2GNHA

Pka five fold mutant model of rho-kinase with h1152p
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYMPGGDMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structural analysis of protein kinase A mutants with Rho-kinase inhibitor specificity
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gnhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gnhA02
5HICA 4AOJA 3FMKA 5FTGA 2YLFA 2Z60A 3E64A 3UC3A 3C4WA 2ZV8A 3OXTA 1J7IA 3TV4A 2J7TA 2J0KA 1FGIA 5CXHA 2XRUA 4D2RA 2BTRA 4DCEA 2FSOX 4HGLA 1M7NA 1PRYA 4TW9A 5K4JA 4BY9E 4A06A 4WNMA 3FI2A 1OPJA 3LFNA 5GHVA 3ROYA 3JYAA 5JQ5A 2V22A 4ID7A 3VF8A 4D1ZA 5LOHA 2RFDA 4U0IA 3HRCA 1MP8A 2ZOQA 3OUKA 3R04A 2OIDA 4RX8A 3ZRMA 5KKRB 2OG8A 1NVQA 3HMNA 4U81A 4N4SA 3HL7A 1U5QA 3PSBA 4BDHA 4IM3A 5BVFA 3MYGA 5F9EA 3R8VA 3NUNA 3NYOA 4YZBA 3I0OA 1SNUA 3SXRA 4RX7A 3QD0A 4RJ7A 5KNJA 3UMXA 2VRXA 4IAIA 3OMVA 2HENA 1H07A 2WTDA 3L9MA 4Y46A 2X8DA 2YWPA 4WSYA 2I6LA 3R9NA 1BMKA 3TKUA 5DMZA 2PVNA 3PY1A 4C3FA 3W2OA 4EH6A 5AX3A 4FTQA 4AN2A 4QYFA 4EK6A 5LCKA 2X0GA 4X3JA 3U9NA 5IEVA 1OVEA 2XIZA 3C0IA 2F2UA 4AZTA 2GNJA 2GQSA 5FUTA 3COKA 3QD3A 4NTSA 5DT3A 4G3EA 2ETRA 4YSJA 1TQMA 5M4IA 2EB3A 3MVMA 2AC3A 2PE1A 5JN2A 1KE6A 3DBDA 1H24A 4QNAA 5CI6A 5E90A 2PE0A 3QCYA 4W9XA 5E7RA 4O1OA 3CE3A 4EZ5A 2R4BA 2CKQA 3ZM9A 3JUHA 2BPMA 3KXZA 2CPKE 1B39A 4NT4A 3E93A 5KZIA 2BKKA 5ANEA 4O7ZA 5DYJA 2XKFA 3ORLA 3HNGA 3VQHA 4AT4A 5JFVA 2WXVA 3GVUA 3G0EA 4HVDA 2WQMA 5K4IA 2JLDA 4YUQA 2ZAZA 4DEAA 1OUYA 3ZZWA 4J71A 5H3QA 3H9RA 3OY1A 3AC3A 3AC5A 3N51A 4L7FA 2Y4IC 2QO7A 3LQ8A 2JDVA 3SQQA 2O5KA 3Q5IA 2GS6A 4WHZA 2YISA 3BEGA 2WOUA 3WF6A 4DGMA 4WKQA 4DH8A 3BU3A 4TL0A 4M69B 2C4GA 3KC3A 3IONA 2W9ZB 1PMUA 2WMSA 3QZHA 4ITJA 3CY3A 2OJ9A 3PG3A 4LRKA 4U80A 4HYSA 1OBGA 3C4ZA 3KK8A 3PRFA 4MNFA 3LCOA 3G5DA 5C26A 2BDWA 3P78A 3QQJA 4LV5A 3O8UA 2PMOX 5DWRA 5D7AA 3ZS5A 4YJPA 4PDYA 3BELA 4O27B 2RF9A 3F3TA 4H1MA 4O0UA 4IQ6A 2JGZA 3FPMA 3GU7A 2QQ7A 2YCFA 4RA4A 1ZMVA 5CT7A 5DRDA 4CD0A 5I9VA 2H96A 3E7OA 5EQYA 3WYYA 4IX5A 1DM2A 3RP9A 2EUFB 4EZ7A 3IGOA 4CFVA 3C4XA 4X2KA 2VWZA 5FDXA 5DI1A 3DK3A 5A46A 2HZ0A 2XIXA 5CT0A 1IA9A 3KULB 2CGUA 4ZJJA 3BHUA 3H9OA 4FOBA 4M67A 4GJ3A 2OIBA 3HMOA 4TTHB 3CD8A 3EN5A 3VUMA 2VX3A 3BLRA 2HELA 3PIXA 4FV4A 4FKQA 4NJ3A 3VS1A 5IG1A 3PXFA 2OJFE 5TT7A 5IQEA 5J8IA 5DHJA 2IVUA 5M55A 1W83A 2PULA 1OIQA 3WYXA 2A27A 3AXWA 4RVTA 4DFLA 1KE9A 3QZGA 3PP1A 3VS0A 4M3QA 4MCVA 3C7QA 3MPTA 4XV3A 4GT5A 4ZSGA 3ZH8A 3GQIA 4E6DA 5C01A 3FLSA 1GIJA 3OG7A 2X9FA 3IO7A 4P2KA 2NPQA 4P5ZA 1SZMA 2W1IA 5AP4A 3EJ1A 1BUHA 2GS7A 4G6LA 4L52A 4IVBA 1UA2A 3SD0A 1YHVA 4EEVA 3MH3A 1DAYA 2IW6A 4XBUA 2XK9A 4JVGA 3V6SA 3C1XA 4J98A 2PVRA 2Z7LA 5IKWA 3UOKA 4QP6A 5CWZA 4IZYA 2V55A 3I5NA 4IE9A 4RJ6A 3LHJA 4WRGA 3OC1A 4LYNA 1PXPA 3U4WA 4H3BA 3WZUA 3HVCA 3TV7A 2IN6A 5A4LA 4CLJA 4FKLA 2F4JA 3W55A 3MFRA 4I6FA 2QOQA 2VZ6A 3KVXA 3DAEA 4XOZA 3EKNA 2CJMA 4IDVA 4PL5A 3LFEA 5A6NA 1G8AA 3R7YA 5CX9A 4I41A 4L45A 2RSVA 1WBTA 4XP0A 1GZOA 3FJQE 3PYYA 2VWXA 5CVFA 5EI8A 3KVWA 1GIHA 3RTPA 5IDNA 3EQPA 4YURA 2QOCA 4U42A 4FSNA 4FTIA 2BUJA 3R21A 5E9EA 4YZDA 1CKIA 4RIXB 4FSQA 1J1BA 5D10A 4M0YA 3TNIA 1MUOA 4D4RA 3ALOA 3WOWA 2XNMA 3U6IA 5DGZA 2C5XA 4Z3VA 4BWKA 3HMMA 4CEGA 3R1YA 4B7TA 4X2GA 4GFOA 3VS3A 3QRTA 3ZCLA 2OZAA 1S9IA 4C4HA 4QTDA 5IMXA 3BGQA 3HYHA 4BICA 5AV2A 2G1TA 3LFBA 2ITTA 2BZJA 4GIHA 4F9YA 4O7SA 4O83A 2ZM3A 3C4EA 3SXSA 4TZRA 2BTSA 3OCTA 4XBRA 2AUHA 4DA5A 4QMXA 3OWLA 3BX5A 4D0XA 4FV1A 4A4XA 1JBPE 3ZSIA 2PZYA 3NNXA 4AZFA 1OMWA 1BI7A 1WVWA 4USDA 3FL5A 3Q5ZA 4APPA 2VO6A 4ZAUA 3QX4A 1BX6A 4IIRA 3DQXA 5L2SA 1GJOA 3KXXA 5HIDA 2Y4PA 5HIBA 1BYGA 4JIAA 3OW3A 4O84A 5HX6A 4BF2A 4FV9A 1MQBA 3LQ5A 1SM2A 5DE2A 3Q2JA 5BVWA 4DFUA 1KWPA 3RPSA 5IQGA 5ACBC 1AQ1A 1R1WA 5M06A 3CTQA 3F7ZA 1JSTA 5AP5A 1OL1A 3SC1A 1H28A 2J50A 4RC4A 2BMCA 3VBTA 4C4JA 5BVNA 3GFWA 2XNNA 3M2WA 5DRBA 2XKCA 3JY0A 5E8WA 4S34A 3G6HA 4YJSA 3LFCA 1G8SA 4Y8DA 4DH3A 4IANA 3QRUA 3UOLA 3ORTA 3M11A 4ZS0A 4CGAA 3ZO2A 2LAVA 4R5SA 3PVWA 2YFXA 5I3RA 4NEUA 3BGPA 4EYMA 3KN6A 3FHIA 4BDCA 4Q2AA 4M0ZA 4FYOA 2WB8A 2CNUA 1OKYA 4UMPA 4R7BA 2OGVA 2ETMA 2XK6A 4LMNA 5A54A 3B2TA 3R28A 5M44A 4MXZA 4DF3A 4F0FA 4RJ4A 4FC0A 5CYIA 5E8UA 4YGAA 2QCSA 3L9PA 1G3NA 3R00A 4FTLA 3DJ6A 5AP7A 4TWNA 3T8OA 4FE2A 2YJRA 1XBAA 4FKGA 3TG1A 4FA2A 3PXQA 3MTLA 4GV1A 4C61A 2W5HA 3QU0A 4YJQA 2J5EA 5JMSA 4MXOA 3L8PA 4C02A 5F20A 4ASDA 3Q9ZA 4KBCA 4BN1A 5CAPA 4F1OA 4XEYA 3LLAA 3DDQA 3IK3A 2DYLA 2P2HA 3OT8A 4KIKA 5ETAA 2J0JA 3FPQA 4L3JA 3I7BA 2Y8OA 3ZFYA 4NK9A 4DG3E 4J52A 3R9HA 1QPEA 2ZMCA 3PJ1A 1KSWA 4NFNA 4AA0A 2Y6OA 4U97A 3OOGA 5FM2A 4G2FA 4Z55A 1UU7A 2PK9A 5BVEA 1RQQA 4OGRA 4EHVA 4QMLA 3R22A 4GRBA 3B8RA 2GQGA 2P3GX 3MGYA 3QF9A 4I4EA 5AP0A 5HNBA 3FXZA 5J5SA 2NNWB 3HECA 2X1NA 3VAPA 4UMUA 3FKNA 3LJ2A 2HYYA 4FZDB 2W0JA 4QP3A 3OS3A 4EHGA 4HJOA 2BZKB 4IX6A 3FV8A 3UPZA 3AC1A 4NCTC 1IG1A 3UODA 2HXQA 4RZWA 3ENMA 3OCBA 2OWBA 1H00A 3BV3A 2EXCX 4WSQA 4ANNA 1JKSA 3DA6A 2W4JA 3GCVA 5HBJA 2PHKA 4MYGA 4YTIA 3V5TA 4BFMA 4G34A 2IZRA 2ZDTA 5EM8A 2IG7A 4JRNA 3OEFX 2JKMA 