3FMEA

Crystal structure of human mitogen-activated protein kinase kinase 6 (mek6) activated mutant (s207d, t211d)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
288
structure length
268
Chain Sequence
MEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFAGCKPYMAPERINPELNQYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase 6 (MEK6) Activated Mutant (S207D, T211D)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 268
sequence length 288
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmeA01
4O38A 4UEUA 3B2WA 5FM3A 2J0KA 2YIYA 3F61A 4FA2A 5HICA 5HCXA 4OTIA 5HNIX 4F1OA 3ZOSA 3N51A 2WTDA 5EKOA 5H3QA 4AG8A 2J0JA 2XA4A 5AV4A 4V05A 3GCUA 3AGMA 3MJ2A 4BI1A 4DEAA 2B52A 3QXOA 3K54A 5EW8A 4GK3A 4U6RA 4AA0A 1YHSA 3Q96A 2B4SB 1OKYA 4IMYA 4XNEA 3ORPA 2PUUA 4TNBA 5DIAA 5L8JA 2OGVA 3VBXA 3IDCA 4EOKA 1ND4A 3R7OA 2JAVA 3D5WA 5TE0A 3P7CA 3ZLSA 4F1TA 3PFQA 2Y6OA 2VWIA 4R6VA 2XJ1A 3HV5A 3ZBXA 2NP8A 5AM7A 3Q5ZA 4A4OA 3AC1A 4KRCA 2PPQA 3I7CA 4U80A 4MX9A 4FMQA 3FMKA 4R8QA 2A4LA 5KMOA 1QCFA 4LOPA 4AZSA 1ERKA 4EZ7A 3Q9YA 3HDNA 4FF8A 5HTIA 3U4WA 3F2RA 5H8GA 5IH5A 4IFCA 4K0YA 4AT4A 1VZOA 3I0QA 4DFYA 3IOPA 3DDPA 4V04A 3BZ3A 3FQEA 2BZIB 4XX9A 5E4HA 1OB3A 3UG2A 3JR1A 3EYGA 3GU5A 1GZ8A 2AUHA 3SX9A 3VAPA 2R2PA 4YLJA 1X8BA 4AE6A 4EZ5A 4EONA 3FMMA 3Q2MA 4RLLA 3R9HA 3OCGA 3E8NA 3P79A 4JL9A 3DS6A 2C3LA 1JQHA 4Z9LA 1G8AA 4O91A 4RPVA 3QYZA 5CXZA 3KXXA 3NMUF 3ENHA 4LQMA 3BU5A 3LFNA 4TY1A 2C5OA 5I9UA 4EYMA 2BKZA 4D28A 3GCQA 4GIHA 5D7VA 5AP5A 5IPJA 3NGAA 1H01A 1QPJA 3RBWA 3IS5A 5HLWA 1WVYA 2JAMA 4E8AA 4K1BA 3OC1A 3FMDA 5IG1A 1PRYA 4CFVA 3CJFA 4ZJJA 3VUHA 2XYNA 3A99A 5IA5A 4IX5A 3RK7A 1NVRA 2VTSA 2IVSA 4GUBA 3R8ZA 4GRBA 4EH5A 4RA5A 3DJ7A 3W2OA 1OZ1A 2ERKA 3OBGA 5CS6A 4GFOA 4J8MA 4I5MA 2RG5A 2IW9A 3U51A 4ZSLA 3EN9A 5LVPA 3NCZA 4FKPA 5BUIA 3P7BA 4LRMA 3HMNA 4I3ZA 3HP5A 3BU6A 4EH3A 3A7HA 5HO6A 2CNUA 4TWPA 3QRIA 2JC6A 5CAOA 4EWHA 5AUZA 2ITZA 3ITZA 3EN4A 2GQRA 4KBCA 1PY5A 4UB7A 2JIVA 4PMSA 3VS4A 4M8TA 3VS6A 3HMIA 4D4SA 3LFSA 4JDIA 2V0DA 4NM3A 4J99A 4I21A 3HRCA 4O2PA 1U5QA 4FNWA 3OFMA 1U46A 4QNYA 3N4TA 2WU6A 4GJ3A 3KMWA 2XIXA 4AGWA 2P55A 4A9SA 4I6HA 3HZTA 4M12A 4IAZA 3PTGA 4DGGA 4I20A 3MV5A 4ERWA 3QF9A 2WTKC 2OJJA 3POZA 4FSZA 4X6QC 2VX0A 3HMMA 1Q8WA 4IXPA 4YBJA 5FG8A 2VTMA 3WIGA 4A9RA 3DJ6A 3L9PA 3VQHA 4FKGA 2PU8A 5CU4A 4G1WA 3R7GA 3CD8A 3TTJA 3MDYA 3VS7A 3DLSA 2XRUA 2P2IA 4WRSA 4UBAA 5AV1A 5KMIA 2QOFA 3AQVA 4ACDA 3VUKA 4OT6A 2JLDA 5FM2A 3V6SA 3UPXA 4BCNA 3W1FA 5EHYA 5ANOA 3DFAA 3UNJA 3ZO1A 2PVMA 1Q41A 2BKKA 4O86A 4IC8A 1UVRA 2VWUA 3TL8A 4DT9A 3EWHA 4GG5A 4AA4A 5I9ZA 4XG4A 3FZ1A 4ZTRA 4DC2A 5IA3A 1PMUA 4HJOA 3H9RA 1H0WA 1PKDA 4CLIA 3F3WA 5IF1A 3DKCA 3CS9A 4AQCA 4ZZOA 3TM0A 1YQJA 3F2AA 4WUNA 1XH8A 2BDJA 3D9VA 4CRSA 2UV2A 3LAUA 4LV8A 2IG7A 3AC8A 4WNMA 5CNNA 3GBZA 4I22A 3MESA 4XLVA 3TV7A 4K33A 4O0XA 2R3IA 1XQZA 4UZDA 4E20A 3PYYA 3SC1A 1PXKA 4S33A 2LAVA 4UX9A 2HOGA 3GOPA 5AR8A 3C4XA 3R02A 2BR1A 4MHAA 4PQNA 4BYIA 2XIRA 2BRBA 3I81A 1NT2A 2VV9A 3NUNA 3G6HA 3Q5IA 4IAAA 1VYZA 1LEWA 2WOUA 1FINA 5KUPA 2XKDA 3G33A 3FQHA 4KABA 4PDSA 4WBOA 3P7AA 1Y6BA 4I1ZA 5IQDA 4E6CA 3VS1A 4QMSA 5IEVA 2WMSA 4CLJA 3CTHA 4U41A 4HVIA 4W8EA 3ZSGA 4QPMA 4APCA 3BYSA 5IU2A 1NW1A 3KVXA 5CZHA 5IQBA 5EYDA 2YIQA 1R78A 3R7VA 4TPTA 3DBEA 3CSVA 4WIHA 3K3IA 5GZAA 4G31A 3E93A 2XK4A 3VBWA 4DH5A 4BBEA 4M69A 4I6FA 2HIWA 2IWIA 4QPAA 2BROA 4AACA 5F95A 2CGXA 3IPHA 5DRDA 4N0SA 2ZV9A 4ACMA 1UNLA 3TZ8A 2R3OA 4BBMA 3HV3A 4CTCA 1LP4A 3BYUA 1J3HA 3E5AA 2BFXA 3NYOA 4TYHA 3MB6A 3R2YA 5LARA 4QMUA 3ZU7A 5J95A 4D9UA 3PY3A 3TV4A 4C4IA 3MVMA 4C58A 4JJRA 1Y91A 4DCEA 2R3HA 1AD5A 2PVKA 4AZWA 2XIKA 5M57A 4DHFA 3FI4A 4ALWA 4EYJA 1JSVA 2BTSA 3BEGA 4IANA 3MVHA 1B38A 3NUYA 4BKZA 4DTBA 4H39A 3R0TA 2UZOA 2C0IA 3KXZA 4EC8A 2CKPA 5I4NA 4BB4A 3UIUA 5D10A 3MBLA 4CT1A 2H6DA 2WXVA 4OTPA 4XOZA 3GOKA 1P5EA 4FR4A 3NSZA 4W4WA 2J9MA 5CQWA 2GPHA 2WTVA 3VBYA 4MNEA 4X3FA 3ERKA 2WIPA 1ZLTA 3V8SA 5EOLA 4F0FA 4FKJA 5JQ5A 4FODA 3NCGA 5HCYA 3FC1X 4QTDA 5HOAA 4EUTA 1MUOA 2W1GA 3W2PA 2HAKA 4LGDA 3QUPA 4X2JA 4I92A 4XP0A 4HYUA 1CDKA 2V22A 3LFBA 2PZRA 4I4FA 2UW7A 4CFNA 4CTBA 4ANNA 4CMUA 5A6NA 1Y8GA 4N6YA 5CNOA 4BDFA 4NFMA 5EQEA 2WGJA 2UVYA 2X8DA 3PXZA 2GMXA 1E9HA 2C69A 4EHGA 1QPEA 2GFCA 2R3PA 1PMEA 4O27B 4QMVA 1YHVA 4L46A 2H34A 3WZUA 4NH1A 4W4XA 2PY3A 2X8EA 4ZY6A 5T68A 4EWQA 4PDPA 4NCTC 2UUEA 5HO7A 4PP7A 4YZNA 4PMMA 3U9CA 4BC6A 1V1KA 1ZMWA 5AM6A 5IQCA 3C4WA 2HZ4A 3MB7A 3CC6A 3CTJA 3MGYA 2VTHA 4Z55A 3QFVA 3FC2A 4RVMA 4UYAA 4X7QA 2SRCA 3A8WA 3FLSA 2BHEA 2VU3A 4QP9A 4U45A 2OIDA 5AV2A 4BDJA 5A46A 5HTCA 4WRGA 1WAKA 5IQGA 4NU1A 3MY0A 5CF4A 3LCOA 3FZTA 4IZ5A 1W8CA 4FTQA 4F0GA 3LQ3A 3KRRA 2BCJA 2PVFA 1V0BA 4X2GA 4ZK5A 3RZFA 3KMMA 3MPMA 3QBNA 4EH8A 4YSMA 3JPVA 4L43A 2XEZA 5M53A 4ONAA 3UTOA 3RKBA 3LW0A 3PP1A 3DNDA 3TACA 4FL1A 4UWYA 4E3CA 2GS2A 2GNJA 3UYTA 3RAKA 5DT3A 3Q52A 4XV3A 4GKIA 1OL5A 5DEWA 5ETAA 3DFCB 5CAQA 4BCQA 3PVGA 4FV4A 1WBVA 2CLXA 3ODYX 3Q60A 3SV0A 3DKFA 4RGJA 2VD5A 3VUMA 4KKEA 3THBA 4E4NA 3CD3A 2W17A 4U5JA 4EH9A 4NZWB 4O84A 4MAOA 3KMUA 1NVSA 