3FMEA

Crystal structure of human mitogen-activated protein kinase kinase 6 (mek6) activated mutant (s207d, t211d)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
288
structure length
268
Chain Sequence
MEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFAGCKPYMAPERINPELNQYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase 6 (MEK6) Activated Mutant (S207D, T211D)
rcsb
source organism Homo sapiens
total genus 67
structure length 268
sequence length 288
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmeA01
4IADA 3NUNA 5K9IA 3DA6A 3L9MA 3QUPA 2C6DA 3OEZA 5C26A 4JIAA 2QURA 4D2SA 4IB5A 4A4LA 4BTFA 2VX0A 2G1TA 4Z7GA 1ZOHA 2JAVA 4AA0A 3R9RA 3BGPA 3DAKA 3HL7A 5HI2A 2RKUA 4TL0A 2BMCA 4JQ7A 3LCDA 3IDCA 3LQ5A 4NK9A 1YHVA 3PJ3A 4IX4A 5KMMA 3OY1A 2ONLC 2WTCA 5L6WL 1H1QA 4CSVA 3VWAA 3F2RA 2XK9A 1Y57A 2WHBA 3FDNA 3QRJA 3U9NA 1H0WA 4FSQA 4D9TA 5A14A 3UG1A 4MQ2A 3EZVA 4U3ZA 4QTCA 4O2PA 3OWLA 2F49A 2VWWA 4GG7A 2DUVA 4M97A 3OHTA 4TWNA 4HYUA 3R2YA 4WRSA 4WBBB 2YITA 4LGDA 1BKXA 1B6CB 1UKHA 2QNJA 4O22A 4ZTHA 3VF9A 3W2SA 2VWXA 4C4IA 3UYTA 2E9NA 1YOMA 1GZNA 1PW2A 4V05A 3JS2A 5A4CA 5I9ZA 3PPKA 4GS6A 4HNFA 2X7OA 4NEUA 4TKSA 4XX9A 3I4BA 3M1SA 2PE2A 2VRXA 4QPMA 5CEOA 3G33A 1U54A 4IAKA 2QOQA 3MY1A 4I24A 4X2NA 4ALUA 3GNIB 3HMPA 5EHOA 3CQWA 3EQDA 1JAMA 1KE7A 3QWKA 3QCSA 4HJOA 2HW6A 4FSRA 3ZXZA 2O3PA 5CQWA 5HORA 2DYLA 5DR2A 3UNKA 4FIGA 4GFOA 4QMXA 3V8SA 3F9NA 4TWCA 4X3FB 4BWKA 3D7TA 5ACBC 2XM8A 4X3JA 2QKWB 5ETIA 3OUKA 5ANEA 4JBVA 5DG5A 4J71A 2QODA 4JDJA 2BIYA 3KCKA 2B9JA 4IZYA 3D94A 2VTNA 4B8LA 4AGWA 3LCSA 2YABA 3F3ZA 3TXOA 3T8OA 4OT6A 1UNHA 2EU9A 2PTKA 3Q9ZA 1WBSA 5IQEA 4L7SA 5CVGA 2Y6OA 5HD4A 3TZMA 3VS4A 4HYSA 5CEPA 1IG1A 3DBEA 3QQFA 4I23A 4JL9A 4C58A 5FM3A 1JKTA 3FZTA 4A06A 4NTSA 4M0ZA 4AFEA 4RJ3A 2VTAA 2OSCA 3MGYA 4JAJA 3VW8A 4AN3A 1JWHA 4L01A 1BYGA 2DWBA 1BL6A 4G6OA 5DR6A 4M67A 2QC6A 2Y9QA 2UW0A 3PZHA 4C35A 2QONA 5M4IA 1A48A 1WMKA 3LMIA 2WQOA 4IMYA 3V5LA 4ZSAA 4BDDA 4ZJVA 4CLIA 1ZYJA 4K0YA 3FSKA 3BPRA 4FSZA 4RPVA 2PVJA 5CEIA 3K5UA 3QA0A 4I6QA 3U4UA 2VO3A 4BWXA 4H3PA 5L3AA 5I3OA 4MF1A 3TJDA 4E5BA 2CMWA 3BE2A 3F7ZA 4W4YA 1E1XA 3ZUTA 4EC8A 5IDNA 4LRMA 5CNOA 4XBUA 3W18A 3W55A 3EB0A 5IKWA 4F1MA 4GG5A 3MB6A 4EH4A 1PXMA 3NMUF 2IZUA 5AX3A 4Y5QA 2UZTA 4GU9A 4E4LA 1OGUA 4DFUA 4FT7A 5DA3A 3BU3A 2C68A 4IVDA 4RBLA 2UVZA 3DNDA 3TZ8A 4RJ5A 2Q83A 4FK3A 4IWOA 1WFCA 2XBJA 3OTUA 5J95A 3UBDA 4E8AA 4ZS4A 5D1JA 4LQMA 4FT3A 3A8WA 2JEDA 5TO8A 2X0GA 4AQCA 3OF0A 4HGEA 3QLFA 3OEFX 2PUUA 2B52A 4QTBA 3D5UA 5AAGA 1WBTA 3CTHA 4XEYA 4H1JA 4IX3A 5J7HA 2CLXA 3F88A 2NO3A 4I0SA 3HRFA 4QQJA 5FEEA 5JEBA 4W4XA 2EB2A 4WUNA 5CSPA 2GS7A 4M66A 5E8YA 2ZB0A 3U87A 4FTIA 3TKIA 5M4UA 4O86A 4DH3A 3GCUA 3F69A 2VWBA 2OBJA 4J95A 4XV9A 4G2FA 2VGOA 3GOPA 4IIRA 4JNWA 4XYFA 3E7OA 5E92A 5BUJA 3QTUA 2OJIA 4GJ3A 3VUMA 4FV8A 4RIOA 3F3TA 3L8VA 5FP6A 3UOHA 4AT3A 4LGGA 4V0GB 1REKA 4JBQA 2HZIA 5HKMA 3RKBA 1BX6A 3DQXA 2O8YA 3UDBA 2ITYA 3VNTA 3KRLA 4UMUA 4BDEA 3QUEA 2I7QA 5CF4A 1VZOA 4TNDA 4ZTQA 4BGQA 3QA8A 4YSJA 2QOHA 1H08A 4ANLA 4DH1A 4F0GA 3AC1A 2OJJA 1F5QA 3ENHA 2SRCA 1SYKA 4BHZA 5LXMA 2C5YA 4Y5HA 5D41A 5IDPA 4C59A 5FXSA 1YI6A 3G0EA 5BUEA 3S3IA 4KABA 4E6DA 2ZVAA 4OTPA 4FTOA 5AP5A 3R22A 1KE5A 5DPVA 3WF5A 4HOKA 5AUTA 4PY1A 4DFYA 3LJ2A 2XKEA 2HXLA 1FVTA 2VN9A 3DFCB 2CSNA 4G31A 4BIDA 5M4FA 2RIOA 4UY9A 4AP7A 3Q9YA 4EKLA 1CTPE 4RVKA 4A9UA 4D4YA 5DHJA 3PE2A 2UW8A 2W99B 4MWHA 3PG3A 3O8PA 2YIXA 2J7TA 1OPJA 1QPEA 2JGZA 3I60A 3QQUA 4FTJA 4MNEA 4RG0A 5CX9A 3WBLA 4A9RA 4IE9A 3RI1A 4BDKA 3OWKA 2GQRA 1XBAA 4ANOA 2AC3A 2WXVA 2C6IA 4E26A 3BV2A 2A2AA 3A4OX 1OL6A 2XUUA 3FYJX 1YRPA 3R1QA 5A6OA 3FL4A 2CCHA 3GC7A 3QAME 4FT0A 3TTJA 3OWJA 4E1ZA 5M09A 5LOHA 3B8RA 2BRBA 2R0UA 1UU9A 5FXQA 2XK4A 3R9NA 2V7OA 4M15A 4U0IA 3ZTXA 4D55A 4DCAA 2PZ5A 2XRUA 2WD1A 4JDIA 3AMYA 5TOZA 1AGWA 3RK5A 4F9WA 4I0RA 4HGSA 3GC8A 2VO0A 3VBXA 3GXLA 2XYNA 2JITA 4FTRA 1XH4A 4BIEA 4UMRA 3QXPA 2C5OA 3HUCA 4R5YA 1K3AA 5ANOA 3R7YA 5I9VA 5L2WA 5E9EA 3GFEA 3O7LB 2BRHA 1OKWA 3U4WA 2UW7A 4QMWA 3TT0A 3DGKA 3BBTB 2FUMA 1M52A 4IXPA 4JDHA 2WQMA 3AT4A 3BZ3A 4RJ6A 4A4XA 3BRBA 3LFQA 3WYXA 3QBNA 3U54A 4MF0A 2YFXA 2C5XA 4EUUA 2H6DA 5BVEA 3VRYA 5EI2A 2PVKA 2B0QA 2YAKA 3G6GA 4FNZA 3UOJA 5LVPA 3VS6A 3TZ9A 3E64A 3QALE 4XG2A 1OPKA 1YKRA 3P4KA 4M84A 5DWRA 1ZZLA 2B54A 1Y6BA 2V55A 2CPKE 4TRLA 2VTOA 5CSVA 2C4GA 3OCBA 5AJQA 1JKSA 2YM6A 4I3ZA 5E91A 4AOJA 4ZLOA 2X7FA 5M55A 2OZAA 4M69A 2VNWA 1F0QA 3D5WA 2C69A 3KF4A 3A4PA 3CD8A 4RLLA 4AZFA 3GU8A 5AUUA 4BYJA 4O82A 3CIKA 1OKVA 3LVPA 4EH8A 2WU7A 3I6WA 3LFSA 3BLQA 4MX9A 4EUTA 2C3KA 2EXCX 1IRKA 2C0OA 4NT4A 1TQIA 3NNUA 2VTPA 2W1FA 3ZC6A 3OS3A 5HNIX 2J0MB 2X9FA 3AGMA 4IHPA 4BTMA 4FVRA 3PIZA 3PXFA 4XUFA 3KF7A 5EOLA 4FGBA 4NU1A 3R8MA 4DFLA 4K8AA 4IB1A 3FE3A 4JAIA 3TM0A 1YQJA 1J1BA 3BYVA 3MTLA 1J1CA 5M53A 3BX5A 2ITTA 4FL1A 3NIZA 4OUCA 3QL8A 4MXXA 2PSQA 3O96A 4AT4A 3PSBA 3CJGA 3VS7A 5A4LA 4CXAA 3PSCA 4JI9A 1ZYSA 3C4EA 4FSMA 5DOSA 3A99A 5CS6A 4XMOA 2BCJA 4R3CA 3N4TA 4H3BA 3FHRA 5IH5A 3LFBA 4FG7A 3VS2A 5GHVA 4BWPA 3NIEA 2J50A 4LOOA 3AD5A 