E9EA 2BRHA 4I93A 1UNGA 4IE9A 4OT6A 3TJDA 4L42A 4GCJA 1P14A 4IM3A 4ZLYA 3FKLA 4YZMA 3GCQA 3TTJA 3CSVA 3VBWA 4JDIA 4HGTA 1UKHA 4CTCA 5AIRA 3FMMA 3EZRA 3G51A 2YDIA 4FV2A 2XNNA 5AAGA 3PRIA 1RJBA 1PYEA 1YWNA 2CLXA 5J7BA 2W1CA 4FIHA 4N6ZA 3UVRA 3BI6A 2VWIA 2BPMA 5FDPA 3PE2A 2YIRA 4G31A 2YZLA 3BCEA 4C57A 2XNBA 3F3WA 4HOKA 2J7TA 5IQDA 3LQ5A 5IEYA 2J50A 4JG7A 5EHOA 3TV6A 2YM6A 5JMSA 3VBXA 4A4LA 2X9FA 4FKJA 3R7VA 4BDJA 3QTIA 1OGUA 4AZTA 3VW6A 3QQGA 3TI1A 3VS2A 2DS1A 3KULB 5DPVA 2DUVA 3KL8A 4JAJA 4MD7E 2VO6A 3R9OA 4C36A 2BAKA 4U9AA 2A19B 2IVVA 1Y6BA 2J5FA 1CKPA 3NW6A 3SOCA 5HZNA 4D9UA 4L01A 4OTFA 2O5KA 2XJ0A 4XV1A 4NJ3A 2GHMA 3FHIA 3GC8A 4F1MA 2PVKA 3PPZA 3QD0A 3ALOA 2OU7A 2PVFA 3HMPA 3LCDA 4JDHA 5HE0A 4BBFA 2C6MA 3EN5A 4C4IA 1K9AA 3KF4A 4CQGA 5JFVA 3Q2MA 4O0SA 2QU5A 5GNKA 1W98A 3DOGA 2W0JA 3MVHA 4FT0A 5HNBA 4EOPA 3PP0A 4J71A 2JLDA 4LOQA 3OBGA 4WG3A 3TJCA 5L2TA 3QZFA 4KIQA 3F5UA 1BLXA 4XG8A 3DNDA 4Z55A 3VHEA 2WD1A 2R2PA 4QO9A 3DKFA 4YHTA 4AGCA 4S2ZA 5I0BA 5AV3A 3S4QA 3ZRKA 3D83A 4YURA 2W5BA 4X3JA 5F9EA 3T9TA 3HYHA 4GG7A 2W4OA 4M66A 3FLYA 3V8WA 4DH8A 2CDZA 4U44A 5A4LA 2RGPA 3QWJA 1XH7A 1WVWA 2PVMA 2XNGA 3QKMA 4YJPA 4EK4A 4PPBA 1XO2B 4C33A 2BFYA 4IB0A 4RWLA 5DLSA 5HG9A 2YCQA 4FNYA 3A4OX 1ZYDA 3CY2A 3QX2A 5BVWA 3ORLA 4WD5A 4BTKA 1ZRZA 4DLIA 3Q96A 1L8TA 3VBYA 4BY9E 3QZHA 4ZP5A 4ZXTA 5KHXA 4MXYA 4P5ZA 5A6NA 5CASA 2HY0A 3GU7A 4FGBA 4L8MA 4ERKA 3AGMA 2BTSA 3FC1X 2ONLA 3DY7A 3O17A 2X8IA 5DEYA 2UW7A 1V1KA 5CEQA 2C1AA 5HVKA 5L8LA 2WGJA 1OMWA 3V5WA 2JDRA 1KE9A 4I5HA 4FEUA 1DI8A 2JEDA 2CLQA 2QURA 2XA4A 3GQLA 4G3GA 4WIHA 4CT1A 2VRXA 5FM3A 2QOHA 2JIIA 4D2SA 4Z16A 5IG1A 3QCYA 4JQEA 1ZYCA 3ATTA 5EW8A 3BKBA 3R00A 4U3YA 5HLPA 4APCA 3AC8A 2BKZA 4C3PA 5HVYA 4G1WA 2REIA 3Q2JA 1UU9A 4ZZOA 3GEQA 5A4QA 3OW4A 4L7SA 4YO4A 1HOWA 4AS0A 4WG4A 5AV2A 4AW2A 1H08A 5FRIA 3E7VA 3AC3A 5FD2A 4IDTA 1J7LA 3R6XA 1WVXA 3QBNA 3D0EA 1LEWA 3OC1A 4O21A 4R7IA 4ZJJA 3UJGA 5AUVA 5ANJA 2BRNA 4O96A 3KXXA 3Q60A 3A8WA 4UZHA 5IQAA 3FY2A 3K2LA 5CSWA 5ACKA 3ZDUA 4RX9A 4HJOA 4NW6A 2C6EA 4QNAA 5JQ5A 4QT1A 3HVCA 4HGLA 3KRJA 3NNWA 4ASEA 4BGHA 5IDPA 2ITPA 1JKLA 4I0TA 3CPCA 2BZIB 4IX6A 1KOAA 2X4ZA 5KMKA 4EK5A 3I7CA 4ZZNA 3EQDA 1JSVA 4HCVA 5ACBC 5F20A 5C1QB 5JH6A 3UZRA 5AR7A 5GJFA 2DWBA 4EOOA 3UBDA 