2X39A 3CY2A 3GOPA 5FQDC 3AC4A 3E88A 4G31A 4WBOA 3ZEPA 2C6KA 4YZCA 4ANOA 1O6YA 4L46A 4YJOA 3HA8A 3ZU7A 4F6SA 3COHA 2PMIA 3BYMA 2JD5A 4BDIA 3RBWA 5IUIA 4H05A 4I93A 2BHHA 4YTFA 2VWVA 3AOXA 4BDGA 4BTFA 4EOLA 4Z9LA 1WCCA 5BNJA 3PJ2A 4UBAA 2LGCA 4CV9A 4EUTA 5CEKA 1WMKA 1VYWA 5DR2A 1OZ1A 4TYJA 4ZTHA 2ZMDA 5TE0A 4L67A 3EN7A 4HNIA 4HPUE 4M66A 4FT5A 4FG9A 3MDYA 4GVAA 4BCGA 4GL9A 3QHRA 3WIGA 2Q0NA 4F6WA 1M2RA 1YWVA 2V62A 4R7IA 4BIDA 4C62A 1A48A 1P2AA 4O0RA 4GSBA 3K5VA 3A7GA 4AG8A 4XHKB 1YI6A 3F2AA 3QC4A 2VTPA 4KSQA 3NYNA 5AV0A 3UVPA 4X2JA 3V5LA 3ZONA 4E20A 4B6LA 2G2IA 4FTUA 3JS2A 4FKRA 2ZB1A 1YHWA 4CFXA 1Q8TA 3MTFA 1IRKA 3F3UA 2HWOA 3F3VA 2IZUA 4TN6A 3DZOA 4I21A 4FIHA 4KBAA 4RC2A 4XG8A 5IDPA 3AT3A 4TNBA 2Y6MA 4FV7A 4FT3A 4O6EA 4LOOA 4ERKA 5M4UA 3O0GA 3OT3A 3TV6A 2BKZA 3F5GA 4KIPA 5IPJA 4AAAA 3BI6A 3PA4A 3PIZA 4EUUA 3UQCA 5B2MA 3GCUA 4NJDA 4QP8A 2BIYA 3TUCA 3FZRA 3G2FA 4XV2A 3R1NA 3RAKA 4O91A 4K11A 2Y4IB 2JKOA 3T3VA 4Z16A 3UG2A 5JZJA 1VEBA 2XM8A 4HNFA 3VQUA 2VUWA 2VTTA 2XJ2A 2Z7QA 3EWHA 4KBKA 4CYJA 3SG9A 2BDFA 3D5UA 4X7QA 1ZOEA 4NCTA 2BZHB 3LFDA 2PPQA 5AV3A 4TWCA 5C4KA 4OTGA 1CTPE 3PWYA 3OFMA 4ZS4A 4A9UA 2ZB0A 3OVVA 4UY9A 4ANSA 2R64A 3LFSA 3WF9A 5CENA 4FL2A 2J9MA 4O0SA 3IGGA 3PP0A 1NY3A 2WOTA 5B2KA 3CR0A 3O7LD 5E8VA 5I9UA 2H8HA 4EC8A 5DA3A 4WOVA 5ETFA 2CCHA 4XH6A 1PKGA 2BAJA 4OTWA 2OZAB 2B9FA 3MH0A 4S31A 3RAWA 1YXVA 4G17A 5J9ZA 4DLJA 1PXLA 5DNRA 3R2YA 3QXOA 4R7HA 3S2PA 4EK3A 1J3HA 4P4CA 5M51A 2YAAA 4LV8A 4CCUA 5DG5A 1OM1A 2FSTX 2X6EA 4IVDA 3AMYA 2YM4A 3NW7A 3D94A 4UV0A 3HDNA 4RSSA 3COIA 2PUIA 2QODA 3DNDA 4ZEGA 5HESA 2C0TA 2ITNA 2UW8A 3G51A 1Q24A 3QL8A 2YN8A 4FSMA 5H8EA 2JDTA 1H25A 5EOLA 3NPCA 1EH4A 5IA3A 4QNYA 3SLSA 3RHXA 3O96A 4FVRA 3S1HA 4NSTA 1CM8A 2DUVA 3RK5A 4HVGA 1CKJA 3OZ6A 4GU6A 3LQ3A 1FPUA 3IW8A 5E8TA 3UPXA 3ZRKA 5KX8A 3FZOA 2JAVA 4TRLA 4PPBA 4W4XA 5ANIA 3LOKA 1WBWA 2WO6A 4C4EA 4HYIA 3UIXA 4DHFA 3PJ3A 3A7IA 4QPAA 5DEWA 5IUHA 2YERA 3KRXA 3L9NA 4BCNA 4BKYA 3M42A 4MNEB 4FNXA 4GK4A 3RK9A 4G9CA 4ZK5A 3C9WA 3JPVA 3TZMA 2J90A 1Q62A 1Q4LA 1VJYA 3GCSA 5KMOA 1JWHA 3NNWA 2XZSA 3TTIA 1Q41A 1OIRA 4XG2A 2Y7JA 4XOYA 2UW9A 1ZYCA 4B0GA 4FI1A 4GFMA 4O0WA 3RINA 4YMJA 5DN3A 3O71A 5IH4A 3EB0A 2VNWA 1PMVA 3A8XA 5DVRA 5F4NA 1YWNA 2X8IA 3EYHA 2X8EA 4RC3A 4D58A 5EM5A 4JDKA 4Q5EA 3FSFA 3UZPA 5K5NA 3DAJA 3KRWA 4H3PA 5L4QA 2ONLC 5EKOA 3TTJA 1ATPE 4RIYA 5CVGA 1OKVA 3KRJA 5C4LA 3MFTA 3S00A 1K2PA 3PVUA 4UMQA 4ZSEA 2O3PA 2P55A 2QOBA 2QURA 4CRSA 4OR5A 1F0QA 3VUTA 3U55A 4GYGA 1G5SA 4E4MA 4F4PA 5KO1A 4DFBA 4XLVA 1FINA 1Y8YA 5M53A 2ITUA 3LLTA 2YM6A 3I4BA 4AW5A 1ZY5A 3D5VA 3E3BX 4EH5A 4YR8A 3L9LA 5KMNA 3EOCA 5J5TA 4KRDA 2UV2A 5DT0A 5J7HA 1H01A 3Q53A 2C1BA 3RPOA 3P86A 4UYAA 2BHEA 4EQMA 2V5QA 3VRZA 3BE9A 2CNQA 2WMXA 3PRIA 4BDBA 1LPUA 2XA4A 3LCSA 3Q3BA 3DXPA 4Y83A 3LCDA 5BVDA 3RPRA 3PTGA 4EOKA 3WF8A 3TNHA 3NW5A 3FMNA 4WO5A 4X3FA 5FBNC 5AIRA 3HA6A 3FKLA 4CNHA 4HYUA 4FTNA 4FV6A 4DEIA 2VV9A 2YDIA 4BCKA 4DTAA 5ANDA 4H36A 3TIZA 4HOKA 5FTQA 1LP4A 3W2QA 4UWBA 4A9YA 3DZQA 3QA8A 3HMPA 2YA9A 2C6LA 2OW3A 2NP8A 3TZ9A 4MVFA 4AX8A 2XIYA 1YDSE 2CN5A 4G6OA 4XCUA 4F64A 2GFCA 4GYIA 4AW2A 2CLQA 3F88A 4R1YA 4UXQA 3E7VA 2IW9A 3LFQA 3ZLYA 4C37A 4F63A 5AP1A 1U4DA 5LVOA 5EYMA 3FI4A 4QMSA 4BWXA 4I5MA 4QP1A 4RGJA 4O0TA 5TR6A 4BC6A 1E1XA 2ITVA 3ZUTA 2W1HA 4UZHA 3HP5A 1P4FA 3ETAA 4ITIA 3W32A 5HIEA 4MHAA 3L1SA 4FICA 5KHXA 2XK4A 4R1VA 3O8TA 3EQRA 4WRSA 4JL9A 3NNUA 3WZEA 4HGTA 2QOKA 2QVSE 3K54A 4JAIA 2ITOA 2J51A 2X7FA 4FZAB 4PTEA 5EDRA 3TT0A 3UJGA 3VS4A 4EOIA 1I44A 4Z7HA 3BHVA 5JGAA 2OFUA 4IB1A 2PL0A 2ITQA 2PVHA 3FAAA 2IJMA 4HZSA 1ZWSA 2HOGA 4MXXA 5ANOA 5EYKA 5JEBA 4O7VA 4G16A 3Q9YA 4YC6A 3Q60A 4KB8A 4LQMA 3U9CA 4CCBA 1ZZ2A 3EZRA 5HD7A 3RMFA 3FL4A 4NZWB 3ZRLA 2W1EA 3NGAA 2QU5A 3KA0A 1J1CA 3FXWA 1H08A 1UKIA 2ITWA 5BQ0A 5AUWA 4GK2A 4FGBA 3DFAA 2F57A 2BALA 4BZNA 3IECA 4FV8A 3LW0A 2HY0A 4S30A 5CQWA 5FEEA 4CZTA 2XCHA 3KF4A 3NVKI 3ZMMA 4DINA 1KOBA 2HAKA 3QQHA 5HVYA 4C34A 3GC8A 4ZSLA 5DH3A 1U46A 1MRYA 1O9UA 4ALVA 4KNBA 4A9RA 4KA3A 4EOOA 3ANRA 3DKGA 4H1JA 2YIQA 3FHRA 4FSYA 4C2WA 4U3ZA 1ND4A 3NUPA 5CAVA 4Y5HA 5C8MA 2FVDA 1M2QA 3MY1A 4WNOA 5J95A 3CTJA 3NYVA 2XJ0A 3HZTA 3KMUA 4DBNA 4OW8A 4QP9A 3MJ1A 2CSNA 4LL0A 2C1AA 3DB8A 3LZBA 1WBNA 3GU8A 3MA6A 4RZVA 2I0VA 4L43A 4FTMA 5JT2A 3U6JA 5KMLA 1UWHA 1M14A 4K0YA 2OXXA 3FC1X 4L01A 3F5UA 3IW7A 5HLPA 3R30A 4XG9A 4O1PA 4U41A 5CU4A 3VHKA 4F08A 4O82A 5AFVA 3DLZA 5JH6A 4R5YA 3IDPA 1GNGA 4K6ZA 5HZNA 1V0BA 2NO3A 3CKXA 4AOTA 4O0VA 4K77A 4MD8E 1HCKA 4E5AX 3PDTA 2C3KA 5IH5A 1UU3A 4LGDA 4ZZNA 4UMTA 4FTOA 4IXPA 3V8TA 2R3GA 2UUEA 4F7LA 3GCQA 2HZ4A 3DS6A 4QO9A 1Q99A 4R3RA 5FRIA 2XEZA 4QMUA 3EL8A 5L8JA 2VTJA 3LFAA 4YJRA 4FKWA 4UXLA 3RCJA 3MH2A 1ZYJA 5J7BA 4RWKA 3KXHA 4ZTMA 3JVRA 3D7ZA 4BDFA 4FYNA 3VF9A 4IACA 4BYJA 2ZV7A 4TYIA 5A4QA 4D5KA 2WHBA 4IFCA 2HWPA 1TKIA 4RQVA 3BGZA 5IF1A 4M14A 3VJOA 1XBBA 5T68A 3FLZA 4ZIMA 3CXWA 4NL0A 5CEIA 1NA7A 1XR1A 4CVAA 4PV0A 3IKAA 2OICA 4XG4A 2VTHA 2XNEA 2EVAA 3HV6A 2XJ1A 3A99A 5AWMA 2YAKA 5JRQA 4R77A 2V7AA 3QTZA 2QU6A 3A61A 2JDOA 