4WKQA 3I1AA 4EOOA 5CU0A 2BALA 3ZXTA 2HYYA 2A27A 4HVDA 4TTHB 5F1ZA 4CVAA 3A7IA 3C4EA 1H27A 4OTGA 2IZRA 2YCRA 3QKKA 4ZTSA 3UZTA 3KU2A 1L3RE 5KE0A 4ZLZA 5AWMA 2BMCA 5M08A 5LXMA 3O0GA 3L9NA 4CYJA 3QGYA 2UZBA 2W05A 4ZS4A 2VWVA 4KIQA 3DV3A 1ZXEA 4TWOA 2HY81 2XMYA 5CX9A 3P5KA 3A7GA 4OBOA 3BV2A 3D7TB 2W9FB 3PIYA 4E4LA 4YC8A 4OTDA 2BAJA 3G9NA 4KAOA 1WZYA 4KSPA 2X1NA 1B39A 2GCDA 3QD3A 5E8UA 1KV1A 1OI9A 2X81A 2UVXA 2ZOQA 4K2RA 4YJSA 5CQUA 1BMKA 2PZ5A 4E6QA 5JFVA 3P23A 3VF8A 4O1OA 4WSYA 5FD2A 4QMQA 1A9UA 1ZOHA 2UW3A 3G5DA 4G16A 2AC5A 3UP7A 5HLPA 5CU2A 5CF8A 4JDHA 5BPYA 4D5HA 3OXIA 4U7ZA 3IW7A 2XVDA 3RCJA 1YW2A 4QMNA 3EOCA 4JG7A 5L2SA 5L2TA 4EH6A 1WBNA 3FXZA 4C38A 5CTPA 2HZ0A 4RX5A 4BCJA 4PL5A 3CIKA 2PVHA 3W2RA 4KRDA 3WF8A 3GCPA 4L8MA 3EQRA 1OKWA 2W99B 2YZLA 4RJ6A 1H1RA 3TJCA 3TNIA 3RWQA 4ENYA 4NL0A 2Z2WA 4QQ5A 3NIZA 5L8KA 2PYWA 3IGGA 4M66A 4BKYA 2I0VA 5CSPA 4M68A 4D4RA 2QC6A 3I4BA 3UYSA 5HX6A 1UU3A 5I9WA 2YABA 4H58A 3M11A 3R7EA 4HYIA 4EHEA 5CLPA 3RNIA 4FICA 5BNJA 3P1AA 3V51A 3PA3A 3KQ7A 2QODA 4AW0A 3S4QA 2ZJWA 3DXPA 3FMJA 3QYWA 3SOAA 1VYWA 4M67A 3PP0A 4LM5A 3M1SA 4IB1A 2FH9A 3KRXA 2ESMA 4A4LA 1KE9A 4F08A 5KHXA 3ID6C 4FTCA 2PUPA 4DTAA 4CV8A 5LCKA 2F7ZE 4AW2A 2W5HA 4DEHA 4BR3A 5FEEA 4M15A 3S2PA 5KKRC 2GSFA 4GT5A 2X6DA 1NA7A 4HPUE 4ANOA 4KIPA 2OF2A 4H36A 3E88A 2QO2A 3EFKA 2CGVA 3QTZA 4O0WA 3FLWA 3LFDA 4MXCA 2VTJA 2GNGA 4FE2A 3MN3A 4B8MA 3NIEA 3CQWA 4YO4A 2BDFA 4XH6A 3FBVA 5CSXA 3D5VA 4R7HA 1MQBA 3NNXA 4E1ZA 1FBNA 3UGCA 2OLCA 3A7JA 3LXNA 3H10A 1IAHA 1OIUA 3SKCA 4GYIA 4AS0A 3FLNC 4YJVA 4UALA 4BICA 3QUEA 4FT3A 3LVPA 4DLJA 4IVCA 4AW5A 3KF4A 3ZO4A 4EOPA 4L3LA 2WAJA 4IZAA 4FNZA 4FSRA 3WARA 1UWJA 3V3VA 3PY1A 2JFLA 4JS8A 4IADA 3V04A 4GK4A 4IWOA 4XP3A 2PZIA 3F82A 4GYGA 3NVMB 3O7LD 5FRIA 1O9UA 3PJ3A 2JDTA 3DJ5A 4U40A 4FIHA 3QQUA 5HD7A 4HOKA 4TNDA 4YHFA 4D55A 1ZWSA 4FOCA 5F9EA 1ZY4A 2IVVA 2XK8A 3R30A 4DINA 4RVKA 4HVHA 3RK5A 5BQ0A 3QTXA 4Y5HA 3HECA 2UW5A 4I0SA 5HE1A 5ACBC 3L9MA 3WF6A 2WHBA 3KRLA 2R0UA 3FPQA 3OY1A 3GU6A 1UKHA 5BYZA 2PVLA 4BHZA 3GB2A 5CF6A 2QI8A 4YJNA 5JFXA 1PXLA 3AXWA 3IONA 4WUAA 4JXFA 4DFZE 5AMNA 1YDTE 3ODZX 4RVTA 5L2QA 4E5BA 4R3PA 4UMUA 1PMVA 2LGCA 4M0ZA 3LFAA 4AX8A 3R1QA 1GY3A 4L00A 4EZ3A 5EYCA 4G9RA 2VTIA 3FZSA 5ANJA 3AD4A 1IEPA 3BHTA 3ZSIA 3E62A 4CG9A 2X8IA 4YHTA 2VZ6A 3FMLA 5IA2A 3F3VA 4L67A 5KX8A 2W4KA 5HG7A 5BVEA 4UV0A 3EKNA 5AUXA 3NW7A 5IMXA 2QOBA 4IAIA 4KS8A 4DYMA 2R9SA 5AP3A 5CASA 5LOHA 4K11A 1CMKE 2NRYA 1XHAA 3QZGA 1UA2A 3P78A 4LOOA 3RK9A 3NYVA 3DPKA 4L53A 2GNLA 3MTFA 4X21A 3QA0A 5DFPA 2X2LA 5FXSA 2UZTA 4BRXA 3FLQA 5CENA 3BLQA 5E1EA 2ETKA 3H9OA 5JRSA 4YC6A 5GIPE 3VS0A 3KN6A 3VO3A 4BIBA 5AP2A 4ZEGA 2I0EA 1CTPE 4I94A 1VJYA 3CCNA 4FTOA 1PXMA 2QOQA 4QTEA 2ITQA 4L68A 1PXNA 3PWYA 2WQBA 4IAYA 1KSWA 1S9IA 4M14A 3RNYA 3PVUA 4BN1A 2OKRA 3R04A 4JT3A 4EL9A 5K4JA 2X6EA 5L3AA 3QD4A 3ZDIA 1YVJA 3OG7A 4N70A 3ZCLA 1PXJA 4GFGA 3C4ZA 4IVAA 3ORTA 3ZRKA 4QMTA 4O83A 4JR3A 2R3NA 2XS0A 2QOHA 5KMLA 3D15A 4U0IA 2PMLX 1FVVA 3BWJA 3VNTA 3EKKA 3Q9WA 3ACKA 5LMKA 2CKQA 2Y4IC 2VO6A 5EI8A 3RPYA 3TEIA 2Y8OA 2C47A 4PV0A 3I79A 5FP6A 3N4UA 5EQYA 2RFDA 3E7OA 2PMOX 3ORIA 2CCHA 4PNKA 2PHKA 3O2MA 5IMEA 2QHMA 3FXWA 4P5ZA 1ZARA 1VEBA 3C0IA 3LXKA 4KKGA 2YDJA 4PL3A 4USDA 1W82A 3C7QA 3P08A 4J7BA 2B9FA 4LMNA 3FY0A 3S95A 4CT2A 3POOA 4EC9A 5M4CA 3CPBA 5L2WA 3EN6A 2KTYA 5C1QB 4WHZA 5CU6A 5FTGA 5HKMA 2EU9A 4ASDA 1WBWA 3EQHA 3W55A 3ZO3A 1YWNA 2VTTA 3KRWA 3VHKA 5IA0A 4B4LA 3BGPA 2VTOA 5AJQA 3GVUA 1TKIA 3G0FA 4OUCA 1TQIA 2QHNA 3C4FA 2VO7A 1SVGA 3CGOA 3Q4CA 4A7CA 2W1IA 4BGQA 4F1MA 3NW5A 3TIZA 4I24A 1ZYSA 4EKKA 3JUHA 4JOAA 1WCCA 5HNBA 4FGRA 4M7IA 4ZTQA 2YWPA 2I1MA 4EUUA 5JMSA 4L9IA 1Q5KA 4Q9ZA 4BCKA 3HGKA 5ANEA 3EN5A 5DMZA 3KCKA 3AC3A 3ZO2A 3F6XA 2DS1A 3A7FA 3LQ5A 2QURA 4YC3A 5CEPA 4JRNA 3CXWA 3VS3A 4ERKA 4IX4A 4MQ2A 4DEEA 4EOMA 2CNVA 3TIYA 2G9XA 2PZYA 4GFMA 2JBPA 5ANKA 1URWA 3DB8A 3DTWA 3QA8A 2XBJA 5HVKA 4TYJA 2UZLA 5IUGA 2QLUA 2W0JA 4CCBA 4ZXTA 4RC2A 2QOIA 4TZRA 5IQFA 3OT3A 4BGGA 1U5RA 4FTRA 2YACA 3TZ9A 3U8WA 3PG1A 1ZYCA 1OPKA 5HG8A 3VQUA 3UODA 4A9YA 4QMMA 1H07A 1R1WA 3SXRA 2YJRA 3BLHA 1JBPE 4C36A 1JWHA 4L44A 2ONLA 2C5NA 3A62A 2XNBA 1XH4A 4GV1A 4JDKA 4N4SA 4PNIA 4V0GB 4NW5A 3F3TA 4AFJA 4FUXA 4YNEA 2A0CX 5DGZA 4AOTA 4NJ3A 5D12A 2G2IA 3OUNB 1CKJA 2C5VA 2YDIA 4KS7A 4X3FC 3DK7A 4FBXA 5CU3A 5AUVA 1IA8A 3JY9A 3OHTA 4RIOA 4AT5A 4D0WA 5BVFA 3O96A 4ACHA 3LZBA 2CNQA 1GJOA 5DNRA 2B0QA 4RJ8A 3QLGA 5ACKA 4I6QA 3VBVA 5K5XA 2BTRA 3ZRMA 5JFWA 3MSSA 5I9YA 2WTKB 3RAHA 2CDZA 4QYHA 4XJ0A 4WNPA 5B7VA 5ITAA 1P4FA 4O1PA 4IDVA 1OL7A 1R3CA 2F4JA 3CQEA 1URCA 3R63A 4FKWA 1HCKA 4AGUA 3PVWA 2QR7A 4C0TA 2YCFA 4JQ7A 4NIFB 4RIYA 3RJCA 2ZDTA 3VRYA 1OM1A 2FSMX 3PSCA 1OIRA 2XKEA 3FUPA 4A07A 1KE5A 3QTQA 4ALUA 2OJ9A 4F9YA 3ZFXA 4EH2A 3K2LA 4EJ7A 5IKWA 3EFLA 3W16A 2XCHA 2I6LA 1PMNA 3OXTA 4FL2A 4FTLA 3TNWA 3PA5A 3WE4A 2V7OA 3BCEA 1DS5A 3IDBA 4LYNA 2JIIA 3UO5A 4IW0A 2PVRA 4FTIA 3OMVA 4IHPA 5CVHA 4H1JA 3F66A 1JKLA 2CMWA 2W1ZA 3HYHA 2J51A 2WTJA 3C5UA 4O0UA 4PMPA 3NUXA 3HKOA 4AZFA 3R9DA 1Q3DA 2WIHA 5GJFA 3KF7A 3OW3A 