3C0GA 4K11A 3HNGA 2IW9A 5EM8A 2W5HA 3GB2A 5CI7A 5EK7A 4KB8A 4WO5A 1Q8ZA 5IA5A 3QQJA 3BLRA 4CG8A 3EQCA 4BIBA 3KRXA 4Y85A 4FKQA 4X2FA 2B9HA 2BIKB 2HIWA 4ZK5A 5KMKA 4UWYA 2AC5A 2HWPA 3VJNA 4EK5A 3KGAA 4L6QA 3ROYA 3FEGA 3UGCA 4YZ9A 3HMMA 4M13A 2UZDA 4RIWA 4U41A 4R3PA 3EFJA 2X81A 3B8QA 4ZSGA 4RC2A 5HIDA 4L8MA 4P5ZA 5JGBA 3SW4A 4D5HA 3VBYA 4WSYA 5GZAA 3BHYA 3W2CA 4UBAA 3DTWA 2BFXA 1UWJA 4I5MA 4IX5A 3A7JA 4NIFA 4IJ9A 1SMHA 3DLSA 4MTAA 4BBMA 5IUIA 4FOBA 2W1DA 3AQVA 3NNWA 5EH0A 1AD5A 4QMVA 2WTWA 3W2RA 2A27A 3VHKA 1YXTA 1I44A 4IWPA 5HTCA 1H07A 3Q6UA 5HX8A 4O1OA 5HIEA 4K77A 2EWAA 5KX8A 3U55A 3KCFA 4C38A 5K0KA 3Q4UA 2W4OA 4L9IA 3SG8A 1Q3WA 3DK3A 2UVXA 1UWHA 4FR4A 4G5PA 4ZSLA 2G2HA 5A4EA 3LXLA 5AADA 1FVVA 2YCFA 3G2FA 3PJCA 3H3CA 1YXXA 4DE4A 4IFCA 4KWPA 3F61A 4RZVA 2OO8X 3D15A 1SNXA 4YGAA 3VULA 3UPZA 5CANA 3BHTA 2WELA 4BN1A 4M12A 1B39A 4TZRA 3ZHPC 2GTMA 2X8DA 2RSVA 4U97A 3KREA 4KINA 5HU3A 4ZXTA 5KE0A 4FKJA 3FC1X 3QQKA 2W05A 1ZMVA 3NYVA 3KXZA 4L44A 4B9DA 4RZWA 2VGPA 3PLAE 4KBAA 2XK3A 5HEZA 3IDPA 4YNOA 2I6LA 5DT4A 4AU8A 4FT5A 3OT8A 4BF2A 5HVYA 3IOKA 5GIOE 2XIKA 4I21A 4RIYA 5EQYA 2QOOA 5B2KA 4LMUA 5AR8A 4LL5A 3F5GA 5CXZA 4AN2A 2ITVA 4BDHA 4CMOA 2E9VA 5LVLA 3ZMMA 1A9UA 4N70A 2ETMA 3R2BA 3WI6A 3ZO2A 4EWHA 4O0UA 1UV5A 4FZ7A 2F4JA 1ZYDA 2UW4A 3QWJA 4XV2A 1MUOA 4EZ3A 5D11A 3FY2A 4O21A 2PMOX 2PVFA 3SXSA 1QPCA 3FQEA 4MWIA 5FTGA 1GY3A 3AOXA 5IH4A 3F82A 3IECA 1CKPA 3V04A 4ANBA 4AT5A 3S1HA 5CLPA 5L8JA 4HPUE 3AC3A 4KS7A 3QX4A 3O2MA 3RPSA 4WNMA 1YOJA 4V01A 1HCKA 1H1SA 3DT1A 3QQGA 4FBXA 4QMZA 4CFUA 5A4TA 3NCGA 1UU3A 1PXKA 4FA2A 2Q0NA 5JFSA 3MW1A 4P7EA 5IMEA 2ZDUA 2ZM1A 3FQHA 3G51A 3NUYA 4S31A 3VBVA 1LR4A 2W1HA 4Z3VA 4BL1A 3ZFXA 4MQ1A 3LAUA 5ETCA 4NSTA 4WKQA 2W0JA 3WZUA 4ZZNA 4CKRA 4YU2A 1PY5A 4W8EA 3OCTA 4AW5A 4KSPA 4AZVA 4UMTA 3QZFA 2GHGA 3BYMA 4PNIA 4DEEA 4XG3A 2BKKA 3THBA 3EFLA 4IX6A 2B9FA 3R9DA 4Y83A 4J99A 4LI5A 1GJOA 4DA5A 2UW5A 4AZWA 4FKLA 2XNNA 3U6JA 2HYYA 3D2KA 4LOPA 2XB7A 4X6RA 2VTIA 3UNJA 3KXXA 4IW0A 3JVRA 3QX2A 3N4VA 2R0IA 3K5VA 1M17A 2W1IA 4P4CA 4HGLA 4TYIA 3TCPA 1ZAOA 4RMZA 3IW5A 3L8PA 4BGGA 4DEGA 4FTQA 2XK7A 3MJ1A 2UZEA 4TT7A 5FD2A 4OTFA 3RJCA 2BROA 3OXZA 3ORXA 3VUGA 3QHRA 4GKHA 3UC4A 2UV2A 3DB8A 2VX1A 3KRWA 1OBDA 2IZTA 4RVTA 2BAJA 1E1VA 3CR0A 5KMOA 4Y46A 3F5XA 3UO6A 3NAYA 3ZCLA 2YHVA 4CFWA 2I0VA 3FXXA 1CM8A 3QZHA 1JVPP 2QKRA 4HNIA 4FTAA 4E93A 4EK6A 4ZY4A 3ZYAA 2X4ZA 3DBDA 3ZOSA 3GBZA 3W16A 4F7SA 3CTQA 3QFVA 3FUPA 4YC3A 3ZU7A 3UZTA 1P5EA 1KOAA 3FZPA 1XKKA 4XP0A 1GNGA 5C4KA 4MHAA 3V5QA 3FKLA 2AUHA 2R3MA 4Z16A 3PG1A 4N0SA 3Q4TA 4ZTLA 2J9MA 4OTGA 4B6LA 1YWNA 2NRYA 5AUYA 2HENA 3AC8A 4GYIA 3PYYA 3W1FA 5CU0A 4R7HA 3P9JA 4CKJA 2BPMA 4BCGA 4HVDA 1XBCA 3TNPC 4UX9A 1NVSA 4EK4A 5GINE 3HEGA 4PUZA 3ALNA 2KULA 3CPBA 3GU6A 3Q53A 3IW7A 3SLSA 3UTOA 2VNYA 4G3EA 3A61A 1WVWA 2W96B 3KRJA 4XV1A 3R8ZA 5K5NA 5M56A 4FI1A 3FMEA 1O6KA 3F3WA 4N6ZA 2QLQA 1U54B 1XH9A 3GCQA 1GZOA 3EQPA 5G6VA 4EOIA 5FUTA 2G15A 3EL8A 3V8WA 3V5WA 2REIA 4XG7A 5DEWA 3F5UA 4K2RA 4UN0C 3MI9A 5BVNA 5HTIA 2OK1A 3W2OA 1P4FA 4CFVA 4ITIA 3MIYA 2IVSA 3O51A 1WAKA 2C6LA 4FV4A 3H9OA 4J7BA 4GV1A 3D7TB 5DFPA 3TN8A 2OF4A 3TUCA 2Z60A 3I79A 3L1SA 1STCE 4F7LA 2Y7JA 3K2LA 4QQTA 3MVJA 4IB3A 4BVUA 5JK3A 3R00A 4OBPA 2JKOA 1YW2A 3ORMA 3A7IA 2P2HA 3L9PA 4JR3A 3OMVA 3NYOA 1NXKA 3WZJA 5JSMA 2R3PA 5F9EA 5CVHA 1OB3A 3QYZA 3R7VA 4O6EA 4CGAA 4PTEA 4GJ2A 5KMLA 5GIPE 5LMKC 3EZRA 5TKDA 4YSMA 3FZRA 3MVLA 4JG7A 3UVPA 4DGNA 5LMKA 3QTIA 4XRJA 1OI9A 1PXNA 1WBWA 3PIXA 2CKQA 3LCTA 5G1XA 4CEGA 3DFAA 5IQDA 3QYWA 3PVBA 3IPHA 5HVKA 1HOWA 3KN5A 5DNRA 5CQUA 3ULIA 3OWPA 2WOTA 2NPQA 3FHIA 5CZIA 5IA3A 5AEPA 4GRBA 3VRZA 5ITAA 3WIKA 3Q9WA 3G15A 2JD5A 4FV5A 5IQCA 4KBKA 3TUBA 3CE3A 2BILB 3FL5A 4PPCA 3U8WA 3ZZEA 5JFWA 3A60A 1ZRZA 4FTUA 2XA4A 4D1ZA 1H27A 5J5TA 3S00A 2JKMA 2ZM4A 4FSNA 2QU6A 3LJ1A 3OOGA 4S34A 5F95A 3OW3A 2Y6MA 4HZSA 5KBRA 1J7IA 3ANRA 3MVHA 1KV2A 4G16A 4G5JA 4LRJA 5EHLA 3VHEA 5KKRC 3Q5ZA 4C4EA 3N51A 4C57A 4C3RA 4EHGA 5BVOA 5KHXA 3HMNA 3RINA 3UZPA 4MXZA 2R5TA 3LZBA 3EL7A 2OXDA 4JQ8A 5ANKA 4R5SA 1IA8A 2ITQA 2A0CX 1FMKA 1RDQE 4YJSA 4R7BA 5HG7A 5HO7A 5FQDC 2ERKA 4F64A 2C6OA 4E5WA 1P4OA 2ITOA 3W2PA 2YEXA 3Q60A 3HKOA 4X0MA 4HVGA 2UZOA 5K0XA 3QC9A 3P1AA 4YPDA 2J0KA 2WMQA 2PUNA 4FK6A 4ASZA 5CI6A 2E2BA 2R3HA 5EM6A 5CALA 4DFBA 2WZJA 4G6LA 4J53A 4DH8A 3R7IA 2WTKB 4WG5A 5LWMA 4QT1A 4FL3A 5I3RA 1DI8A 4DTAA 4IZ7A 4TWOA 3LCKA 4FKWA 1WBPA 2A1AB 3DTCA 3D0EA 1DM2A 4PTGA 4QTAA 4TYGA 3IW4A 4EQMA 4F7NA 4AE9A 2PK9A 5FP5A 1VYZA 2IO6A 3UQGA 2ZYBA 1Y91A 2UZWE 1H4LA 2ONLA 4FF8A 4P90A 2RFEA 5DT3A 5F1ZA 3T3UA 2QO7A 3KA0A 2P55A 3F6XA 5I4NA 2Y4IB 4O1PA 3ZLXA 4AXAA 1OKYA 4M0YA 2CJMA 5C03A 4JQEA 3GEQA 3PWYA 4RJ7A 4AZSA 4AA4A 1PJKA 1SVGA 5DIAA 5CEMA 2W4JA 4GVJA 5AFVA 4S33A 4CYIA 5M57A 2W9FB 1L8TA 4U8ZA 3BCEA 1H1RA 4DGMA 3C7QA 4DCEA 1KWPA 3L8XA 4WBOA 3F2NA 4FV2A 4MXOA 4C4JA 4FL2A 4RT7A 2OW3A 3UYSA 5KMJA 4AW2A 3MFSA 3QCYA 4O2ZA 3RNYA 3Q2MA 5AR5A 2WMAA 4I20A 5AUXA 2R7BA 4EHEA 2ZMDA 1G8SA 3C4WA 2QHMA 2VUWA 2YCSA 4FOCA 2HW7A 1SVHA 4DGOA 2OXXA 3UOLA 1P2AA 1XH8A 2EB3A 4D9UA 