3V6RA 4FSQA 4H3PA 4DEHA 3ET7A 1WBNA 3AT2A 4OTPA 2JIVA 5HG7A 2F2UA 1OKVA 2EB3A 2YZAA 3IGOA 4KKGA 4APPA 3MH1A 4G16A 4JRVA 5DT4A 4E1ZA 5CEPA 4FMQA 3F5GA 3O2MA 4FTJA 3EQCA 5CALA 3LM5A 4F70A 4WA9A 3FI4A 4EK3A 2CKPA 1H1PA 1NXKA 2FA2A 4ZJVA 3QD3A 3VS5A 3GOPA 4BIEA 4TRLA 4ZY6A 4C2WA 4QP3A 2ZOQA 3UE4A 4U0IA 1H8FA 1JVPP 4KS7A 3BYUA 2LGCA 2QO9A 3FLSA 2XJ2A 3ZC5A 4BCNA 5M51A 4PP7A 1W83A 3Q52A 3PJ1A 4DEIA 3FLNC 3T3VA 4C8BA 4G3DA 5M06A 2O2UA 4GFMA 1QPJA 2NPQA 5AP3A 4V05A 4IFCA 4NM0A 2O3PA 4XP0A 2QOBA 4FX3A 4RA4A 4FKQA 2VTIA 3TIZA 1PF8A 5JGAA 3F3ZA 3G33A 2ZV7A 4GSBA 4X2GA 1MQBA 3BPRA 2YWVA 3N51A 1K2PA 5KMJA 4YPDA 3OROA 4FV4A 4C34A 4L43A 4EKKA 5CEKA 5EDQA 5CF8A 5LXMA 2OZAB 4FT7A 3PE1A 1BI8A 3ORKA 4IACA 4Q5HA 4E5AX 3DK7A 3QFVA 2XIKA 4LRJA 2NRUA 5BMMA 3ULIA 3NAXA 4EYMA 4O7VA 3W18A 4JG8A 2VTMA 5E1SA 5T6KA 1YI4A 5FEDA 4J97A 2GQSA 1FOTA 2Z7SA 4LRMA 1WMKA 1OIUA 4XJ0A 5K4IA 1MUOA 3IGGA 4CV9A 4AACA 4W4WA 2YM7A 3UNJA 2X39A 2WQEA 3IS5A 1GY3A 2YM5A 5HO6A 3BHTA 1STCE 1PRYA 4O7LA 4YPSA 2VNWA 2R3JA 5DR2A 4FL3A 4L68A 4BCQA 3KCFA 3SV0A 5KZ0A 3DK6A 3PVUA 3I6UA 4PMMA 5HI2A 4FSNA 4R1YA 4BRXA 2QG7A 3NNXA 4O0XA 3RPRA 4YTIA 2OIQA 1DM2A 2X2KA 4RA5A 3IG7A 5F4NA 4AFJA 5IQCA 4AZFA 4H05A 2J0JA 4QMQA 5GZ8A 1ZZ2A 1H01A 3V5QA 4PDYA 4D4YA 5K3YA 4E20A 4D5KA 4X7QA 1W8CA 2W1GA 1H0WA 3FL5A 2QOCA 2OJIA 5E8YA 4XV2A 5E8WA 4K2RA 1ZOHA 4TYJA 3B8QA 4RC2A 2BDJA 4F7SA 3ZFXA 4HVHA 2VWXA 5EHYA 4TPTA 3G5DA 4YJTA 4KA3A 2ZM1A 3CC6A 2UZBA 3SQQA 4O82A 3DQXA 4XEYA 4PNKA 4I24A 2EXEA 3PP1A 5IKWA 3BHYA 1X8BA 3UG2A 5CXHA 2ZM3A 3VQHA 3LKMA 3UODA 4FG7A 3E87A 1A48A 4BL1A 4C4JA 4RWKA 1V0BA 3CBLA 1B39A 4HZSA 2GNIA 3BGPA 3DQWA 4QMSA 3WF9A 3L9NA 3R1SA 3DB6A 3AC1A 2WU7A 4EONA 1M52A 4G5PA 5BQ0A 3FAAA 4PDPA 3PSCA 3R2BA 4AW5A 4C4EA 3ROCA 3KXMA 4HYHA 4ZMFA 4CKIA 4YR8A 2YCSA 3GB2A 4BCHA 4YMJA 3MTFA 3BEGA 5FG8A 4MF1A 1T45A 2PWLA 3GU8A 2VNYA 4R1VA 4C37A 1KE6A 3DAEA 3Q04A 2YM8A 4GUEA 1Q99A 3MV5A 4EHGA 3VS6A 4FIGA 5KBQA 3LHJA 3BIZA 3KXNA 2HY81 5AV1A 2FO0A 3TACA 2Y4IC 4QMPA 3OTUA 4FL1A 3GOKA 2XK3A 4EZ5A 2XKEA 3DFCB 1SNUA 1YQJA 3MFRA 4RC4A 3NUNA 4Q9SA 3EN4A 3GVUA 2HOGA 3UYTA 4CZUA 2WQMA 3NW5A
chains in the Genus database with same CATH superfamily