3FY2A 2GS2A 3MI9A 5AUUA 4D2VA 4MD9E 5CU2A 4AW0A 3FMDA 1URWA 3TUBA 2GQRA 2XB7A 4ACHA 4DT9A 3P5KA 4UB7A 5EI2A 3RPVA 4AFJA 3HRBA 3D7TB 5LVNA 3ZBFA 3GNIB 1T46A 5EDQA 5HG8A 4BI0A 2R3IA 4HCTA 3WI6A 5H9BA 3NUYA 1H26A 3UVRA 4HVSA 2XNPA 3BEAA 2UZLA 2VTOA 2YDJA 3ZEWA 4JBPA 1W0XC 2WMAA 3ODZX 3PE1A 1K9AA 1XQZA 4GH2A 1Z57A 5ANGA 5J79A 4DH1A 5I0BA 3UGCA 2R3NA 2IWIA 5EQEA 1U54B 3REPA 5CU0A 2VO7A 2R5TA 3R8PA 1UKHA 4MK0A 2R3PA 3CLYA 4ITHA 2GFSA 3D5WA 3CGOA 3LKMA 1GOLA 2QOHA 4AACA 3UP7A 1IA8A 3QRJA 1XH7A 1XH4A 2PWLA 4ZZOA 5B7VA 2A19B 1AD5A 5HCYA 3R1QA 4JIKA 4K18A 4GUEA 3NRMA 3ORIA 5E91A 4ENXA 4AT3A 1YRPA 1OPKA 4XP2A 3TJDA 2UVYA 4X6QC 2ERZE 5GZ9A 2GHGA 3G6GA 5CY3A 3QD4A 4YTHA 3HDMA 4IHPA 3MWUA 3QQFA 4O7RA 2GHMA 2OJGA 4YSMA 4NTTA 5K5XA 3A8WA 4LI5A 3FKOA 4O21A 4F9CA 2ERKA 2X2MA 4BDJA 1H1QA 4IWOA 4LGGA 2W17A 2QO9A 3A4OX 5GINE 5LVLA 4QYEA 3PA3A 4PMTA 3HV7A 5LVMA 5DFPA 2E9NA 4IFGA 5L6WL 3SRVB 4CV8A 4ZTLA 1RW8A 2Z7SA 2ZV2A 2R0IA 4F6UA 4D1SA 4NIFA 4FNWA 4PMSA 2XMYA 4FKPA 2B55A 3RNYA 3BWFA 3BRBA 2FUMA 3NEWA 4RX5A 2P2IA 3QQUA 4FIEA 2VTSA 1CMKE 2JIVA 2W7XA 3AGLA 4OTHA 5H2UA 2C0OA 2RG6A 2BCJA 2H6DA 5BUJA 5LVPA 4S2ZA 1UWJA 2VTAA 3E63A 4E4NA 3GP0A 3QTWA 4RIOA 4TWOA 2IZTA 3UOHA 4EOQA 5FG8A 3PXYA 2GSFA 5AMNA 4D55A 3RJCA 3EQFA 3OF0A 2WTIA 3AGMA 3C4FA 3PIYA 2RL5A 3QBNA 1H0VA 1DI8A 2W5AA 5BPYA 4EWHA 3IW5A 2PVMA 3DB6A 3PFQA 4D4SA 3V6RA 3CEKA 4J99A 5EM7A 1PMNA 2GHLA 2F7EE 4XX9A 2I0YA 3G90X 4EOMA 5CSVA 4FEXA 2J0MB 4O7WA 3GU4A 3H3CA 4BTJA 3F5PA 3OOMA 2OZOA 4FUYA 5BX0A 2ITXA 4FMQA 4ZMEA 2QR7A 2UZEA 3Q96A 1Y91A 2I40A 3WF7A 4F1MA 3NR9A 2A1AB 2XF0A 4D28A 4EC9A 3C0HA 3NCZA 1HCLA 4ACDA 5C8KA 1AGWA 2HY81 3QLGA 4DT8A 4JBQA 3PZHA 4WBBB 1BL7A 5EYCA 1UNHA 2XH5A 3Q04A 4Y85A 3KXNA 4EBWA 5CALA 1KUTA 4XG6A 1Q8UA 5CSXA 4FEWA 4GW8A 3LJ1A 5JQ8A 3NSZA 3GGFA 4RFYA 5CU3A 1FVVA 4C36A 4FIJA 3R0TA 4TYGA 4QMYA 2WEVA 4L00A 3NDMA 2OH0E 4RWLA 2ZDUA 1W7HA 3GXLA 4G1WA 4FKOA 4IAFA 4QMMA 1DAWA 2VTNA 3E92A 3GUBA 2UW7A 3QTRA 4RWIA 5BMMA 4XYFA 3GCPA 3F61A 4PMMA 3UIBA 1F5QA 2XNBA 3DTCA 3MFUA 3UO6A 1PYEA 2IVVA 4GJ2A 3SW7A 2ZVAA 4DCAA 1FVRA 5IQIA 4OT5A 3A62A 3ZUUA 5EH0A 4ZZMA 4BDEA 5J9YA 5L8KA 4C8BA 2R3OA 3MESA 4FV5A 3K5UA 1Z9XA 3BU6A 4O22A 3GC9A 5LCJA 4GK3A 3QWJA 2W1ZA 4MBLA 4P90A 2ZYBA 5L2QA 1M17A 1WAKA 1WVYA 5G6VA 4C58A 5KMMA 4DN5A 4I22A 2VX1A 4FKUA 4IZ5A 2PVJA 2JKQA 2ITPA 2C6OA 2QG7A 2YM3A 4I5CA 4PNKA 5EW8A 1IR3A 3LIJA 3TDVA 2P33A 3PE2A 4K1BA 2WEIA 3ZUVA 4EK5A 5L8LA 2O65A 4F09A 1ZRZA 5JGBA 4GUBA 2PTKA 3ROCA 2GTNA 2R3FA 5I9XA 1Y57A 3HKOA 2WMBA 3VS7A 2YM8A 2B7AA 3UVQA 1UU9A 4JQ7A 2QLQA 1T45A 1LEZA 2R3JA 4W4VA 3NZ0A 3W2PA 4G3CA 4ACGA 2BRNA 3FMHA 4KSPA 4FT9A 5EI6A 2C69A 2OI4X 3DY7A 4BCJA 3FI8A 3LPBA 3ODYX 1LR4A 4DG0E 5AEPA 3I60A 4OTFA 4FK6A 4NYEA 4BI1A 2PMLX 4XRLA 4XLIA 4WG4A 2GU8A 4AE9A 1XH6A 3I5ZA 5I4NA 1B6CB 3LXKA 3A7JA 3E87A 3MBLA 3R7GA 4GS6A 4MTAA 4BZOA 4NUSA 4D4YA 3N9XA 1YDRE 4IC8A 3BWJA 4GT4A 5HO6A 2GNFA 1FMOE 1O6KA 4QRCA 4YZ9A 4BCQA 4ORKA 3LMHA 3UOJA 3ANQA 4RPVA 3PPJA 4LUDA 4Z7GA 1PMEA 3TACA 3WE8A 4C3RA 2KULA 3ALNA 4ANBA 3T9TA 3OBJA 4YPSA 1M7QA 3VHEA 4I0RA 4WNPA 4AZWA 1STCE 2VGPA 5E8XA 4XRJA 5BYLA 1ZY4A 4J7BA 4BGGA 3OHTA 4CXAA 4O7TA 3QZFA 5E8YA 1OIUA 3QUDA 4Q9ZA 2B4SB 4IJ9A 4M7IA 3OTVA 1OBDA 1K3AA 4I24A 4O7LA 4E73A 1PXJA 4NM7A 3GENA 4YHTA 5EFQA 3F66A 3U8WA 3P7CA 2UZOA 5AR3A 3ZSGA 1YQJA 4L3PA 4DGOA 3PXKA 4RX9A 2VGOA 5FD2A 5HQ0A 3LFFA 4RIWA 5C27A 4D4VA 1WFCA 5HLWA 2IVTA 2WTWA 3B2WA 3IS5A 4D2SA 1KE7A 1YHSA 4JX3A 1PY5A 4ACMA 5A4TA 4PDPA 2CN8A 5IA0A 4RQKA 4ZTNA 4IAZA 2P4IA 3UYTA 4FV2A 3BE2A 3BPRA 3K3IA 3QLFA 5E92A 3S3IA 4IMYA 2OJIA 2YJSA 5A14A 2WGJA 4CFFA 3H0ZA 2AYPA 3DTWA 3T9IA 3POOA 1J7UA 3VBQA 3W8QA 5CLPA 4A07A 5L3AA 5F95A 3C50A 1H1RA 4FOCA 2WMVA 2XEYA 4GU9A 4CLIA 1XKKA 3E8EA 2BR1A 5AIKA 3DBCA 3FMJA 5ACKA 5CF6A 2GNGA 2PMNX 4YNEA 4HVIA 2UW4A 1JSVA 3W33A 2UW6A 5AJQA 4TT7A 2WMUA 3O2MA 5JZNA 1PF8A 3ZC6A 3QGYA 2C5NA 4JOAA 4CYIA 3QCSA 3WILA 5LJJA 4U6RA 1XH9A 4U8ZA 3MVLA 4DYMA 4FEUA 5ETIA 2XNGA 4CTBA 4ONAA 4ASEA 3V5JA 4RJ3A 4IM0A 3CKWA 5ITAA 4DEDA 3KY2A 2X9EA 1VZOA 3BQRA 1JKKA 2PZPA 3MPAA 3I81A 5KUPA 1KE8A 3P7BA 2IPXA 3SXFA 4JX7A 2GNHA 3RI1A 1IEPA 4ANQA 4FEQA 5BYYA 1A06A 3RKBA 1YWRA 4F9WA 2A4LA 1UNGA 3RAHA 3QKLA 2C47A 2C3IB 3HUBA 4NIFB 3EFWA 4FKIA 3R7OA 3R7UA 2RFNA 4OAVB 4I1ZA 4CKRA 4J95A 3ZO3A 1JVPP 1KV1A 4QT1A 4I92A 4JS8A 3UO5A 1UVRA 3FXXA 3WARA 4DFXE 5K0XA 4EH3A 4G3GA 3R7EA 1MRUA 5HG5A 2JBPA 4FV0A 3KU2A 3C51A 4U5JA 2HIWA 3O8PA 4HYHA 4MH7A 4FK3A 2WU6A 1OL2A 5L6OA 4EH4A 2YWVA 3OROA 5AUXA 3C0GA 2PUPA 5EDPA 2UZWE 4LRMA 3R8ZA 4CG8A 3TZ7A 4I6QA 4YJVA 2A0CX 3RNIA 5HVKA 3Q4UA 4YTCA 2OXYA 4D2TA 3ORZA 4KKHA 4B4LA 3PWDA 3ELJA 4I4FA 4II5A 5GJDA 3ORKA 3FMLA 5HVJA 4J1RA 2XBAA 4DEBA 4QMOA 5KBRA 3Q9WA 4WT6A 2YIRA 5TKDA 2JFMA 4XJ0A 4DEHA 4P5QA 4ACCA 4UALA 4YO6A 4FTCA 1YKRA 4QPSA 2WQNA 2PUNA 1TQIA 4Q5HA 3C13A 3NNVA 4E5BA 3AD5A 3N4VA 3JVSA 3AMBA 4J8NA 4CQEA 3N4UA 4JDJA 4RJ8A 5L2WA 4MWHA 2YEXA 3QZIA 2YITA 2C6EA 3WBLA 4CT1A 4D2PA 2CDZA 2VAGA 4GVJA 4BRXA 5AAEA 4RVLA 3I6UA 5DBXA 1NW1A 4OTRA 5KBQA 5F94A 