4BDCA 3QTSA 3WARA 3CY2A 1MRVA 1OIQA 4MNEB 4X6QC 3HDNA 4U80A 2BZIB 4H58A 4FEXA 3QKKA 5I9YA 4YJRA 2BZJA 3T3VA 2CNUA 4CV9A 2BTRA 4P2KA 5AX9A 2Q0BA 1R39A 1LUFA 2RG5A 3RPRA 4GIHA 5LVMA 3U6IA 5EQEA 2QOKA 4L46A 3JYAA 4WOVA 3FI4A 3FLNC 5JFVA 4YBKA 3F3VA 3NUPA 4C34A 3UO4A 1DS5A 1OUKA 4KA3A 3NVKI 4F9AA 4QMLA 3BEGA 3UMWA 5TE0A 4IFGA 3PY1A 2UW6A 3HLLA 3GENA 5DE2A 4YP8A 2XM9A 4XCUA 2PMIA 5EW3A 3GU5A 4EOOA 3ZM9A 4YTHA 2BDJA 2O2UA 4FX3A 1IASA 1Q97A 4O27B 4OGRA 5J9LA 1IAJA 5AUZA 4O7RA 4CV8A 4O7TA 4YZCA 5FEQA 4AUAA 2HK5A 2IW6A 4PDPA 4EJNA 2XRWA 4O7YA 3R9HA 3LIJA 2X2LA 2GS2A 3IQ7A 5KZIA 4BCMA 2OGVA 3UQCA 3UNZA 4YHFA 2XIRA 5ANJA 5HGIA 4USEA 5J7BA 3TUDA 2W5AA 2WU6A 3FC2A 3DS6A 4H05A 4U43A 5AIKA 4HCUA 4NKSA 3COMA 1JNKA 3EQFA 3VVHA 4XH6A 1QCFA 5HE1A 3RALA 4NWMA 5KUPA 4FYOA 1ZMUA 1OZ1A 3WIGA 5EYKA 5I0BA 3QRKA 4WUAA 3DKFA 3DV3A 3FMDA 4XP3A 4KAOA 4W4VA 5HBEA 3P7CA 3VUKA 4CRLA 2YCQA 2IW8A 3VBTA 3HA8A 1PF8A 2OIDA 4YMJA 3GT8A 4L43A 3HYHA 5HNGA 4YLJA 4FV3A 1UU8A 4EYJA 2OZAB 4M69B 1IEPA 2ERZE 3EFKA 4GL9A 1PMUA 5CAOA 4PMSA 3QF9A 1FGIA 3KULA 4O7ZA 2R9SA 3KEXA 3AXWA 4L7FA 5AAEA 3E8NA 2YWPA 2IVTA 2YLFA 4GUBA 4D58A 5IG1A 1PMNA 4S30A 4Y73A 3ALOA 3ZRMA 5HLPA 1S9JA 4RSSA 4ZP5A 4IM0A 3CXWA 4RC3A 3MN3A 3EQBA 1XH7A 1IA9A 4FZ6A 4L52A 3LCOA 4OBQA 2OF2A 3PVGA 2C1AA 3DAJA 1OVEA 1HCLA 1U4DA 3CP9A 2RGPA 2XNGA 3R83A 3NDMA 4AGUA 4I5PA 5IA1A 4QNYA 3UO5A 1OIRA 2XKCA 3H4JA 3QRTA 2IG7A 1CKJA 5HG9A 4C2VA 4JLCA 1ZY5A 3E5AA 4U44A 3BIZA 2VTTA 3UP2A 3AD4A 3EKNA 3FKNA 3LPBA 4K9YA 5DN3A 1U5QA 2HOGA 1ZYCA 2NP8A 2WOUA 2O5KA 1L3RE 3R7OA 2G01A 3ZRKA 4F4PA 4A07A 3C4CA 4A9SA 3ZLWA 3JY9A 4XV3A 2C0TA 2OH4A 4W9WA 1GAGA 1P14A 4X2GA 3GU7A 2PVNA 2QHNA 3FQSA 3DCVA 4DAWA 1OIYA 2QR8A 3JY0A 5LMBA 3DJ5A 3HVCA 5EKOA 3B2WA 4BI0A 3QTWA 4WT6A 3UMXA 3KB7A 3R8UA 4GMYA 3RAIA 5CZHA 4AFJA 4QYYA 1WVXA 2KTYA 4FKOA 4KIKA 3II5A 4RIWB 2OFUA 3CY3A 4XG9A 1XR1A 4YZNA 4EOMA 4Q9ZA 3R9OA 1DAWA 3PSDA 4L45A 4NJDA 4FEWA 5EQPA 1APME 4CFFA 3EFWA 3FMHA 3VF8A 4AGCA 4XOZA 2PY3A 3QLGA 5IQIA 4O0XA 3V5TA 2EVAA 4J8NA 2VZ6A 3PDTA 4XNEA 3OFMA 1WCCA 2E9PA 2BVAA 3BHUA 1XQZA 4NIFB 4Y8DA 2XBAA 5A54A 3F3UA 1BMKA 3CQUA 2RFSA 3CKWA 3O0GA 4K1BA 1XHAA 4QP3A 4UZHA 2VD5A 4R3RA 4JS8A 4DTKA 4CVAA 3EMGA 4IVBA 1URCA 5IEXA 3V6SA 5K4JA 5J79A 5C4LA 3TKUA 1XH5A 4QMOA 3C4ZA 3RNIA 4ANQA 5L8LA 4YJNA 1NY3A 2XNEA 3F2AA 4I5HA 4XLVA 3O8TA 5CT7A 5AV1A 4C4HA 3ZEWA 2V5QA 3DDPA 4FEVA 4C33A 3ACKA 2NRUA 2OZOA 2R3LA 4UXLA 5CSWA 4JXFA 1Q8TA 2J90A 4TYHA 3BQRA 3DKGA 3MPMA 2RFDA 5KMNA 3OC1A 4USDA 2CDZA 4OTQA 5HOAA 1MRYA 2O0UA 5GJGA 2QLUA 5CU4A 3MJ2A 2R3JA 3FMKA 3H30A 5HD7A 3R1YA 3AGLA 5A3XA 2IZRA 3R71A 5HIBA 2C47A 5M07A 3WYYA 4QMUA 4RIYB 2GNHA 2WMTA 2XIXA 4GU6A 4BKYA 4FIIA 3CSVA 2HY81 4ZSJA 4GYGA 4I22A 4BBFA 1LEWA 1YI4A 4CFXA 3E8DA 1FVRA 3GOKA 5JGDA 4UYNA 3LM0A 2VTJA 3HGKA 4RRVA 3E8EA 3QTXA 2YACA 3MBLA 3P23A 4QRCA 4KKEA 1YXSA 5GJFA 4K18A 4QNAA 3QTRA 4CCUA 2PVYA 2JDTA 2A4LA 3QD3A 4IVAA 4QTEA 5JFXA 2VWYA 2J5FA 2R4BA 1KE6A 5JT2A 3RPOA 2HZ0A 4PWNA 3FI3A 5CU2A 5EG3A 5AAFA 5CU3A 2UW3A 3RWPA 4HPTE 5K5XA 3HA6A 5AP3A 3COIA 3F66A 4DLJA 3OVVA 2BTSA 1ZY4A 4LG4A 3G9LX 1NA7A 1ZMWA 5F20A 5EYCA 5CXHA 2RF9A 5CU6A 4FKUA 3UE4A 2XNBA 4FTNA 4I5CA 5LQFA 3ORLA 3UIBA 1TKIA 3KC3A 4AW0A 2H8HA 4G3DA 4QP1A 3VQUA 4N57A 3KVXA 1ZOGA 4YJOA 4E7WA 1YXVA 5I5ZA 5DEYA 3M2WA 2NNWB 2W5BA 3HDMA 3HAMA 3QC4A 4O0SA 4RQVA 5D12A 2FSOX 4OAVB 4EORA 4FT9A 3W8LA 1RJBA 3JXWA 3MTFA 3TZ7A 2YLEA 3DXNA 1V0OA 2R3FA 3QRUA 4Q9SA 4R8QA 4BKZA 3TACA 3K3IA 4BZDA 2R3GA 3MYGA 2XNMA 3TDWA 3QZGA 4MBLA 1H01A 3TNHA 5BVFA 3UJGA 4LM5A 3ZBXA 4B7TA 5EKNA 4I41A 1PHKA 3HRBA 5J9ZA 5J1VA 4JG6A 4DYMA 1UU7A 2B1PA 2FB8A 3EJ1A 4FKPA 3FLSA 1KE8A 4R7IA 3TV4A 3FMNA 3GCVA 4FG9A 5H8BA 4CQGA 5IA4A 3TWJA 5BYYA 3PA5A 3SVVA 2WMBA 3HV7A 2BRGA 4U42A 4B0GA 2WMWA 5EFQA 1GIHA 2OJFE 3NUSA 5HCYA 5L2IA 4NL0A 4O7SA 1H00A 1MP8A 2FSMX 2P33A 4BCJA 2ACXA 2PVMA 4J97A 3PXKA 4AN9A 4UMQA 3M11A 4X2JA 4F6WA 3R7EA 4BTJA 2WTIA 3VUDA 5CSHA 3ZZWA 4MH7A 2A19B 3PPJA 4BDAA 5KNJA 2ZM3A 2CLQA 3SXRA 1E9HA 1SNUA 3C5UA 3D83A 4NM3A 5B2MA 4O91A 4ORKA 3R30A 4FKRA 2XK8A 2HZ4A 1BI7A 3A2CA 5HX6A 1BL7A 4C4GA 2QOBA 4KBCA 4BCIA 3QRIA 4RA5A 4MBIA 4EBWA 5DBXA 2XNPA 2BKZA 4RX9A 4CG9A 5BPYA 3D5VA 3M42A 2X8IA 5AP0A 4EH5A 5FM2A 2XJ1A 2DQ7X 4G3CA 5H8EA 5KCVA 2RFNA 2J5EA 4FYNA 2CNVA 1PXIA 5IZFA 5EDQA 4NTTA 4EK3A 5JQ5A 2BDWA 3MB7A 2CGXA 3VUHA 2QG7A 3OY3A 3CGOA 4O84A 2VWZA 2EXEA 4YUQA 4DEIA 2ETRA 3BV3A 3FLZA 3TIYA 3TG1A 1NVRA 3ETAA 4O0RA 2FSLX 2CCIA 3FWQA 5HBHA 4CRSA 3R8VA 4F09A 5E8XA 4IZAA 2HCKA 3D14A 2VTQA 3SX9A 2Z02A 3ORPA 5HESA 2X1NA 5EI8A 4NUSA 1FPUA 4DBXA 2WIHA 4PMMA 4TTHB 2UZLA 4F7JA 2QD9A 3OBJA 4YJUA 2PUPA 4C3PA 5JQ8A 1PRYA 3CPCA 4JIKA 4KKGA 1SVEA 5F4NA 4UMPA 3RCJA 5HO6A 3MPTA 1I09A 2WEIA 3PTGA 4FTMA 4C02A 4IAIA 2XKFA 5DVRA 3R8LA 4FTKA 3DLZA 3NUUA 4FNYA 5AR4A 2OI4X 4ZOGA 2OXYA 2YM5A 1LPUA 4ZMEA 3HP5A 5HVJA 2W06A 1X8BA 4JJRA 3VS0A 4ZZOA 3KY2A 2HY0A 1T45A 4FSUA 4G6NA 4EI4A 4FUYA 5BNJA 2YZAA 4EQUA 5LCKA 3Q9XA 4GW8A 5BMMA 2XF0A 4E4XA 5C27A 3FPQA 1OKZA 3K3JA 4M3QA 3VN9A 3L8SA 2WB8A 5C01A 4BBEA 3P78A 