4K8AA 5E8TA 5AV3A 2GHLA 5JQ8A 5AAGA 3LJ2A 4C8BA 4RFYA 5JK3A 2IPXA 3RZBA 5AX9A 5K0XA 3IGOA 3QAME 4Y8DA 3F2NA 5F94A 4IX6A 1NXKA 5FWKK 1U54B 4Q2AA 4V01A 2G2HA 4ZTMA 3FJQE 4HCTA 4FSTA 3AMBA 5TR6A 2YM7A 4NJDA 4H1MA 4BKJA 4O7VA 1ZMVA 5KO1A 4EJNA 2FA2A 3ZBFA 5J7HA 4DFNA 5ANIA 4RQKA 4DAWA 3JVRA 4C3RA 1PXIA 3QKLA 4ZS0A 2VTAA 2YIXA 3GU4A 4Z7HA 3OT8A 4RT7A 5CEOA 2VRXA 3W8LA 4Y73A 2OXDA 4LL5A 1RJBA 3BGQA 2PK9A 2VTPA 3CQUA 4F6SA 3B8RA 4CFMA 4G3GA 2OWBA 4BZDA 5FUTA 1MQ4A 5K3YA 5J1VA 3D7ZA 5EQPA 4FZAB 4EKLA 1YXXA 4FV9A 4ANBA 3OWKA 4GIIA 2Y9QA 2XM9A 3A61A 2OFVA 3NLBA 4QP3A 5DHJA 4O81A 4EK5A 3O50A 3WZKA 4J1RA 5HEZA 3B8QA 4N6ZA 4BI0A 2FB8A 2ZM4A 4HGSA 3PPZA 5LVOA 4GEOA 1PXOA 4IIRA 4YURA 4G9CA 5CY3A 1TQMA 2XNNA 2C6KA 3PVBA 3PE1A 3OOMA 4Q5HA 2IW8A 2IZTA 2UZUE 5CSVA 5B2LA 3LM0A 4MTAA 3UPZA 4RLKA 3TKIA 3IKAA 4QP4A 5M44A 4WSQA 1OL1A 5GNKA 2C6MA 3ZMMA 4G3FA 2P3GX 4RZWA 5TF9A 4WOVA 3AC2A 3PZEA 2JKQA 3DAKA 1KE6A 1Q24A 4FG7A 3MWUA 4PTCA 4F70A 3G6GA 2HZIA 2ITVA 3ZFMA 5JEBA 5EYMA 5AUTA 4HW7A 4L3PA 5HVYA 1SYKA 3EFJA 5CT0A 4C62A 1M7NA 3I5ZA 4CZUA 4DFLA 5AA9A 1OBGA 5FEQA 3UC3A 5AUWA 4HGEA 5HNGA 4NYEA 4FIIA 4WNOA 4FKSA 3PXFA 3RAIA 3DK6A 4MF1A 3N4VA 2OJFE 2OJIA 5B0XA 1H1WA 5B2MA 2GQSA 4DCAA 1PJKA 3REPA 2ZV7A 1YXSA 3AG9A 3KL8A 5TKDA 4N57A 2RG6A 4JVGA 1REJA 3UBDA 2GS6A 3RWPA 5L8LA 4RIXB 5BMMA 5KMMA 4RWLA 2R3LA 3VUGA 2DYLA 1GZKA 4NWMA 2C30A 5CVGA 1FMKA 4YJUA 3EYHA 1SM2A 2XJ2A 4YBKA 5G6VA 2ERZE 5CT7A 1XH9A 1XO2B 3KB7A 4XEYA 2WFYA 4C37A 3IDPA 3NAXA 5BVOA 4GKHA 3OCBA 4S2ZA 3DKOA 3QTWA 4DE4A 4CNHA 4B0GA 3U87A 4FTKA 3FZPA 3NX8A 5LWMA 4QP2A 5BX0A 3S00A 4APPA 2WQMA 4AGCA 3UZPA 2RFNA 2PE0A 5BMSA 2CCIA 2J2IB 3O71A 4NM0A 3Q4TA 2F7EE 3BGZA 4KKHA 2OXYA 1RQQA 2XIYA 2UW8A 2W06A 3SD0A 4IBMA 3MIYA 3L8PA 3ULIA 4FVQA 4W4VA 1K9AA 2BVAA 4X2FA 2XM8A 4OT5A 3DT1A 1M14A 3D4QA 2B9IA 4O0RA 4AP7A 2RL5A 4AUAA 3BU3A 3E64A 4DGLC 3QHRA 3TXOA 2ZM3A 4AOJA 1Q99A 2WMRA 5GIOE 4FSMA 5IDPA 4RWJA 3COIA 4U97A 4E5WA 2R3KA 4BWKA 4Z7GA 4BDCA 3QHWA 3LCKA 4FGBA 3MTLA 5EG3A 1OPLA 5DVRA 3ROCA 4UMRA 5EOBA 1M2RA 4X3JA 3O8UA 2XNEA 4MBIA 4ZTNA 1OPJA 2R3JA 3LLAA 2OZAB 4KA3A 5JH6A 4RG0A 4YTCA 4U3YA 4NW6A 3JS2A 3GCVA 4I41A 4KINA 4DT8A 1P14A 1GIIA 2XK7A 3ZZEA 2PSQA 3FI3A 3PXQA 4LOQA 3V5WA 3NZ0A 4DN5A 2ITOA 4EH7A 4NKAA 4EOQA 5HIBA 3QZHA 4D1SA 5IQAA 3I5NA 4F7LA 4D2RA 3MJ1A 5LMAA 4AE9A 2OSCA 3I6WA 3MH2A 4XG2A 5DA3A 2J4ZA 3F5GA 4GT4A 1DI8A 3TI1A 1JVPP 3R00A 3VHEA 4K6ZA 1H26A 1UNHA 4MWHA 4HZRA 2VN9A 5CEKA 4FTMA 4DA5A 3CLYA 3NNWA 1KOBA 5FTQA 3PJ2A 2CJMA 2QONA 3OS3A 2WMXA 1KOAA 3UNKA 3FQSA 3TV6A 3AC5A 4GVAA 1E1XA 1ZAOA 2RSVA 4YZ9A 4C2VA 4CQGA 4RIWA 1BLXA 3U54A 4F7JA 4OGRA 4J71A 4NEUA 4WBBB 1WFCA 4ZZMA 2C6DA 3DBQA 3R7UA 3W2SA 3F3ZA 5C8KA 3EH9A 4MVFA 3SRVB 4FEWA 5M55A 3Q53A 5GJGA 3LXPA 3PZHA 3RCDA 3EZRA 1V0OA 3I0OA 5AP6A 4HZSA 3IW8A 2WNTA 2GTMA 5AR2A 2X7FA 5HX8A 2UW9A 3D83A 2FSLX 2CHLA 3O8PA 3AD6A 5IA4A 2YAKA 4HGTA 4GT3A 4X2NA 3GEQA 4FV1A 3BELA 4YZDA 4G6OA 3GI3A 2VGPA 3E92A 4FI1A 3PIZA 3F5PA 4IDTA 4OTHA 3RHXA 5CAUA 2X9EA 3TNPC 4QMPA 3VUDA 3V5JA 2O65A 1LEZA 2C6OA 1OUYA 3R21A 3SQQA 2VX3A 4J53A 1G5SA 1H1PA 5EI6A 4BI2A 4Y95A 3F9NA 5E8ZA 3D2KA 1F3MC 3JYAA 5DYJA 4U9AA 4YJQA 2YM3A 4OBQA 2WMWA 4O22A 3H30A 3SW7A 4KNBA 2HWOA 4LV5A 3OXZA 3R01A 2WMQA 3WE8A 3IO7A 1J1CA 2VNWA 2C6EA 4H3QA 4F0IA 5C03A 3QTRA 1JLUE 5I5ZA 4CFXA 4FX3A 3NPCA 2OJGA 3FYKX 4RMZA 3F7WA 1ZYDA 1GNGA 5BVKA 2ETRA 5F20A 2PULA 4EORA 2ZB1A 4C57A 3SA0A 3RP9A 4FEUA 2XP2A 5CAVA 5M4UA 3HRFA 5AP7A 1YOLA 2J6MA 2VWZA 5JT2A 4PDOA 2QVSE 3T9TA 2I0HA 2GDOA 2OIBA 5AUYA 3RI1A 3HRBA 4G6LA 3TNQB 2WELA 5JKGA 5KKRB 4FV0A 4K18A 3PRFA 1ZZ2A 5L6PA 4G3DA 3PSDA 4DH7A 3DXQA 5C9CA 2IVTA 3QZFA 4MCVA 3I6UA 5IUHA 3SG9A 4I23A 4FTNA 5CEIA 5CSHA 5M09A 2RIOA 5HO8A 4JAIA 3UZRA 3RGFA 3PLSA 4R1YA 2UZEA 4Y85A 4CFWA 5EK7A 2Z7RA 4F7SA 5J87A 3D2IA 4ZSGA 1Z57A 3MFRA 1ZZLA 5AEPA 4CZYB 1IASA 3BBTB 3VF9A 2C1AA 2WEIA 2VWXA 5D11A 5FBOA 4ALVA 2HW7A 3QRKA 4GMYA 2PE2A 4IX3A 2WZJA 2XRWA 5EW3A 3TT0A 3VC4A 5IH4A 3QX4A 2UVZA 2R7BA 4U42A 4USEA 5D41A 2W1HA 5CSWA 3PWDA 2R7IA 2RKUA 4JDJA 4MEDA 3VIDA 4D2WA 2XNMA 2OO8X 4OR5A 3FSFA 3EZVA 4HGLA 4NTSA 3DCVA 2J5FA 4AOIA 4BIEA 1XR1A 3PE2A 4Y72A 5DT4A 3DAEA 3IK3A 3LCSA 3H9FA 2P0CA 4IC7A 4QOXA 4V0GA 5DG5A 2V62A 2QOOA 1JKSA 3R73A 3ELJA 4FVPA 4RX7A 1ZOGA 4FKIA 3HEGA 3TKUA 4O7WA 3UOJA 2QU5A 4BDAA 5DPVA 1YWVA 4CXAA 1PXPA 3R2BA 3RM6A 4Z16A 2Z02A 4YLLA 3RPSA 5E8SA 1XH6A 5ANDA 3GFEA 4DFXE 4FIJA 4QQJA 4G2FA 2C1BA 2XF0A 2JFMA 4IEBA 4NTTA 4Q9SA 4RX8A 4B9DA 2YWVA 1CKPA 2PVYA 1GOLA 3FHIA 1IR3A 2ZVAA 3TJDA 3ZSHA 2X0GA 2ZM1A 4QMYA 3KULB 4WT6A 4O7LA 3ALOA 2WMTA 2BZHB 3LFCA 1XBAA 5AR5A 5FXQA 4EK4A 3HNGA 4TKSA 3ANQA 4D58A 3VULA 3TTIA 3BE9A 2BIYA 5K4IA 3Q4ZA 4G5JA 2OF4A 4U8ZA 3O7LB 5EFQA 4C34A 3QC9A 3F3UA 2W1DA 3MVLA 4FKUA 2J0IA 1OL2A 3FZRA 3L8VA 1O6YA 1OKVA 3LFFA 2FO0A 5J9YA 4DBXA 2C68A 2G1TA 3NW6A 2R3MA 2R0IA 4HYSA 4XOYA 5E90A 4D2SA 4DLIA 4ZJIA 2RFEA 3PJ8A 2G2FA 2J5EA 2X7OA 3RVGA 4R7BA 2GU8A 3NR9A 3ORXA 2YERA 5CYIA 2FSTX 3HMPA 3E8EA 3Q3BA 3ZTXA 4CFFA 3G90X 2YA9A 2WPAA 3R9RA 2YAAA 4AZEA 1IA9A 2OW3A 5CWZA 