3ZBXA 4YU2A 3EQBA 5LWMA 3HEGA 4KUJA 3GU5A 2W1CA 3NLBA 3TN8A 2DWBA 3R8MA 3ENHA 4JG6A 5JK3A 4LRJA 1GAGA 1OB3A 2PVFA 4WA9A 3R01A 3W2CA 3VBYA 3EQCA 3FQEA 4EH7A 2KTYA 4EH9A 3ZSHA 3PLAE 3QTQA 4O38A 1ZMWA 3RALA 4F7JA 3P08A 4OTIA 4V01A 4DEEA 2BDJA 4YLKA 4OAUC 5TOZA 3ATSA 4UMRA 2C6IA 4AUAA 3RHKA 4WUAA 3NYXA 5FDPA 5LMKA 2UZTA 3D14A 1YOJA 2BIKB 2VTIA 2PZRA 2JEDA 3FSKA 3GT8A 3KGAA 4FG8A 4KD1A 3MIYA 4B8LA 1UU8A 2C6TA 2CHLA 3MVHA 4JBOA 3RM7A 3UYSA 4C4GA 4PP7A 2Z02A 4LOPA 3FMMA 3Q6UA 4H3QA 5TF9A 5CEPA 3D2KA 4FX3A 4HZRA 3C5UA 3FQSA 2WQEA 4X3FC 4FKVA 4E4XA 3QUPA 3GU6A 3RPYA 3WE4A 2CMWA 3AC8A 3QWKA 4Y5QA 4PF4A 5DOSA 4XG3A 3UO4A 5HG9A 2VTMA 2CGXA 3MIAA 1U5RA 1A9UA 1JKLA 2QI8A 2VWYA 3UIMA 3QUEA 5C1QB 3Q2MA 1F3MC 3LM0A 5HE0A 3IG7A 5BVOA 3EN6A 3QQGA 2QD9A 5ANJA 5FM3A 4EH8A 3D9VA 3TNQB 3NIZA 4FL1A 4IBMA 4EK4A 2F7XE 5EK7A 5M08A 3QALE 4PUZA 4N57A 2W4OA 4CSVA 3FWQA 4YJTA 4H39A 2WTKC 3BHYA 4LUEA 4TXCA 2HW7A 4GEOA 4H58A 2ETKA 2BAQA 5IA5A 1ZYDA 4PL3A 1PJKA 3R6XA 4RA5A 1URCA 2R3HA 3F5XA 3UNKA 4IEBA 1ZZLA 4FZFB 4I23A 4I6BA 2R2PA 4PDOA 4U45A 2OU7A 1OUKA 4MF0A 4BVUA 2VWUA 5EQPA 5KE0A 4C0TA 3MY5A 4KRCA 2UZVA 4S33A 4DBXA 4L7SA 3RAIA 2YZAA 2YACA 3H30A 5KZ0A 2XK8A 3EMGA 2V7OA 1SYKA 4M69A 4AE6A 2C6DA 3CP9A 3PPZA 4JJRA 3VBXA 4KIKB 2C0IA 2BROA 3F7WA 3SW4A 3DBQA 1Q5KA 4J96A 4R3PA 4ZJIA 3DXQA 1Q8ZA 4E1ZA 3FZPA 4RIWB 5BUIA 4W4WA 4ZLZA 5CAUA 5IMEA 4BHNA 3EQHA 5HBHA 2EU9A 4G3FA 5LXMA 3WZDA 2RFEA 4BZDA 1ZXEA 3U51A 3W10A 3I7CA 3HP2A 3PY0A 1BL6A 4EHEA 2YLEA 3ORMA 4MXAA 3SAYA 3ERKA 4D5HA 4JG7A 2CKEA 3V51A 2YIWA 4ERWA 1CKPA 4M97A 3VW8A 3GC0A 3NUSA 5AUVA 2JIIA 2OF2A 1XHAA 4IADA 3MW1A 3BZ3A 3KULA 4IAYA 4A7CA 3NS9A 3QFVA 3TM0A 3BKBA 4D2WA 1B38A 4FODA 4I20A 1E9HA 4F0GA 3O50A 3DXNA 4DGNA 3DKFA 3E3PA 2VTQA 4DLIA 3R71A 4ZOGA 4O81A 3MS9A 3BHTA 3R8LA 1FBNA 1REKA 3WIKA 3Q4TA 5D7VA 4C38A 2X81A 3RVGA 4FIGA 4I5PA 5AR7A 5FXSA 2WZJA 4A9TA 5LWNA 3VUDA 4JDHA 3QQLA 4AXAA 3UZTA 1PXIA 2FH9A 4I5HA 4QQJA 4OTQA 4HW7A 4KIQA 4DGLC 4GKHA 2QKWB 4EWQA 4F7SA 5KMJA 3NMUF 4FTAA 3C4CA 2VWWA 2GDOA 3TZ8A 3DT1A 4CFUA 3D83A 5EYDA 3QYZA 3OXZA 4F9BA 3PG1A 4RFMA 2XBJA 4GMYA 4F0IA 4K2RA 2JKKA 3D0EA 5CXZA 2EB2A 2RG5A 3QRIA 5CU6A 2BZIB 4IDTA 4EQUA 4EBVA 2WD1A 3PY3A 4U7ZA 4IAKA 4MEDA 3PSCA 4IWDA 5CZIA 3AD4A 3VUGA 1GZNA 3KXMA 2R3KA 4IVAA 4PRJA 3SOCA 3VC4A 4FEVA 4O6LA 3VUKA 1YW2A 5CEMA 2BFXA 3HLLA 4V0GA 1PKDA 3DJ5A 4S32A 5CEOA 2XIRA 4YPDA 2J4ZA 2WMQA 5AP6A 4A9SA 2PVKA 3COMA 4RIXA 2ZJWA 4PPCA 5D1JA 2B0QA 1GY3A 3TKIA 3L8VA 1OIYA 3MH1A 2YM5A 3F69A 4RG0A 4X2FA 3ZO4A 4F1TA 3RWQA 5JFSA 3EZVA 4ZMFA 1ZOHA 3DBEA 4HCUA 4GFGA 4NKSA 3FLNC 3DJ7A 5TO8A 5FP6A 2F7ZE 1NVSA 4XUFA 3AT4A 4PMPA 3OTUA 4AA4A 4IWPA 3MPMA 4C59A 4AGUA 4BL1A 4KINA 4FTJA 1Q8WA 4FZ6A 1TQPA 5M4FA 5IQAA 3O17A 3BBWA 4WG5A 3FZSA 4JDIA 1JQHA 4DFNA 3KEXA 3QX2A 3VNTA 4GG7A 5HO7A 4DC2A 4PWNA 3W8LA 3AMAA 5M09A 3B8QA 3FLWA 2QOIA 4ENYA 3DOGA 3RZBA 1V0OA 4MQ1A 4KWPA 3MB7A 3EHAA 3F6XA 5GJGA 4JNWA 3R9OA 5KHWA 1YXSA 3AT2A 3O7LB 4F65A 4LOQA 3ACJA 3GBZA 2XKEA 4D0WA 4O2PA 3UIUA 4RWJA 5CF5A 3QD2B 3EFKA 4JXFA 4FBXA 3FYKX 4N6YA 3SV0A 4DAWA 4F70A 1KV2A 4P7EA 2YCRA 3U87A 5CAQA 3VIDA 2ZM1A 5HOAA 2E9OA 3MN3A 4FIIA 4BDAA 4G6NA 5FEDA 5J9LA 5DR9A 2R3RA 4GCJA 5GZAA 5IEYA 3NVMB 5CEQA 4N6ZA 3EL7A 2NRYA 3VJNA 2B9JA 4NM3A 3P79A 4E7WA 2WIHA 5C9CA 5HX8A 1JKTA 2WTVA 5IQBA 4FSTA 4ZSAA 3H0YA 2WTJA 5AA8A 2X7GA 3MVJA 4ZLYA 3LXPA 3KFAA 1KOAA 4DTKA 3GC7A 4M13A 5CQUA 3SHEA 2YHVA 5CAOA 3ZFMA 4FSZA 3UMWA 1JPAA 2GPHA 5EM6A 2ZM4A 1Y8GA 5CI7A 4ANMA 5JSMA 4YZMA 5I9YA 5D12A 4GIIA 3FEGA 2C30A 4CMOA 4ZJVA 3EN4A 4L6QA 2OKRA 1XJDA 3QTXA 4IWQA 4ASZA 1DI9A 4C35A 2VN9A 3VULA 4A4LA 5LMBA 2Q83A 5IQCA 4ASXA 2O0UA 5ANKA 2FA2A 3FDNA 5CNNA 4EL9A 3UG1A 3P9JA 4EQCA 4BR3A 3D5XA 3DK7A 1REJA 2YCQA 1OKZA 3LJ0A 4BCIA 2UVXA 2W06A 1YXTA 2OK1A 5HGIA 4AGWA 1YXUA 4CT2A 1SVEA 4J97A 4BBEA 3I1AA 4DEGA 5HCXA 3BBTB 3DNEA 2WTCA 4V04A 3DDPA 4K33A 5AX9A 3F3WA 1FMKA 4AZVA 5D41A 1M2PA 1J7LA 4TPTA 3HV3A 3VWAA 5HNIX 4L42A 4IZ7A 3ZXTA 5ICPA 4XV9A 4U40A 4KS7A 3LXNA 4BBMA 4FIFA 3TWJA 3MY0A 4DE4A 3V5WA 4ZTSA 1IAJA 2BRGA 3N4TA 5IZFA 4JI9A 2WPAA 5I3OA 1R3CA 3MSSA 4GT3A 4DFYA 5C8NA 2ITYA 4RIYB 2PE2A 4AGCA 3CD3A 4UN0C 2OXDA 4MWIA 4EYJA 5KMIA 1TVOA 4FUXA 4YJUA 1Q97A 3EFJA 4QTCA 2C5VA 2G2HA 3VS2A 2XCKA 4FSWA 3RZFA 4QQCA 1VYZA 5J87A 3W2SA 4JAJA 2CKOA 5HTCA 2ACXA 3L8XA 3CGFA 4ALWA 3G15A 3SKCA 4CG9A 2VWBA 2X2KA 2XP2A 1CDKA 2EXEA 4QP4A 4NH1A 3HRFA 4U79A 1OGUA 1SVHA 5K0KA 3JY9A 4CFMA 3ORPA 2BRBA 3F2NA 3ET7A 4E3CA 1XBCA 4CKIA 4AOIA 2XVDA 3BQCA 3KRLA 4K8AA 3PJCA 4YHJA 3GFEA 5HTIA 2UZDA 1WBVA 4IW0A 5ETCA 5A4EA 3ID6C 2XS0A 3BIZA 4AT5A 5IQHA 1O6LA 3FLYA 3ULZA 2WAJA 3VN9A 2CCIA 5HTBA 2G2FA 3PSDA 5AR8A 5EHLA 3NIEA 2J0IA 3DPKA 3OCSA 4BIEA 4JBVA 3NUAA 2PVLA 4X3FB 2REIA 4MF1A 4EKLA 3D15A 4M15A 4FNYA 3KMMA 2J6MA 5AV4A 4M12A 1FGKA 4EI4A 3E8DA 4AF3A 4AS0A 2QHNA 5JKGA 2C3JA 2OBJA 2R0UA 4ZY6A 4B99A 2BVAA 3FMEA 5HORA 5IA4A 5K9IA 4E26A 4MX9A 3TDWA 1RJBA 3EN9A 4E5WA 4LL5A 4PX6A 5FWKK 1V0PA 2YIXA 4OT6A 4FNZA 3OWKA 4R8QA 2PY3A 4UWCA 4IB3A 5HNGA 1H27A 5E1EA 3OP5A 