3FMEA

Crystal structure of human mitogen-activated protein kinase kinase 6 (mek6) activated mutant (s207d, t211d)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
288
structure length
268
Chain Sequence
MEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFAGCKPYMAPERINPELNQYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase 6 (MEK6) Activated Mutant (S207D, T211D)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
total genus 67
structure length 268
sequence length 288
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmeA01
2R3JA 4L9IA 4JNWA 5M4CA 3CJGA 4BZDA 4D58A 2WTKC 3BWJA 3EKNA 3QD2B 4KS7A 3E5AA 2W96B 4DTKA 3I5NA 1A06A 4JLCA 5AAFA 2WELA 4A06A 3KCKA 4NFNA 4HVGA 3MBLA 1H1SA 3PFQA 5T3QA 3RNIA 3MJ1A 2IW6A 4RWKA 4BGHA 2QOHA 3DCVA 3H0ZA 4TT7A 3UYSA 5ANKA 2BMCA 3I1AA 1CKJA 2EVAA 1FPUA 5D12A 5TT7A 3V6SA 4GIHA 5EI2A 3IK3A 1WVWA 3MH0A 1FOTA 3ZRMA 5K5NA 4DT9A 1OMWA 2X81A 4RLLA 4K33A 3CP9A 5K4IA 2GU8A 2B7AA 2QURA 4O0XA 4DITA 2HWOA 2W4JA 2PSQA 2OGVA 3F88A 3OP5A 2UW6A 1UU3A 5JSMA 4FKQA 2JEDA 4JQEA 4QMTA 5DEWA 4X2KA 4P5QA 5HOAA 4BDDA 1P4OA 2O2UA 3BX5A 3PJ8A 4OBQA 2QU5A 5KBRA 4GH2A 3BV2A 4YTCA 4UBAA 1KE5A 4XEYA 5AUXA 4BDKA 3BHHA 2P2HA 1LP4A 3A7IA 3G5DA 4AGDA 4ALVA 4G5JA 2YN8A 4QT1A 4C3PA 2SRCA 4E5BA 3C4EA 4QQTA 5E1EA 3FPMA 2C5OA 4X0MA 2WU6A 3OTVA 4CQGA 1FVRA 1H08A 3W2RA 5IA3A 1Y6BA 2O5KA 3F7WA 1NA7A 1ZZLA 2W7XA 3WZKA 1OM1A 4LUDA 4KABA 4ITIA 4CKIA 1V1KA 2XKEA 3VN9A 5BYLA 4YJSA 5CY3A 3BGQA 3G51A 3PXKA 5AMNA 3IW4A 4FI1A 4W4WA 2GQSA 3F61A 4U6RA 4YZBA 5L8LA 1BMKA 4CLIA 4KIOA 5HIDA 1TQIA 3HRCA 3QAME 4FKVA 1PF8A 4K9YA 3RAIA 4O0RA 4CZTA 4FKWA 1JKSA 3HMNA 3QWKA 5ANGA 3FBVA 5HESA 5AM6A 3Q5ZA 4O27B 3IPHA 3LFEA 5CQUA 2X7FA 3BYUA 4HYIA 4IZAA 3V8WA 2HIWA 3AC4A 3MIYA 4U40A 4NIFA 2PE0A 5HKMA 3HYHA 5D1JA 4KKHA 3NNUA 5ANEA 4KIKA 3WYYA 3EZRA 1GY3A 3HMMA 3AD6A 1IA9A 2XJ2A 3NCGA 3QC9A 4FODA 2C47A 4QMLA 4XLVA 5AR3A 2QHNA 4IB0A 4CFFA 3BBTB 5J1VA 4HVIA 3EN9A 4LGDA 1OB3A 4GFOA 3VS7A 3A4PA 4BTJA 4U41A 4F7LA 4RIYA 2ZDUA 1GNGA 4X3FC 2CGUA 4KS8A 5FTQA 4YC6A 3C51A 2VWWA 1MRVA 4YBJA 4WO5A 3QZFA 4O96A 3WARA 5HI2A 2QOBA 4R3PA 3QXPA 4RX8A 5JFWA 5KMMA 1PXNA 2JDRA 3R8MA 4EOJA 4TPTA 4TYHB 5FGKA 1Y8YA 3NPCA 2PVJA 3KULA 1FBNA 2EU9A 4LM5A 1H00A 1ZYSA 2HZNA 3C5UA 4U44A 2BRMA 4X2GA 3AXWA 3F66A 2JFLA 1SNXA 4QP6A 4XCUA 3CPBA 2YA9A 3KFAA 4BCKA 4CLJA 5J79A 4U79A 3UO6A 1PXKA 4ANMA 3QX2A 2XRUA 3VRYA 1BI8A 2JKKA 4C4FA 4ZY5A 2GTMA 3LCDA 2YZLA 5KMKA 4V04A 4XOZA 4BZOA 3OD6X 4PPAA 5FEDA 3G15A 2ITQA 3W2PA 1B38A 3VS1A 3ELJA 2I40A 3CY3A 5E8XA 4E8AA 1UA2A 4UMUA 5AAEA 4S32A 5A3XA 4C59A 2RFEA 4HGTA 4RIWA 