4O7NA 3QQKA 3U6IA 3OBJA 3QD2B 3EIDA 1YKRA 4LRKA 3HV4A 3OUKA 4ID7A 4DFBA 4PTEA 4QRCA 4C3PA 3FDNA 4ZY4A 4DH3A 3NAYA 2JKOA 4JIAA 1YDSE 3DBFA 4GU6A 4E6AA 3U6JA 2P33A 2C5YA 4I0RA 5TO8A 3MH0A 5CZIA 3EMGA 1O6LA 2JBOA 3UQGA 4XG7A 3HUCA 4FT5A 5AAFA 3UVPA 4CD0A 2YEXA 5CANA 3Q2JA 4PDYA 4ITJA 3U55A 5C4KA 4ZSAA 4QTAA 3ZZWA 4HYHA 5HGIA 4X2KA 3ZUUA 2UW4A 4JRVA 2BRHA 2BDWA 3OP5A 2Y4IB 4RBLA 4DEDA 4P5QA 4FNYA 4GCJA 5D1JA 4I4EA 4YNOA 4YJTA 2B1PA 1YHWA 1UV5A 1GIJA 3MPTA 4JQEA 2HY0A 4XRJA 3D5UA 4DH8A 3ATTA 5KMNA 5J8IA 3T3VA 4KBKA 2QCSA 4FC0A 2B55A 2GQGA 2QO9A 3II5A 3ZXZA 3IOKA 2GTNA 4MBLA 1FMOE 3GFWA 3JXWA 4BIDA 3MS9A 2W1FA 4FEQA 2BHHA 4PPAA 4C02A 4DEIA 3KGAA 3E87A 4DGMA 3RTPA 2J0MB 4YP8A 4XP2A 4TWNA 2ZMDA 3R7IA 5ETCA 4BTMA 4YO6A 4FTAA 3ZONA 1FQ1B 4PPBA 4IVDA 1B6CB 3QXPA 2JDOA 4L45A 2Z7LA 1UU8A 3DU8A 3PRIA 3Q6UA 2B9JA 2IN6A 3LM5A 3Q04A 4D1XA 5E1SA 1R0EA 2DUVA 4R7IA 5AADA 1UNGA 2CGUA 2HW6A 3A60A 5CI6A 4C4JA 2YM6A 5AFVA 3ZC6A 4WG5A 4M69B 4AN9A 3E8DA 4TW9A 3KY2A 3R8LA 3W10A 2X4FA 3OEFX 3BWFA 3SXFA 3P0MA 5HI2A 4YMJA 4YU2A 4IACA 3TZMA 4QYFA 2C6TA 3KVWA 4TN6A 3NUUA 3GC9A 2W96B 5F4NA 4YZCA 2XKFA 4W9XA 2O64A 2X39A 2XZSA 3HP2A 5AIRA 4YPDA 5ANGA 3V8WA 5EM8A 5HU3A 1NY3A 5IQHA 2WTIA 4Y46A 5E9EA 2WTWA 3BKBA 2R64A 2CKOA 4F9CA 3BYVA 4GH2A 1P2AA 5HCZA 2A1AB 5AP1A 4RZVA 2RGPA 3UO4A 3C9WA 1SMHA 1W7HA 3P4KA 2UW6A 5DEYA 3WZEA 4EQUA 4RSSA 2XNGA 4L6QA 3R1SA 2GNFA 4KUJA 5LJJA 3QKMA 5D7AA 3KXGA 4IB5A 3ZHPC 4EHZA 5J7BA 3OWPA 4WNKA 4RIXA 4QTBA 3FHRA 2R3FA 2VNYA 1WVWA 2H9VA 2XCKA 4LGGA 5E8VA 3ZM4A 2W4OA 5HD4A 4X3FB 5IH6A 2XEYA 2ZAZA 5FLFA 4QT1A 3F5UA 4FZ6A 3FEGA 3TDWA 1MRVA 4O7RA 2CN5A 4NCTA 1GZOA 3WF7A 3OW4A 4O0VA 2UW0A 3S0OA 3O8TA 3TG1A 4O0SA 3OOGA 4DTKA 3HX4A 4F63A 4EQMA 5HLNA 1W84A 1GIHA 2FSOX 4IFGA 5LVLA 3RPVA 2JKMA 4FV3A 4O7ZA 3VJOA 3COHA 3MFTA 4MYGA 5LVNA 5DH3A 3HAMA 4CEGA 2OFUA 5FBNC 4F6UA 4FKOA 4JNWA 4U81A 3WZDA 4FSYA 4FV2A 3PG3A 4AN3A 4QYEA 4ORKA 3WIKA 3U4UA 5KHWA 3CKWA 1FOTA 3MH1A 5J5SA 3PUPA 3H0ZA 4KD1A 3QX2A 1Y8YA 2XUUA 3C4CA 5M06A 3BYMA 1H24A 3DTCA 1ZYLA 4DF3A 2UZVA 2XBAA 3RPOA 2GNHA 5ICPA 5KCVA 1YXUA 5HESA 1XH7A 4QYGA 4O82A 4RJ3A 1DM2A 4FG8A 4FIEA 3IG7A 4JX3A 2XK3A 1G3NA 1ZMUA 4ZY5A 3FV8A 4MXXA 3BBWA 4ZLOA 1WBOA 2OZAA 3I7BA 1Q8YA 2UZNA 4Y83A 1REKA 3P9JA 4LGHA 3TN8A 1BUHA 2E2BA 4CGAA 3BYOA 3PY0A 5M51A 4ARKA 2GS7A 5EW9A 2BAQA 2PL0A 3ZS5A 4I93A 3GXLA 5CEQA 4IH8A 4YTIA 2JDRA 5H9BA 4HCVA 3MI9A 3G0EA 1STCE 4LFIA 5KMKA 4KIOA 3HV6A 2CLQA 4FZFB 5JGDA 2AC3A 2OBJA 5T6KA 5FGKA 1JAMA 3ORMA 3JVSA 4JLCA 5EM7A 4FEXA 3KXMA 2NNWB 3AT3A 2C5XA 3LE6A 3SVVA 5HVJA 3KXHA 2ZYBA 3EQGA 3V5PA 1IAJA 4IWPA 4F4PA 3BIZA 3DXNA 3LQ8A 3LCTA 4M97A 4PY1A 1RE8A 4Y5QA 5HORA 2BZJA 1KE8A 3ENMA 5I9XA 3SGCA 2WO6A 4W8DA 3SRVA 5FXRA 4AGDA 2W5BA 5IQEA 5L6OA 4I5PA 3C1XA 2X2MA 4I6BA 4BTJA 1AGWA 2R3GA 3OZ6A 3UOKA 2NPQA 2PWLA 3UIMA 3ZYAA 4ZZNA 3CEKA 1TVOA 1OKZA 3WZJA 4MK0A 4EK8A 3DZOA 1JNKA 5FTOA 2O3PA 4EK3A 3RALA 5IISA 2XNPA 4KIKB 1OGUA 2Z60A 2Z7SA 3GP0A 3PA4A 4R3CA 1OMWA 5K0KA 3VW6A 5TT7A 4RVLA 5DBXA 4UN0C 5A6OA 4O21A 2WQNA 4ASZA 2OI4X 3QTIA 3LKMA 5BYLA 3LCDA 4KBAA 1YI4A 4LMUA 2XYUA 4UXLA 4AZTA 1UU7A 2QLQA 5L4QA 2X9FA 5L6WL 4FT9A 4QQCA 3V01A 1YXTA 4YPSA 3ZLWA 2YZAA 4IVBA 3CBLA 2WU7A 4XV9A 3T8OA 4FKVA 4UXQA 4PUZA 3FI2A 3W2CA 1OBDA 3TZ7A 1PHKA 4OTWA 2B9HA 2FYSA 2ITWA 4S31A 3W33A 3TKHA 3A4OX 1I44A 1YXVA 4X6RA 1MP8A 2QOLA 2HK5A 3CY3A 3NYXA 3PPKA 3QTUA 4GK2A 3MY1A 5HBEA 2Z7QA 5GZ8A 2W4JA 3MYGA 4PWNA 4KSQA 3L8XA 1O6KA 4WD5A 3C5IA 3QGWA 4B6LA 4XCUA 3VJNA 4ZJVA 2FVDA 5TOZA 4OAUC 3KK9A 4S34A 1GAGA 5CALA 3QCSA 4BDDA 3DDQA 4QNAA 4LG4A 4DFUA 3VUTA 3GENA 1BL6A 1JPAA 3UOLA 1Q8UA 2ZDUA 1H1QA 3WBLA 4BDGA 4J8NA 5HTBA 4MWIA 2H8HA 2ZMCA 4GVJA 4MBJA 4QP6A 2BZKB 4OAVB 4WG3A 4JG8A 4C4EA 1J7IA 4L42A 2BUJA 5DOSA 4QP7A 4MD7E 4OW8A 4CQEA 3FL4A 3GUBA 3MVJA 5J9ZA 4JG6A 2OICA 2FGIA 3PIXA 1U59A 2C6LA 3V5TA 3CP9A 3ORLA 4C4GA 2BAKA 2YN8A 4E6DA 2A19B 2Y4PA 3GC7A 1H0VA 4XHKB 5J79A 2E9PA 2EB3A 3QL8A 1YWRA 5DWRA 4BFMA 3L8SA 4ZSEA 1H1SA 2YLEA 4EHVA 5K9IA 3BEAA 3UQFA 2XK9A 4ASXA 1AQ1A 4CV9A 3UIBA 5A9UA 5GJDA 1Q97A 1W98A 3H0YA 4E4XA 4BCHA 2R3RA 5I3RA 2YDKA 5KBQA 3IW5A 4RC3A 4GUEA 5HIEA 3PDTA 4DGNA 2OH4A 1JKTA 3D7TA 1WVXA 3DK3A 4EOLA 3FZOA 4M3QA 4TRLA 3RINA 3FLYA 2I7QA 2HXLA 3H3CA 3NRMA 4ANMA 4KWPA 4ANQA 3COMA 4FV5A 5EYKA 5C27A 2J0LA 4BDKA 3QQJA 3MA6A 5HU9A 3UDBA 1XBBA 3G2FA 3OVVA 4IZYA 3FSKA 2WMVA 5ETFA 4CRLA 2V55A 4QMWA 3GNIB 4Q5EA 1ZRZA 3WOWA 3SAYA 4PTGA 1UU9A 5E7RA 3ZRLA 4DH1A 4D4VA 2VUWA 4H3BA 4ACGA 3LJ0A 1I09A 2QR8A 4AWIA 3VBQA 4C7TA 3D14A 3NS9A 5BVDA 1Z9XA 2BIKB 2VO0A 3OWJA 3RPRA 5LMBA 5JZNA 1APME 2WKMA 3DZQA 3OCSA 3BQCA 2YLFA 1OL6A 4FKLA 5A4EA 3UC4A 3B2TA 3M2WA 1GZNA 1K3AA 3RMFA 1BKXA 3QQGA 2B53A 4BWPA 4O7SA 4JR7A 3KKVA 3JY0A 3DKGA 4J96A 4QMZA 4BCMA 2R5TA 2WMBA 4G6NA 4UZHA 3R1YA 4A06A 3KULA 5LCJA 1SVHA 4O96A 5A4TA 2GNIA 4I5HA 2OG8A 2CGWA 2XB7A 4RFMA 3KXNA 5LVMA 3OTUA 4IM2A 1CM8A 4MXYA 4F6WA 1CKIA 2IZUA 2X7GA 3W2QA 3R83A 3KK8A 3GCSA 4FSWA 4RWIA 1CSNA 3HLLA 5EKNA 4YJPA 5HG5A 2KULA 2PTKA 5DR2A 5CEMA 4BCGA 1FGIA 1J91A 4USFA 3R8UA 3ZM9A 