2BTRA 4JBPA 2BILB 4QP9A 3DPKA 3MYGA 3HECA 4UN0C 1PHKA 2UV2A 1TFFA 1OL6A 5GJGA 4MK0A 5C8MA 3DLSA 4BGGA 3E7OA 4EZ7A 3LQ8A 4WSYA 5JN2A 2WELA 3UIUA 2GQGA 4XOYA 1JPAA 4D0WA 4OBQA 2XF0A 3UVPA 2ZB1A 3F5PA 4KINA 1UU3A 2ONLC 3EYGA 4E5WA 5D7VA 5IZFA 4E6QA 4RJ8A 1OITA 3QUEA 3HLLA 2FH9A 2VZ6A 4AN3A 4FC0A 4TWPA 4O7TA 4XOZA 4BBEA 4YZDA 5EYCA 4BDEA 3F2NA 4KB8A 4DTBA 4IVBA 2I40A 3NW7A 4KBKA 5EYDA 5EKNA 2J5EA 4FEVA 4NJDA 2IW9A 2XK8A 1XQZA 2IZTA 4X6RA 5HESA 4Z7GA 4OGRA 4TWNA 4II5A 2X2LA 3RHXA 2BRMA 3PXYA 4K18A 4EJ7A 3EFWA 4PTCA 3D14A 2JKMA 4WNMA 4ENXA 2NYAA 3PG3A 2CKOA 3MB6A 2G9XA 3I79A 3NCGA 4O2ZA 3JPVA 3UO4A 5KMIA 4RIYB 2Q0BA 1U4DA 4S34A 4QTAA 4ZSJA 5BVFA 4KIOA 4FNWA 3R01A 4FICA 1FVTA 3P5KA 3UC3A 2NP8A 3OY1A 4EWQA 4CMUA 3QRKA 2B55A 4F99A 4YJRA 3MDYA 3PSBA 4M15A 1Q8UA 3F5XA 3RINA 2WOTA 2ETKA 4RGJA 5HBHA 2X8EA 4A9RA 2QO2A 3I6WA 2W4KA 3PIZA 3GC7A 2PE2A 2VWYA 1GZNA 5DR9A 4QYYA 1XH4A 4OAUC 2H8HA 3CPBA 4NZWB 3R9NA 2CGWA 2H9VA 4EOLA 3F7WA 3R73A 3HV6A 4D9TA 1PW2A 2JBPA 4D2PA 1BMKA 3PUFC 4C38A 2I6LA 2X4FA 3UDSA 4XG9A 4ACCA 1PKDA 4I4EA 1YDSE 2A4LA 2Z02A 2PZ5A 5HLNA 4IX4A 2C30A 2J0IA 3EYHA 5DT3A 4TXCA 4ZEGA 1OUKA 5HVJA 1KE7A 4DFBA 3WZKA 4ZS4A 3COMA 2B9FA 1IRKA 2QR8A 3IPHA 2G2HA 3NEWA 2UW6A 1GJOA 4M69B 4AT4A 4C61A 2E2BA 4AT5A 5IF1A 4XG2A 2HK5A 2JBOA 3O8PA 4QPMA 4XRJA 4BDGA 1YRPA 4Q2AA 5EKOA 4O7ZA 4YBKA 5J87A 3RM6A 4NCTC 3D2KA 1F5QA 3VQUA 4BHZA 3II5A 4O91A 3UYSA 3R04A 3U4UA 4MCVA 2G2FA 2W7XA 3U9NA 3PVWA 4I3ZA 2C1BA 3UIXA 3G9LX 3OWJA 3VRZA 2C47A 4C4FA 2OF2A 3JY0A 4NFNA 5AUTA 4JX7A 4F9CA 1TQIA 4BTFA 3R8PA 4I0SA 3WZUA 4CZYB 4ANMA 3DAJA 3DJ7A 1YXVA 1KSWA 4LV8A 4FTIA 4NYEA 2P2HA 3F69A 2YWPA 5A14A 3MFTA 4JDJA 5CQUA 5BYZA 5IA1A 4C62A 3R7OA 4TYHB 2C3KA 3PLSA 5LWNA 4QMLA 4QQCA 2QI8A 4D4VA 3OHTA 3DKCA 4NKSA 2HYYA 5IEXA 5TKDA 1H1RA 2IJMA 2G15A 5DRDA 1Q97A 5AADA 1M2QA 1P2AA 5FP6A 4KD1A 5FXQA 1GIHA 1R39A 2UZEA 3I7BA 3HMOA 2BALA 4G3EA 2XCHA 1LEZA 2UZLA 3CE3A 3V6SA 1BX6A 3QTWA 5AJQA 4DBNA 4FTLA 3LCKA 4FV3A 4ASDA 5L6OA 3HV4A 4DTAA 4FIFA 2O8YA 4YZNA 5JFXA 2LAVA 4BR3A 3AC2A 3MS9A 3BHVA 2ITZA 2UZVA 2R0IA 2WMWA 4JAIA 4WNOA 4FTCA 4AZSA 4FKPA 5AMNA 4ZSGA 4R7BA 3BHHA 1SNXA 2ETMA 3PY1A 5ANEA 4J8MA 3CTJA 2WKMA 3QGWA 4FVQA 4JLCA 2X7GA 3ROYA 2B0QA 4PY1A 2CN8A 2Y7JA 3BGZA 2CSNA 4GK4A 3AT4A 4YLLA 3WIKA 4GH2A 4ONAA 4TYIA 4TZRA 4MKCA 2I1MA 2PE1A 