3TI1A 2YZLA 3O23A 4KRDA 4GFMA 3D7ZA 3DZOA 3R21A 4ZY5A 4IM3A 1YDSE 4R6VA 3NUXA 2VWIA 4NZWB 3EHAA 2BFYA 1H8FA 3T9IA 5J8IA 4NCTC 4JVGA 5CSXA 4AZTA 4IWQA 5CAPA 4M7IA 2V0DA 4ZAUA 4FV9A 4C8BA 2JDVA 3MA3A 3RP9A 3I0OA 1V0BA 3SAYA 4ERWA 5CF5A 2X39A 1ZLTA 3LLAA 5HG5A 2J51A 4F0IA 5KKRB 3H0YA 2OH0E 4IC8A 5AUVA 4KKHA 1JKLA 4AOIA 5LARA 2PZYA 3MDYA 5K4IA 3JUHA 1JSUA 2PVRA 5FDXA 4M8TA 4LFIA 4AZEA 4CFMA 3HV5A 2UW9A 3OT3A 5J5SA 3MS9A 3KU2A 2BALA 1G3NA 3DXQA 3W10A 4Y72A 1H0VA 4GUEA 3JPVA 5DRDA 3ZUVA 2YISA 4ASDA 2H9VA 4MCVA 2F7EE 3KRRA 3KFAA 5CWZA 4C37A 2BAKA 1QL6A 3RBWA 3EN7A 3F7WA 4DFZE 4MYGA 4CTBA 2W7XA 4ZZMA 3P86A 3IK3A 2IWIA 4RC4A 3D9VA 2W1GA 3MY0A 3NGAA 3ORZA 3S4QA 5ACKA 5HLWA 1J7LA 4FV0A 1REJA 4J8MA 1YHWA 4USFA 3ZXTA 4CT1A 4O7VA 4FUXA 2UZNA 3NYNA 4CCBA 3RMFA 3ERKA 5JZNA 3NUAA 4PRJA 4KNBA 3E93A 4EL9A 4AAAA 5E1SA 3HRCA 4MXCA 2C3LA 4APCA 4JBPA 4ID7A 1MQ4A 3HV4A 2YDIA 4PP9A 4WRGA 1GZ8A 4EYMA 2YIWA 5CAQA 3G9NA 4GH2A 5ETAA 4TXCA 1PKGA 3WZDA 2HZNA 4OTDA 3IW8A 2B7AA 2Y8OA 3CGFA 4LUEA 3DPKA 4PPAA 1OBGA 3RK9A 3VUTA 1W0XC 2CGWA 5LJJA 4YC6A 3QD2B 4IDTA 5EW8A 4WG4A 1U59A 4D4SA 5D7AA 4DF3A 1J3HA 4PNKA 2GNJA 3FLWA 3E8CA 1H1WA 4F70A 5KHWA 3MSSA 4PMTA 3ZDUA 4O7WA 2QO2A 3E3BX 3L9NA 4IACA 3D5XA 3DY7A 2YJRA 2XVDA 5HBJA 1FINA 3HV6A 4R78A 1IAHA 4RLKA 5BVDA 3U9CA 2ITXA 3GCSA 4HGTA 5FWKK 4AOTA 4CZTA 5IH6A 2YWVA 4EJ7A 3R28A 4GKIA 2C6TA 5DRBA 3MIAA 5A6NA 3EQRA 5EOBA 3E7VA 4TWPA 5EDRA 4ACMA 1XBBA 4YURA 5BYLA 2WIPA 3I0QA 3ITZA 2EXMA 4XLIA 5AP6A 3WZEA 4DGGA 5ICPA 1JSTA 2P2IA 2B55A 1BLXA 2F57A 3AC2A 1OECA 5AA8A 1ZYLA 1GIJA 2GNIA 4RX7A 5HE2A 2UUEA 2GSFA 4FC0A 3PXZA 4QP2A 4DG0E 3C5IA 4UWCA 2OJ9A 4FZAB 1T46A 3DOGA 3Q6WA 1YHSA 3VS5A 1G5SA 3BWFA 5AP4A 4BICA 4EC9A 4A9TA 3H0ZA 2C6KA 4JRNA 3FJQE 2XIYA 3RPYA 3ZUUA 1V0PA 5M08A 3NR9A 1QMZA 4EBVA 1OL1A 1WBNA 4WD5A 3QGYA 4L42A 5E8UA 1KV1A 3Q2JA 2CN5A 2X4FA 5FEDA 4F6UA 3LXPA 3ET7A 4KIPA 3RAWA 4HVSA 4IBMA 4MNFA 3KXMA 2Z7RA 2OIBA 2ESMA 3PP1A 4TYEA 4CQEA 4DEHA 3ZO1A 5HE3A 2JDRA 5I9WA 4O81A 5FGKA 2ITUA 1Q41A 3CJFA 4ACCA 3ORNA 1YDRE 2WMUA 1W98A 2OLCA 2P0CA 1MQBA 1XH6A 2Z2WA 3ACJA 1MRUA 2BZKB 5E7RA 3UOKA 1Q4LA 5LMAA 3BE9A 4MVFA 1TQMA 1O9UA 2ZMCA 2GNLA 3CD3A 2PHKA 2HWOA 2Z7SA 2BHHA 3LQ8A 3PJ1A 3HECA 4XBRA 4L3JA 4D2TA 2C3IB 4F1OA 5HE0A 4G17A 2XNOA 2IJMA 4EZ7A 3LFAA 1DAYA 1FBNA 3TV6A 4QQCA 2Z8CA 3MFRA 3OROA 3N4UA 3A8XA 3I7CA 2WTVA 1PMVA 4RX8A 5KO1A 3KMUA 4X2KA 3Q52A 3ZH8A 4NM0A 3C51A 4U5JA 4I6FA 4WSQA 3I6UA 4QMQA 4HVIA 4RIXA 4E20A 2XH5A 3UIXA 4F6SA 4BYIA 3G5DA 2FSTX 2GPHA 4QPSA 2JLDA 3GCPA 3KULB 5HICA 3ORTA 4D2VA 4LV8A 4ZS0A 4UALA 4IAZA 4RA4A 3SD0A 4J98A 3RCDA 3ELJA 4MD8E 3DXPA 1ZARA 3RAKA 2ZDTA 3PE1A 4KD1A 3ENMA 4D0WA 3ZO4A 4PQNA 5DLSA 3EYGA 3LFEA 5ETFA 4ASEA 2UZUE 3NVMB 3NNXA 5HCZA 3EQIA 2F7XE 3LE6A 3RVGA 4YR8A 3PUPA 2R3NA 3QXOA 4FE2A 4E4MA 4IAAA 3NRMA 3FMJA 4OTWA 5AV0A 4DFXE 2W1ZA 4FZFB 3UP7A 4QMYA 3VBWA 4BDIA 5CNNA 2CN8A 4Y95A 4A7CA 3ZO3A 4Q5EA 3TEIA 2XKDA 4K33A 3IOPA 5AA9A 4O0VA 3ORIA 4II5A 5AV4A 4EHZA 5E8WA 5IISA 3BHVA 5E8VA 1URWA 2YDKA 4DH7A 4I4EA 3KK8A 4O38A 3BU5A 1PXOA 2X6EA 3BI6A 3EOCA 4ZEGA 4GIIA 1M7QA 2GNFA 3C9WA 4TY1A 1XJDA 5IU2A 3R7GA 4LV5A 4M68A 2QOLA 5CT0A 1JKKA 3DDQA 4WHZA 5GZ8A 5E4HA 2BR1A 2J0LA 3QQLA 4FG8A 4FEQA 5AV3A 5KZ0A 2G9XA 3IW6A 2BZHB 3PY0A 3R1SA 4QYEA 3A7GA 2CKOA 2GHMA 4BDBA 3VS1A 2ZV8A 3C0HA 4HYIA 4QYFA 3OBGA 4J1RA 4NM7A 3RHKA 3PRIA 3MFTA 1QPJA 4F63A 4EH7A 1YWRA 4PMPA 3LW0A 4FEUA 3VO3A 5EYDA 4O6LA 4W4WA 3A7HA 1NVQA 3QUDA 4U40A 3O50A 4YLKA 4C62A 1JSVA 2FVDA 4KIKB 5IA2A 5AV2A 4QD6A 1H25A 1ERKA 2RL5A 3EKKA 3COHA 2VO7A 3TIZA 1OUYA 4XOYA 5HU9A 4I6BA 4L3PA 4PF4A 3JR1A 2I0YA 3PZEA 4U79A 3ZSIA 4BI1A 5EYMA 3S0OA 3V51A 4EH6A 5M06A 4KRCA 3SKCA 4GK3A 2F9GA 1R1WA 2WGJA 4EOJA 5L8KA 3KVWA 4UYAA 3OP5A 3R63A 3V6RA 4ZTMA 2OJGA 4G3GA 4DFNA 4AW1A 4MKCA 3F5PA 4NFMA 4IQ6A 1Z57A 5BYZA 4DITA 3P7BA 1CKIA 5H2UA 5HNBA 4ZLZA 5EHYA 3PVUA 3ZRLA 4APPA 4N6YA 2C6EA 5L2SA 3GC9A 5A4QA 3HAVA 4ZTSA 2P3GX 3G90X 3P7AA 4NH1A 3RGFA 3PFQA 3GVUA 4GK2A 4QP7A 2WMRA 5HCXA 3WF9A 2JAMA 5FBOA 3RHXA 5IQBA 3C4XA 5T6KA 3HMOA 3IKAA 3TTIA 5H9BA 5E90A 3UQFA 1YXUA 3KK9A 4S32A 4C7TA 1B38A 4TYHB 3FV8A 4FV1A 3V3VA 2EUFB 4AG8A 2V22A 2WQEA 4PDOA 2GFCA 1BUHA 3CTJA 5BVWA 1KSWA 4F9BA 3ATTA 2XEYA 4JX7A 5CEQA 3LKMA 1ZZ2A 3AG9A 3BGZA 4IAYA 4IM2A 3SRVA 4E6CA 1NT2A 4B99A 2C1BA 1A06A 1GOLA 4GEOA 3SOAA 4FV7A 5IUHA 4O83A 4FTLA 4C0TA 4U45A 1ZWSA 2IPXA 1YDTE 3ORKA 3RWQA 2WPAA 3VUIA 3R02A 4DTBA 2I0EA 4H39A 5IPJA 3GU4A 2VX3A 1M2RA 1Z9XA 5H3QA 4D4RA 3UVQA 2C5VA 3TNQB 3V5JA 3FBVA 3E92A 1M2PA 5CAVA 4YHJA 2I0HA 2X8EA 4L00A 2J0IA 2XYUA 3NPCA 3SGCA 4RVLA 3QHWA 2Z7LA 3WE8A 5LWNA 2JIIA 3MH3A 4EWQA 5CAUA 1RE8A 1ZOEA 4YHTA 4AS0A 5DR9A 2B4SB 5ANGA 4ITJA 4FNXA 2IN6A 5DI1A 1OL2A 3KQ7A 3OOMA 4IVCA 5FBNC 4DGLC 4I93A 4TN6A 2FGIA 2BDFA 2BAQA 2ZB1A 4BCOA 2GS6A 2O64A 3WILA 3QU0A 4JR7A 4BZOA 3UC3A 1K2PA 5T3QA 4G3FA 3DK7A 4Q2AA 4EOKA 1R0EA 2CKPA 1ND4A 2R3KA 3ID6C 5M4CA 4YTFA 3N9XA 3WE4A 1QPDA 4HCTA 3H9RA 1YOLA 3SXFA 5JH6A 4J96A 4MEDA 3CBLA 3NNVA 4MAOA 4EH2A 2CHLA 4ZY6A 4TW9A 3R8PA 1KUTA 1FOTA 4EKKA 2WNTA 4UZDA 