2Y8OA 4QMSA 4FIGA 4AX8A 4EWQA 1NVRA 2UVYA 4GK2A 4TWCA 3R7YA 3EMGA 3FI2A 4QQJA 4D1XA 3FC2A 4FGBA 3DLSA 4GT4A 3FZRA 3QQJA 4GSBA 4W4YA 3JVRA 3TXOA 2OIDA 5A6OA 3QQUA 3HV3A 2X4FA 2HENA 1U54A 3F3ZA 3FHRA 2C6DA 3A7JA 2WB8A 4FTIA 3MS9A 4KIPA 2QOLA 3E87A 4F64A 1WMKA 4BYJA 3MI9A 1F5QA 2OU7A 2UUEA 3G0EA 4FKIA 5DWRA 2YCRA 4G3EA 4D2WA 3HMOA 3CY2A 3KVWA 4BR3A 2OZAB 2E9UA 4F6WA 4IW0A 3OCBA 4F99A 2DYLA 3QTSA 4JR3A 4O2ZA 4OTRA 4C58A 2CNVA 4GKHA 4G3GA 4G1WA 3NVMB 4Z9LA 4AOTA 4Z7GA 3ZXTA 3HDMA 4QYHA 4CV8A 4A9RA 3OWKA 1H1WA 4DGLC 5CU4A 2VTMA 1WFCA 1DAYA 3HUCA 2UW0A 5FM3A 3RZFA 3U8WA 3UPXA 4W8DA 4NM7A 2W5AA 3S00A 2EUFB 5KMNA 4L3PA 4KB8A 4W4XA 4D9TA 2QOOA 5DGZA 5I3RA 5HE2A 4DAWA 4E4XA 4UB7A 4KD1A 4I22A 4FIEA 3EQRA 4N70A 2EB3A 2ZB1A 3DTCA 3NX8A 3ZLWA 2X8DA 4C3FA 3DLZA 3QRIA 3LLTA 3EHAA 4O7TA 4IHPA 4EOPA 3NRMA 2IZSA 2R2PA 4FGRA 1BLXA 5EG3A 4CZUA 4JRNA 4BGQA 2JKMA 4JQ8A 4L01A 4BDAA 5FTGA 5HGIA 3RTPA 3HP2A 4OTGA 1CKPA 4DFNA 2WNTA 5DT3A 4F6SA 4J95A 2X39A 1YXUA 2WTVA 2X6EA 2V55A 4JDIA 4C35A 5DH3A 4TW9A 4APPA 5FTOA 2I0YA 3A7GA 2OZOA 3ZMMA 4C7TA 4EOMA 2G1TA 3GU8A 3F7ZA 3ULZA 4NTTA 3G9LX 4U5JA 5ANJA 4RJ3A 4EH2A 2OJFE 4F09A 3EYHA 2OBJA 4QNAA 1REKA 3WF7A 1OL6A 1Z57A 2ZB0A 5TO8A 2Z7SA 4YSMA 1OL2A 3FMKA 4XG9A 4FSZA 5CVGA 2XA4A 2CKOA 3ZYAA 1Q62A 3P4KA 3UO4A 4LYNA 2J7TA 2VU3A 1M7NA 1GZ8A 3I0QA 4GK4A 1OL1A 3BHTA 3O50A 3EN7A 4GVAA 1ZRZA 5K3YA 5A54A 3LQ3A 3PY3A 5EYKA 3BYMA 4RVKA 1LEZA 1Q8WA 3BYSA 2ITNA 4IWOA 2RSVA 4FG9A 2Z2WA 1U5QA 3VWAA 3QFVA 2GNIA 3NUYA 4PUZA 3BHYA 1W83A 2OH4A 4CVAA 3MFRA 1U54B 4RVMA 4M8TA 5CF4A 1H4LA 3ZO3A 5GJDA 3RMFA 4K18A 4EK6A 4XMOA 3C4FA 1QCFA 2R7BA 4LMNA 5CSPA 5IUHA 3UPZA 4YJRA 1PKDA 3ZLXA 5EI6A 2ITXA 4C57A 4CFUA 1H1PA 4IVDA 3U9CA 4QMQA 3HA8A 3TIZA 2ZJWA 3O2MA 4IVAA 3RZBA 4YTFA 3OWJA 2CN8A 1NVQA 2J5EA 4JQ7A 4EZ5A 2WTWA 5BMSA 5AV2A 4EH9A 5FDPA 4ZZMA 5LOHA 3PY0A 4FKGA 3DBCA 4QTBA 5BNJA 3K2LA 5CEMA 3KK9A 3MGYA 5C26A 4OAUC 3D2KA 3PIZA 2BZHB 3WI6A 4I0TA 5EH0A 3V3VA 4M67A 3GGFA 4I24A 4XLIA 3R30A 2ZDTA 4BKZA 4DINA 5LXMA 4TYIA 2VGPA 1J7IA 1G8AA 5C8KA 3A2CA 4UZDA 5AUYA 2YJRA 1ZYLA 5E7RA 1NT2A 2PL0A 3HNGA 5HG5A 3ZOSA 3NCZA 3OMVA 3EOCA 2WD1A 2WU7A 4J8NA 2B9HA 4KKGA 4KSPA 5H8EA 4E6AA 3BLRA 5IA5A 4ENYA 4S34A 2O3PA 4EUUA 2ZOQA 4ZSLA 3CD3A 3KXGA 4DEHA 2W5BA 1IRKA 4P5ZA 4BB4A 3ZXZA 4DEAA 3HP5A 3VJNA 2BAQA 2FUMA 1OIRA 4C4EA 2C6LA 4JRVA 4L68A 2H34A 4GKIA 4BGGA 3MA3A 5IA4A 3U4WA 4XG3A 2VTNA 1YOLA 4XBRA 3UMXA 3LFFA 3Q9XA 5CENA 3TZMA 2A4LA 2C0OA 3O23A 3OCSA 3ZFMA 3BYOA 4YZDA 4EYMA 2GSFA 4XX9A 4AFEA 4S31A 3EZVA 4R8QA 3QTRA 3SAYA 2I7QA 3JR1A 5M44A 4J7BA 3EFLA 2C6KA 4QPSA 4A4OA 2PVFA 2ETRA 