3EJ1A 4O4DA 4Y46A 2JAMA 3GGFA 1LP4A 3ITZA 3EFLA 3SOAA 1F3MC 4PMPA 4ORKA 2OJFE 5M4IA 2X2MA 2XEZA 2ITUA 4IC8A 4EH7A 4KAOA 2YJRA 3DJ5A 4IADA 2XNEA 2RFDA 2WMTA 2R64A 3VUDA 1E1XA 4EUTA 4EBVA 2CNUA 3IOPA 4GW8A 4CFXA 1ND4A 2ZAZA 4M3QA 4F64A 5A4EA 5J79A 5KMLA 3QHRA 2ITYA 5CT0A 1WBTA 4JBOA 4TY1A 4AA5A 3L8PA 1ZARA 4YC3A 5IMEA 2R3GA 5DR6A 5HHWA 3RCDA 4QMUA 4ZSEA 3BQCA 4JIKA 4QTEA 4UEUA 2WTIA 2YERA 5ANOA 4FTQA 4E4NA 3HMIA 2E9PA 2ZV9A 3EQBA 4X3FC 3A60A 4JR3A 4M69A 5ANIA 3EL7A 4BTMA 1YW2A 1Q41A 3ORTA 3OWLA 3WZEA 4IDVA 4EH6A 4IX3A 4TW9A 3U6JA 3QTZA 5J9LA 3MW1A 4F08A 1ZMVA 2PY3A 3HL7A 1R1WA 3QLFA 2C5YA 3E63A 1ZMWA 1SVHA 5EM5A 3C9WA 3KN5A 2RIOA 1U59A 5K5NA 5G1XA 4BCOA 2UW9A 2WMAA 5IH5A 2C3IB 4NCTA 2J2IB 4QYGA 3I5NA 5AP2A 1M14A 2E9NA 4BDBA 4M97A 4DBXA 1GIIA 3DT1A 4KKHA 4X2NA 1BYGA 2OIBA 3ODZX 4B4LA 4A9UA 3H9FA 4A07A 4XH6A 4RFMA 1SYKA 5DGZA 4TYHA 2QG5A 2OZAA 3PXZA 3I5ZA 3Q5IA 3D2IA 4LUEA 4EQUA 4E93A 5DNRA 1LR4A 3Q9ZA 3WOWA 5M4FA 3U6HA 2R3KA 4RRVA 2ZB0A 4IW0A 3F9NA 3LFCA 2Z7QA 4LV7A 5FM2A 4PTEA 4EC8A 3FL4A 2VTRA 3UOHA 2EXMA 3QQLA 4USEA 5I9XA 4A9TA 4LL0A 3PFQA 3DFAA 3ELJA 4JMQA 4ALWA 4PV0A 2PULA 5K5XA 2OJGA 2PMOX 4JVGA 3PJ2A 3ULZA 4AWIA 2PUUA 4D2TA 4D4RA 2WFYA 5JFWA 1PXMA 1URCA 2YEXA 4BI2A 3UPZA 1Q61A 5B0XA 3R9HA 4FSMA 5HEZA 4Z3VA 4D2VA 4EKLA 3OT3A 3PJCA 4C2VA 4RLKA 4RMZA 1RQQA 1GNGA 4S33A 3FMKA 5KX8A 3D4QA 4BCIA 2BZKB 3G15A 2CGUA 4L46A 5HCYA 5CI6A 5KKRC 4DCEA 4IZAA 4E6AA 1J3HA 2BCJA 4RJ5A 4W4YA 4HW7A 5IU2A 2PTKA 3C4XA 3F3TA 4FZ6A 2GFCA 2OKRA 3QC9A 3VBQA 4ZTNA 4F6UA 3RZBA 5M56A 2VO3A 3NUXA 4B8LA 3PA5A 2V55A 4DN5A 3SRVA 3TKIA 3ZSHA 4NTSA 3VW8A 2JGZA 3NR9A 4CYIA 3FMNA 3BZ3A 2WAJA 4I21A 4EHEA 3ZCLA 3VHKA 4DYMA 2ESMA 2C0TA 3ZONA 5ETCA 4KNBA 5FWKK 2XJ1A 3ZLYA 1OBDA 1CM8A 3NRMA 2XYUA 4XNEA 1VYZA 4R3PA 4PDSA 4HCUA 5AM6A 2Z60A 4F09A 4ZAUA 2A1AB 2I7QA 5EQEA 2I0HA 4V0GB 4LL5A 1ST4A 1Y6AA 3O96A 2XIRA 4NWMA 4DHZA 2HZIA 5HG5A 3ZHPC 1UWHA 4G9CA 4GU6A 4XRLA 1K3AA 4O2PA 3RPSA 2PVYA 3SW4A 5T68A 4EWHA 1DI9A 2PPQA 3FSFA 4EH5A 2YFXA 4BJJB 5FEQA 4RJ6A 3CKWA 3KK8A 3TDVA 3DKOA 2P4IA 2VTAA 3OUNB 2C6OA 3OMVA 4IZ7A 5IEVA 4QMTA 4LYNA 5H2UA 4QQ5A 3QHWA 4YZBA 4ITIA 3FMLA 3CS9A 4Z9LA 4DEAA 1ZYSA 3NNVA 3VS7A 3ZUUA 3L8VA 2AUHA 3SA0A 3FMJA 1Q8TA 2X0OA 2XAMA 3FEGA 3TV7A 4CCUA 