2WTKC 3DBCA 2X2KA 5GNKA 2ZAZA 2PZIA 1OIUA 4F1TA 4FSWA 2GQGA 5CEKA 2W17A 4QO9A 5FDPA 2PZRA 3TNWA 3WOWA 2ITNA 4EH3A 2JBOA 3TV7A 2FA2A 2ZOQA 1UKIA 4BCPA 3VC4A 4PPBA 4QP9A 2R3OA 3FXWA 4GSBA 3AT2A 1U46A 4BTKA 1OPLA 1PYEA 4YJQA 3BQCA 3LQ3A 4E3CA 4CMUA 3RAHA 3A62A 4ITHA 4LGHA 4RFZA 4TPTA 3KMMA 2QI8A 2W9ZB 1Y8YA 2Y4IC 1IR3A 4NM5A 5AR7A 2CGVA 2FH9A 4BHNA 3PJ2A 4EOQA 3E87A 3OCSA 2IZSA 4RJ4A 4ERKA 3EWHA 4QMSA 4DEAA 2UZBA 4RFYA 5F94A 2HAKA 2I40A 4DEBA 1JQHA 1PXJA 4EEVA 2IVUA 4GFGA 2XCKA 4BCKA 2E9OA 2Y4PA 4JT3A 4CMTA 5HG8A 4IB0A 3EN4A 4EOLA 5H8GA 4KS8A 3CQEA 4MD9E 2VWUA 2VV9A 4G1WA 2BHEA 4O0TA 3PRFA 1J91A 4G34A 2OWBA 3UPXA 1O6YA 3V5PA 3PXQA 4R1VA 1XWSA 4PP7A 1PYXA 3E62A 4BKJA 1R78A 4S2ZA 4OT5A 2VWVA 4ZSEA 3MA6A 3QTQA 4BI2A 2GHLA 3ZSHA 3FAAA 4QP4A 3SDJA 5IEYA 4D2RA 4Q5HA 4D1XA 4X3FC 3ZC5A 3FMMA 4AACA 3MY5A 3DQWA 2GTNA 4EK8A 4FIFA 4FODA 4I6HA 1H26A 1W82A 4I94A 3SV0A 3ZSGA 4D4VA 4X3FA 2BRMA 4XRLA 2J4ZA 3BKBA 5L2TA 4DT9A 4W9XA 5AP7A 1G8AA 2YDJA 3ZFMA 4X21A 2YM8A 5EW9A 3BYSA 3P08A 4FIEA 5AM6A 3WF6A 3ZONA 4EOPA 3QZIA 1KE9A 2JC6A 4JBOA 3QGWA 4WG3A 3C4FA 3FZSA 3G6HA 2LGCA 4OTIA 3W8QA 3WF7A 2W1EA 5HO8A 1H24A 1SZMA 1UVRA 3PY3A 2PYWA 2C6MA 4E6QA 5E8SA 5AUWA 4UEUA 3ODYX 3GC0A 4C4FA 4F9YA 4O96A 4DH5A 2R64A 4HVHA 4ANMA 1EH4A 2G2IA 1AQ1A 2JKKA 4FICA 2VU3A 4RFMA 4A4OA 5A9UA 4KIQA 2V7AA 3CKXA 3ROCA 4FIJA 4NW6A 3DB6A 1Y8GA 3I5NA 3VW6A 5BMSA 4RX5A 4FSTA 3SHEA 4OAUC 4RJ8A 3LFCA 5AP1A 3IO7A 4CLJA 1J7UA 4WNOA 2XIZA 3HMIA 4YJTA 4LL0A 3EN5A 1XO2B 3MESA 4C36A 1FMOE 3EIDA 4PL3A 4AGDA 2GDOA 2JIUA 2ZV7A 2DS1A 4DN5A 2YA9A 4YLLA 4CTCA 4CT2A 4FVQA 4IH8A 4D2PA 1Z5MA 2PMNX 2YM3A 5FRIA 1V1KA 1TQPA 3C0IA 5GJDA 5IF1A 5AM7A 1DI9A 3D4QA 4YJVA 5E8ZA 3QD0A 3GI3A 5AR3A 4OTHA 1CMKE 4BY9E 4LUDA 4FKIA 1FQ1B 3SQQA 4FZDB 3R7UA 4TNBA 3LMHA 5BQ0A 2PVHA 2WMXA 3I5ZA 2O63A 3SC1A 4ACGA 1YVJA 4C3FA 2R3RA 2CNQA 1TVOA 2FO0A 4XP2A 3OD6X 2C5NA 5IQFA 4DEDA 5BX0A 2PE1A 4JOAA 3ATSA 2PMLX 4W8DA 2OIQA 5J87A 3VS3A 2VO6A 4KIOA 3LFNA 3O8UA 3RM7A 3DZQA 5EM5A 3VQHA 3IONA 4BCQA 3HUBA 2C30A 4MBJA 4QMPA 4R1YA 4BCNA 3FYKX 3MV5A 4XG8A 4PL5A 3PJ8A 4RWIA 4E6AA 3EQHA 1OL7A 2VTLA 3QCXA 3VIDA 3Q3BA 2ITWA 4UB7A 3KXHA 2PUIA 3QCQA 3FLYA 5DMZA 2WO6A 2PU8A 4I1ZA 5KMIA 2WTJA 3FKOA 4ZMFA 2YCRA 3GUBA 2OICA 2R2PA 4RWLA 2YM7A 4DG2E 2JBPA 1R3CA 3OXIA 3PP0A 3PXRA 4G9RA 3DKCA 5C1QB 3LLTA 4HYHA 5FXRA 5M44A 3G0FA 1OL5A 4QMNA 3B2TA 4V0GA 4DINA 4D5KA 1H28A 4QTDA 5HTBA 4EH9A 5DGZA 4YZMA 5ANDA 4D0XA 3VJOA 5I9XA 2QOFA 2QO9A 3IGGA 3HZTA 4LMNA 4V04A 3DJ6A 3RK7A 3PLSA 3BBWA 4OW8A 4U3YA 3DBFA 5TR6A 3UZRA 3OZ6A 3TL8A 3ZDIA 3OUNB 4IWDA 3NW6A 3LOKA 5CF8A 4UV0A 2ZV2A 3PPZA 4FV6A 4QYHA 2XK6A 3FLQA 5C8MA 5JGAA 5JRSA 3LFDA 2J0JA 3MFUA 3RTPA 4F9CA 3BU6A 5D7VA 1FGKA 2HXQA 5HLNA 1Q61A 5LVNA 5T68A 3ZLSA 1VYWA 5AIRA 4FKSA 5E8TA 3UIMA 4H3QA 2OU7A 3VBQA 4BDFA 3PVWA 4WIHA 3DAEA 1GZKA 3PA3A 4BC6A 2QU5A 3UIUA 1LEZA 5FG8A 3H9FA 3NLBA 4GVAA 4XG6A 2WQBA 4ASXA 5JN2A 2XS0A 3O71A 4E73A 2F2UA 5D9HA 4QQ5A 4NYEA 4YO6A 4FNWA 2OG8A 4QYGA 3T9TA 3MH0A 4AE6A 3GP0A 4B8MA 4PV0A 4AWIA 4FKVA 4B4LA 4N4SA 3GGFA 5TT7A 2J2IB 4EZ5A 3KXGA 2H96A 4L3LA 2X9EA 4PTCA 4Z55A 3IGOA 1U5RA 2VTSA 3ZEPA 4CKIA 3LHJA 1Q24A 1S9IA 1Y6AA 5BUIA 2R3QA 1Q62A 3EQGA 2W1CA 2ZV9A 4BB4A 4MXAA 4U6RA 4I4FA 1ATPE 2XP2A 3ANQA 3OCGA 3VAPA 3V01A 3D2IA 4EOSA 4KUJA 2LAVA 5B0XA 1KOBA 4EONA 3C13A 4UWBA 4IJPA 1UNGA 2F2CB 4ACDA 2YIQA 4IC7A 3NSZA 2PE0A 4EHVA 3HP2A 4ANNA 3SA0A 1W84A 3FPMA 4GK4A 2F7ZE 2UZVA 3K54A 4UXQA 1PXPA 4DLIA 3Q5IA 2WEVA 3FY0A 4F08A 3IS5A 4GT3A 3ZLYA 3AC5A 4EQCA 4YTCA 3A7FA 3ULZA 2YIRA 2JDSA 1UNLA 3RPVA 4K6ZA 4ENYA 4DT8A 1Q8YA 2XJ0A 3KKVA 5E1EA 4ENXA 1WBVA 3Q04A 4GT5A 3FMLA 3QKLA 2UVYA 2B53A 3H10A 1PXLA 3E63A 3O7LD 5D10A 4RVMA 3W2QA 3BGQA 2O65A 3S95A 4BDGA 4NJ3A 1JOWB 3HV3A 5CENA 3KMWA 4FVPA 4RWKA 5HQ0A 5J9YA 2B9IA 3R0TA 3PWDA 1YWVA 4I92A 4FKGA 4YNEA 4MD7E 4IANA 4OTRA 3TJCA 2HELA 1M7NA 4FMQA 1OITA 5TF9A 2JFMA 1LP4A 2I1MA 4U7ZA 4X7QA 1PMEA 5AP2A 4A9YA 4D28A 2R3IA 3DJ7A 4YBJA 2VTRA 5AR2A 2WTDA 4YZDA 4BDJA 4BRXA 5C8KA 4TYJA 4BFMA 3LXKA 4XJ0A 4D2WA 1Q5KA 3ZFYA 2Y0AA 3DK6A 4U81A 5FLFA 4HW7A 4PDYA 5CYIA 3E88A 4U9AA 3NYXA 5IA0A 1Q3DA 1Q8WA 2GCDA 4DC2A 4FKTA 4NCTA 1Q8UA 3SW7A 2OKRA 4CFNA 2JFLA 4Z9LA 2PWLA 4J52A 4ZLYA 5IMXA 4H1MA 2P4IA 3S2PA 4IZ5A 5JZJA 4XG4A 4WA9A 4F99A 3MWUA 2YM4A 3AMBA 2BUJA 5FTQA 1NW1A 4NKAA 4RIXB 3NCZA 4ZTRA 3IDBA 4ACHA 4XS2A 2J6MA 3AMAA 3FZ1A 2BRNA 3OTVA 4YO4A 3P0MA 2CKEA 2VTHA 3OXTA 4YPSA 2X6DA 4FIHA 2QOCA 1Q99A 3L9LA 4QPAA 5IQHA 2JKQA 2YIYA 2ETKA 3KN6A 3OW4A 5DH3A 5CTPA 4YTIA 4CNHA 4I0TA 4FGRA 3R73A 5JKGA 4E5AX 2XCHA 2GNGA 4F65A 5CY3A 4CZUA 5FTOA 4XHKB 2CGUA 3ZM4A 4AX8A 3GFWA 3POOA 4BGHA 4CYJA 3TNIA 3RZFA 2QR7A 3V8TA 5IEVA 3NZ0A 2C3JA 3REPA 3P79A 3LFFA 3AT3A 4BCHA 3JVSA 4Z7HA 4LRKA 5L2QA 5CASA 3LMGA 2XJ2A 3SOCA 3MPAA 3BYOA 3FI2A 1CSNA 1PKDA 1WBOA 3CC6A 3MH1A 4PL4A 3ODZX 3QTZA 5BVKA 3I1AA 4YZBA 5EDPA 5M51A 5CF6A 4WNKA 2E9UA 4BCFA 4QMMA 4L67A 1M2QA 5ANIA 2QCSA 5HZNA 1VJYA 2WMSA 1O6LA 3C1XA 1JLUE 4ZTNA 4OR5A 2Z7QA 3QD4A 4ZJJA 2AYPA 2H34A 1YI3A 3R04A 3UG2A 2PULA 3ZS5A 5LCJA 3CS9A 