4QTAA 3NWWA 2I0EA 2W1DA 5H8GA 2HCKA 4M68A 1ZAOA 2R9SA 3DQWA 2W96B 2B52A 3M1SA 3R83A 3O23A 3UNJA 5LMAA 3W1FA 4IX4A 1JLUE 1ZYLA 2HXLA 5A9UA 4R78A 4L44A 2WTKB 4QD6A 3WZJA 2AC5A 3OY3A 2QR8A 4BWPA 3OEZA 3FBVA 2UZUE 4ZP5A 2ITZA 4CTCA 3E5AA 5CSPA 4YLLA 2YCSA 2YZLA 3NX8A 2Z2WA 2R7IA 5T3QA 4EONA 3PVBA 4OTPA 4X21A 4C4IA 5CSHA 5FEQA 4JQEA 1YDTE 4YBKA 2PVYA 5IA2A 3SVVA 2QHMA 2PUUA 1H4LA 3I0QA 3UZRA 3RM6A 4I0SA 5HD4A 3TNWA 3GOKA 3RK7A 3HAMA 1ERKA 3OWPA 2QOOA 4X0MA 3UDBA 2JITA 4I6HA 4IM2A 4C2VA 1XO2B 3OCGA 3T3UA 4DITA 4V0GB 3W18A 3CJGA 3UTOA 4QP2A 2OJJA 4PTCA 4ZTQA 3KKVA 1WBSA 1YXXA 4QMVA 3IDBA 5AM7A 1H1WA 2VO0A 4KKGA 2QOFA 4V05A 4BIBA 3S95A 3P7AA 4FTRA 3PLSA 5IH6A 3PXZA 5LQFA 2BAKA 1OPLA 2Q0BA 4ZXTA 1MQ4A 2XYNA 4LFIA 4PL4A 4QQTA 3D4QA 5CASA 5IUGA 3UP2A 3FUPA 3Q6WA 3ATTA 1QMZA 1MRVA 1PHKA 3QKMA 3E8NA 4I0TA 2HZIA 5DEYA 3GQLA 1W82A 2F49A 2UZNA 3HUCA 2WIPA 2IW8A 3UQFA 5GJFA 5CVHA 4FV3A 2FO0A 2CGVA 4AN9A 2XUUA 3D2IA 2DQ7X 4QYGA 4O7NA 3FE3A 3V8WA 2Z7RA 4A4OA 3ZYAA 3VW6A 3QYWA 5HBEA 1UV5A 2R3MA 4YO4A 5IA1A 2VWIA 2OH4A 4IX3A 4O2ZA 1GIIA 3ZDIA 2OFVA 4FR4A 4E4LA 1SVGA 3LXLA 4DH5A 3QCXA 4JT3A 3ZDUA 3EIDA 3P4KA 4CMTA 3W16A 5HLNA 2GNIA 3H10A 4ANLA 4GKIA 3A2CA 3F3ZA 3GB2A 3KB7A 4IJPA 4HPTE 4U43A 4W9WA 5AUZA 5CTPA 5DT4A 3O51A 1QL6A 4QP7A 2CNVA 1ZYSA 3R1SA 3R9RA 3ZO1A 1RDQE 3H4JA 4PPAA 4C4FA 3IOKA 5GZ8A 5CSWA 1YOMA 4UEUA 3S4QA 3IQ7A 5M57A 5I5ZA 4MNEA 2GMXA 4MBIA 4FT7A 5EHYA 2WMTA 4NM0A 4FKTA 4YNOA 3BV2A 4YBJA 4L68A 2QKRA 4UYNA 3VVHA 4BYIA 5A6OA 5J1VA 5AR4A 3CBLA 4KAOA 2EXMA 4IZAA 4RMZA 1OKWA 3FY0A 1YOLA 3TIYA 1QPJA 3V04A 4CKJA 1QPCA 2E2BA 1GZKA 1XH5A 4HVHA 4WUNA 5DIAA 3TI1A 4QMZA 1V1KA 2O63A 2X4ZA 4LMUA 5J1WA 1OECA 1Q8YA 4ALUA 4N0SA 3V01A 1OL7A 2EWAA 5FP5A 3QKKA 3CSVA 2WFYA 3OUNB 5JRSA 4TWPA 1OL6A 2R7BA 4C33A 4MKCA 5CF8A 4QYYA 4C7TA 4MAOA 1IASA 2V0DA 3Q32A 4NWMA 5CZHA 2I1MA 3TXOA 5AM6A 3EQIA 4OBQA 5T6KA 3V8SA 2C6MA 2XK3A 4W8EA 4DFZE 2W1GA 3E8CA 3TEIA 2PSQA 2VNYA 1WBPA 5AAGA 2OIQA 4WNKA 4L53A 4FL3A 1HOWA 1WBOA 3A4PA 4BI2A 3UNZA 3VS6A 4B9DA 4MD7E 5E8ZA 3WF5A 3I6WA 2YM7A 3R02A 2PYWA 4RLLA 1JAMA 3OXIA 3ZFXA 4FG7A 5B2LA 2O8YA 1JOWB 2UW3A 3VO3A 3VRYA 5I9WA 4YC8A 4B8MA 5AADA 4G9RA 3AD6A 1X8BA 5HI2A 5BVKA 4TYHA 2GTMA 4PNIA 4D9UA 4FF8A 4E6CA 5KKRC 5C03A 3RGFA 4HGEA 4FGRA 2WMWA 3II5A 4L3LA 2R3QA 5EKNA 1U59A 1YI4A 4OBOA 4U9AA 5A3XA 3JXWA 4PY1A 4DG2E 2JDRA 2W9FB 4QTBA 3UQGA 4BDKA 3CS9A 5IQDA 1Q3DA 5DPVA 1WVXA 1S9JA 1FQ1B 4YC3A 2P0CA 3OBGA 1BKXA 4QMQA 5LMKC 4FVPA 2C5YA 2XM9A 2G15A 2I7QA 1NVRA 2QOLA 3BLHA 4XV1A 4AW1A 4K9YA 5BUEA 5E1SA 4MXYA 5EOBA 2BRMA 4YJNA 3MB6A 2QG5A 3NAXA 4CZYB 4FSRA 3VUIA 1CSNA 2OSCA 2WMRA 2E9VA 4BHZA 3KK9A 4TY1A 2FB8A 3BCEA 1JSUA 3L8SA 4FSUA 1BLXA 4QMPA 2YDKA 4L8MA 4LGHA 3R73A 3DKCA 4EOJA 5IEXA 5L2IA 3PJ8A 3CQWA 4QMWA 4EZ3A 1GZ8A 3CJFA 5L2TA 3ZHPC 3RWPA 3NW6A 2H34A 3KCFA 2RGPA 2VTRA 2DS1A 3LM5A 4OUCA 4TKSA 4YP8A 3SDJA 3UBDA 4D9TA 4XNEA 4C3PA 2FYSA 1FOTA 2GNLA 3KQ7A 3I79A 2YABA 3DCVA 3ZLXA 3F9NA 1PW2A 2C3LA 3ZLWA 4MBJA 1QCFA 2OF4A 1Y6BA 5LARA 3IOPA 4BCPA 3FI3A 2WNTA 4JR3A 2X6DA 2HZNA 4KKEA 4USEA 1ZOGA 4QPMA 4X6RA 4RFZA 3AC2A 3CPCA 3G9LX 5CNOA 2G9XA 2IO6A 5EW9A 2BFYA 2F9GA 5GNKA 3SX9A 4AFEA 1BI8A 2B9IA 1SNXA 4O0XA 3IDCA 4L9IA 3AQVA 3DV3A 1VR2A 3DKOA 3LVPA 3QTIA 5EG3A 5GIOE 4HCVA 2VU3A 4QQ5A 3Q9XA 4IB0A 1NT2A 3PUPA 4KS8A 2WKMA 4MXCA 4UZDA 3VUHA 3QAME 2UW5A 2QLUA 1P4OA 5HKMA 2VX0A 4G5JA 5AAFA 1OITA 1SMHA 4I94A 3ORNA 1H1PA 4QMNA 2WELA 3HAVA 3ITZA 5I9ZA 4Y72A 3MFSA 4X2NA 4BCFA 4U3YA 4APCA 4E6QA 4NU1A 2CGWA 1PXNA 3HGKA 3EQGA 4QOXA 4USFA 4BTKA 3SA0A 4JQ8A 2I0HA 5AUYA 4LM5A 5GIPE 2OO8X 3DAKA 4BCOA 3CTHA 3EH9A 5H8BA 3FZ1A 5A4CA 4W8DA 1P14A 4BCHA 4PTGA 3KL8A 2UZBA 3LCKA 2VO3A 3KREA 1PYXA 5D11A 4CZUA 3AG9A 3GI3A 3CCNA 4D1XA 3KN5A 3U54A 2YIYA 3F82A 4PP9A 3FZTA 2B1PA 5FGKA 4WIHA 3MJ2A 2NRUA 3MA3A 3LMIA 2JIUA 3LE6A 4IB5A 4FKSA 5B0XA 1Q61A 5M07A 4F9AA 4FTTA 3WZKA 3CQUA 3CC6A 4Y73A 4BTMA 4CMUA 3POZA 3VS5A 4E6AA 3ORXA 3CIKA 4RJ5A 4AWIA 4AQCA 2CKPA 3FQHA 4RT7A 2WQBA 5E4HA 3VBWA 1P5EA 3QRKA 4LG4A 5AV1A 2QNJA 3RCDA 1W8CA 2ESMA 2XRWA 4TYEA 4HGSA 3PZEA 4RLKA 4YLJA 4ZLOA 3R63A 4JG8A 3ZOSA 2W4KA 1Q3WA 3QCQA 4NM5A 3C5IA 1ZMUA 4JR7A 1OI9A 3ZM4A 4BCMA 3BHHA 3KCKA 4ZY4A 1FVTA 1LEWA 4EK8A 5EW3A 3UE4A 4DGGA 4FT0A 2Z8CA 3K3JA 5AP2A 2JDSA 2XK7A 4EH2A 3BLQA 2XNOA 3DK6A 4XG7A 4EOPA 4CFNA 1DS5A 1Z5MA 1UNLA 3LMGA 2W05A 3IPHA 4M8TA 3LAUA 5DR6A 3THBA 3TKHA 3ZTXA 5HE3A 2G01A 4F99A 5E8SA 5FTOA 3OW4A 2W5BA 3Q4ZA 2HK5A 4EJ7A 3ZXZA 5M4CA 2RKUA 3ZC5A 5HU9A 3D7TA 4IVCA 3DGKA 4WG3A 3TCPA 2B9HA 4AA5A 4ZTRA 5IISA 5HE2A 1YI3A 2J2IB 5HG7A 3R8UA 4CQGA 3QQKA 3A7HA 2FSMX 5CF4A 3G33A 3BYOA 5K3YA 1L3RE 3PPKA 2HW6A 3EQDA 3V3VA 3A60A 3W2RA 4O96A 3QA0A 4IC7A 3V5PA 4XS2A 5EHOA 5AR2A 3ZZEA 1U54A 4KABA 1NXKA 1ZARA 3BU5A 3U6HA 2FSLX 2VTLA 3BYVA 4ARKA 3ACKA 3TJCA 3OWJA 4GG5A 4J8MA 3F2RA 2OLCA 4EJNA 5G1XA 3K2LA 2WQOA 3R7VA 2CLXA 3EFLA 4RVKA 3A7FA 2Y0AA 4UWYA 3DU8A 4OTDA 1I09A 4FVQA 1APME 2J5FA 3EYGA 4AU8A 3DLSA 4RBLA 5FLFA 2F2CB 4Y95A 4NFMA 3FC2A 3Q52A 4QMTA 1WZYA 4AZSA 2B53A 4M84A 2IVSA 