3KMWA 3EQCA 2IVVA 4NJDA 2ITTA 3FQHA 4TXCA 2IW9A 5J9YA 4QTCA 3KF4A 4V0GA 5J5TA 3TNPC 2YLFA 3ORPA 3R00A 2B52A 4AZFA 4DN5A 2ITUA 3GQLA 5J9ZA 4YJUA 4XHKB 3POZA 2YJSA 3TNQB 4I4EA 2OW3A 3ZRLA 4ANSA 2PE1A 3Q9WA 4I20A 4L53A 5DYJA 2EXMA 2BAKA 4IDVA 1Q4LA 5JZNA 4EOIA 2FH9A 4ITHA 4BDCA 5FUTA 5FP5A 3V8TA 4MXXA 5AR5A 2R3OA 3L8SA 5AUTA 3CBLA 5D10A 3CE3A 4DEGA 5M4IA 4M15A 5L2IA 3SVVA 4GK3A 4J52A 5CEPA 3R1NA 5EHOA 3NWWA 4FC0A 1H1RA 2XKDA 4ZSGA 2CCIA 2XK9A 3G6GA 3LXPA 3I6UA 3VNTA 3E64A 1Q24A 3C4XA 1FMOE 3K5UA 3NYVA 3KRWA 3H30A 3B8RA 3RPSA 4G16A 4EZ7A 1YI6A 3TEIA 3GC0A 1MP8A 3QRJA 4IB5A 5HE0A 4RVTA 4XNEA 4PMPA 3DXPA 5IH5A 2XB7A 4XRLA 3MTLA 2E2BA 4KWPA 5FXSA 3F6XA 2HY81 3OTUA 3R01A 1IASA 5JK3A 3IDPA 1OL7A 3F5GA 2F4JA 2W1ZA 2XK7A 4ZK5A 4E1ZA 3Q32A 4G9RA 1WVXA 2ITPA 5FXQA 3CIKA 2IW8A 2WXVA 4TKSA 3T8OA 5M53A 2WTJA 4AA0A 3F2RA 2JD5A 2HYYA 2YIQA 1M17A 4BKYA 2X7GA 3NYNA 1PXMA 2BDJA 3F82A 4DLIA 2J9MA 5KMOA 3P5KA 3VC4A 5EYCA 2JIIA 2VX0A 3PSCA 3HV6A 2VWXA 1SMHA 4JI9A 3PVBA 3PSBA 3UG1A 3DPKA 4YJQA 2YM8A 1P14A 1UU7A 1BX6A 2WQNA 3AC1A 3I81A 3MJ2A 4L7FA 2ZM4A 1VYWA 3O8UA 4QMNA 4O84A 3PZEA 5CVHA 2HZIA 2G2HA 1P4FA 5DI1A 2OICA 4FX3A 4FYOA 1TVOA 4PY1A 3O96A 4JX7A 5FEQA 3I0OA 3FZPA 2WKMA 3ORTA 4XUFA 5AJQA 4FBXA 5AP2A 3UE4A 5HLWA 4JDHA 3MY5A 3M2WA 3Q9ZA 4GCJA 3ATSA 5IQIA 3MA6A 3QA0A 4OBPA 3GOKA 4FNYA 3MIAA 4MF1A 4H1MA 4EK4A 4BBEA 5CAVA 3QTUA 2WMVA 4JG7A 5HCZA 3PIXA 4O1PA 4I6QA 3OOMA 5F9EA 2QO2A 4FV1A 3KXNA 1ZWSA 4H58A 2XS0A 2QU6A 5CYIA 4G17A 2XK6A 5K0KA 4I3ZA 3SRVA 5C4KA 1YDSE 1PHKA 2W4OA 5ETIA 5J7HA 2RGPA 3RPVA 2HCKA 5LWNA 1O6KA 3KRJA 3IQ7A 3TM0A 2HW6A 3WF6A 3UNKA 1ZMUA 1OZ1A 3BQRA 5EYMA 4P7EA 4NK9A 2YCSA 4HW7A 1YXTA 4PNKA 3UDBA 3UMWA 3BELA 4RC4A 4YLKA 1U4DA 4BCOA 1I44A 2P33A 3QL8A 3HX4A 4KBAA 4YGAA 3FMHA 5AV0A 3D7TA 4FG8A 4O7VA 4DCEA 5DPVA 5A4EA 3EL7A 4O82A 2BVAA 4MD9E 3NNXA 4F6UA 4U97A 4UYNA 2UW9A 4DEEA 3QCQA 4ALWA 4YO4A 4HPTE 3WF8A 3ZO4A 3GCQA 4WRGA 4F9WA 4BDEA 5EHLA 2JDOA 3F3UA 3R63A 5A4TA 3PYYA 5KZIA 3NAYA 3JYAA 3CD8A 5HG9A 3MY0A 2OJGA 5L6PA 4OTDA 3VF8A 2W1EA 4RGJA 3HL7A 4AN3A 3VVHA 3ZLYA 4AWIA 1YVJA 3TNIA 5HG8A 2XMYA 4EBVA 4FEXA 3DKOA 2PZRA 4XH6A 3TTIA 5CXHA 4E5AX 3U9NA 4BDBA 4M84A 5IH4A 4RX7A 4C2WA 5B2MA 4XV9A 3KL8A 2JLDA 3PIYA 3GEQA 3ATTA 4P2KA 1XH6A 3ORXA 2XEZA 3GFEA 4RG0A 4E26A 2W1FA 3TZ8A 1OIQA 1Q8UA 3E8EA 3ANRA 1IG1A 2X2LA 1ND4A 2ITVA 4F4PA 1UKHA 1W7HA 2QCSA 4CFWA 1YI3A 2BROA 2IN6A 3NUXA 4FL3A 4AU8A 3IONA 3GU6A 2UZOA 3R73A 5L8KA 2VTLA 4M69B 1OI9A 3JPVA 5IMEA 1R0EA 3VS3A 1QPDA 1WZYA 4IAFA 2YFXA 2FO0A 2XUUA 3RK7A 5L2WA 1U5RA 1SM2A 3VUTA 4EHZA 4RJ8A 4DYMA 2RG5A 4GT3A 3U54A 2P4IA 