3QCQA 3K3JA 4F9WA 3K5VA 2BILB 5C4LA 4ZAUA 4J98A 1XBCA 3C0HA 4L7SA 3WILA 1Q3WA 2FUMA 4QQTA 4PRJA 4FZ7A 4OBPA 1OIQA 2QOCA 4MH7A 4TYIA 5IZFA 4S30A 1F0QA 4D1ZA 5HE2A 2O8YA 1WBPA 2GFSA 3NUSA 4KB8A 4JBQA 4MNFA 4FYNA 4C3FA 2XJ0A 3IECA 4R77A 3GC0A 4TWCA 3K5UA 3DB6A 1U4DA 2XNOA 3I60A 3MA3A 3GQIA 3DLZA 4O7TA 4C35A 5EHOA 4C4HA 5A4CA 1PYEA 3RM7A 4FOBA 3S1HA 3FMEA 1J7UA 3HVCA 4BZOA 4YZMA 1MRYA 2VX1A 3FMHA 4E26A 2YISA 1IG1A 3F69A 5FEDA 2YFXA 1H8FA 4UYNA 1Z5MA 1ZOEA 2EB2A 5C01A 5CVFA 4A9UA 4F64A 2JD5A 3CE3A 5DRBA 3HAVA 4ZMFA 3BE2A 3EN7A 2QD9A 2ZV2A 5JGAA 2Y0AA 4XBRA 4GSBA 2CSNA 4R3RA 4AA5A 3BV3A 4AW1A 3H4JA 3FKOA 4OTRA 4I0TA 5KZIA 1L8TA 5D9HA 5JGBA 4FV7A 4NSTA 2QNJA 2P4IA 2JGZA 4TL0A 3TWJA 4E4MA 4GL9A 1XH5A 4UMQA 3KRJA 5EDPA 4FUYA 3HMOA 4R78A 2C0OA 2I0YA 2YM5A 3CKXA 5ETIA 3U9NA 1MRUA 3EHAA 4F09A 1E1VA 2OXXA 4CKJA 3EL8A 2EXEA 3R8VA 3SXSA 2WOTA 4IAFA 2ITNA 3NNUA 3MPAA 4FYOA 4ZIMA 1JSUA 4O0YA 3R7YA 1WBSA 5AAEA 4DITA 2GHMA 3LMIA 4GG7A 2ITPA 4BTFA 3FPMA 1XKKA 3RHKA 4C59A 2UZWE 4YR8A 4K9YA 5HZNA 5JRQA 3TUCA 3FI8A 2F7XE 3C13A 4ZLYA 3UO6A 3UVQA 3HV7A 2E9OA 4TYEA 5EDRA 1LR4A 3ET7A 3BHHA 1J1BA 2ACXA 2F9GA 2IVUA 2Y7JA 3A4PA 1BI7A 5E8YA 5EM6A 3LOKA 3GU7A 3LFEA 2WQOA 1K2PA 4FTTA 4IAKA 1QMZA 3BLRA 3FE3A 4AT3A 3NWWA 4MD9E 4PMTA 3DA6A 3KCFA 5IEXA 3UMWA 4EOIA 4RWKA 4QYYA 2OZOA 3QWJA 2WTCA 4UWCA 3UNZA 1FGKA 1UKIA 3SLSA 4EOSA 2C6IA 4R5YA 3ZUTA 2E9UA 2PVJA 4XG8A 3NYNA 4D4YA 4WA9A 4YHJA 4HVGA 3DBDA 2OU7A 5JN2A 4P7EA 3R1NA 4PF4A 2F49A 5C8NA 5KNJA 4DG3E 3HA8A 5H8BA 4ZMEA 3OEZA 2E9VA 4IM0A 4QP1A 5KMJA 1YI3A 3UG1A 2ZV8A 4UWBA 1Y57A 3CR0A 4J52A 5A3XA 2B7AA 4BGHA 5JZJA 5A4QA 3OY3A 4YLKA 3QQLA 4ITIA 3NNVA 4H3PA 4HPTE 1YRPA 3LIJA 4IB0A 5I3OA 2YJSA 4LUDA 4XV2A 1SNUA 4K77A 4QD6A 1SVEA 4AXAA 2WEVA 4XG3A 3Q9ZA 4RC4A 5CF5A 5LQFA 1DAYA 4HVSA 5C8MA 5CI7A 4ZTHA 4EI4A 3R8PA 3SDJA 3AD5A 5CXHA 1OUKA 3QRJA 3VW8A 1A06A 4XLIA 5IDNA 1FPUA 4XRLA 2JDSA 2WD1A 3ZH8A 4NM5A 5AV0A 3VN9A 4MQ1A 3R8MA 4PPCA 1Q61A 4NFNA 5IQIA 4U79A 4P2KA 5LMKC 4L52A 3V6RA 2C3KA 2WMAA 3R28A 4XS2A 3D94A 4ANLA 3ETAA 4RIYB 3HA6A 2E9NA 4FV8A 4L3JA 4FIGA 4RA4A 2B54A 2G01A 3BI6A 3DNEA 3OD6X 5AR3A 4D2VA 3TUDA 5DN3A 2F57A 4QTCA 5HG9A 2C4GA 5K5NA 3MIAA 2J7TA 4II5A 4L7FA 3VWAA 4FL3A 4EK6A 4QPSA 2YCSA 2ETMA 3O51A 3MW1A 3EL7A 4XV1A 2O5KA 4JBPA 3E3BX 1ATPE 4RJ7A 5BUEA 3PPJA 4OTFA 5HIDA 2YIWA 2VWWA 2YM4A 3FKLA 3EQCA 2XH5A 5HQ0A 2ITYA 1J7LA 3MY5A 3QCXA 3EQPA 4QMOA 4NT4A 4J97A 5H8EA 3ZEPA 2BPMA 2Y6MA 3DGKA 4ACCA 2DQ7X 4YJRA 4ANSA 3G15A 1M2QA 3IW6A 3QRTA 2X4ZA 3N9XA 4TT7A 4TXCA 4RX9A 2W9ZB 2PUIA 4U43A 2HZNA 4TYGA 4LL0A 3S3IA 2YIRA 3BPRA 3ATSA 3SG8A 2VO3A 5E92A 2QO7A 2JKKA 2ITUA 4IWDA 3HL7A 1H25A 2QG7A 4B8LA 1SZMA 2V5QA 4BWXA 3MFSA 4FEVA 3FWQA 3LMGA 3VUIA 4FSNA 3VRZA 4O6LA 2VTNA 4B99A 1H28A 5J1WA 4FKTA 3EFWA 4BY9E 2CKEA 1JSTA 5GHVA 3C0GA 3QALE 5AP4A 4D9TA 4KIKA 4YTFA 4J95A 4O6EA 5J5TA 2HELA 2PE1A 4AFEA 4YGAA 1OIYA 3KA0A 3R9NA 2I40A 3V5QA 2C0TA 3CTQA 4IE9A 3AMAA 3WF9A 4C61A 2BRMA 2EXMA 5DI1A 1W0XC 2JEDA 2ONLC 2BFYA 3HDMA 3C51A 3E3PA 1IRKA 2Z8CA 1H4LA 3PJCA 2VTLA 3BX5A 1H08A 1QPCA 4NKSA 3CJGA 3NDMA 3PXYA 1HOWA 2C3IB 1OECA 4NIFA 4BCIA 4UMTA 5BVWA 3ZFYA 4D2TA 5DR9A 3WI6A 4NK9A 3UP2A 4E93A 3QLFA 5GZ9A 4XG6A 2V7AA 1T46A 5DE2A 3U6HA 5E91A 4O7YA 4YTHA 3P86A 4XUFA 3FKNA 4XG9A 3F7ZA 1KUTA 3AT2A 4AU8A 2W1EA 1JOWB 4BDIA 4Z3VA 3FY2A 4AZVA 3WYXA 1RDQE 2WMUA 3ANRA 4MF0A 3VS5A 4WO5A 5LWNA 3WF5A 3UOHA 3OWLA 5M07A 2QG5A 2EUFB 2VWYA 4IQ6A 1VR2A 3NUAA 4IZ7A 5DLSA 4FKQA 5AX3A 3E8CA 1BX6A 3BHVA 4ZOGA 5A14A 5C26A 2JDVA 3BRBA 3D5XA 3FYJX 3R22A 3FXXA 4U3ZA 3RAWA 2JITA 1M17A 2PZPA 1DAWA 4GW8A 3QD0A 5HHWA 3AOXA 3KREA 5HBJA 1PW2A 2IW6A 3AT4A 2HENA 2OK1A 3IW4A 5JFSA 1YI6A 2Q0BA 2YM8A 2W1CA 5FQDC 4BCFA 3PSBA 1U54A 4RQVA 3G51A 4RJ4A 5AP0A 5H2UA 5JSMA 3W18A 3T9IA 1Y6AA 3A8XA 3R9OA 1BYGA 5FDPA 2W7XA 2X2KA 3QCYA 3BHYA 4FSQA 3LMHA 4AAAA 2EWAA 3DY7A 4CCUA 3FAAA 3FMNA 3NVKI 4NM7A 4YJOA 2H96A 4E73A 5AA8A 3R6XA 4BDEA 4F9AA 2REIA 4XYFA 2OIQA 1M2PA 4AF3A 5IA1A 3ZUVA 2ZB0A 4M84A 3QU0A 4MXOA 3CY2A 2NRUA 2W5AA 3DOGA 5I9VA 4W9WA 4FTJA 1BI8A 3AMYA 3Q6WA 3DQWA 4HCUA 3ZLXA 2RF9A 3NUPA 4YSJA 4QO9A 1OITA 4GJ2A 3V5LA 2R3QA 4DBNA 4S32A 4XBUA 3FLZA 4FK3A 4F99A 2CN8A 3O23A 4BZNA 4WG4A 2EVAA 2PUNA 3O17A 3CGFA 3ALNA 5AIKA 2BRNA 3IQ7A 3V8TA 5A4LA 2IJMA 1XJDA 3F88A 3QZIA 4DEGA 5HBHA 2ITXA 3EQFA 3WYYA 3UJGA 5KBRA 4GS6A 2RFSA 2EXCX 5AR7A 5G1XA 4LUEA 2YCQA 2NO3A 5EH0A 3PLAE 4BCPA 4M13A 4NUSA 3QQHA 4FT0A 4FNXA 2G15A 4FZDB 3NEWA 3L1SA 1FVTA 4FT7A 4CMOA 4A4XA 1A48A 4DG2E 1YOJA 4I5CA 2XIZA 4ENXA 4FK6A 4C33A 2Q0NA 4FIFA 4G17A 4CMTA 3EQDA 5GINE 4B7TA 3COKA 4CKRA 4G5PA 4TYHB 3C50A 1PF8A 3Q4UA 3T3UA 4G3EA 4LRJA 3E7VA 4PL4A 5E8XA 5E8WA 1FVRA 2WQEA 3AGLA 3W8QA 3QC4A 4IM3A 5M4FA 1Q8ZA 1JKKA 4U44A 4C4FA 2VTQA 4XMOA 3UE4A 2A2AA 1WBTA 2QQ7A 1Q62A 3L9LA 3MFUA 3MH3A 4DGOA 4P90A 4E5AX 2VTRA 2HWPA 3GC8A 4FSUA 4FTUA 4BTKA 3OTVA 3R71A 5KZ0A 3DQXA 3GQLA 3UIXA 1PKGA 4W4YA 5J9LA 1YDRE 2IO6A 4JBOA 3ZC5A 2DWBA 2OH0E 4IWQA 3LHJA 4ASEA 3TUBA 4AN2A 4C2WA 5IEYA 2QU6A 4PX6A 3PXRA 5AUUA 1WMKA 2O2UA 3BHUA 4IB3A 4MNEB 