3UC4A 4QTEA 3V5QA 2IZSA 4F7NA 4G5PA 3FYJX 1LUFA 1M52A 2B54A 3BYSA 4N70A 4Q9SA 4JLCA 1R39A 3FLQA 4AZEA 4I3ZA 5AA9A 5FBOA 2PZ5A 1JNKA 5CANA 1W84A 2UVZA 3P0MA 3PXRA 5JFXA 5KCVA 2X2LA 5IQFA 3NAYA 3E62A 3SRVA 4UX9A 4FTKA 5JFWA 3KMWA 4AN3A 2RFSA 3MV5A 3TNPC 1OL5A 1PXMA 2QO2A 2WU7A 2GCDA 3DFCB 5D9HA 2J0LA 3NUXA 3PVGA 1RE8A 3P1AA 4TYHB 4O0YA 4IH8A 2RIOA 5AR5A 5FXRA 1R78A 2X4FA 5AP3A 4YHFA 3U4UA 2C5OA 1H1SA 2O2UA 4FKJA 3VBVA 3NCGA 4R3CA 4DTBA 2QC6A 5DLSA 4AGDA 4QYHA 5F1ZA 3IW6A 1PXOA 1J91A 1XH8A 1Y6AA 1QPDA 2R3LA 2XYUA 3KF7A 3BYUA 3HV4A 3LCTA 4XMOA 5BYZA 4RVMA 4BB4A 2JBOA 3TL8A 1KE5A 5HE1A 1IAHA 5L6PA 2E9PA 3QGWA 3CPBA 3HMIA 2UW0A 3QXPA 4TNDA 2BRHA 4ZSJA 1H0WA 4CFWA 4E93A 1H8FA 2PZIA 2XKDA 3CQEA 3HV5A 4ZY5A 2PU8A 2H9VA 5HHWA 1R0PA 3OD6X 4R6VA 4E8AA 1L8TA 5JGDA 3SGCA 4FZ7A 4O7YA 3G0FA 4XP3A 2X7OA 4EOSA 3SG8A 3SOAA 3ZLSA 3H9FA 4EHZA 2FGIA 3S0OA 5FXQA 4NW6A 4BGQA 4EKKA 5M56A 3TUDA 2Y9QA 4RRVA 2ZV9A 1XWSA 2E9UA 3GEQA 4KIOA 2SRCA 3R2BA 4BBFA 5HEZA 1R0EA 2BILB 1ZLTA 3P23A 4CRLA 5IU2A 4NW5A 4YZNA 4BKZA 3ULIA 4BDDA 3IW4A 4J53A 4O86A 1W98A 3NUUA 2O64A 2XIKA 3HX4A 4OBPA 4EORA 3JR1A 2JAMA 3QTUA 4AP7A 3KRRA 2QONA 4PDSA 3QHWA 4U44A 1PXKA 4G3DA 3R7IA 1E1VA 5HO8A 2ONLA 4MQ2A 2JFLA 5KMKA 3QC9A 2A2AA 4BKJA 3QTSA 4WD5A 3DBFA 4IAAA 5HCZA 4BGHA 3KXGA 4OLIA 3PA5A 4JRVA 5AUTA 1YVJA 2JC6A 2W1FA 5BMSA 2VD5A 3R9DA 3G9NA 4C57A 4W4YA 4DH7A 5HU3A 5CS6A 3Q4CA 2W99B 2C68A 4PQNA 3EKKA 4NKAA
chains in the Genus database with same CATH superfamily
5HICA 4AOJA 3FMKA 5FTGA 2YLFA 2Z60A 3E64A 3UC3A 3C4WA 2ZV8A 3OXTA 3KIOC 1J7IA 3TV4A 2J7TA 2J0KA 1FGIA 5CXHA 2XRUA 4D2RA 2BTRA 4DCEA 2FSOX 4HGLA 1M7NA 1PRYA 4TW9A 5K4JA 4BY9E 4A06A 4WNMA 3FI2A 1OPJA 3LFNA 5GHVA 3ROYA 3JYAA 5JQ5A 2V22A 4ID7A 3VF8A 4D1ZA 5LOHA 2RFDA 4U0IA 3HRCA 1MP8A 2ZOQA 3OUKA 3R04A 2OIDA 4RX8A 3ZRMA 5KKRB 2OG8A 1NVQA 3HMNA 4U81A 4N4SA 3HL7A 1U5QA 3PSBA 4BDHA 4IM3A 5BVFA 3MYGA 5F9EA 3R8VA 3NUNA 3NYOA 4YZBA 3I0OA 1SNUA 3SXRA 4RX7A 3QD0A 4RJ7A 5KNJA 3UMXA 2VRXA 4IAIA 3OMVA 2HENA 1H07A 2WTDA 3L9MA 4Y46A 2X8DA 2YWPA 4WSYA 2I6LA 3R9NA 1BMKA 3TKUA 5DMZA 2PVNA 3PY1A 4C3FA 3W2OA 4EH6A 5AX3A 4FTQA 4AN2A 4QYFA 4EK6A 5LCKA 2X0GA 4X3JA 3U9NA 5IEVA 1OVEA 2XIZA 3C0IA 2F2UA 4AZTA 2GNJA 2GQSA 5FUTA 3COKA 3QD3A 4NTSA 5DT3A 4G3EA 2ETRA 4YSJA 1TQMA 5M4IA 4LV7A 2EB3A 3MVMA 2AC3A 2PE1A 5JN2A 1KE6A 3DBDA 1H24A 4QNAA 5CI6A 5E90A 2PE0A 3QCYA 4W9XA 5E7RA 4O1OA 3CE3A 4EZ5A 2R4BA 1G8KA 2CKQA 3ZM9A 3JUHA 2BPMA 3KXZA 2CPKE 1B39A 4NT4A 3E93A 5KZIA 2BKKA 5ANEA 4O7ZA 5DYJA 2XKFA 3ORLA 3HNGA 3VQHA 4AT4A 5JFVA 2WXVA 3GVUA 3G0EA 4HVDA 2WQMA 5K4IA 2JLDA 4YUQA 2ZAZA 4DEAA 1OUYA 3ZZWA 4J71A 5H3QA 3H9RA 3OY1A 3AC3A 3AC5A 3N51A 4L7FA 2Y4IC 2QO7A 3LQ8A 2JDVA 3SQQA 2O5KA 3Q5IA 2GS6A 4WHZA 2YISA 3BEGA 2WOUA 3WF6A 4DGMA 4WKQA 4DH8A 3BU3A 4TL0A 4M69B 2C4GA 3KC3A 3IONA 2W9ZB 1PMUA 2WMSA 3QZHA 4ITJA 3CY3A 2OJ9A 3PG3A 4LRKA 4U80A 4HYSA 1OBGA 3C4ZA 3KK8A 3PRFA 4MNFA 3LCOA 3G5DA 5C26A 2BDWA 3P78A 3QQJA 4LV5A 3O8UA 2PMOX 5DWRA 5D7AA 3ZS5A 4YJPA 4PDYA 3BELA 4O27B 2RF9A 3F3TA 4H1MA 4O0UA 4IQ6A 2JGZA 3FPMA 3GU7A 2QQ7A 2YCFA 4RA4A 1ZMVA 5CT7A 5DRDA 4CD0A 5I9VA 2H96A 2XALA 3E7OA 5EQYA 3WYYA 4IX5A 1DM2A 3RP9A 2EUFB 4EZ7A 3IGOA 4CFVA 3C4XA 4O4FA 4X2KA 2VWZA 5FDXA 5DI1A 3DK3A 5A46A 2HZ0A 4BJJA 2XIXA 5CT0A 1IA9A 3KULB 2CGUA 4ZJJA 3BHUA 3H9OA 4FOBA 4M67A 4GJ3A 2OIBA 3HMOA 4TTHB 3CD8A 3EN5A 3VUMA 2VX3A 3BLRA 2HELA 3PIXA 4FV4A 4FKQA 4NJ3A 3VS1A 5IG1A 3PXFA 2OJFE 5TT7A 5IQEA 5J8IA 5DHJA 2IVUA 5M55A 1W83A 2PULA 1OIQA 3WYXA 2A27A 3AXWA 4RVTA 4DFLA 1KE9A 3QZGA 3PP1A 3VS0A 4M3QA 4MCVA 3C7QA 3MPTA 4XV3A 4GT5A 4ZSGA 3ZH8A 3PFYA 3GQIA 4E6DA 5C01A 3FLSA 1GIJA 3OG7A 2X9FA 3IO7A 4P2KA 2NPQA 4P5ZA 1SZMA 2W1IA 5AP4A 3EJ1A 1BUHA 2GS7A 4G6LA 4L52A 4IVBA 2AEGA 1UA2A 3SD0A 1YHVA 4EEVA 3MH3A 1DAYA 2IW6A 4XBUA 2XK9A 4JVGA 3VONA 3V6SA 3C1XA 4J98A 2PVRA 2Z7LA 5IKWA 3UOKA 4QP6A 4FJVA 5CWZA 4IZYA 2V55A 3I5NA 4IE9A 4RJ6A 3LHJA 4WRGA 3OC1A 4LYNA 1PXPA 3U4WA 4H3BA 3WZUA 3HVCA 3TV7A 2IN6A 5A4LA 4CLJA 4FKLA 2F4JA 3W55A 3MFRA 4I6FA 2QOQA 2VZ6A 3KVXA 3DAEA 4XOZA 3EKNA 2CJMA 4IDVA 4PL5A 3LFEA 5A6NA 1G8AA 3R7YA 5CX9A 2X0OA 4I41A 4L45A 2RSVA 1WBTA 4DHIB 4XP0A 1GZOA 3FJQE 3PYYA 2VWXA 5CVFA 5EI8A 3KVWA 1GIHA 3RTPA 5IDNA 3EQPA 4YURA 2QOCA 4U42A 4FSNA 4FTIA 2BUJA 3R21A 5E9EA 4YZDA 1CKIA 4RIXB 4FSQA 1J1BA 5D10A 4M0YA 3TNIA 1MUOA 4D4RA 3ALOA 3WOWA 2XNMA 3U6IA 5DGZA 2C5XA 4Z3VA 4BWKA 3HMMA 4CEGA 3R1YA 4B7TA 4X2GA 4GFOA 3VS3A 3QRTA 3ZCLA 2OZAA 1S9IA 4C4HA 4QTDA 5IMXA 3BGQA 3HYHA 4BICA 5AV2A 2G1TA 3LFBA 2ITTA 2BZJA 4GIHA 4F9YA 4O7SA 4O83A 2ZM3A 3C4EA 3SXSA 4TZRA 2BTSA 3OCTA 4XBRA 2AUHA 4DA5A 4QMXA 3OWLA 3BX5A 4D0XA 4FV1A 4A4XA 1JBPE 3ZSIA 2PZYA 3NNXA 4AZFA 1OMWA 1BI7A 1WVWA 4USDA 3FL5A 3Q5ZA 3AKLA 4APPA 2VO6A 4ZAUA 3QX4A 1BX6A 4IIRA 3DQXA 5L2SA 1GJOA 3KXXA 5HIDA 2Y4PA 5HIBA 1BYGA 4JIAA 3OW3A 4O84A 5HX6A 4BF2A 4FV9A 1MQBA 3LQ5A 1SM2A 5DE2A 3Q2JA 5BVWA 4DFUA 1KWPA 3RPSA 5IQGA 5ACBC 1AQ1A 1R1WA 5M06A 3CTQA 3F7ZA 1JSTA 5AP5A 1G8JA 1OL1A 3SC1A 1H28A 2J50A 4RC4A 2BMCA 3VBTA 4C4JA 5BVNA 3GFWA 2XNNA 