4DH1A 5HVYA 2R3KA 2BIKB 3UVQA 4QP2A 4I41A 5EK7A 4YP8A 4FVPA 3ALNA 4LI5A 3QD3A 3OHTA 3R04A 3GCUA 5A46A 4WKQA 4DGGA 1R0PA 1OGUA 4QYYA 1YWNA 5AP7A 4FL2A 5F1ZA 1XH7A 1YW2A 4FTAA 4IJ9A 5CF8A 2X8EA 4EONA 3PZHA 4KRCA 1OIYA 2XCHA 3P79A 2CCHA 4FZAB 1GZNA 2OJIA 4CMOA 5LCJA 3PLSA 3C7QA 4LGGA 5DN3A 5BYZA 5KKRB 3BEGA 3QRUA 4EH7A 2UZDA 5C27A 1JPAA 2C3JA 4WUAA 4FK3A 3ZDIA 3UODA 5DR2A 2Z60A 3VUKA 4MX9A 5ANIA 1JQHA 2QG5A 4YJOA 3NSZA 3RAKA 3UOHA 3LM0A 4EI4A 3QX4A 5JFSA 3FQEA 3LAUA 4O91A 1UU8A 1ZOGA 3Q2MA 5IUGA 2VO3A 3MPMA 1PXPA 1OKYA 4UWCA 5DEYA 2NRYA 4D2RA 4X2JA 4ZP5A 4NT4A 5EOLA 2XNMA 3QQGA 4WT6A 4IX6A 4QRCA 2YCFA 3IECA 1KE8A 4DBNA 3FUPA 4CT1A 4JL9A 3OEZA 5CU2A 2XIKA 2W1GA 4JAIA 2P0CA 4FT5A 4ZTHA 3PE1A 2VAGA 2UW4A 2WHBA 5I9UA 3IO7A 2IJMA 4FF8A 4HVSA 4YNOA 5CVFA 3RAWA 4FMQA 2PHKA 2BRGA 3EFJA 3R02A 2XRWA 3TT0A 3ZC5A 3LLAA 4HGEA 3QCXA 4FV5A 2BRNA 4TNDA 4RPVA 4D4SA 3TKIA 2W05A 3F3VA 3VUHA 3LJ1A 1PMVA 5EQYA 1YXVA 3S1HA 3MFUA 3SOCA 4GVJA 2GNFA 3NNVA 2VTTA 4E73A 4BC6A 4E7WA 3H4JA 5AIRA 3WZDA 5HHWA 4EJ7A 2WIPA 3C0HA 5FRIA 3QZIA 4FTJA 3MDYA 5FBOA 4UWYA 3QU0A 3EFWA 5BUJA 3QKKA 3MVLA 4CMTA 2X2MA 2PVRA 2BUJA 3R71A 4UMRA 2YHVA 3TNWA 5L6OA 3W2OA 1JKTA 4MBLA 1G5SA 3E62A 2C6MA 3EFKA 2VNYA 5CX9A 2VWIA 1JSVA 2A27A 3DGKA 1H28A 4FZDB 4X6QC 2XYNA 5C03A 5M55A 3P7AA 2YIRA 2J0IA 3L9LA 5D7AA 4XG8A 3R9HA 4LMUA 5CASA 4G2FA 5GZAA 3R9RA 2PK9A 4MF0A 2R4BA 4G3CA 2QKRA 3WE8A 4F70A 5JQ5A 1PY5A 3RALA 4D0XA 2BZJA 3L8VA 3NS9A 5HICA 1IEPA 4FSTA 3LFSA 4F9CA 4FIFA 1YHWA 4O0TA 5HE1A 4EH4A 2IVTA 2JKQA 4FTUA 5E92A 1XO2B 4ASEA 4OUCA 1ATPE 3FLSA 2BPMA 3CEKA 3FMJA 1JSTA 3VBXA 4IZ7A 3OBGA 2J50A 4GFMA 4YUQA 3V8SA 4NFMA 2Y7JA 1BYGA 3LPBA 4FSUA 1KV1A 4Q5EA 4XV2A 4YNEA 4DH5A 1SVEA 3E8DA 1L3RE 3OXTA 4FTQA 3MVHA 2PMIA 3TV4A 1XH4A 2C6OA 3W1FA 5LVOA 3B8QA 2G01A 3ORMA 4GJ2A 4I93A 4JXFA 4LOPA 4M12A 2NPQA 3V04A 3ZUVA 4AZWA 2I0VA 5CTPA 2W0JA 3VHEA 4DC2A 3QGWA 4I5MA 1B39A 3LFBA 4AOIA 4GRBA 5JGDA 3FXWA 3KQ7A 3E88A 4RIOA 5CLPA 3VQUA 2IG7A 2UZLA 1P5EA 4FICA 3MB7A 5DNRA 3WF9A 3ACJA 4FV4A 1M14A 5DR9A 3KRLA 2BALA 4YJTA 3RJCA 3RWQA 4WSQA 1KE9A 4OTFA 3AC3A 3WBLA 5TKDA 2VO6A 5LMKC 4NYEA 1HCLA 1J3HA 3CXWA 2RFDA 4OTIA 3RM7A 1HCKA 5CF5A 3QYWA 4Y5HA 4YURA 4ZSAA 4ZMFA 1E1VA 3R83A 3L8XA 3TJCA 3AMYA 1WBSA 4GEOA 4RIXA 4YR8A 2ZMDA 4F9AA 4OR5A 3R1YA 1H27A 3Q60A 3RVGA 3ZBFA 4F1MA 4X2FA 4QPMA 4R6VA 3GU7A 2JAMA 4DH8A 4NW5A 4D4RA 4OLIA 2WMUA 3GCSA 3L9PA 3TIYA 4AZSA 2ZMCA 3W33A 4I0SA 4IX3A 4EEVA 5CEQA 2CKQA 3D9VA 5TF9A 2O65A 2R3GA 4WA9A 4NCTC 3QZGA 3PXYA 4YJNA 2E9NA 3IOKA 2G9XA 3QGYA 4FOCA 4K2RA 5LVNA 2F2CB 2F7ZE 1PKGA 1M52A 4USDA 5DRBA 4B8MA 5CF6A 3VBVA 