4MXZA 2XKCA 3ORKA 1H00A 2J90A 4RIWB 3UMXA 3OF0A 2QKRA 3EQIA 2UZDA 2VGOA 3M42A 1TQPA 4FG9A 5HE3A 3VVHA 1DI9A 4BDHA 3W32A 4EOJA 4CG8A 3A2CA 4M0YA 4X0MA 2VAGA 3ZEWA 4R5SA 4YZBA 4F7NA 3SOCA 5EDQA 3TNHA 1OVEA 4FVRA 1HCLA 4UMPA 4FKRA 2QOKA 5IUIA 4RFZA 1PYXA 1KV2A 4GU9A 3ROYA 5FP5A 4ZTLA 1M52A 5DT0A 1YOMA 4JQ8A 3OROA 3D0EA 3Q32A 4L01A 5AR4A 4F9BA 1QL6A 4MKCA 3LJ1A 4JAJA 4R1VA 4DG0E 1F5QA 4BF2A 4RRVA 2Q83A 4JI9A 1NVQA 1EH4A 3EJ1A 1M7QA 2PMNX 4EH4A 4O2ZA 3TDVA 4BVUA 1RW8A 3DBCA 3KN5A 4BL1A 4H05A 3VS2A 4A9TA 3SHEA 1UWHA 1V0PA 4EEVA 5T3QA 4RJ5A 5B2KA 4EBWA 3QTSA 3OCTA 3BQRA 3F5XA 4HNFA 1QPDA 5FDXA 1Q8TA 1LPUA 4EBVA 3SW4A 3UQCA 1S9JA 2R4BA 4ZSJA 3Q9XA 3G9LX 4JBVA 2IZSA 3LFQA 4BDBA 2VWBA 2HCKA 3QQFA 4PP9A 5EI2A 5DR6A 5M56A 5L2IA 3QWKA 1G8SA 2J50A 2YITA 4JX7A 4OTQA 3KEXA 4CKIA 4ITHA 4UY9A 5EM5A 4F65A 4G34A 3EQBA 2O63A 1XWSA 3PJ1A 1BL7A 3GGFA 1ZY5A 2CPKE 1W83A 4DEBA 4D5KA 5CAPA 4YUQA 3AC4A 5M4IA 3GT8A 1T45A 1LUFA 3E63A 1KWPA 4MD8E 4QP8A 3ORZA 4P4CA 4BBFA 3ACJA 3LXLA 4QMXA 4BHNA 4BYJA 5HE0A 5BYYA 4HNIA 5I0BA 2PMIA 2GHGA 2QKWB 4CFUA 1KE7A 2YHVA 2JIUA 4G3CA 5BVNA 4D0XA 5A54A 2F2UA 3QRUA 2AYPA 4JIKA 3LPBA 4FV6A 1SNXA 3ZLYA 3CPCA 3DAJA 4CZTA 5EHLA 2C3JA 2HXQA 3ZDUA 4CSVA 3VBTA 2F2CB 3KC3A 4BCOA 4E7WA 2PVNA 3KFAA 4O0TA 1R0PA 4ZP5A 4IJPA 4IJ9A 3FL5A 4EQCA 3UVRA 2ITTA 4OLIA 4CYIA 4D2PA 2WB8A 3HUBA 2XK6A 1ZYJA 3QUDA 4LI5A 3TCPA 1R39A 3GU8A 1P4OA 2O0UA 3EB0A 4MXAA 2BRGA 3ORNA 4QMLA 3LLTA 3ULZA 5BUJA 1Q4LA 2P2HA 3PXKA
chains in the Genus database with same CATH superfamily
4O38A 4UEUA 3B2WA 5FM3A 2J0KA 2YIYA 3F61A 4FA2A 5HICA 5HCXA 4OTIA 5HNIX 4F1OA 3ZOSA 3N51A 2WTDA 5EKOA 5H3QA 4AG8A 2J0JA 2XA4A 5AV4A 4V05A 3GCUA 3AGMA 3MJ2A 4BI1A 4DEAA 2B52A 3QXOA 3K54A 5EW8A 4GK3A 4U6RA 4AA0A 1YHSA 3Q96A 2B4SB 1OKYA 4IMYA 4XNEA 3ORPA 2PUUA 4TNBA 5DIAA 5L8JA 2OGVA 3VBXA 3IDCA 4EOKA 1ND4A 3R7OA 2JAVA 3D5WA 5TE0A 3P7CA 3ZLSA 4F1TA 3PFQA 2Y6OA 2VWIA 4R6VA 2XJ1A 3HV5A 3ZBXA 2NP8A 5AM7A 3Q5ZA 4A4OA 3AC1A 4KRCA 2PPQA 3I7CA 4U80A 4MX9A 4FMQA 3FMKA 4R8QA 2A4LA 5KMOA 1QCFA 4LOPA 4AZSA 1ERKA 4EZ7A 3Q9YA 3HDNA 4FF8A 5HTIA 3U4WA 3F2RA 5H8GA 5IH5A 4IFCA 4K0YA 4AT4A 1VZOA 3I0QA 4DFYA 3IOPA 3DDPA 4V04A 3BZ3A 3FQEA 2BZIB 4XX9A 5E4HA 1OB3A 3UG2A 3JR1A 3EYGA 3GU5A 1GZ8A 2AUHA 3SX9A 3VAPA 2R2PA 4YLJA 1X8BA 4AE6A 4EZ5A 4EONA 3FMMA 3Q2MA 4RLLA 3R9HA 3OCGA 3E8NA 3P79A 4JL9A 3DS6A 2C3LA 1JQHA 4Z9LA 1G8AA 4O91A 4RPVA 3QYZA 5CXZA 4DHIB 3KXXA 3NMUF 3ENHA 4LQMA 3BU5A 3LFNA 4TY1A 2C5OA 5I9UA 4EYMA 2BKZA 4D28A 3GCQA 4GIHA 5D7VA 5AP5A 5IPJA 3NGAA 1H01A 1QPJA 3RBWA 3IS5A 5HLWA 1WVYA 2JAMA 4E8AA 4K1BA 3OC1A 3FMDA 5IG1A 1PRYA 4CFVA 3CJFA 4ZJJA 3VUHA 3W0MA 2XYNA 3A99A 5IA5A 4IX5A 3RK7A 1NVRA 2VTSA 2IVSA 4GUBA 3R8ZA 4GRBA 4EH5A 4RA5A 3DJ7A 3W2OA 1OZ1A 2ERKA 3OBGA 5CS6A 4GFOA 4J8MA 4I5MA 2RG5A 2IW9A 3U51A 4ZSLA 3EN9A 5LVPA 3NCZA 4FKPA 5BUIA 3P7BA 4LRMA 3HMNA 4I3ZA 3HP5A 3BU6A 4EH3A 3A7HA 5HO6A 2CNUA 4TWPA 4O4CA 3QRIA 2JC6A 5CAOA 4EWHA 5AUZA 2ITZA 3ITZA 3EN4A 2GQRA 4KBCA 1PY5A 4UB7A 2JIVA 4PMSA 3VS4A 4M8TA 3VS6A 3HMIA 4D4SA 3LFSA 4JDIA 2V0DA 4NM3A 4J99A 4I21A 3HRCA 4O2PA 1U5QA 3W0QA 4FNWA 3OFMA 1U46A 4QNYA 3N4TA 2WU6A 4GJ3A 3KMWA 2XIXA 4AGWA 2P55A 4A9SA 4I6HA 3HZTA 4M12A 4IAZA 3PTGA 4DGGA 4I20A 3MV5A 4ERWA 3QF9A 2WTKC 2OJJA 3POZA 4FSZA 4X6QC 2VX0A 3HMMA 1Q8WA 4IXPA 4YBJA 5FG8A 2VTMA 3WIGA 4A9RA 3DJ6A 3L9PA 3VQHA 4FKGA 2PU8A 5CU4A 4G1WA 3R7GA 3CD8A 3TTJA 3MDYA 3VS7A 3DLSA 2XRUA 2P2IA 4WRSA 4UBAA 5AV1A 5KMIA 2QOFA 3AQVA 4ACDA 3VUKA 4OT6A 2JLDA 5FM2A 3V6SA 3UPXA 4BCNA 3W1FA 5EHYA 5ANOA 3DFAA 3UNJA 3ZO1A 2PVMA 1Q41A 2BKKA 4O86A 4IC8A 1UVRA 2VWUA 3TL8A 4DT9A 3EWHA 4GG5A 4AA4A 5I9ZA 4XG4A 3FZ1A 4ZTRA 4DC2A 5IA3A 1PMUA 4HJOA 3H9RA 1H0WA 1PKDA 4CLIA 3F3WA 5IF1A 3DKCA 3CS9A 4AQCA 4ZZOA 3TM0A 1YQJA 3F2AA 4WUNA 1XH8A 2BDJA 3D9VA 4CRSA 2UV2A 3LAUA 4LV8A 2IG7A 3AC8A 4WNMA 5CNNA 3GBZA 4I22A 3MESA 4XLVA 3TV7A 4K33A 4O0XA 2R3IA 1XQZA 4UZDA 4E20A 3PYYA 3SC1A 1PXKA 4S33A 2LAVA 4UX9A 2HOGA 3GOPA 2XAOA 5AR8A 3C4XA 3R02A 2BR1A 4MHAA 4PQNA 4BYIA 2XIRA 2BRBA 3I81A 1NT2A 2VV9A 3NUNA 3G6HA 2XAMA 3Q5IA 4IAAA 1VYZA 1LEWA 4QDVA 2WOUA 1FINA 5KUPA 2XKDA 3G33A 3FQHA 4KABA 4PDSA 4WBOA 3P7AA 1Y6BA 4I1ZA 5IQDA 4E6CA 3VS1A 4QMSA 5IEVA 2WMSA 4CLJA 3CTHA 4U41A 4HVIA 4W8EA 3ZSGA 4LV7A 4QPMA 4APCA 3BYSA 5IU2A 1NW1A 3KVXA 5CZHA 5IQBA 5EYDA 2YIQA 1R78A 3R7VA 4TPTA 3DBEA 3CSVA 4WIHA 3K3IA 5GZAA 4G31A 3E93A 2XK4A 3VBWA 4DH5A 4BBEA 4M69A 4I6FA 2HIWA 2IWIA 4QPAA 2BROA 4AACA 4O4FA 5F95A 2CGXA 3IPHA 5DRDA 4N0SA 2ZV9A 4ACMA 1UNLA 3TZ8A 2R3OA 4BBMA 3HV3A 4CTCA 1LP4A 3BYUA 3P5JC 1J3HA 3E5AA 2BFXA 3NYOA 4TYHA 3MB6A 3R2YA 5LARA 4QMUA 3ZU7A 5J95A 4D9UA 3PY3A 3TV4A 4C4IA 3MVMA 4C58A 4JJRA 1Y91A 4DCEA 2R3HA 1AD5A 2PVKA 4AZWA 2XIKA 5M57A 4DHFA 3FI4A 4ALWA 4EYJA 1JSVA 2BTSA 3BEGA 4IANA 3MVHA 1B38A 1W2DA 3NUYA 4BKZA 4DTBA 4H39A 3R0TA 2UZOA 2C0IA 3KXZA 4EC8A 2CKPA 5I4NA 4BB4A 3UIUA 5D10A 3MBLA 4CT1A 2H6DA 2WXVA 4OTPA 4XOZA 3GOKA 1P5EA 4FR4A 3NSZA 4W4WA 2J9MA 5CQWA 2GPHA 2WTVA 3VBYA 4MNEA 4X3FA 3ERKA 2WIPA 1ZLTA 3V8SA 5EOLA 4F0FA 4FKJA 5JQ5A 4FODA 3NCGA 5HCYA 