1SM2A 5AMNA 3LXNA 5B7VA 2XZSA 3MVMA 3BLHA 3NWWA 2V62A 2QOIA 2WQNA 3FZOA 4NW5A 5CVFA 4MK0A 5IUGA 3U51A 5J1WA 3COKA 5IQGA 4CD0A 4GCJA 3TKHA 4ALVA 1BI8A 2PL0A 3CEKA 5L6OA 1R0PA 2GFSA 3R6XA 4E4NA 5EI6A 3PA4A 5GZ9A 4DBNA 3NEWA 3LM5A 3CCNA 4QP8A 2XMYA 5DT0A 2QG5A 2R7IA 3BHHA 2JDOA 3DKOA 5C8NA 5DYJA 3Q4ZA 3UODA 4MXYA 2ITPA 4R77A 2C0IA 5JRQA 1WVYA 4ANSA 3KL8A 2FYSA 4O0YA 2G2FA 5EM7A 4G9CA 2JIVA 2YN8A 4M14A 2XEZA 4JX3A 2X7GA 4O0WA 3FXZA 5JMSA 3Q4CA 1WZYA 4ZJIA 4AA5A 5I9UA 4D1SA 1JBPE 3I7BA 3Q96A 3U6HA 4AF3A 3NW7A 2QVSE 5L6PA 2YAAA 4ARKA 3AD6A 3HX4A 1K9AA 4OBOA 3EYHA 1OM1A 1CDKA 1OMWA 4JDKA 4PDSA 3SG9A 3MH2A 4H36A 4HZRA 3FI8A 4C61A 4F0FA 5B2LA 4IAFA 2WKMA 3NS9A 1W83A 3RM6A 4DG3E 2WMVA 2YJSA 2GU8A 1GIIA 3NW5A 1VEBA 2QQ7A 1UA2A 4L68A 3O17A 3W33A 3EN9A 4ALWA 3BWJA 3KXNA 2X2MA 4RQKA 3FSFA 4BZNA 4BR3A 3SRVB 1VR2A 3R01A 2WFYA 5L4QA 2ZJWA 4NFNA 4QMTA 4FSYA 1M14A 4HCVA 3R1NA 3BYUA 4JRVA 4P5QA 4DHFA 3PIYA 3P5KA 4O7NA 1JPAA 2VTMA 2RG6A 4FTCA 2IVVA 2WAJA 3BEAA 3GQIA 2PPQA 3E3PA 3TDVA 3AC4A 4C2WA 4RGJA 4CZYB 3CLYA 3EH9A 4YJPA 3DBQA 4QOXA 5K3YA 1H1PA 3WZKA 4GT4A 3DNEA 4FTTA 4WNPA 3W32A 1RW8A 3EN6A 4IEBA 4L53A 2PVLA 4ZIMA 4OLIA 4YC8A 3GQLA 5C9CA 3BELA 3WF8A 1W8CA 3C50A 3NAXA 2ITZA 5LVOA 3OG7A 3IG7A 1RQQA 2VAGA 3QKMA 2GMXA 3LJ0A 4RWJA 5IQAA 4QP6A 1W7HA 4KSQA 4JG8A 2GQSA 2W4KA 3NX8A 2PZPA 3POZA 3ZBFA 2YERA 1ZXEA 3I81A 4LOQA 5KBQA 4LYNA 1F3MC 5HHWA 3Q32A 3UVRA 3PXYA 3DU8A 4ONAA 3RZBA 5AWMA 3QQHA 4O7LA 4PX6A 4IDVA 5A46A 2OFVA
chains in the Genus database with same CATH superfamily
4IADA 3NUNA 5K9IA 3DA6A 3L9MA 3QUPA 2C6DA 3OEZA 5C26A 4JIAA 2QURA 4D2SA 4IB5A 4A4LA 4BTFA 2VX0A 2G1TA 4Z7GA 1ZOHA 2JAVA 4AA0A 3R9RA 3BGPA 3DAKA 3HL7A 5HI2A 2RKUA 4TL0A 2BMCA 4JQ7A 3LCDA 3IDCA 3LQ5A 4NK9A 1YHVA 3PJ3A 4IX4A 5KMMA 3OY1A 2ONLC 2WTCA 1XMLA 5L6WL 1H1QA 4CSVA 3VWAA 3F2RA 2XK9A 1Y57A 2WHBA 3FDNA 3QRJA 3U9NA 1H0WA 4FSQA 4D9TA 5A14A 3UG1A 4MQ2A 3EZVA 4U3ZA 4QTCA 4O2PA 3OWLA 2F49A 2VWWA 4GG7A 2DUVA 4M97A 3OHTA 4TWNA 4HYUA 3R2YA 4WRSA 4WBBB 2YITA 4LGDA 1BKXA 1B6CB 1UKHA 2QNJA 4O22A 4ZTHA 3VF9A 3W2SA 2VWXA 4C4IA 3UYTA 2E9NA 1YOMA 1GZNA 1G8JA 1PW2A 4V05A 3JS2A 5A4CA 5I9ZA 3PPKA 4GS6A 4HNFA 2X7OA 4NEUA 4TKSA 4XX9A 3I4BA 3M1SA 2PE2A 2VRXA 4QPMA 5CEOA 3G33A 1U54A 4IAKA 2QOQA 3MY1A 4I24A 4X2NA 4ALUA 3GNIB 3HMPA 5EHOA 3CQWA 3EQDA 1JAMA 1KE7A 3QWKA 3QCSA 4HJOA 2HW6A 4FSRA 3ZXZA 2O3PA 5CQWA 5HORA 2DYLA 5DR2A 3UNKA 4FIGA 4GFOA 4QMXA 3V8SA 3F9NA 4TWCA 4X3FB 4BWKA 3D7TA 5ACBC 2XM8A 4X3JA 2QKWB 5ETIA 3OUKA 5ANEA 4JBVA 5DG5A 4J71A 2QODA 4JDJA 2BIYA 3KCKA 2B9JA 4IZYA 3D94A 2VTNA 4B8LA 4AGWA 3LCSA 2YABA 3F3ZA 3TXOA 3T8OA 4OT6A 1UNHA 2EU9A 2PTKA 3Q9ZA 1WBSA 5IQEA 4L7SA 5CVGA 2Y6OA 5HD4A 3TZMA 3VS4A 4HYSA 5CEPA 1IG1A 3DBEA 3QQFA 4I23A 4JL9A 4C58A 5FM3A 1JKTA 3FZTA 4A06A 4NTSA 4M0ZA 4AFEA 4RJ3A 2VTAA 2OSCA 3MGYA 4JAJA 3VW8A 4AN3A 1JWHA 4L01A 1BYGA 2DWBA 1BL6A 4G6OA 5DR6A 4M67A 2QC6A 2Y9QA 2UW0A 3PZHA 4C35A 2QONA 5M4IA 1A48A 1WMKA 3LMIA 2WQOA 4IMYA 3V5LA 4ZSAA 4BDDA 4ZJVA 4CLIA 1ZYJA 4K0YA 3FSKA 3BPRA 4FSZA 4RPVA 2PVJA 5CEIA 3K5UA 3QA0A 4I6QA 3U4UA 2VO3A 4BWXA 4H3PA 5L3AA 5I3OA 4AQKA 4MF1A 3TJDA 4E5BA 2CMWA 3BE2A 3F7ZA 4W4YA 1E1XA 3ZUTA 4EC8A 5IDNA 4LRMA 5CNOA 4XBUA 3W18A 3W55A 3EB0A 5IKWA 4F1MA 4GG5A 3MB6A 4EH4A 1PXMA 3NMUF 2IZUA 5AX3A 4Y5QA 2UZTA 4GU9A 4E4LA 1OGUA 4DFUA 4FT7A 5DA3A 3BU3A 2C68A 4IVDA 4RBLA 2UVZA 3DNDA 3TZ8A 4RJ5A 2Q83A 2XAOA 4FK3A 4IWOA 1WFCA 2XBJA 3OTUA 5J95A 3UBDA 4E8AA 4ZS4A 5D1JA 4LQMA 4BJJA 4FT3A 3A8WA 2JEDA 5TO8A 2X0GA 4AQCA 3OF0A 4HGEA 3QLFA 3OEFX 2PUUA 2B52A 4QTBA 3D5UA 5AAGA 1WBTA 3CTHA 4XEYA 4H1JA 4IX3A 5J7HA 2CLXA 3F88A 2NO3A 4I0SA 3HRFA 4QQJA 5FEEA 5JEBA 4W4XA 2EB2A 4WUNA 5CSPA 2GS7A 4M66A 5E8YA 2ZB0A 3U87A 4FTIA 3TKIA 5M4UA 4O86A 4DH3A 3GCUA 3F69A 2VWBA 2OBJA 4J95A 4XV9A 4G2FA 2VGOA 3GOPA 4IIRA 4JNWA 4XYFA 3E7OA 5E92A 5BUJA 3QTUA 2OJIA 4GJ3A 3VUMA 4FV8A 4RIOA 3F3TA 3L8VA 5FP6A 3UOHA 4AT3A 4LGGA 4V0GB 1REKA 4JBQA 2HZIA 5HKMA 3RKBA 1BX6A 3DQXA 2O8YA 3UDBA 2ITYA 3VNTA 3KRLA 4UMUA 4BDEA 3QUEA 2I7QA 5CF4A 1VZOA 4TNDA 4ZTQA 4BGQA 3QA8A 4YSJA 2QOHA 1H08A 4ANLA 4DH1A 4F0GA 3AC1A 2OJJA 1F5QA 3ENHA 2SRCA 1SYKA 4BHZA 5LXMA 2C5YA 4Y5HA 5D41A 5IDPA 4C59A 5FXSA 1YI6A 3G0EA 5BUEA 3S3IA 4KABA 4E6DA 2ZVAA 4OTPA 4FTOA 5AP5A 3R22A 3UDZA 1KE5A 5DPVA 3WF5A 4HOKA 5AUTA 4PY1A 4DFYA 3LJ2A 2XKEA 2HXLA 1FVTA 2VN9A 3DFCB 2CSNA 4G31A 4BIDA 5M4FA 2RIOA 4UY9A 4AP7A 3Q9YA 4EKLA 4FRFA 1CTPE 4RVKA 4A9UA 4D4YA 5DHJA 3PE2A 2UW8A 2W99B 4MWHA 3PG3A 3O8PA 2YIXA 2J7TA 1OPJA 1QPEA 2JGZA 3I60A 3QQUA 4FTJA 4MNEA 4RG0A 5CX9A 3WBLA 4A9RA 4IE9A 3RI1A 4BDKA 3OWKA 2GQRA 1XBAA 4ANOA 2AC3A 2WXVA 2C6IA 4E26A 3BV2A 2IEWA 2A2AA 3A4OX 1OL6A 2XUUA 3FYJX 1YRPA 3R1QA 5A6OA 3FL4A 2CCHA 3GC7A 3QAME 4FT0A 3TTJA 3OWJA 4E1ZA 5M09A 5LOHA 3B8RA 2BRBA 2R0UA 1UU9A 5FXQA 2XK4A 3R9NA 2V7OA 4M15A 4U0IA 3ZTXA 4D55A 4DCAA 2PZ5A 2XRUA 2WD1A 4JDIA 3AMYA 5TOZA 1AGWA 3RK5A 4F9WA 4I0RA 4HGSA 3GC8A 2VO0A 3VBXA 3GXLA 2XYNA 2JITA 4FTRA 1XH4A 4BIEA 4UMRA 3QXPA 2C5OA 3HUCA 4R5YA 1K3AA 5ANOA 3R7YA 5I9VA 5L2WA 5E9EA 3GFEA 3O7LB 2BRHA 1OKWA 3U4WA 