3P1AA 2ITZA 3OY1A 1PJKA 3D94A 4MKCA 5ANDA 5H3QA 2WMRA 4UN0C 5IISA 2OWBA 3ANQA 4PPCA 3V5TA 4BDJA 4UYAA 4N6ZA 5BVOA 1DI9A 3IS5A 4L43A 1OUKA 5CAPA 5M08A 2PZPA 3LHJA 3R28A 4R1YA 4EHGA 3UQCA 4IAIA 3DDPA 2CPKE 2OO8X 3BLQA 2OJJA 2C1BA 4QMWA 4RZWA 2O63A 2WQOA 2OKRA 4EOQA 1T45A 3DXNA 4CYJA 4K6ZA 4XP2A 1BL7A 1W82A 3TDVA 1Y6AA 4RQKA 3PXRA 4PMTA 3CR0A 4EOLA 4EQUA 5EDRA 3GC8A 3GI3A 2WMBA 4M3QA 1JOWB 5I3OA 4IEBA 2RIOA 5EKOA 3CCNA 2YIWA 1W8CA 3BLHA 4QTEA 4ZJIA 2NP8A 5JGBA 1IAHA 4AGUA 4IM2A 1V0BA 2UZVA 3VULA 4C62A 3GXLA 2J51A 3I7BA 1Y91A 2A1AB 3W2CA 4WUNA 1MRYA 3AD4A 3VS2A 3DAEA 3DBQA 1VZOA 5B2LA 3EWHA 3TUDA 3EQIA 3I79A 4XBUA 1WBTA 1PMNA 3DAJA 4BCIA 2YABA 4WG3A 4RJ5A 1GIJA 4WIHA 4Y73A 4A9YA 4ACDA 3D7TB 3SW7A 5KUPA 3VF9A 2H6DA 3OVVA 5LARA 3RI1A 1WVYA 3ZS5A 3UYTA 2ZM1A 3ODZX 3GP0A 3JY9A 3UC4A 3WIKA 2VTSA 3OW3A 5KNJA 3DB6A 5BVFA 4L7SA 5J95A 2Y0AA 1ZYJA 5FM2A 3GUBA 3FQSA 4PP9A 4DLJA 5J1WA 4KKEA 4OTPA 2JC6A 2V0DA 4G6LA 4EQMA 4FVQA 4MTAA 4OGRA 4C61A 1X8BA 3QHWA 3SXRA 4C38A 3HMIA 4AW2A 4UMPA 4H1JA 3TKHA 4OTHA 2Z02A 2QODA 3GOPA 5HBJA 4CTBA 3NUSA 1VEBA 4MXYA 4CCUA 4D2PA 3HRFA 2VO7A 2F7XE 4I4FA 2PULA 4D2SA 4N6YA 4M0ZA 3DA6A 4FSYA 3ET7A 3COKA 1YOMA 1LUFA 4LOOA 3W8QA 4XOYA 3FMNA 4W9XA 3E63A 1A48A 3ZTXA 1I09A 3NUUA 3ZLSA 4GMYA 4NL0A 4K8AA 3QA8A 1KSWA 3IW5A 4EK8A 5DIAA 4FSMA 1XKKA 4EORA 2W99B 4O6LA 2FVDA 5AA9A 2R3QA 3R7OA 5IZFA 2RG6A 3GU4A 1FVTA 3MH3A 4YC3A 3B2WA 2WMWA 4YJVA 5FG8A 4CMUA 2C5VA 2WMAA 4O86A 4GG7A 4DFBA 4H36A 2ONLA 2FSTX 2WEIA 2WIHA 5KO1A 3NVKI 2R7IA 1H07A 4FKJA 1J7LA 3N51A 4GFGA 4BWPA 4IQ6A 4FTOA 3FKNA 2VWUA 4E5WA 1STCE 5IDPA 5BX0A 2ZV8A 2YIXA 2E9PA 4C4IA 3QQLA 5EOBA 3MV5A 2WO6A 4WBOA 3TZ9A 4JG8A 4DEBA 2X0GA 5HX6A 2PTKA 4IDTA 3MPTA 4FNWA 5EW8A 2GS2A 4RC3A 5I4NA 5IQCA 2GDOA 4QQ5A 1U59A 5JN2A 2YM3A 3I7CA 4FTMA 3G33A 2ZV9A 3DKGA 4G3DA 5CSHA 3RK9A 4IWDA 4CFVA 4AFJA 4PTEA 1ZMVA 1Q99A 4FIIA 5HTIA 5AIKA 4M14A 5CANA 3NYOA 4FKRA 4QOXA 5BMMA 3ODYX 3SLSA 1Z9XA 3U6HA 4LV8A 4C33A 4PL5A 4YSJA 5LWMA 1NY3A 3D2IA 3EKKA 3FC1X 5HVKA 4MWIA 4MXZA 4V05A 3G2FA 4J8MA 4Q9ZA 1TKIA 5I9XA 2BIYA 3E3BX 2XH5A 2R3HA 4L8MA 3LMHA 5IA0A 3D5UA 1V0PA 2B53A 2JDTA 4IC8A 2CNUA 3Q4CA 4RFZA 1R1WA 4D1SA 3HECA 2VTJA 5M07A 3QTWA 4FK6A 3D14A 3ORIA 2UVZA 1HOWA 3EH9A 1UKIA 5LQFA 4ZSEA 2PMLX 5BPYA 3A7HA 4FTLA 4QMPA 4S33A 3KB7A 5AWMA 4ZY4A 4RWIA 2G15A 2XNOA 3KGAA 2W9FB 4XG2A 3GCVA 1LR4A 3PY1A 3WZUA 2VUWA 2C5NA 4ZAUA 3RP9A 3NGAA 5AP3A 5H8BA 4JT3A 4BI2A 2A2AA 3Q2JA 2CGVA 4FKSA 5JRSA 5M4FA 2EXEA 4U3YA 4HPUE 4U81A 4YMJA 3PDTA 1IA8A 4QP7A 2V7AA 4BTMA 3SC1A 4OTQA 4AW0A 4FTKA 4DF3A 3II5A 4J96A 5F94A 4QP4A 4MVFA 3OZ6A 4C36A 