2R0UA 1M7NA 3PIYA 1CTPE 5DE2A 3VUHA 1Y8YA 1FMKA 1ZLTA 4WSQA 4WRGA 3HGKA 5DIAA 4FZAB 2GQRA 3PVGA 5CSHA 4PPAA 4RVLA 4FTRA 2WEVA 4O0YA 5AR4A 3R8MA 5C8NA 5KE0A 4JNWA 4CVAA 2SRCA 2CNVA 1WBOA 4W4XA 4L67A 3TUCA 2C68A 5DOSA 3O5AA 3FYJX 4CKRA 4DF3A 2W1DA 3ZSGA 3QC4A 4U42A 5TE0A 4IHPA 3ZH8A 4CRSA 2FUMA 5KZIA 3C4WA 2JAVA 5I3RA 1UVRA 4XS2A 3W16A 4CLIA 1WAKA 4JT3A 3QL8A 3R1NA 4G6LA 3GI3A 4PL4A 2BDWA 1WBVA 4RVKA 5GIOE 1E1VA 2VTTA 1PKGA 2IN6A 1Q3DA 4YBJA 3R7IA 4ZSLA 5FTOA 3NLBA 5AR3A 2YIQA 2YN8A 4WNPA 3R2YA 3G6HA 5CX9A 4YO6A 4X6QC 1ZMUA 2PZIA 2RG5A 4RFYA 4H1MA 3KIOC 4R7HA 3FQHA 2E9VA 4YC6A 2EVAA 2AEGA 2HWOA 4C3FA 4MXAA 4MNFA 1DS5A 3QLGA 3L9PA 4PX6A 2W5HA 3ANRA 3MI9A 5DI1A 3U9CA 3HV5A 3IOKA 2XK9A 3GU5A 3SHEA 2WMQA 3E88A 3QQFA 1QL6A 3LMIA 2QQ7A 3V5TA 1G5SA 4U43A 2G2IA 3OP5A 2XIXA 5BVNA 4DGMA 2JD5A 4RIOA 1IEPA 3A7GA 4CGAA 4EK6A 3AG9A 4U45A 4CV8A 3A7IA 3PVBA 1KE8A 3ZMMA 1XBAA 2HZ4A 5HE1A 1ZYJA 5K4JA 5CSXA 5GZ9A 1WFCA 3ENHA 1OIQA 4FUXA 1ZY5A 4FUYA 3MY0A 2QOLA 2V22A 2UZOA 4BCKA 2VWZA 2Q83A 5FXRA 5E4HA 3HV7A 4MNEA 2GNGA 3TYKA 1SZMA 5E1EA 2XALA 2HXLA 5JZNA 2PVLA 3QUPA 3T3UA 3VS4A 4P2KA 5I9YA 3GFWA 1IA8A 2WQNA 1Q8ZA 4PPCA 4O83A 4U3ZA 3R7YA 4BCPA 4RZVA 1TQMA 2XZSA 4AU8A 4BDKA 2UW8A 4FSWA 4QP8A 3BLAA 4GS6A 5A54A 3B2TA 3BBTB 2C6TA 3F2RA 3FI2A 5EK7A 3KXZA 4FZFB 4WT6A 3RNIA 4L7FA 2ITNA 2XKFA 1PMNA 4L00A 5L6WL 2XBAA 5FBOA 2R3IA 4N70A 4YNEA 5M55A 4BDHA 2BUJA 3W0RA 5ITAA 5GIPE 2JFMA 4FEQA 4XUFA 4LMUA 2VX3A 2WPAA 2F9GA 3COHA 4ZZMA 3BYMA 4MNEB 5IQFA 3ID6C 4PDOA 4FSZA 5CS6A 4EOKA 1B6CB 4OT5A 3I60A 1NT2A 1JQHA 3OWPA 4FTOA 3NVMB 3BE2A 1BI7A 4ZTSA 4I94A 3N4VA 4YU2A 1A9UA 4G6NA 3LVPA 2ETRA 3BL7A 3VUMA 1OUYA 3F61A 3H0YA 1ZY4A 1O6LA 4HVDA 3S1HA 1UNLA 4YZCA 4QYFA 3CEKA 3R0TA 5L2QA 3VVHA 3F82A 4QMWA 4EOIA 4CKJA 3LCSA 2W1IA 2HCKA 2YABA 2R3OA 3R28A 3PA4A 4O6EA 2R5TA 4HZRA 1J91A 3LZBA 3FKNA 2CGVA 4FKGA 2HWPA 4FT3A 3MH0A 2C6IA 3ZUTA 2C5XA 4DITA 4NKAA 4IX5A 1Q3WA 5EM6A 5EW3A 3UDZA 4MD9E 3KXHA 4GV1A 1OKZA 1BL6A 2ZVAA 3DK3A 1KUTA 4R77A 4F7NA 3FY0A 1Q8YA 3KF7A 3QQUA 3TUDA 3E8CA 3BL9A 1PMEA 4KIKA 5AUZA 3FKOA 3WILA 3SD0A 5CAVA 4DGGA 4O38A 3COKA 4BHNA 2VAGA 4I5CA 4P7EA 5DFPA 1BUHA 4F7JA 5AA9A 4GT5A 3KRLA 4L45A 3RWPA 4FT9A 4DH3A 5ANDA 3EL8A 4FG9A 3SG8A 3QALE 2VWUA 2YAAA 5K0KA 3R7GA 