3FC1X 4QTDA 5HOAA 4EUTA 1MUOA 2W1GA 3W2PA 2HAKA 4LGDA 3QUPA 4X2JA 4I92A 4XP0A 4HYUA 1CDKA 2V22A 3LFBA 2PZRA 4I4FA 2UW7A 4CFNA 4CTBA 4ANNA 4CMUA 5A6NA 1Y8GA 4N6YA 5CNOA 4BDFA 4NFMA 5EQEA 2WGJA 1TFFA 2UVYA 2X8DA 1OGYA 3PXZA 2GMXA 1E9HA 2C69A 4EHGA 1QPEA 2GFCA 2R3PA 1PMEA 4O27B 4QMVA 1YHVA 4L46A 2H34A 3WZUA 4NH1A 4W4XA 2PY3A 2X8EA 4ZY6A 5T68A 4EWQA 4PDPA 4NCTC 2UUEA 5HO7A 4PP7A 4YZNA 4PMMA 3U9CA 4BC6A 1V1KA 1ZMWA 5AM6A 5IQCA 3C4WA 2HZ4A 3MB7A 3CC6A 3CTJA 3MGYA 2VTHA 4Z55A 3QFVA 3FC2A 4RVMA 4UYAA 4X7QA 2SRCA 3A8WA 3FLSA 2BHEA 2VU3A 4QP9A 4U45A 2OIDA 5AV2A 4BDJA 5A46A 5HTCA 4WRGA 1WAKA 5IQGA 4NU1A 3MY0A 5CF4A 3LCOA 3FZTA 4IZ5A 1W8CA 4FTQA 4F0GA 3LQ3A 3KRRA 2BCJA 2PVFA 1V0BA 4X2GA 4ZK5A 1TZDA 3RZFA 3KMMA 3MPMA 3QBNA 4EH8A 4YSMA 3JPVA 4L43A 2XEZA 5M53A 4ONAA 3UTOA 3RKBA 4AQKA 3LW0A 3PP1A 4O4DA 3DNDA 3TACA 4FL1A 4UWYA 4E3CA 2GS2A 2GNJA 3UYTA 3RAKA 5DT3A 3Q52A 4XV3A 4GKIA 1OL5A 5DEWA 5ETAA 3DFCB 5CAQA 4BCQA 3PVGA 4FV4A 1WBVA 2CLXA 3ODYX 3Q60A 3SV0A 3DKFA 4RGJA 4I6LA 2VD5A 3VUMA 4KKEA 3THBA 4E4NA 3CD3A 2W17A 4U5JA 4EH9A 4NZWB 4O84A 4MAOA 3KMUA 1NVSA 4WKQA 2X0PA 3I1AA 4EOOA 5CU0A 2BALA 3ZXTA 2HYYA 2A27A 4HVDA 4TTHB 5F1ZA 4CVAA 3A7IA 3C4EA 1H27A 4OTGA 2IZRA 2YCRA 3QKKA 4ZTSA 3VONA 3UZTA 3KU2A 1L3RE 5KE0A 4ZLZA 5AWMA 2BMCA 5M08A 4BJJB 5LXMA 3O0GA 3L9NA 4CYJA 3QGYA 2UZBA 2W05A 4ZS4A 2VWVA 4KIQA 3DV3A 1ZXEA 4TWOA 2HY81 2XMYA 5CX9A 3P5KA 3A7GA 4OBOA 3BV2A 3D7TB 2W9FB 3PIYA 4E4LA 4YC8A 4OTDA 2BAJA 3G9NA 4KAOA 1WZYA 4KSPA 2X1NA 1B39A 2GCDA 3QD3A 5E8UA 1KV1A 1OI9A 2X81A 2UVXA 2ZOQA 4K2RA 4YJSA 5CQUA 1BMKA 2PZ5A 4E6QA 5JFVA 3P23A 3VF8A 4O1OA 4WSYA 5FD2A 4QMQA 1A9UA 1ZOHA 2UW3A 3G5DA 4G16A 2AC5A 3UP7A 5HLPA 5CU2A 5CF8A 4JDHA 5BPYA 4D5HA 3OXIA 4U7ZA 3IW7A 2XVDA 3RCJA 1YW2A 4QMNA 3EOCA 4JG7A 5L2SA 5L2TA 4EH6A 1WBNA 3FXZA 4C38A 5CTPA 2HZ0A 4RX5A 4BCJA 4PL5A 3CIKA 2PVHA 3W2RA 4KRDA 3WF8A 3GCPA 4L8MA 3EQRA 1OKWA 2W99B 2YZLA 4RJ6A 1H1RA 3TJCA 3TNIA 3RWQA 4ENYA 4NL0A 2Z2WA 4QQ5A 3NIZA 5L8KA 2PYWA 3IGGA 4M66A 4BKYA 2I0VA 5CSPA 4M68A 4D4RA 2QC6A 3I4BA 3UYSA 5HX6A 1UU3A 5I9WA 2YABA 4H58A 3M11A 3R7EA 4HYIA 4EHEA 5CLPA 3RNIA 4FICA 5BNJA 3P1AA 3V51A 3PA3A 3KQ7A 2QODA 4AW0A 3S4QA 2ZJWA 3DXPA 3FMJA 3QYWA 3SOAA 1VYWA 4M67A 3PP0A 4LM5A 3M1SA 4IB1A 2FH9A 3KRXA 2ESMA 4A4LA 1KE9A 4F08A 5KHXA 3ID6C 4FTCA 2PUPA 4DTAA 4CV8A 5LCKA 2F7ZE 4AW2A 2W5HA 4DEHA 4BR3A 5FEEA 4M15A 3S2PA 5KKRC 2GSFA 4GT5A 2X6DA 1NA7A 4HPUE 4ANOA 4KIPA 2OF2A 4H36A 3E88A 2QO2A 3EFKA 2CGVA 3QTZA 4O0WA 3FLWA 3LFDA 4MXCA 2VTJA 3W0SA 2GNGA 4FE2A 3MN3A 4B8MA 2A98A 3NIEA 3CQWA 4YO4A 2BDFA 4XH6A 3FBVA 5CSXA 3D5VA 4R7HA 1MQBA 3NNXA 4E1ZA 1FBNA 3UDSA 3UGCA 2OLCA 3A7JA 3LXNA 3H10A 1IAHA 1OIUA 3SKCA 4GYIA 4AS0A 3FLNC 4YJVA 4UALA 4BICA 3QUEA 4FT3A 3LVPA 4DLJA 4IVCA 4AW5A 3KF4A 3ZO4A 4EOPA 4L3LA 2WAJA 4IZAA 4FNZA 4FSRA 3WARA 1UWJA 3V3VA 3PY1A 2JFLA 4JS8A 4IADA 3V04A 4GK4A 4IWOA 4XP3A 2PZIA 3F82A 4GYGA 3NVMB 3O7LD 2X0OA 1O9UA 5FRIA 3PJ3A 2JDTA 3DJ5A 4U40A 4FIHA 3QQUA 5HD7A 4HOKA 4TNDA 4YHFA 4D55A 1ZWSA 4FOCA 5F9EA 1ZY4A 2IVVA 2XK8A 3R30A 4DINA 4RVKA 4HVHA 3RK5A 5BQ0A 3QTXA 4Y5HA 3HECA 2UW5A 4I0SA 5HE1A 4O4BB 5ACBC 3L9MA 3WF6A 2WHBA 3KRLA 2R0UA 3FPQA 3OY1A 3GU6A 1UKHA 5BYZA 2PVLA 4BHZA 3GB2A 5CF6A 2QI8A 4YJNA 5JFXA 1PXLA 3AXWA 3IONA 4WUAA 4JXFA 4DFZE 5AMNA 1YDTE 3ODZX 4RVTA 5L2QA 4E5BA 4R3PA 4UMUA 1PMVA 2LGCA 4M0ZA 3LFAA 4AX8A 3R1QA 1GY3A 4L00A 4EZ3A 5EYCA 4G9RA 2VTIA 3FZSA 5ANJA 3AD4A 1IEPA 3BHTA 3ZSIA 3AKKA 3E62A 4CG9A 2X8IA 4YHTA 2VZ6A 3FMLA 5IA2A 3F3VA 4L67A 5KX8A 2W4KA 5HG7A 5BVEA 4UV0A 3EKNA 5AUXA 3NW7A 5IMXA 2QOBA 4IAIA 4KS8A 4DYMA 2R9SA 5AP3A 5CASA 5LOHA 4K11A 1CMKE 2NRYA 1XHAA 3QZGA 1UA2A 3P78A 4LOOA 3RK9A 3NYVA 3DPKA 4L53A 2GNLA 3MTFA 4X21A 3QA0A 5DFPA 2X2LA 5FXSA 2UZTA 4BRXA 3FLQA 5CENA 3BLQA 5E1EA 2ETKA 3H9OA 5JRSA 4YC6A 5GIPE 3VS0A 3KN6A 3VO3A 4BIBA 5AP2A 4ZEGA 2I0EA 1CTPE 4I94A 1VJYA 3CCNA 4FTOA 1PXMA 2QOQA 4QTEA 2ITQA 4L68A 1PXNA 3PWYA 2WQBA 4IAYA 1KSWA 1S9IA 2X0QA 4M14A 3PVUA 3RNYA 4BN1A 2OKRA 3R04A 4JT3A 4EL9A 5K4JA 2X6EA 5L3AA 3QD4A 3ZDIA 1YVJA 3OG7A 4N70A 3ZCLA 1PXJA 4GFGA 3C4ZA 4IVAA 3ORTA 3ZRKA 4QMTA 4O83A 4JR3A 2R3NA 2XS0A 2QOHA 5KMLA 3D15A 4U0IA 2PMLX 1FVVA 3BWJA 3VNTA 3EKKA 3Q9WA 3ACKA 5LMKA 2CKQA 2Y4IC 2VO6A 5EI8A 3RPYA 3TEIA 2Y8OA 2C47A 4PV0A 3I79A 5FP6A 3N4UA 5EQYA 2RFDA 3E7OA 2PMOX 3ORIA 2CCHA 4PNKA 2PHKA 3O2MA 5IMEA 2QHMA 3FXWA 4P5ZA 1ZARA 1VEBA 3C0IA 3LXKA 4KKGA 2YDJA 4PL3A 4USDA 1W82A 3C7QA 3P08A 4J7BA 2B9FA 4LMNA 3FY0A 3S95A 4CT2A 3POOA 4EC9A 5M4CA 3CPBA 5L2WA 3EN6A 2KTYA 5C1QB 4WHZA 5CU6A 4QDEA 5FTGA 5HKMA 2EU9A 4ASDA 1WBWA 3EQHA 3W55A 3ZO3A 1YWNA 2VTTA 3KRWA 3VHKA 5IA0A 4B4LA 3BGPA 2VTOA 5AJQA 3GVUA 1TKIA 3G0FA 4OUCA 1TQIA 2QHNA 3C4FA 2VO7A 1SVGA 3CGOA 3Q4CA 4A7CA 2W1IA 4BGQA 4F1MA 1XMLA 3NW5A 3TIZA 4I24A 1ZYSA 4EKKA 3JUHA 4JOAA 1WCCA 5HNBA 4FGRA 4M7IA 4ZTQA 2YWPA 2I1MA 4EUUA 5JMSA 4L9IA 1Q5KA 4Q9ZA 4BCKA 3HGKA 5ANEA 3EN5A 5DMZA 3KCKA 3AC3A 3ZO2A 3F6XA 2DS1A 3A7FA 3LQ5A 2QURA 4YC3A 5CEPA 4JRNA 3CXWA 3VS3A 3KIOC 4ERKA 4IX4A 4MQ2A 4DEEA 4EOMA 2CNVA 3PFYA 3TIYA 2G9XA 2PZYA 4GFMA 2JBPA 