4PV0A 4Y5QA 4KBCA 5ETAA 4ZJVA 3MYGA 4FV2A 4KIQA 4DGMA 2FSOX 3G90X 4QMOA 4I92A 5JFXA 3S2PA 4JX3A 5A6NA 3H9OA 3CKWA 2XNPA 4AE9A 4ACHA 4BCGA 4I1ZA 4ANOA 3Q4UA 1UU9A 1GAGA 4NWMA 5HORA 4EZ3A 4RVLA 3FXZA 2XIXA 3ORKA 1G8SA 4RIYB 3A4OX 5K5XA 4CG9A 5B7VA 4O2PA 3ORNA 3JS2A 1PXLA 4C0TA 3UTOA 3BV3A 3ZZEA 3MESA 3GFWA 3F3TA 5AV1A 3FL4A 3ID6C 1PMUA 2IWIA 2G2IA 3MSSA 4RLKA 3CQUA 2JITA 3V5WA 1ZYDA 4D1ZA 2HXQA 4ANBA 2AYPA 2HAKA 4L6QA 2P2IA 3AT2A 4G34A 2XIZA 2KTYA 3IDBA 4KSQA 4NUSA 4D2TA 3UOKA 2QR8A 5AR7A 2XKFA 2YEXA 4BDHA 4EH3A 4D5KA 5F20A 3QRTA 5AM7A 4EWHA 4DG2E 4OTWA 5L4QA 2YM6A 2ITOA 4JBQA 3IGGA 4NM0A 4F1TA 5LCKA 3IW8A 3PXZA 3PA5A 2F9GA 4O0YA 4TTHB 1OPLA 3PA4A 4GIIA 4DA5A 4NU1A 3NUNA 4QYGA 1Q8ZA 2GHGA 4AP7A 3UZTA 2NO3A 3F5UA 4ACCA 3DDQA 5GNKA 2VZ6A 4Q9SA 3MFSA 3VHKA 3E3PA 3DAKA 1KWPA 3CKXA 4LGHA 3KREA 3O8PA 4B6LA 4USFA 1CMKE 2ITWA 4KUJA 4FA2A 2JGZA 2V7OA 4BICA 3NDMA 1OIUA 5H2UA 1YKRA 5ETFA 4MXCA 2FYSA 2VWVA 1RE8A 3DQWA 1DM2A 4QD6A 2C4GA 2C5XA 1E9HA 2GQGA 2R9SA 4F08A 3R7UA 3GVUA 4FT3A 5FQDC 3ZO2A 4AQCA 2PZ5A 2XBAA 1PXIA 1XBBA 3KY2A 4OT5A 3H9RA 4YPSA 2VRXA 4GT5A 4XP3A 3RCJA 2KULA 4EHVA 3FHIA 4J1RA 3KVXA 3HA6A 5DLSA 2REIA 3ZM4A 2Y6MA 2JIVA 4FYNA 5BVEA 2QC6A 4FEVA 2Y6OA 1WBNA 3FI8A 4V0GB 2R3FA 4AZEA 3DNEA 3EQGA 5EW9A 3UQFA 4AN9A 3FMDA 5TOZA 4RIWB 4E4MA 2VTQA 1OVEA 2HK5A 5CU6A 4TWNA 5DR6A 4CV9A 3SV0A 2R3NA 3O7LB 4ASDA 4FT0A 5E8ZA 4BIDA 5HTBA 4AACA 4BI1A 3C4ZA 5AUZA 4R7BA 4J71A 2ESMA 4I0RA 5IQGA 3NUPA 2WTKB 4IXPA 1DI8A 2WFYA 2UZNA 2UV2A 4ARKA 3SKCA 3OF0A 2C3LA 4F0IA 3UNZA 3R9OA 2J2IB 1XHAA 4RX5A 4USEA 5CALA 1VJYA 2BZKB 4FL1A 3QALE 4FR4A 3TN8A 3PSDA 5LMAA 1Q3DA 3QUEA 4II5A 4BI0A 5FDXA 4BL1A 4GV1A 5L8JA 4KNBA 5KE0A 5IQAA 4Q5HA 2J90A 4WBBB 4BVUA 4KA3A 5HD4A 1Q5KA 2BKKA 3DFAA 4AG8A 2QHMA 2VTOA 3LJ0A 2QOQA 5AV3A 5I9WA 2IPXA 5HG7A 4YZMA 4I5CA 3R6XA 3QWJA 4HZSA 4WHZA 5HLPA 5CXZA 4UX9A 2WQMA 4TN6A 3S0OA 4L00A 4MNEA 4LQMA 2UW5A 3UQGA 3R22A 1ZAOA 3DFCB 3FLWA 1G3NA 5AUWA 5FXRA 3W2QA 5HO7A 4O38A 3KXZA 4O7SA 4CFXA 3HMPA 4IFGA 3KN5A 1URCA 3LMGA 3QHRA 2BDWA 2GNHA 4FT9A 5J87A 1XR1A 3MH1A 3ROYA 2CLQA 4IZ5A 5EQPA 3LJ2A 3FAAA 3PJCA 5KBQA 3PP1A 1OKZA 3FLZA 4JS8A 2QOKA 4ACGA 4QMZA 3V51A 3KC3A 1YXXA 4R5SA 4AA5A 3LE6A 5M06A 2VWYA 4Y8DA 1LEWA 4QMMA 2WQBA 3OC1A 4HYUA 5AX3A 5HVJA 3THBA 3UOLA 3WZEA 3U6JA 4CG8A 4E6QA 3RGFA 3UOJA 1YI4A 3BQCA 1WBPA 3QLFA 2C6EA 2OI4X 4YTHA 3DOGA 4NZWB 5K4JA 5HU3A 5HCYA 3NUAA 3Q5IA 2FSMX 3FI3A 2HOGA 3KRRA 3PG1A 4LRJA 4F7NA 2XJ1A 4JBVA 2UZEA 1GIIA 2WTCA 3DY7A 3LZBA 2RFSA 4JR7A 4AZVA 4CKJA 3Q3BA 2GFCA 4AE6A 3OWLA 2AUHA 4FKLA 2XNEA 4HYHA 1YHSA 2YWPA 4Y85A 3AG9A 4RC2A 1Q97A 