1MRYA 4YTHA 5GZAA 1H25A 1OL5A 3FXWA 1QCFA 4YNOA 1UWJA 3ZO3A 5C01A 3UOJA 4IQ6A 3MA3A 4BZDA 2RKUA 3OEFX 1F0QA 3KY2A 3FV8A 4L9IA 2YIYA 4FK3A 5JZJA 4HCTA 4IBMA 3LFFA 5M08A 4GFGA 4USFA 4LOOA 4EYJA 1REKA 4L3LA 4CZTA 5TT7A 5ANKA 3CQEA 4JIAA 3WI6A 4E5BA 2IZSA 1XBCA 3MVMA 2BR1A 2CJMA 4RIWB 3QF9A 3Q9WA 4FKSA 2R3MA 5H9BA 2OG8A 2QC6A 2W05A 2X9EA 3QTXA 3O71A 3ODYX 5CT7A 2XK4A 3RWQA 4AN9A 3ZM9A 3NIEA 4IIRA 3QZGA 4J7BA 3P7AA 2ACXA 4EL9A 1V0OA 1L3RE 3AT3A 3RMFA 4AA4A 5IA2A 5JEBA 4Y5HA 2XIZA 3OCTA 3ORZA 2BKKA 5A4CA 4DFYA 1Z57A 4GG5A 3GXLA 3UDTA 2X0PA 2R3FA 5DYJA 3U4WA 3NUUA 3BHUA 4YLJA 3GCVA 4O1OA 5CVFA 4ZTHA 2QU6A 2W99B 4GRBA 1AQ1A 2WU6A 4HNFA 2GNFA 4Y5QA 4ZTRA 4N0SA 5HU3A 3GP0A 3LFBA 4M7IA 5C27A 4EHVA 2WIHA 4X2FA 2YDJA 3MGYA 4QQTA 5HU9A 2GMXA 4FA2A 3K3JA 5CF6A 1YXXA 5BNJA 2BHHA 3UQFA 1WCCA 2QODA 3HV3A 3C0IA 3OT8A 4LOPA 2YACA 3VIDA 4QMNA 4DFUA 3JUHA 5D10A 5LMBA 1OI9A 3PXFA 2Y4IB 3F3VA 5LMKA 4AAAA 4KS8A 3MH2A 3CR0A 3SC1A 2IVUA 3UDBA 2XUUA 3KU2A 4ASXA 2PU8A 1XHAA 4GIHA 4QD6A 2JKKA 4QMVA 2OICA 3NAYA 4QTBA 4EH3A 4CYJA 4CCBA 3PFYA 3KVXA 5EYMA 3W2PA 1TVOA 3FZTA 2QHNA 4M14A 4DFXE 3E3PA 2X81A 4NM3A 2X1NA 5AR5A 4W4VA 3WF8A 2WO6A 4K77A 3F2AA 3NFGB 4MTAA 4TNBA 5HGIA 4U7ZA 5DRBA 4F63A 4FEXA 3K5UA 4K0YA 4YUQA 3VF8A 3EQIA 3W32A 4J95A 5EI8A 4C58A 3N4UA 1YXTA 3A7FA 2J0MB 4UALA 3REPA 4AZEA 4MXCA 4D1SA 1VJYA 5L6PA 4DT8A 2CN5A 3MY5A 4WRSA 4CSVA 4CRLA 3GU4A 2GNHA 4O27B 1FQ1B 2UVYA 4O1PA 3LCTA 5I9UA 4BKYA 2OF4A 2C5VA 5BV3A 4DGLC 2GU8A 5JGDA 5KMMA 4P90A 4WOVA 3VF9A 3L1SA 3NYNA 4I5PA 1FPUA 4GT4A 1G8KA 4KSPA 5FEEA 5I4NA 4IANA 3HKOA 1ERKA 4AX8A 5I9WA 5L8KA 3HUCA 4W8DA 5AAEA 4O7YA 1G3NA 4IVDA 3FLZA 2Y0AA 3O8TA 1I09A 2O65A 3BU3A 3NYOA 1R0PA 4LV5A 1TKIA 4JI9A 2EB2A 3O0GA 1NW1A 2OO8X 1QPEA 3PZEA 2Y8OA 5EDRA 1QPCA 2F4JA 4J99A 4YLKA 1LUFA 5CVHA 1XH5A 4KKEA 5HCXA 4AA0A 4QMZA 2KTYA 5C8KA 4NM5A 4D5HA 3DZQA 4ITHA 4LDTA 5KCVA 4AE6A 4XG6A 2J0KA 2PE0A 4GU9A 4KIPA 3PPJA 4L44A 3VJOA 3VBVA 3NDMA 4UMRA 3HRFA 3MPAA 4CFUA 2UZTA 3PY3A 3ZO4A 1REJA 2BDFA 3C7QA 3DJ6A 4OTQA 3ZC6A 4D28A 3W0PA 2XK7A 1OM1A 2B1PA 4ZTMA 2ITQA 3KCKA 3RAKA 3OXIA 4IXPA 1R0EA 3MFUA 3E92A 3Q4CA 2QVSE 5DA3A 2XK6A 4I5MA 4U5JA 2F7EE 2JITA 4U81A 4GKHA 1PXJA 3VULA 1UKIA 2QOQA 4QP7A 3DTCA 4G5JA 2ITVA 2B9JA 4YSJA 4JOAA 