5ANKA 1URWA 3DB8A 3DTWA 3QA8A 2XBJA 5HVKA 4TYJA 2UZLA 5IUGA 2QLUA 2W0JA 4CCBA 4ZXTA 4RC2A 2QOIA 4TZRA 5IQFA 3OT3A 4BGGA 1U5RA 4FTRA 2YACA 3TZ9A 3U8WA 3PG1A 1ZYCA 1OPKA 5HG8A 3VQUA 3UODA 4A9YA 4QMMA 1H07A 1R1WA 3SXRA 2YJRA 3BLHA 1JBPE 4C36A 1JWHA 4L44A 2ONLA 2C5NA 3A62A 2XNBA 1XH4A 4GV1A 4JDKA 4N4SA 4PNIA 4V0GB 4NW5A 3F3TA 4AFJA 4FUXA 4YNEA 2A0CX 5DGZA 4AOTA 4NJ3A 5D12A 3W0OA 2G2IA 3OUNB 1CKJA 2C5VA 2YDIA 4KS7A 4X3FC 3DK7A 4FBXA 5CU3A 5AUVA 1IA8A 3JY9A 3OHTA 4RIOA 4AT5A 4D0WA 5BVFA 3O96A 4ACHA 3LZBA 2CNQA 1GJOA 5DNRA 2B0QA 4RJ8A 3QLGA 5ACKA 4I6QA 3VBVA 5K5XA 2BTRA 3ZRMA 5JFWA 3MSSA 5I9YA 2WTKB 3RAHA 2CDZA 4QYHA 4XJ0A 4WNPA 5B7VA 5ITAA 1P4FA 4O1PA 4IDVA 1OL7A 1R3CA 2F4JA 3CQEA 1URCA 3R63A 4FKWA 1HCKA 4AGUA 3PVWA 2QR7A 4C0TA 2YCFA 4JQ7A 4NIFB 4RIYA 3RJCA 2ZDTA 3VRYA 1OM1A 2FSMX 3PSCA 1OIRA 2XKEA 3FUPA 4A07A 1KE5A 3QTQA 4ALUA 2OJ9A 4F9YA 3ZFXA 4EH2A 3K2LA 4EJ7A 5IKWA 3EFLA 3W16A 2XCHA 2I6LA 1PMNA 3OXTA 4FL2A 4FTLA 3TNWA 3PA5A 3WE4A 4QEBA 2V7OA 3BCEA 1DS5A 3IDBA 4LYNA 2JIIA 3UO5A 4IW0A 2PVRA 4FTIA 3OMVA 4IHPA 5CVHA 4H1JA 3F66A 1JKLA 2CMWA 2W1ZA 3HYHA 2J51A 2WTJA 3C5UA 4O0UA 4PMPA 3NUXA 3HKOA 4AZFA 3R9DA 1Q3DA 2WIHA 5GJFA 3KF7A 3OW3A 4K8AA 5E8TA 5AV3A 2GHLA 5JQ8A 5AAGA 3LJ2A 4C8BA 4RFYA 5JK3A 2IPXA 3RZBA 5AX9A 5K0XA 3IGOA 3QAME 4Y8DA 3F2NA 5F94A 4IX6A 1NXKA 5FWKK 1U54B 4Q2AA 4V01A 2G2HA 4ZTMA 3FJQE 4HCTA 4FSTA 3AMBA 5TR6A 2YM7A 4NJDA 4H1MA 4BKJA 4O7VA 1ZMVA 5KO1A 4EJNA 2FA2A 3ZBFA 5J7HA 4DFNA 5ANIA 4RQKA 4DAWA 3JVRA 4C3RA 1PXIA 3QKLA 4ZS0A 2VTAA 2YIXA 3GU4A 4Z7HA 3OT8A 4RT7A 5CEOA 2VRXA 3W8LA 4Y73A 2OXDA 4LL5A 1RJBA 3BGQA 2PK9A 2VTPA 3CQUA 4F6SA 3B8RA 4CFMA 4G3GA 2OWBA 4BZDA 5FUTA 1MQ4A 5K3YA 5J1VA 3D7ZA 5EQPA 4FZAB 4EKLA 1YXXA 4FV9A 4ANBA 3OWKA 4GIIA 2Y9QA 2XM9A 3A61A 2OFVA 3NLBA 4QP3A 5DHJA 4O81A 4EK5A 3O50A 1VLRA 3WZKA 4J1RA 5HEZA 3B8QA 4N6ZA 4BI0A 2FB8A 2ZM4A 4HGSA 3PPZA 5LVOA 4GEOA 1PXOA 4IIRA 4YURA 4G9CA 5CY3A 1TQMA 2XNNA 2C6KA 3PVBA 3PE1A 3OOMA 4Q5HA 2IW8A 2IZTA 2UZUE 5CSVA 5B2LA 3LM0A 3BL7A 4MTAA 3UPZA 4RLKA 3TKIA 3IKAA 4QP4A 5M44A 4WSQA 1OL1A 5GNKA 2C6MA 3ZMMA 4G3FA 2P3GX 4RZWA 5TF9A 4WOVA 3AC2A 3PZEA 2JKQA 3DAKA 1KE6A 1Q24A 4FG7A 3MWUA 4PTCA 4F70A 3G6GA 2HZIA 2ITVA 3ZFMA 5JEBA 5EYMA 5AUTA 4HW7A 4L3PA 5HVYA 1SYKA 3EFJA 5CT0A 4C62A 1M7NA 3I5ZA 4CZUA 4DFLA 5AA9A 1OBGA 5FEQA 3UC3A 5AUWA 4HGEA 5HNGA 4NYEA 4FIIA 4WNOA 4FKSA 3PXFA 3RAIA 3DK6A 4MF1A 3N4VA 2OJFE 2OJIA 5B0XA 1H1WA 5B2MA 1G8KA 2GQSA 1PJKA 4DCAA 3REPA 2ZV7A 1YXSA 3AG9A 3KL8A 5TKDA 4N57A 2ZFYA 2RG6A 4JVGA 1REJA 3UBDA 2GS6A 3RWPA 5L8LA 4RIXB 5BMMA 5KMMA 4RWLA 2R3LA 3VUGA 2DYLA 1GZKA 4NWMA 2C30A 5CVGA 1FMKA 4YJUA 3EYHA 1SM2A 2XJ2A 4YBKA 5G6VA 2ERZE 5CT7A 1XH9A 1XO2B 3KB7A 4XEYA 2WFYA 4C37A 3IDPA 3NAXA 5BVOA 4GKHA 3OCBA 4S2ZA 3DKOA 3QTWA 4DE4A 4CNHA 4B0GA 3U87A 4FTKA 3FZPA 3NX8A 5LWMA 4QP2A 5BX0A 3S00A 4APPA 2WQMA 4AGCA 3AKLA 3UZPA 2RFNA 2PE0A 5BMSA 2CCIA 2J2IB 3O71A 4NM0A 3Q4TA 2F7EE 3BGZA 4KKHA 2OXYA 1RQQA 2XIYA 2UW8A 2W06A 3SD0A 4IBMA 3MIYA 3L8PA 3ULIA 4FVQA 4W4VA 3NFGB 1K9AA 2BVAA 4X2FA 2XM8A 4OT5A 3DT1A 4MUQA 4FRFA 1M14A 3D4QA 2B9IA 4O0RA 4AP7A 2RL5A 4AUAA 3BU3A 3E64A 4DGLC 3QHRA 3TXOA 2ZM3A 4AOJA 1Q99A 2WMRA 5GIOE 4FSMA 5IDPA 4RWJA 3COIA 4U97A 4E5WA 2R3KA 4BWKA 4Z7GA 4BDCA 3QHWA 3LCKA 4FGBA 3MTLA 5EG3A 1OPLA 5DVRA 3ROCA 2XALA 4UMRA 5EOBA 1M2RA 4X3JA 3O8UA 2XNEA 4MBIA 4ZTNA 1OPJA 2R3JA 3LLAA 2OZAB 4KA3A 5JH6A 4RG0A 4YTCA 4U3YA 4NW6A 3JS2A 3GCVA 4I41A 4KINA 4DT8A 1P14A 1GIIA 2XK7A 3ZZEA 2PSQA 3FI3A 3PXQA 4LOQA 3V5WA 3NZ0A 4DN5A 2ITOA 4EH7A 4AAYA 4NKAA 4EOQA 5HIBA 3QZHA 4D1SA 5IQAA 3I5NA 4O4EA 4F7LA 4D2RA 3MJ1A 5LMAA 4AE9A 2OSCA 3I6WA 3MH2A 4XG2A 5DA3A 2J4ZA 3F5GA 4GT4A 1DI8A 3TI1A 1JVPP 3R00A 3VHEA 4K6ZA 1H26A 1UNHA 4MWHA 4HZRA 2VN9A 5CEKA 4FTMA 4DA5A 3CLYA 3NNWA 1KOBA 5FTQA 3PJ2A 2CJMA 2QONA 3OS3A 2WMXA 1KOAA 3UNKA 3FQSA 3TV6A 3AC5A 4GVAA 1E1XA 1ZAOA 2RSVA 4YZ9A 4C2VA 4CQGA 4RIWA 1BLXA 3U54A 4F7JA 4OGRA 4J71A 4NEUA 4WBBB 1WFCA 4ZZMA 2C6DA 3DBQA 3R7UA 3W2SA 3F3ZA 5C8KA 3EH9A 4MVFA 3SRVB 4FEWA 5M55A 3Q53A 5GJGA 3LXPA 3PZHA 3RCDA 3EZRA 1V0OA 3I0OA 5AP6A 4HZSA 3IW8A 2WNTA 2GTMA 5AR2A 2X7FA 5HX8A 2UW9A 3D83A 2FSLX 2CHLA 3O8PA 3AD6A 5IA4A 2YAKA 4HGTA 4GT3A 4X2NA 3GEQA 4FJVA 4FV1A 3BELA 4YZDA 4G6OA 3GI3A 2VGPA 3E92A 4FI1A 3PIZA 3F5PA 4IDTA 4OTHA 3RHXA 5CAUA 2X9EA 3TNPC 4QMPA 3VUDA 3V5JA 2O65A 1LEZA 2C6OA 1OUYA 3R21A 3SQQA 2VX3A 4J53A 1G5SA 3TMOA 1H1PA 5EI6A 4BI2A 4Y95A 3F9NA 5E8ZA 3D2KA 1F3MC 3JYAA 5DYJA 4U9AA 4YJQA 2YM3A 4OBQA 2WMWA 4O22A 3H30A 3SW7A 4KNBA 2HWOA 4LV5A 3OXZA 3R01A 2WMQA 3WE8A 3IO7A 1J1CA 2VNWA 2C6EA 4H3QA 4F0IA 4JMQA 5C03A 3QTRA 1JLUE 5I5ZA 4CFXA 4FX3A 3NPCA 2OJGA 3FYKX 4RMZA 3F7WA 1ZYDA 1GNGA 5BVKA 2ETRA 5F20A 2PULA 4EORA 2ZB1A 4C57A 3SA0A 3RP9A 4FEUA 2XP2A 5CAVA 5M4UA 3HRFA 5AP7A 1YOLA 2J6MA 2VWZA 5JT2A 4PDOA 2QVSE 2XARA 3T9TA 2I0HA 2GDOA 2OIBA 5AUYA 3RI1A 3HRBA 4G6LA 3TNQB 3O5AA 2WELA 5JKGA 5KKRB 4FV0A 4K18A 3PRFA 1ZZ2A 5L6PA 4G3DA 3UDTA 3PSDA 4DH7A 3DXQA 5C9CA 2IVTA 3QZFA 4MCVA 3I6UA 5IUHA 3SG9A 4I23A 4FTNA 5CEIA 5CSHA 5M09A 2RIOA 5HO8A 4JAIA 3UZRA