2UW7A 4QMWA 3TT0A 4O4CA 3DGKA 3BBTB 2FUMA 1M52A 4IXPA 4JDHA 2WQMA 3AT4A 3BZ3A 4RJ6A 4A4XA 3BRBA 3LFQA 3WYXA 3QBNA 3U54A 4MF0A 2YFXA 2C5XA 4EUUA 2H6DA 5BVEA 3VRYA 5EI2A 2PVKA 2B0QA 2YAKA 3G6GA 4FNZA 3UOJA 5LVPA 3VS6A 3TZ9A 3E64A 3QALE 4XG2A 1OPKA 1YKRA 3P4KA 4M84A 5DWRA 1ZZLA 2B54A 1Y6BA 2V55A 2CPKE 4TRLA 2VTOA 5CSVA 2C4GA 3OCBA 1TZDA 1JKSA 5AJQA 2YM6A 4I3ZA 5E91A 4AOJA 4ZLOA 2X7FA 5M55A 2OZAA 4M69A 2VNWA 1F0QA 3D5WA 2C69A 3KF4A 3A4PA 3CD8A 4RLLA 4AZFA 3GU8A 5AUUA 4BYJA 4O82A 3CIKA 1OKVA 3LVPA 4EH8A 2WU7A 3I6WA 3LFSA 3BLQA 4MX9A 4EUTA 2C3KA 2EXCX 1IRKA 2C0OA 4NT4A 1TQIA 3NNUA 2VTPA 2W1FA 3ZC6A 3OS3A 5HNIX 2J0MB 2X9FA 3AGMA 4IHPA 4BTMA 4FVRA 3PIZA 3PXFA 4XUFA 3KF7A 5EOLA 4FGBA 4NU1A 3R8MA 4DFLA 4K8AA 4IB1A 3FE3A 4JAIA 3TM0A 1YQJA 1J1BA 3BYVA 3MTLA 1J1CA 5M53A 3BX5A 2ITTA 4FL1A 3NIZA 4OUCA 3QL8A 4MXXA 2PSQA 3O96A 4AT4A 3PSBA 3CJGA 3VS7A 5A4LA 4CXAA 3PSCA 4JI9A 1ZYSA 3C4EA 4FSMA 5DOSA 3A99A 5CS6A 4XMOA 2BCJA 4R3CA 3N4TA 4H3BA 3FHRA 5IH5A 3LFBA 4FG7A 3VS2A 5GHVA 4BWPA 3NIEA 2J50A 4LOOA 3AD5A 3C0GA 4K11A 3HNGA 2IW9A 5EM8A 2W5HA 3GB2A 5CI7A 5EK7A 4KB8A 4WO5A 1Q8ZA 5IA5A 3QQJA 3BLRA 4CG8A 3EQCA 4BIBA 3KRXA 4Y85A 4AXFA 4FKQA 4QDEA 3UDSA 4X2FA 2B9HA 2BIKB 3AKJA 2HIWA 4ZK5A 5KMKA 4UWYA 2AC5A 2HWPA 3VJNA 4EK5A 3KGAA 4L6QA 3ROYA 3FEGA 3UGCA 4YZ9A 3HMMA 4M13A 2UZDA 4RIWA 4U41A 4R3PA 3EFJA 2X81A 3B8QA 4ZSGA 4RC2A 5HIDA 4L8MA 4P5ZA 5JGBA 3SW4A 4D5HA 3VBYA 4WSYA 5GZAA 3BHYA 3W2CA 4UBAA 3DTWA 2BFXA 1UWJA 4I5MA 4IX5A 3A7JA 4NIFA 4IJ9A 1SMHA 3DLSA 4MTAA 4BBMA 5IUIA 4FOBA 2W1DA 3AQVA 3NNWA 5EH0A 1AD5A 4QMVA 2WTWA 3W2RA 2A27A 3VHKA 1YXTA 1I44A 4IWPA 3AKLA 5HTCA 1XMMA 1H07A 3Q6UA 5HX8A 4O1OA 5HIEA 4K77A 2EWAA 5KX8A 3U55A 3KCFA 4C38A 5K0KA 3Q4UA 2W4OA 4L9IA 3SG8A 1Q3WA 3DK3A 2UVXA 1UWHA 4FR4A 4G5PA 4ZSLA 2G2HA 5A4EA 3LXLA 5AADA 1FVVA 2YCFA 3G2FA 3PJCA 3H3CA 3PUFC 1YXXA 4DE4A 4IFCA 4KWPA 3F61A 4RZVA 1W2DA 2OO8X 1SNXA 3D15A 4YGAA 3VULA 3UPZA 5CANA 3BHTA 2WELA 4BN1A 4M12A 1B39A 4TZRA 3ZHPC 2GTMA 2X8DA 2RSVA 4U97A 3KREA 4KINA 5HU3A 4ZXTA 5KE0A 4FKJA 3FC1X 3QQKA 2W05A 1ZMVA 3NYVA 3KXZA 4L44A 4B9DA 4RZWA 2VGPA 3PLAE 4KBAA 2XK3A 5HEZA 3IDPA 4YNOA 2I6LA 5DT4A 4AU8A 4FT5A 3OT8A 4BF2A 5HVYA 3IOKA 5GIOE 2XIKA 4I21A 4RIYA 5EQYA 2QOOA 5B2KA 4LMUA 5AR8A 4LL5A 3F5GA 5CXZA 4AN2A 2ITVA 4BDHA 2XARA 4CMOA 2E9VA 5LVLA 3ZMMA 1A9UA 4N70A 2ETMA 3R2BA 3WI6A 3ZO2A 4EWHA 4O0UA 1UV5A 4FZ7A 2F4JA 1ZYDA 2UW4A 3QWJA 4XV2A 1MUOA 4EZ3A 5D11A 3FY2A 4O21A 2PMOX 2PVFA 3SXSA 1QPCA 3FQEA 4MWIA 5FTGA 1GY3A 3AOXA 5IH4A 3F82A 3IECA 1CKPA 3V04A 4AXDA 4ANBA 4AT5A 3S1HA 5CLPA 5L8JA 4HPUE 3AC3A 4KS7A 3QX4A 3O2MA 3RPSA 4WNMA 1YOJA 4V01A 1HCKA 1H1SA 3DT1A 3QQGA 4FBXA 4QMZA 4CFUA 5A4TA 3NCGA 1UU3A 1PXKA 4FA2A 2Q0NA 5JFSA 3MW1A 4P7EA 5IMEA 2ZDUA 2ZM1A 3FQHA 3G51A 3NUYA 4S31A 3VBVA 1LR4A 2W1HA 4Z3VA 4BL1A 3ZFXA 4MQ1A 3LAUA 5ETCA 4NSTA 4WKQA 2W0JA 3WZUA 4ZZNA 4CKRA 4YU2A 1PY5A 4W8EA 3OCTA 4AW5A 4KSPA 4AZVA 4UMTA 3QZFA 2GHGA 3BYMA 4PNIA 4DEEA 4XG3A 2BKKA 3THBA 3EFLA 4IX6A 2B9FA 3R9DA 2XANA 4Y83A 4J99A 4LI5A 1GJOA 4DA5A 2UW5A 4AZWA 4FKLA 2XNNA 3U6JA 2HYYA 3D2KA 4LOPA 2XB7A 4X6RA 2VTIA 3UNJA 3KXXA 4IW0A 3JVRA 3QX2A 3N4VA 2R0IA 3K5VA 1M17A 2W1IA 4P4CA 4HGLA 4TYIA 3TCPA 1ZAOA 4RMZA 3IW5A 3L8PA 4BGGA 4DEGA 4FTQA 2XK7A 3MJ1A 2UZEA 4TT7A 5FD2A 4OTFA 3RJCA 2BROA 3OXZA 3ORXA 3VUGA 3QHRA 4GKHA 3UC4A 2UV2A 3DB8A 2VX1A 3KRWA 1OBDA 2IZTA 4RVTA 2BAJA 1E1VA 3CR0A 5KMOA 4Y46A 3F5XA 3UO6A 3NAYA 3ZCLA 2YHVA 4CFWA 2I0VA 3FXXA 1CM8A 3QZHA 1JVPP 2QKRA 4HNIA 4FTAA 4E93A 4EK6A 4ZY4A 3ML1A 3ZYAA 2X4ZA 3DBDA 3ZOSA 3GBZA 3W16A 4F7SA 3CTQA 3QFVA 3FUPA 4YC3A 3ZU7A 3UZTA 1P5EA 1KOAA 3FZPA 1XKKA 4XP0A 1GNGA 5C4KA 4MHAA 3V5QA 3FKLA 2AUHA 2R3MA 4Z16A 3PG1A 4N0SA 3Q4TA 4ZTLA 2J9MA 4OTGA 4B6LA 1YWNA 2NRYA 5AUYA 2HENA 3AC8A 4GYIA 3PYYA 3W1FA 5CU0A 4R7HA 3P9JA 4CKJA 2BPMA 3W0MA 4BCGA 4HVDA 1XBCA 3TNPC 4UX9A 1NVSA 4EK4A 5GINE 3HEGA 4PUZA 3ALNA 2KULA 3CPBA 3GU6A 3Q53A 3IW7A 3SLSA 3UTOA 2VNYA 4G3EA 3A61A 1WVWA 2W96B 3KRJA 4XV1A 3R8ZA 5K5NA 5M56A 4FI1A 3FMEA 1O6KA 3F3WA 4N6ZA 2QLQA 1U54B 1XH9A 3GCQA 1GZOA 3EQPA 5G6VA 4EOIA 5FUTA 2G15A 3EL8A 3V8WA 3V5WA 2REIA 4XG7A 5DEWA 3F5UA 4K2RA 4UN0C 3MI9A 5BVNA 5HTIA 2OK1A 3W2OA 1P4FA 4CFVA 4ITIA 3MIYA 2IVSA 3O51A 1WAKA 2C6LA 4FV4A 3H9OA 4J7BA 4GV1A 3D7TB 5DFPA 3TN8A 2OF4A 3TUCA 2Z60A 3I79A 3L1SA 1STCE 4F7LA 2Y7JA 3K2LA 4QQTA 3MVJA 4IB3A 4BVUA 5JK3A 3R00A 4OBPA 2JKOA 1YW2A 3ORMA 3A7IA 1OGYA 2P2HA 3L9PA 4JR3A 3OMVA 3NYOA 1NXKA 3WZJA 5JSMA 2R3PA 5F9EA 5CVHA 1ST0A 1OB3A 3QYZA 3R7VA 4O6EA 4CGAA 4PTEA 4GJ2A 5KMLA 5GIPE 5LMKC 3EZRA 5TKDA 4YSMA 3FZRA 3MVLA 4JG7A 3UVPA 4DGNA 5LMKA 3QTIA 4XRJA 1OI9A 1PXNA 1WBWA 3PIXA 2CKQA 3LCTA 5G1XA 4CEGA 3DFAA 5IQDA 3QYWA 3PVBA 3IPHA 5HVKA 1HOWA 3KN5A 5DNRA 5CQUA 3ULIA 3OWPA 2WOTA 2NPQA 3FHIA 5CZIA 5IA3A 5AEPA 4GRBA 3VRZA 5ITAA 3WIKA 3Q9WA 3G15A 2JD5A 4FV5A 5IQCA 4KBKA 3TUBA 3CE3A 2BILB 3FL5A 4PPCA 3U8WA 3ZZEA 5JFWA 3A60A 1ZRZA 4FTUA 2XA4A 4D1ZA 1H27A 5J5TA 3S00A 2JKMA 2ZM4A 4FSNA 2QU6A 3LJ1A 3OOGA 4S34A 5F95A 3OW3A 2Y6MA 4HZSA 5KBRA 1J7IA 3ANRA 3MVHA 1KV2A 4G16A 4G5JA 