3A7HA 3A99A 3ZLSA 2ZYBA 2XCKA 4KSQA 4D1ZA 4E4MA 5J5SA 2QKRA 3CD3A 2JC6A 3Q4UA 3VC4A 5HBJA 1IASA 3TDWA 2NNWB 3OS3A 5BUJA 2AC3A 3G6GA 3LFSA 4M67A 1ZXEA 4FF8A 4ACMA 3BV2A 4NT4A 2R3QA 5CTPA 2X7OA 4RJ4A 5EH0A 4ZSAA 4AFEA 3EH9A 3HP5A 3WZJA 1XWSA 4BWKA 3DCVA 1W84A 3R1YA 1XR1A 5DH3A 4IC7A 2ITXA 3LFEA 2WMSA 2EU9A 3P79A 4W8EA 5GJDA 1Q24A 5I9VA 1P4OA 2PMNX 1TQPA 3KQ7A 3O51A 3FZPA 4I1ZA 3OW3A 4K1BA 4FYNA 5IA5A 1O6YA 3SG9A 4M0ZA 2VWBA 2RL5A 4EC9A 2OXYA 1YXUA 1KV1A 2FB8A 3BYVA 3RPOA 4O0RA 4ANLA 3D7ZA 2FSOX 2OGVA 4E26A 2Z7LA 3AKJA 3RNYA 4XMOA 4ITJA 3CGFA 5HICA 4BN1A 1TZDA 3MVJA 5IA4A 3EKNA 4J1RA 3ZO2A 1PXOA 4DH1A 5K9IA 2XARA 4DDIA 2EUFB 3BLQA 3L9MA 3PJ8A 3NUSA 1HCKA 3POOA 1OVEA 1JKKA 3V04A 2JKOA 3UMWA 5IMXA 4I4FA 4EHZA 5TO8A 5IA0A 3NUPA 3P23A 3OZ6A 3VWAA 1H27A 2PVJA 3BYSA 4RT7A 2Y6MA 4F65A 4PTGA 4YTCA 4O86A 1P4FA 2R4BA 2YLFA 4O4BB 2IVTA 4V0GA 5AX3A 5HNGA 4JXFA 3V5PA 2BRGA 2PVRA 3VO3A 3W1FA 4GK2A 3AGLA 3TZ7A 3ETAA 3OWKA 4C4GA 2PHKA 4RVTA 3SKCA 4UBAA 4C4HA 3OEZA 1YWRA 2ZJWA 4I6FA 4M13A 1SVEA 2P3GX 3PY0A 3WYYA 3ZSIA 4ID7A 3PUPA 1H0VA 4GUBA 5EM7A 3R30A 4LGDA 3LFNA 4OW8A 4UX9A 1Q5KA 2CCIA 4HGEA 4ZIMA 5JK3A 3NGAA 4KRCA 5CYIA 3H3CA 4HVSA 3JS2A 2GFSA 3P4KA 3AMAA 1LPUA 5LVLA 2QOOA 1GZKA 2J90A 2HIWA 4IWPA 3G9NA 4WKQA 2PZYA 4Y73A 4F6WA 4BF2A 3QD4A 5HIDA 2B9IA 2XKCA 4BIDA 5T3QA 4F7LA 5AP7A 3S00A 3DBFA 5F94A 1OPKA 3PXQA 3PJ3A 5EOLA 4TWCA 1Y91A 4DEBA 5TF9A 3IK3A 4C59A 5C26A 1J1CA 3U6IA 2OLCA 1JNKA 3MSSA 3NMUF 2XNOA 2YITA 2BZHB 1U5RA 2JDTA 2WTJA 3PIXA 3QQJA 4CMTA 4B0GA 3NWWA 3SX9A 4K33A 2XM9A 4MXXA 5HX6A 2RF9A 4NSTA 5F95A 4FIJA 3QCSA 2I0YA 3D15A 3H30A 3KA0A 4RG0A 4CFFA 4D2RA 4F1TA 3TNQB 5BUIA 4ANQA 4WNKA 3DDPA 4YGAA 3WBLA 2X7FA 3OFMA 1ZOGA 4O0UA 1J7UA 1PXKA 3WZDA 4AG8A 1VYWA 1YHSA 3BRBA 2H6DA 3KFAA 3QZIA 4CEGA 2VTSA 4MQ1A 5EDPA 4DG3E 3QTSA 3I0QA 3IW8A 3I1AA 4BYJA 1RDQE 4CFWA 2C4GA 5BVDA 4MVFA 1JLUE 4UWBA 4E8AA 3ZO1A 2W06A 4MQ2A 2F2CB 4PQNA 4F9AA 2WEIA 3CLYA 5IH6A 3GNIB 4F9WA 3DXPA 2ITOA 4CFMA 4IM2A 2R3LA 1S9JA 3QKLA 4J53A 4RBLA 2WB8A 4YHJA 3VS1A 2YCRA 4E7WA 3Q53A 3UZTA 3EN9A 1YOLA 3HMMA 2VTPA 4R3CA 4RIXA 1KOBA 1Q8WA 2X6EA 3O7LB 4FKRA 5B2KA 3TNPC 4EH2A 2HAKA 4LGHA 3MPMA 3OCGA 2QR7A 1BKXA 5E91A 2IW8A 4RZWA 4O84A 4CFNA 4WUAA 5AAFA 3VN9A 4CLJA 4BB4A 3EFJA 