5DA3A 3RPRA 3QTXA 3VRZA 2WTIA 4IM0A 3ZRKA 4AZTA 4NH1A 4O7ZA 2VTIA 3BRBA 4HOKA 1QPJA 3ENMA 5M4UA 1GZOA 4R3RA 3QTZA 3QCSA 5I9ZA 3R9NA 4TWPA 3VUIA 2UVXA 2XKCA 1XQZA 4E20A 4IACA 4NSTA 4BCJA 4NTSA 3M1SA 2PUNA 2B54A 4B8LA 4FSNA 2DQ7X 3IKAA 2ERKA 1REJA 4IVCA 4JG6A 1OKVA 3HV7A 4LOQA 4O0UA 5J5SA 2BCJA 4HVHA 5AR2A 3R8PA 4RWLA 5CAOA 1RJBA 4RJ4A 3QC4A 4O0VA 3SW4A 5C4LA 4PX6A 3FWQA 4FUXA 3V5LA 3PJ1A 2VN9A 4XP0A 4RMZA 4NM5A 2WOUA 2OF4A 3CTQA 5HNIX 2XIYA 3TNHA 3O17A 2QOIA 4PTGA 4QPAA 4FV0A 4DFXE 4F0FA 5I9VA 4ANLA 4PDYA 2EXCX 2XZSA 4L42A 4CTCA 4FKTA 5E9EA 5J8IA 2CN5A 4EOSA 4MHAA 5KMJA 3VBYA 3CPCA 4Y72A 1K3AA 3NIEA 3VBQA 3F2AA 3BE2A 2VX3A 2PMOX 1JAMA 4IBMA 1NW1A 2CKEA 4UXQA 1PYEA 3DT1A 3AC5A 4YLLA 2YACA 4FV6A 4FOBA 5FLFA 4BTKA 2GQRA 3OUNB 4UY9A 2XIRA 3OW4A 4HZRA 5M09A 3WOWA 2W9ZB 5GJFA 3CLYA 2VNWA 2VO0A 4IFCA 5EW3A 3VO3A 3W32A 3FXXA 4UZHA 4RA5A 3BYVA 4F7SA 5E8YA 4YTIA 2PUIA 2R0IA 3FI4A 4IC7A 1Y57A 1FQ1B 4D4YA 3LXLA 5ANOA 3EQBA 4NJ3A 3UIUA 4D5HA 3PWDA 3R0TA 4DGOA 3OXIA 5HO8A 3VIDA 1ERKA 2ONLC 3EB0A 2W1CA 3ZSHA 3WYXA 1O9UA 4EH5A 2BHHA 4H05A 3K5VA 5HBHA 4R78A 3R7EA 5A4QA 4FNXA 3RM6A 3MWUA 4J98A 4MD8E 3KXMA 5C1QB 1UV5A 4QMXA 4A4LA 4BHZA 3D4QA 4N0SA 2Q83A 3QTIA 2IVSA 3D5WA 3MFTA 3QD4A 1OPKA 4IH8A 1ZYCA 4MBIA 3FZTA 4O21A 4C2VA 4A07A 2PZYA 5JFVA 2YIYA 4H3PA 4RA4A 1SYKA 4PMMA 4IMYA 5EM8A 1OECA 1NVSA 3W55A 4AOJA 3OROA 4U7ZA 3ETAA 3TKUA 1PXOA 4I6FA 4IADA 4BRXA 4EHEA 3ZUTA 1WBVA 3KMUA 5CU3A 4F1OA 2PVNA 4BN1A 2PU8A 5ETCA 4C4HA 3QYZA 1JKLA 1H24A 2OXXA 2YDKA 5D9HA 5G1XA 2GNJA 2OXDA 4ZS4A 4H39A 4IZYA 3ULIA 4BIEA 1R78A 4QMYA 4CFMA 3AC8A 3VUMA 3RCDA 4X7QA 2XM8A 3LFNA 4I6BA 2E9VA 3BGPA 3DQXA 3BHVA 4IX4A 5C9CA 3TTJA 5CAQA 3BU3A 4FV7A 1NXKA 2BKZA 3R8ZA 3ZFYA 4AXAA 5HTCA 2AC3A 3GQIA 2B9IA 4GJ3A 4LL5A 3S4QA 3O51A 5JRQA 5KCVA 4RJ7A 4BHNA 3DJ5A 4TY1A 2JBPA 4IAZA 2CLXA 3P9JA 5IA1A 2J6MA 4TRLA 2YERA 1DAWA 2Z8CA 3EYGA 3IG7A 3PRIA 3ZSIA 3DZOA 5G6VA 3TUBA 2PWLA 4FEUA 4BY9E 3DU8A 3P7CA 1B6CB 4IAKA 3EQPA 4DH3A 3ACKA 4CRSA 4F65A 1H25A 4ZIMA 5FP6A 4DG0E 5B0XA 2C3IB 3R7IA 5A4LA 2JKOA 5HEZA 3FLQA 3LFQA 2DUVA 4FEWA 4EUTA 2OSCA 4MQ1A 4S30A 5IF1A 4TZRA 3MB6A 3DS6A 3NIZA 3FL5A 4BF2A 4EH8A 2O0UA 3ZUUA 3VUDA 3M11A 1OBDA 4YHJA 3OT8A 4C37A 2OJ9A 2VWBA 2VV9A 2R3MA 4OW8A 4FSWA 5KMLA 4YU2A 1YHVA 4F63A 3ZEPA 3FDNA 3K3JA 4K1BA 4RFYA 3WE4A 3BEAA 3DK6A 2FA2A 3Q52A 4XG4A 3MW1A 5GIOE 2YZAA 3GENA 4W9WA 3R8UA 1IAJA 4IAYA 4RX9A 3Q4TA 4YZ9A 4CZYB 2LAVA 4EQCA 5CNNA 3BZ3A 3Q9YA 3A99A 2XCKA 4GU9A 4AN2A 3NYXA 4QP9A 3NW6A 2WMXA 2C0TA 3TZ7A 5TR6A 3M42A 2I0HA 4MQ2A 2XK8A 4R3CA 4ZEGA 2GFSA 4F9YA 2W5HA 3BI6A 1LPUA 2QR7A 3DJ7A 4TYEA 4G31A 