4LRJA 5EHLA 3VHEA 5KKRC 3Q5ZA 4C4EA 3N51A 4C57A 4C3RA 4EHGA 5BVOA 5KHXA 3HMNA 3RINA 3UZPA 4MXZA 2R5TA 3LZBA 3PFYA 3EL7A 2OXDA 4JQ8A 5ANKA 4R5SA 1IA8A 2ITQA 2A0CX 1FMKA 1RDQE 4YJSA 4R7BA 4DDGA 5HG7A 5HO7A 5FQDC 2ERKA 4BJJB 4F64A 2C6OA 4E5WA 1P4OA 2ITOA 3W2PA 2YEXA 3Q60A 3HKOA 4X0MA 4HVGA 2UZOA 5K0XA 3QC9A 3P1AA 4YPDA 2J0KA 2WMQA 2PUNA 4FK6A 4ASZA 5CI6A 2E2BA 2R3HA 5EM6A 5CALA 3W0OA 4DFBA 2WZJA 4G6LA 4J53A 4DH8A 3R7IA 2WTKB 4WG5A 5LWMA 4QT1A 4FL3A 5I3RA 1DI8A 4DTAA 4IZ7A 4TWOA 3LCKA 4FKWA 1WBPA 2A1AB 3DTCA 3D0EA 1DM2A 4PTGA 4QTAA 4TYGA 3IW4A 4EQMA 4F7NA 4AE9A 2PK9A 5FP5A 1VYZA 2IO6A 3UQGA 2ZYBA 1Y91A 2UZWE 1H4LA 2ONLA 4FF8A 4P90A 2RFEA 5DT3A 5F1ZA 3T3UA 2QO7A 3KA0A 2P55A 3F6XA 5I4NA 2Y4IB 4O1PA 3ZLXA 4AXAA 1OKYA 4M0YA 2CJMA 5C03A 4JQEA 3GEQA 3PWYA 4RJ7A 4AZSA 4AA4A 1PJKA 1SVGA 5DIAA 5CEMA 2W4JA 4GVJA 5AFVA 4S33A 4CYIA 5M57A 2W9FB 1L8TA 4U8ZA 3BCEA 1H1RA 4DGMA 3C7QA 4DCEA 1KWPA 3L8XA 4WBOA 3F2NA 4FV2A 4MXOA 4C4JA 4FL2A 4RT7A 2OW3A 3UYSA 5KMJA 4AW2A 3MFSA 3QCYA 4O2ZA 3RNYA 3Q2MA 5AR5A 2WMAA 4QEBA 4I20A 5AUXA 2R7BA 4EHEA 2ZMDA 1G8SA 3C4WA 2QHMA 2VUWA 2YCSA 4FOCA 2HW7A 1SVHA 4DGOA 2OXXA 3W0NA 3UOLA 1P2AA 1XH8A 2EB3A 4D9UA 4BDCA 3QTSA 3WARA 3CY2A 1MRVA 1OIQA 4MNEB 4X6QC 3HDNA 4U80A 2BZIB 4H58A 4FEXA 3QKKA 5I9YA 4YJRA 2BZJA 3T3VA 2CNUA 4CV9A 2BTRA 4P2KA 5AX9A 2Q0BA 1R39A 1LUFA 2RG5A 3RPRA 4GIHA 5LVMA 3U6IA 5EQEA 2QOKA 4L46A 3JYAA 4WOVA 3FI4A 3FLNC 5JFVA 4YBKA 3F3VA 3NUPA 4C34A 3UO4A 1DS5A 1OUKA 4KA3A 3NVKI 4F9AA 2IF8A 4JMQA 4QMLA 3BEGA 3UMWA 5TE0A 4IFGA 3PY1A 2UW6A 3HLLA 3GENA 5DE2A 4YP8A 2X0PA 2XM9A 4XCUA 2PMIA 5EW3A 3GU5A 4EOOA 3ZM9A 4YTHA 2BDJA 2O2UA 4FX3A 1IASA 1Q97A 4O27B 4OGRA 5J9LA 1IAJA 5AUZA 4O7RA 4CV8A 4O7TA 4YZCA 4I6LA 5FEQA 4AUAA 2HK5A 2IW6A 4PDPA 4EJNA 3TYKA 2XRWA 4O7YA 3R9HA 3LIJA 2X2LA 2GS2A 3IQ7A 5KZIA 4BCMA 2OGVA 3UQCA 3UNZA 4YHFA 2XIRA 5ANJA 5HGIA 4USEA 5J7BA 3TUDA 2W5AA 3BLAA 2WU6A 3FC2A 3DS6A 4H05A 4U43A 5AIKA 4HCUA 4NKSA 3COMA 1JNKA 3EQFA 3VVHA 4XH6A 1QCFA 5HE1A 3RALA 4NWMA 5KUPA 4FYOA 1ZMUA 1OZ1A 3WIGA 5EYKA 5I0BA 3QRKA 4WUAA 3DKFA 3DV3A 3FMDA 4XP3A 4O4BB 4KAOA 4W4VA 5HBEA 3P7CA 3VUKA 4CRLA 2YCQA 2IW8A 3VBTA 3HA8A 1PF8A 2OIDA 4YMJA 3GT8A 4QDVA 3KIOC 4L43A 3HYHA 5HNGA 4YLJA 4FV3A 1UU8A 4EYJA 2OZAB 4M69B 1IEPA 2ERZE 3EFKA 4GL9A 1PMUA 5CAOA 4PMSA 3QF9A 1FGIA 3KULA 4O7ZA 2R9SA 3KEXA 3AXWA 4L7FA 5AAEA 3E8NA 2YWPA 2IVTA 2YLFA 4GUBA 4D58A 5IG1A 1PMNA 4S30A 4Y73A 3ALOA 3ZRMA 5HLPA 1S9JA 4RSSA 4ZP5A 4IM0A 3CXWA 4RC3A 3MN3A 3EQBA 1XH7A 1IA9A 4FZ6A 4L52A 3LCOA 4OBQA 2OF2A 3PVGA 2C1AA 3DAJA 1OVEA 1HCLA 1U4DA 3CP9A 2RGPA 2XNGA 3R83A 3NDMA 4AGUA 4I5PA 5IA1A 4QNYA 3UO5A 1OIRA 2XKCA 3H4JA 3QRTA 2IG7A 1CKJA 5HG9A 4C2VA 4JLCA 1ZY5A 3E5AA 4U44A 3BIZA 2VTTA 3UP2A 3AD4A 3EKNA 3FKNA 3LPBA 4K9YA 5DN3A 1U5QA 2HOGA 1ZYCA 2NP8A 2WOUA 2O5KA 1L3RE 3R7OA 2G01A 3ZRKA 4F4PA 4A07A 3C4CA 4A9SA 3ZLWA 3JY9A 4XV3A 2C0TA 2OH4A 4W9WA 1GAGA 1P14A 4X2GA 3GU7A 2PVNA 2QHNA 3FQSA 3DCVA 4DAWA 1OIYA 2QR8A 3JY0A 5LMBA 3DJ5A 3HVCA 5EKOA 3B2WA 4BI0A 3QTWA 4WT6A 3UMXA 3KB7A 3R8UA 4GMYA 3RAIA 5CZHA 4AFJA 4QYYA 1WVXA 2KTYA 4FKOA 4KIKA 3II5A 4RIWB 2OFUA 3CY3A 4XG9A 1XR1A 4YZNA 4EOMA 4Q9ZA 3R9OA 1DAWA 3PSDA 4L45A 4NJDA 4FEWA 5EQPA 1APME 4CFFA 3EFWA 3FMHA 3VF8A 4AGCA 4XOZA 2PY3A 3QLGA 5IQIA 4O0XA 3V5TA 2EVAA 4J8NA 2VZ6A 3PDTA 4XNEA 3OFMA 1WCCA 2E9PA 2BVAA 3BHUA 1XQZA 4NIFB 4Y8DA 2XBAA 5A54A 3F3UA 1BMKA 3CQUA 2RFSA 3CKWA 3O0GA 4K1BA 1XHAA 4QP3A 4UZHA 2VD5A 4R3RA 4JS8A 5BV3A 4DTKA 4CVAA 3EMGA 4IVBA 1URCA 5IEXA 3V6SA 5K4JA 5J79A 5C4LA 3TKUA 1XH5A 4QMOA 3C4ZA 3RNIA 4ANQA 5L8LA 4YJNA 1NY3A 2XNEA 3F2AA 4I5HA 4XLVA 3O8TA 5CT7A 5AV1A 4C4HA 3ZEWA 2V5QA 3DDPA 4FEVA 4C33A 3ACKA 2NRUA 2OZOA 2R3LA 4UXLA 5CSWA 4JXFA 1Q8TA 2ZFYA 2J90A 4TYHA 3BQRA 3W0RA 3DKGA 3MPMA 2RFDA 5KMNA 3OC1A 4USDA 2CDZA 4OTQA 5HOAA 3NFGB 1MRYA 2O0UA 5GJGA 2QLUA 5CU4A 3MJ2A 2R3JA 3FMKA 3H30A 5HD7A 3R1YA 3AGLA 5A3XA 2IZRA 3R71A 5HIBA 2C47A 5M07A 3WYYA 4QMUA 4RIYB 2GNHA 2WMTA 2XIXA 4GU6A 4BKYA 4FIIA 3CSVA 2HY81 4ZSJA 4GYGA 4I22A 4BBFA 1LEWA 1YI4A 4CFXA 3E8DA 1FVRA 3GOKA 5JGDA 4UYNA 3LM0A 2VTJA 3HGKA 4RRVA 3E8EA 3QTXA 2YACA 3MBLA 3P23A 4QRCA 4KKEA 1YXSA 5GJFA 4K18A 4QNAA 3QTRA 4CCUA 2PVYA 2JDTA 2A4LA 4DHJA 3QD3A 4IVAA 4QTEA 5JFXA 2VWYA 2J5FA 2R4BA 1KE6A 5JT2A 3RPOA 2HZ0A 4PWNA 3FI3A 5CU2A 5EG3A 5AAFA 5CU3A 2UW3A 3RWPA 4HPTE 5K5XA 3HA6A 5AP3A 3COIA 3F66A 4DLJA 3OVVA 2BTSA 1ZY4A 4LG4A 3G9LX 1NA7A 1ZMWA 5F20A 5EYCA 5CXHA 2RF9A 5CU6A 4FKUA 3W0QA 3UE4A 2XNBA 4FTNA 4I5CA 5LQFA 3ORLA 3UIBA 1TKIA 3KC3A 4AW0A 2H8HA 4G3DA 4QP1A 3VQUA 4N57A 3KVXA 1ZOGA 4YJOA 4E7WA 1YXVA 5I5ZA 5DEYA 3M2WA 2NNWB 2W5BA 3HDMA 3HAMA 3QC4A 4O0SA 4RQVA 5D12A 2FSOX 4OAVB 4EORA 4FT9A 2X0OA 3W8LA 1RJBA 3JXWA 3MTFA 3TZ7A 2YLEA 3DXNA 1V0OA 2R3FA 3QRUA 4Q9SA 4R8QA 4BKZA 3TACA 3K3IA 4BZDA 2R3GA 3MYGA 2XNMA 3TDWA 3QZGA 4MBLA 1H01A 3TNHA 5BVFA 3UJGA 4LM5A 3ZBXA 4B7TA 5EKNA 4I41A 1PHKA 3HRBA 5J9ZA 5J1VA 4JG6A 4DYMA 1UU7A 2B1PA 2FB8A 3EJ1A 4FKPA 3FLSA 1KE8A 4R7IA 3TV4A 3FMNA 3GCVA 4FG9A 5H8BA 4CQGA 5IA4A 3TWJA 5BYYA 3PA5A 3SVVA 2WMBA 3HV7A 2BRGA 4U42A 4B0GA