3AMBA 3O7LD 4FV8A 4CD0A 5EM8A 4H36A 1T46A 1J1BA 2NO3A 2V7AA 3DLZA 5JFSA 3RZFA 4W9WA 5L2WA 5CEOA 3DU8A 2W96B 5L3AA 3C4EA 3CY3A 5FQDC 3S2PA 3ZS5A 2XVDA 5A9UA 4YJQA 5M09A 2A27A 5AM7A 4MD8E 3SXRA 3HDMA 4FRFA 2JDVA 1WBPA 4AGWA 4C3RA 3KK9A 3QQKA 4G9RA 3FUPA 1MRVA 5EHLA 5BVOA 3IECA 2QNJA 1XKKA 1OPJA 3KMMA 5C9CA 2J0LA 2EWAA 3KULA 4GEOA 4JR7A 2EXCX 4LFIA 5HORA 4B9DA 3C5IA 3PTGA 4AT3A 2O0UA 4IWDA 4AOTA 3DKGA 3DS6A 4X3FA 5TR6A 5HKMA 3NZ0A 2QOKA 3EB0A 3WIGA 5IUGA 3CQWA 4Q9ZA 3NYXA 5ICPA 1OIRA 1NY3A 3B8RA 4I6HA 5CXZA 5M4CA 4AN2A 3KB7A 1EH4A 1E9HA 3QKKA 4EH9A 1OECA 4NH1A 4XBRA 1KE5A 1ATPE 2AC5A 4FBXA 5CAOA 4FZ7A 5AUUA 4H3BA 3V01A 2JKQA 2C0IA 5A4TA 3D7TB 2YISA 3W2OA 3QRJA 3CD8A 4DINA 5E8TA 5DVRA 3F66A 1JSUA 3PG1A 2VX1A 1W2CA 4HYUA 4HVGA 3TKUA 4C02A 3QWKA 4QMYA 4HYSA 4QMMA 3W0NA 4ZY5A 4GYIA 2OWBA 3EQPA 4QTCA 4D1XA 3AOXA 1UU7A 2IZRA 2OK1A 3VRYA 4PP9A 4R3RA 2KULA 1H07A 4JBVA 1GOLA 4BCJA 1Q4LA 5B2MA 3R7EA 2HW7A 3DDQA 2C6LA 1FVRA 2OIDA 4TWOA 5LCKA 3Q4TA 4L6QA 5D1JA 4TN6A 2W17A 4PMTA 4GJ3A 1H4LA 5TOZA 3UIBA 1OIYA 2WNTA 3RBWA 3RK9A 2QLUA 5KKRB 4FOBA 4ZS0A 4PF4A 1XJDA 2A0CX 4I23A 4U79A 3FYKX 3NX8A 3OVVA 3HMNA 3V3VA 2ITTA 3UC4A 2CPKE 3I0OA 4DC2A 4UB7A 4FJVA 2ZMDA 2IW6A 4MWHA 4QNYA 4QP2A 2BHEA 1ZZLA 1U54B 2FVDA 3FI3A 4QP1A 4DFZE 3HP2A 3Q6WA 5D41A 5IUIA 3C0HA 4XP2A 4ZMEA 3R1QA 4R6VA 3TG1A 4E3CA 2ZV2A 3EMGA 3EOCA 3IDBA 4FV7A 1QMZA 4PL5A 2I0VA 4K6ZA 1H1WA 3THBA 3ZEWA 2ZDUA 5CNOA 2VO0A 2R3RA 3CKXA 4DH7A 2YDKA 4JRNA 5IH4A 4V01A 3C50A 1JSTA 4D55A 4FTKA 5IISA 5F1ZA 4MF0A 5J1WA 3EHAA 3E8DA 1ZWSA 4BDFA 5J9ZA 3IW4A 1VEBA 5E8VA 3ZXTA 4BTJA 4RX7A 4UYAA 3NUAA 3JXWA 4MEDA 2YM3A 4PNIA 4E6DA 1OL2A 2R3NA 3LFAA 2OJJA 3WF5A 5LVMA 1S9IA 5FXSA 4O22A 2GDOA 2PMIA 4QMOA 4E4LA 4L53A 5C4KA 2WMRA 5EI6A 4CNHA 3EIDA 4FKTA 4N4SA 4BI0A 3ORIA 3A4PA 3QCQA 5LOHA 2C3LA 3NVKI 3MA6A 3ANQA 4UMQA 5FTQA 3V5LA 3BBWA 3ZLWA 4F9YA 1IA9A 4ALVA 3HDNA 1IAJA 4I92A 5E8UA 3H0ZA 2O64A 2X6DA 5K0XA 4ZY4A 3LE6A 3Q4ZA 4U40A 3KGAA 3R8VA 3W8QA 4DFLA 5CU0A 3BU6A 3TM0A 4J96A 4FT5A 1YI6A 3OXTA 4G17A 3OOGA 1AD5A 4H39A 3PA3A 3RK7A 5EFQA 4AP7A 3PSDA 1G8AA 3QD2B 4Z7HA 5J95A 3VS3A 4EBWA 4YJVA 4BKJA 3ZBFA 4L52A 5B7VA 4EOQA 4J8NA 5DBXA 4U41A 3MJ2A 2WMXA 3BX5A 5CU2A 3ZEPA 4BZOA 3S0OA 4FIEA 3W2RA 4O7NA 3VNTA 3I81A 5AX9A