3M2WA 5DRBA 2XKCA 3JY0A 5E8WA 4S34A 3G6HA 4YJSA 3LFCA 1W2FA 4Y8DA 1G8SA 4DH3A 4IANA 3QRUA 3UOLA 3ORTA 3M11A 4ZS0A 4CGAA 3ZO2A 2LAVA 4R5SA 3PVWA 2YFXA 5I3RA 4NEUA 3BGPA 4EYMA 3KN6A 3FHIA 4BDCA 4Q2AA 4M0ZA 4FYOA 2WB8A 2CNUA 1OKYA 4UMPA 4R7BA 2OGVA 2ETMA 2XK6A 4LMNA 5A54A 3B2TA 2A98A 3R28A 4MXZA 5M44A 4DF3A 4F0FA 4RJ4A 4FC0A 5CYIA 5E8UA 4YGAA 2QCSA 3L9PA 1G3NA 3R00A 4FTLA 3DJ6A 5AP7A 4TWNA 3T8OA 4FE2A 2YJRA 1XBAA 4FKGA 3TG1A 4FA2A 3PXQA 3MTLA 4GV1A 4C61A 2W5HA 3QU0A 4YJQA 2J5EA 5JMSA 4MXOA 3L8PA 4C02A 5F20A 4ASDA 3Q9ZA 4KBCA 4BN1A 5CAPA 4F1OA 4XEYA 3LLAA 3DDQA 3IK3A 2DYLA 2P2HA 3OT8A 4KIKA 5ETAA 2J0JA 3FPQA 4L3JA 3I7BA 2Y8OA 3ZFYA 4NK9A 4DG3E 4J52A 3R9HA 1QPEA 2ZMCA 3PJ1A 1KSWA 4NFNA 4AA0A 2Y6OA 4U97A 3OOGA 5FM2A 4G2FA 4Z55A 1UU7A 2PK9A 5BVEA 1RQQA 4OGRA 4EHVA 4QMLA 3R22A 4GRBA 3B8RA 2GQGA 2P3GX 3MGYA 3QF9A 4I4EA 5AP0A 5HNBA 3FXZA 5J5SA 2NNWB 3HECA 2X1NA 3VAPA 4UMUA 3FKNA 3LJ2A 2HYYA 4FZDB 4DHJA 2W0JA 4QP3A 3OS3A 4EHGA 4HJOA 2BZKB 4IX6A 3FV8A 3UPZA 3AC1A 4NCTC 1IG1A 3UODA 2HXQA 4RZWA 3ENMA 3OCBA 2OWBA 1H00A 3BV3A 2EXCX 4WSQA 4ANNA 1JKSA 3DA6A 2W4JA 3GCVA 5HBJA 2PHKA 4MYGA 4YTIA 3V5TA 4BFMA 5BV3A 4G34A 2IZRA 2ZDTA 5EM8A 2IG7A 4JRNA 3OEFX 2JKMA 2X39A 3CY2A 3GOPA 5FQDC 1TZDA 3AC4A 3E88A 4G31A 4WBOA 3ZEPA 2C6KA 4YZCA 4ANOA 1O6YA 4L46A 4YJOA 3HA8A 3ZU7A 4F6SA 3COHA 2PMIA 3BYMA 2JD5A 4BDIA 3RBWA 5IUIA 4H05A 4I93A 2BHHA 4YTFA 2VWVA 3AOXA 4BDGA 4BTFA 4EOLA 4Z9LA 1WCCA 5BNJA 3PJ2A 4UBAA 2LGCA 4CV9A 4EUTA 5CEKA 1WMKA 1VYWA 5DR2A 1OZ1A 4TYJA 4ZTHA 4QDVA 2ZMDA 5TE0A 4L67A 3EN7A 4HNIA 4HPUE 4M66A 4FT5A 4FG9A 3MDYA 4GVAA 4BCGA 4AXEA 4GL9A 3QHRA 3WIGA 2Q0NA 4F6WA 1M2RA 1YWVA 2V62A 4R7IA 4BIDA 4C62A 1A48A 1P2AA 4O0RA 4GSBA 3K5VA 3A7GA 4AG8A 4XHKB 1YI6A 3F2AA 3QC4A 2VTPA 4KSQA 3NYNA 5AV0A 3UVPA 4X2JA 3V5LA 3ZONA 4E20A 4B6LA 2G2IA 4FTUA 2XAMA 3JS2A 4FKRA 2ZB1A 1YHWA 4CFXA 1Q8TA 3MTFA 1IRKA 3F3UA 2HWOA 3F3VA 2IZUA 4TN6A 3DZOA 4I21A 4FIHA 4KBAA 4RC2A 4XG8A 5IDPA 3AT3A 4TNBA 4DHZA 2Y6MA 4FV7A 4FT3A 4O6EA 4LOOA 4ERKA 5M4UA 3O0GA 3OT3A 3TV6A 2BKZA 3F5GA 4KIPA 5IPJA 4AAAA 3BI6A 3PA4A 3PIZA 4EUUA 3UQCA 3P5JC 5B2MA 3GCUA 4NJDA 4QP8A 2BIYA 3TUCA 3FZRA 3G2FA 4XV2A 3R1NA 3RAKA 4O91A 4K11A 2Y4IB 2JKOA 3T3VA 4Z16A 3UG2A 5JZJA 1VEBA 2XM8A 4HNFA 3VQUA 2VUWA 2VTTA 2XJ2A 2Z7QA 3EWHA 4KBKA 4CYJA 3SG9A 2BDFA 3D5UA 4X7QA 1ZOEA 4NCTA 2BZHB 3LFDA 2PPQA 5AV3A 4TWCA 5C4KA 4OTGA 1CTPE 3PWYA 3OFMA 4ZS4A 4A9UA 2ZB0A 3OVVA 4UY9A 4ANSA 2R64A 3LFSA 3WF9A 5CENA 4FL2A 2J9MA 4O0SA 3IGGA 3PP0A 1NY3A 3W0QA 2WOTA 5B2KA 3CR0A 3O7LD 5E8VA 5I9UA 2H8HA 4EC8A 5DA3A 4WOVA 5ETFA 2CCHA 4XH6A 1PKGA 2BAJA 4OTWA 2OZAB 2B9FA 3MH0A 4S31A 3RAWA 1YXVA 4G17A 5J9ZA 4DLJA 1PXLA 5DNRA 3R2YA 3QXOA 4R7HA 3S2PA 4EK3A 1J3HA 4P4CA 5M51A 2YAAA 4LV8A 4CCUA 5DG5A 1OM1A 2FSTX 2X6EA 4IVDA 3AMYA 2YM4A 3NW7A 3D94A 4UV0A 3HDNA 4RSSA 3COIA 2PUIA 2QODA 3DNDA 4ZEGA 5HESA 2C0TA 2ITNA 2UW8A 3G51A 1Q24A 3QL8A 3W0RA 2YN8A 4FSMA 5H8EA 2JDTA 1H25A 5EOLA 3NPCA 1EH4A 5IA3A 4QNYA 3SLSA 3RHXA 3O96A 4FVRA 3S1HA 4NSTA 1CM8A 2DUVA 3RK5A 4HVGA 1CKJA 3OZ6A 4GU6A 3LQ3A 1FPUA 3IW8A 5E8TA 3UPXA 3ZRKA 5KX8A 3FZOA 2JAVA 4TRLA 4PPBA 4W4XA 5ANIA 3LOKA 1WBWA 2WO6A 4C4EA 4HYIA 3UIXA 4DHFA 3PJ3A 3A7IA 4QPAA 5DEWA 5IUHA 2YERA 3KRXA 3L9NA 4BCNA 4BKYA 3M42A 4MNEB 4FNXA 4GK4A 3RK9A 4G9CA 4ZK5A 3C9WA 3JPVA 3TZMA 2J90A 1Q62A 1Q4LA 1VJYA 3GCSA 5KMOA 1JWHA 3NNWA 2XZSA 3TTIA 1Q41A 1OIRA 4XG2A 2Y7JA 4XOYA 2UW9A 1ZYCA 4B0GA 4FI1A 4GFMA 4O0WA 3RINA 4YMJA 5DN3A 3O71A 5IH4A 3EB0A 2VNWA 1PMVA 3A8XA 5DVRA 5F4NA 1YWNA 2X8IA 3EYHA 2X8EA 4RC3A 4D58A 5EM5A 4JDKA 4Q5EA 3FSFA 3UZPA 5K5NA 3DAJA 3KRWA 4H3PA 5L4QA 2ONLC 1ST0A 5EKOA 3TTJA 1ATPE 4RIYA 5CVGA 1OKVA 3KRJA 5C4LA 3MFTA 3S00A 1K2PA 3PVUA 4UMQA 4ZSEA 2O3PA 2P55A 2QOBA 2QURA 4CRSA 4OR5A 1F0QA 3VUTA 3U55A 4GYGA 1G5SA 4E4MA 4F4PA 5KO1A 4DFBA 4XLVA 1FINA 1Y8YA 5M53A 2ITUA 3LLTA 2YM6A 3I4BA 4AW5A 1ZY5A 3D5VA 3E3BX 4EH5A 4YR8A 3L9LA 5KMNA 3EOCA 5J5TA 4KRDA 2UV2A 5DT0A 5J7HA 4LDTA 1H01A 4O4BB 3Q53A 2C1BA 3RPOA 3P86A 4UYAA 2BHEA 4EQMA 2V5QA 3VRZA 3BE9A 2CNQA 2WMXA 3PRIA 4BDBA 1LPUA 2XA4A 3LCSA 3Q3BA 3DXPA 4Y83A 3LCDA 5BVDA 3RPRA 3PTGA 4EOKA 3WF8A 3TNHA 3NW5A 3FMNA 4WO5A 4X3FA 5FBNC 5AIRA 3HA6A 3FKLA 4CNHA 4HYUA 4FTNA 4FV6A 4DEIA 2VV9A 2YDIA 4BCKA 4DTAA 5ANDA 4H36A 3TIZA 4HOKA 5FTQA 1LP4A 3W2QA 4UWBA 4A9YA 3DZQA 3QA8A 3HMPA 2YA9A 2C6LA 2OW3A 2NP8A 3TZ9A 4MVFA 4AX8A 2XIYA 1YDSE 2CN5A 4G6OA 4XCUA 4F64A 2GFCA 4GYIA 4O4EA 4AW2A 2CLQA 3F88A 4R1YA 4UXQA 3E7VA 2IW9A 3LFQA 3ZLYA 4C37A 4F63A 5AP1A 1U4DA 5LVOA 5EYMA 3FI4A 4QMSA 4BWXA 4I5MA 4QP1A 4RGJA 4O0TA 5TR6A 4BC6A 1E1XA 2ITVA 3ZUTA 2W1HA 4O4CA 4UZHA 3HP5A 3BLAA 1P4FA 3ETAA 4ITIA 3W32A 5HIEA 4MHAA 3L1SA 4FICA 5KHXA 2XK4A 4R1VA 3O8TA 3EQRA 4WRSA 4JL9A 3NNUA 3WZEA 4HGTA 2QOKA 2QVSE 3K54A 4JAIA 2ITOA 2J51A 2X7FA 4FZAB 4PTEA 5EDRA 3TT0A 3UJGA 3VS4A 4EOIA 1I44A 4Z7HA 3BHVA 5JGAA 2OFUA 4IB1A 2PL0A 2ITQA 2PVHA 3FAAA 2IJMA 4HZSA 1ZWSA 2HOGA 4MXXA 5ANOA 5EYKA 5JEBA 4O7VA 4G16A 3Q9YA 4YC6A 3Q60A 4KB8A 4LQMA 3U9CA 4CCBA 1ZZ2A 3EZRA 5HD7A 3RMFA 3FL4A 4NZWB 3ZRLA 2W1EA 3NGAA 2QU5A 3KA0A 1J1CA 3FXWA 1H08A 1UKIA 2ITWA 5BQ0A 5AUWA 4GK2A 4FGBA 3DFAA 2F57A 2BALA 4BZNA 3IECA 4FV8A 3LW0A 2HY0A 4S30A 5CQWA 5FEEA 4CZTA 2XCHA 3KF4A 3NVKI 3ZMMA 4DINA 1KOBA 2HAKA 3QQHA 5HVYA 4C34A 3GC8A 4ZSLA 5DH3A 1U46A 1MRYA 1O9UA 4ALVA 4KNBA 4A9RA 4KA3A 4EOOA 3ANRA 3DKGA 4H1JA 2YIQA 3FHRA 4FSYA 4C2WA 4U3ZA 1ND4A 3NUPA 5CAVA 4Y5HA 5C8MA 2FVDA 1M2QA 3MY1A 4WNOA 5J95A 3CTJA 3NYVA 2XJ0A 3HZTA 3KMUA 4DBNA 4OW8A 4QP9A 3MJ1A 2CSNA 4LL0A 2C1AA 3DB8A 3LZBA 1WBNA 3GU8A 3MA6A 4RZVA 2I0VA 4FRFA 4FTMA 4L43A 5JT2A 3U6JA 5KMLA 1UWHA 1M14A 4K0YA 2OXXA 3FC1X 4L01A 3F5UA 3IW7A 5HLPA 3R30A 4XG9A 4O1PA 4U41A 5CU4A 3VHKA 4F08A 4O82A 5AFVA 3DLZA 5JH6A 4R5YA 3IDPA 1GNGA 4K6ZA 5HZNA 1V0BA 2NO3A 3CKXA 4AOTA 4O0VA 4K77A 4MD8E 1HCKA 4E5AX 3PDTA 2C3KA 5IH5A 3UDZA 1UU3A 4LGDA 4ZZNA 4UMTA 4FTOA 4IXPA 3V8TA 2R3GA 2UUEA 4F7LA 3GCQA 2HZ4A 3DS6A 4QO9A 1Q99A 4R3RA 5FRIA 2XEZA 4QMUA 3EL8A 5L8JA 2VTJA 3LFAA 4YJRA 4FKWA 4UXLA 3RCJA 3MH2A 1ZYJA 5J7BA 4RWKA 3KXHA 4ZTMA 3JVRA 3D7ZA 4BDFA 3UDSA 4FYNA 3VF9A 4IACA 4BYJA 2ZV7A 3NFGB 4TYIA 5A4QA 4D5KA 2WHBA 4IFCA 2HWPA 1TKIA 2XARA 4RQVA 3BGZA 5IF1A 4M14A 3VJOA 1XBBA 5T68A 3FLZA 4ZIMA 3CXWA 4NL0A 5CEIA 1NA7A 1XR1A 4CVAA 4PV0A 3IKAA 2OICA 4XG4A 2VTHA 2XNEA 2EVAA 3HV6A 2XJ1A 3A99A 5AWMA 2YAKA 5JRQA 4R77A 2V7AA 3QTZA 2QU6A 3A61A 2JDOA 3FY2A 2GS2A 3MI9A 5AUUA 4D2VA 4MD9E 3BL7A 5CU2A 4AW0A 3FMDA 1URWA 3AKJA 3TUBA 2GQRA 2XB7A 4ACHA 4DT9A 3P5KA 4UB7A 5EI2A 3W0PA 3RPVA 4AFJA 3HRBA 3D7TB 5LVNA 3ZBFA 3GNIB 1W2DA 1T46A 5EDQA 5HG8A 4BI0A 2R3IA 4HCTA 3WI6A 5H9BA 3NUYA 1H26A 3UVRA 4HVSA 2XNPA 3BEAA 2UZLA 2VTOA 2YDJA 3ZEWA 4JBPA 1W0XC 2WMAA 3ODZX 3PE1A 1K9AA 1XQZA 4GH2A 1Z57A 5ANGA 5J79A 4DH1A 5I0BA 3UGCA 2R3NA 2IWIA 5EQEA 1U54B 3REPA 5CU0A 2VO7A 2R5TA 3R8PA 1UKHA 4MK0A 2R3PA 3CLYA 4ITHA 2GFSA 3D5WA 3CGOA 3LKMA 1GOLA 2QOHA 4AACA 3UP7A 1IA8A 3QRJA 1XH7A 1XH4A 2PWLA 4ZZOA 5B7VA 2A19B 1AD5A 5HCYA 3R1QA 4JIKA 4K18A 4GUEA 3NRMA 3ORIA 5E91A 4ENXA 4AT3A 1YRPA 1OPKA 4XP2A 3TJDA 2UVYA 4X6QC 2ERZE 5GZ9A 2GHGA 3G6GA 5CY3A 3QD4A 4YTHA 3HDMA 4IHPA 3MWUA 3QQFA 4O7RA 2GHMA 2OJGA 4YSMA 4NTTA 5K5XA 4AQKA 3A8WA 4LI5A 3FKOA 4O21A 4F9CA 2ERKA 2X2MA 4BDJA 1H1QA 4IWOA 4LGGA 2W17A 2QO9A 3A4OX 5GINE 5LVLA 4QYEA 3PA3A 4PMTA 3HV7A 5LVMA 5DFPA 2E9NA 4IFGA 5L6WL 3SRVB 4CV8A 4ZTLA 1RW8A 2Z7SA 2ZV2A 2R0IA 4F6UA 3NFFB 4D1SA 4NIFA 4FNWA 4PMSA 2XMYA 4FKPA 2B55A 3RNYA 3BWFA 3BRBA 2FUMA 3NEWA 4RX5A 2P2IA 3QQUA 4FIEA 2VTSA 1CMKE 2JIVA 2W7XA 3AGLA 4OTHA 5H2UA 2C0OA 2RG6A 2BCJA 2H6DA 5BUJA 5LVPA 4S2ZA 1UWJA 2VTAA 3E63A 4E4NA 3GP0A 3QTWA 4RIOA 4TWOA 2IZTA 3UOHA 4EOQA 5FG8A 3PXYA 2GSFA 5AMNA 4D55A 3RJCA 3EQFA 3OF0A 2WTIA 3AGMA 3C4FA 3PIYA 2RL5A 3QBNA 1H0VA 1DI8A 2W5AA 5BPYA 4EWHA 3IW5A 2PVMA 3DB6A 3PFQA 4D4SA 3V6RA 3CEKA 4J99A 5EM7A 1PMNA 2GHLA 2F7EE 4XX9A 2I0YA 3G90X 4EOMA 5CSVA 4FEXA 2J0MB 4O7WA 3GU4A 3H3CA 4BTJA 3F5PA 3OOMA 2OZOA 4FUYA 5BX0A 2ITXA 4FMQA 4ZMEA 2QR7A 2UZEA 3Q96A 1Y91A 2I40A 3WF7A 4F1MA 3NR9A 2A1AB 2XF0A 4D28A 4EC9A 3C0HA 3NCZA 1HCLA 4ACDA 5C8KA 1AGWA 2HY81 3QLGA 4DT8A 4JBQA 3PZHA 4WBBB 1BL7A 5EYCA 1UNHA 2XH5A 3Q04A 3AKKA 4Y85A 3KXNA 4EBWA 5CALA 1KUTA 4XG6A 1Q8UA 5CSXA 4FEWA 4GW8A 3LJ1A 5JQ8A 3NSZA 3GGFA 4RFYA 5CU3A 1FVVA 4C36A 4FIJA 3R0TA 4TYGA 4QMYA 2WEVA 4L00A 3NDMA 2OH0E 4RWLA 2ZDUA 1W7HA 3GXLA 4G1WA 4FKOA 4IAFA 4QMMA 1DAWA 2VTNA 3E92A 3GUBA 2UW7A 3QTRA 4RWIA 5BMMA 4XYFA 3GCPA 3F61A 4PMMA 3UIBA 1F5QA 2XNBA 3DTCA 3MFUA 3UO6A 1PYEA 2IVVA 4GJ2A 3SW7A 2ZVAA 4DCAA 1FVRA 5IQIA 4OT5A 3A62A 3ZUUA 5EH0A 4ZZMA 4BDEA 5J9YA 4DDIA 5L8KA 4C8BA 2R3OA 3MESA 4FV5A 3K5UA 1Z9XA 3BU6A 4O22A 3GC9A 5LCJA 4GK3A 3QWJA 2W1ZA 4MBLA 4P90A 2ZYBA 5L2QA 1M17A 1WAKA 1WVYA 5G6VA 4C58A 5KMMA 4DN5A 4I22A 2VX1A 4FKUA 4IZ5A 2PVJA 2JKQA 2ITPA 2C6OA 2QG7A 2YM3A 4I5CA 4PNKA 5EW8A 1IR3A 3LIJA 3TDVA 2P33A 3PE2A 4K1BA 2WEIA 3ZUVA 4EK5A 5L8LA 2O65A 4F09A 1ZRZA 5JGBA 4GUBA 2PTKA 3ROCA 2GTNA 2R3FA 5I9XA 1Y57A 3HKOA 2WMBA 3VS7A 2YM8A 2B7AA 3UVQA 1UU9A 4JQ7A 2QLQA 1T45A 1LEZA 2R3JA 4W4VA 3NZ0A 3W2PA 4G3CA 4ACGA 2BRNA 3FMHA 4KSPA 4FT9A 5EI6A 2C69A 2OI4X 3DY7A 4BCJA 3FI8A 3LPBA 3ODYX 1LR4A 4DG0E 5AEPA 3I60A 4OTFA 4FK6A 4NYEA 4BI1A 2PMLX 4XRLA 4XLIA 4WG4A 2GU8A 4AE9A 1XH6A 3I5ZA 5I4NA 1B6CB 3LXKA 3A7JA 3E87A 3MBLA 3R7GA 4GS6A 4MTAA 4BZOA 4NUSA 4D4YA 3N9XA 1YDRE 4IC8A 3BWJA 4GT4A 5HO6A 2GNFA 1FMOE 1O6KA 4QRCA 4YZ9A 4DDGA 4BCQA 4ORKA 3LMHA 3UOJA 3ANQA 4RPVA 3PPJA 4LUDA 4Z7GA 1PMEA 3TACA 3WE8A 4C3RA 2KULA 3ALNA 4ANBA 3T9TA 3OBJA 4YPSA 1M7QA 3VHEA 4I0RA 4WNPA 4AZWA 1STCE 2VGPA 5E8XA 4XRJA 5BYLA 1ZY4A 4J7BA 4BGGA 3OHTA 4CXAA 4O7TA 3QZFA 5E8YA 1OIUA 3QUDA 4Q9ZA 2B4SB 4IJ9A 4M7IA 3OTVA 1OBDA 1K3AA 4I24A 4O7LA 4E73A 1PXJA 4NM7A 3GENA 4YHTA 5EFQA 3F66A 3U8WA 3P7CA 2UZOA 5AR3A 3ZSGA 1YQJA 4L3PA 4DGOA 3PXKA 4RX9A 2VGOA 5FD2A 5HQ0A 3LFFA 4RIWA 5C27A 4D4VA 1WFCA 5HLWA 2IVTA 2WTWA 3B2WA 3IS5A 4D2SA 1KE7A 1YHSA 4JX3A 1PY5A 4ACMA 5A4TA 4PDPA 2CN8A 5IA0A 4RQKA 4ZTNA 4IAZA 2P4IA 3UYTA 2XAOA 4FV2A 3BE2A 3BPRA 3K3IA 3QLFA 5E92A 3S3IA 4IMYA 2OJIA 2YJSA 5A14A 2WGJA 4CFFA 3H0ZA 2AYPA 3DTWA