5AR8A 4QP3A 4RQVA 3NNWA 3FKOA 4PP7A 2WOTA 3P0MA 3NR9A 4ZTLA 4D28A 4AUAA 3OCTA 3OFMA 3BE9A 1YXSA 4MD7E 2H8HA 2JAVA 3FKLA 4PF4A 4IWQA 3R7VA 3ENHA 3WF5A 3BWFA 2CGXA 4DBXA 2PYWA 2C6TA 2YM7A 3GC9A 4NKSA 5ITAA 4C3RA 4HNFA 3VW6A 2X8IA 2GNGA 5E8UA 5EDQA 3O71A 3UIBA 4DEDA 2WMQA 4FZFB 3CGFA 3U87A 2R64A 5E8WA 2ETKA 4E4NA 3E7VA 4O1OA 2C6IA 4B0GA 2XP2A 4ANQA 4KAOA 1YDTE 2W17A 4G6OA 3DB8A 3RBWA 3N9XA 2QONA 3JY0A 3SDJA 3C0IA 3PVWA 3QLGA 2QO7A 2Y4IC 4GUEA 4MK0A 4JDJA 4X3JA 3E92A 3FMMA 3C5IA 4ZS0A 4ZLYA 2RKUA 4PL3A 5DG5A 3SX9A 2GS7A 5L2SA 4QTAA 3TG1A 2OIBA 1YWVA 2B1PA 3C0GA 3P7BA 4ASZA 3QKMA 1BI7A 1O6YA 2WAJA 3BKBA 5IH6A 3HRBA 2XVDA 2J0MB 5B2KA 3ZZWA 3H0YA 3IGOA 3R1QA 2ZV2A 5K0XA 4YHFA 3RK5A 4B4LA 2Z7RA 4XV3A 4FTTA 4QP1A 5CI7A 2F7EE 4DGNA 3QTQA 4RIXB 1KE7A 5CZHA 1OPJA 3KULB 3ZDUA 4L52A 4DE4A 3AD5A 5IEXA 2ITYA 2H96A 3FY0A 3NZ0A 5LMBA 3F9NA 2X9FA 4WNOA 4FTRA 1MQBA 2DWBA 3ZO1A 4X2NA 4WNPA 1Q8YA 3P23A 2PVHA 4G3FA 4PL4A 4E93A 3ROCA 4GYGA 3EQFA 5CSVA 4CXAA 2BHEA 4ZY6A 3GBZA 4IWPA 1CDKA 3HZTA 4AW5A 3POOA 4QP8A 3VJOA 3AT4A 4B7TA 3AMAA 3QZHA 1OKWA 4AA4A 4ZTQA 1MUOA 2BDFA 2F49A 2Q0BA 4FNZA 3D15A 5C01A 3BBWA 5BVNA 5FWKK 4AS0A 4F7JA 4YZCA 4ALUA 5E4HA 5CEKA 2VTPA 4ZLZA 1JVPP 2X2KA 3NMUF 3SG9A 1KE6A 2C0IA 4ZZOA 5D41A 5GJGA 1JKKA 1R3CA 3U55A 2HWPA 4MXAA 5AAGA 3UC3A 3AGLA 2W1IA 2CNQA 4DG3E 1F0QA 2R3RA 4ORKA 3LQ5A 1GOLA 1H0VA 5DHJA 2GTNA 2YCQA 4I5PA 5EM5A 2W1HA 5TE0A 4MEDA 3D5XA 2JIUA 4QYEA 5KMIA 2BRBA 3OWPA 3QF9A 4QTDA 1MRUA 4ZJJA 1BUHA 3LFDA 4O0SA 3AT3A 5E8SA 5AUUA 3FYJX 3DJ6A 4GG5A 2ZYBA 1WBOA 4DFZE 3GC7A 1PYXA 4AF3A 5ICPA 3T3VA 3E8CA 5IQFA 3O7LD 3F3WA 3OCGA 3DK7A 3L1SA 3PWYA 2VTRA 4I6HA 3RAHA 1T46A 5GZ8A 2LGCA 2AC5A 3AC2A 4X21A 3DBEA 2QO9A 3NEWA 2I6LA 1Q41A 1SVGA 4J99A 4WRSA 4DCAA 1K2PA 3PPJA 4M69A 5A14A 4APCA 1VR2A 1ZZ2A 3B2TA 3FSFA 5E8TA 3H9FA 4JBPA 3HAVA 3Q04A 1V0OA 4BZNA 2IO6A 4R7HA 2XYUA 5LVMA 1KOBA 5I5ZA 1YQJA 3NAXA 3JVSA 5E90A 2Z7LA 4KINA 2GNLA 4ENXA 3O8TA 4ZTMA 1XH9A 2R3IA 3C1XA 5HCXA 3ZHPC 1WCCA 5IQBA 4GL9A 2VGOA 2OLCA 2WEVA 3OBJA 4W8EA 4GUBA 3TL8A 5KKRC 1Q3WA 2CJMA 4BCPA 3ZONA 5IG1A 2HXLA 5AP4A 3HEGA 4PPBA 4RZVA 5CAUA 5CEOA 3IDCA 2CHLA 2C30A 4S2ZA 5ACKA 4FE2A 2QNJA 2O64A 4A9UA 3QUPA 4D0WA 4NIFB 4OT6A 4R1VA 4BYIA 4H3QA 5GHVA 2YM4A 4MCVA 2XBJA 5IMXA 3CQEA 2XEYA 4LFIA 4XG7A 4FKOA 4ZSJA 1KV2A 5HO6A 2IZTA 4BTFA 1CTPE 1YDRE 4TNBA 3FSKA 2UZUE 4U0IA 2QOCA 4L3LA 5AX9A 4CYIA 2GHMA 1M2RA 4WG5A 5FD2A 2YWVA 3AGMA 3ORLA 4ZXTA 2PVKA 3AOXA 3G9NA 2PE2A 5CEIA 3KF7A 4BIBA 4UMQA 3R7GA 4M0YA 4PWNA 5EKNA 1Q8TA 3GCPA 1S9JA 4HGSA 4F0GA 3TV6A 3DV3A 2NRUA 5I0BA 1ZY4A 4Z3VA 3GU5A 4MYGA 5IEYA 4E6CA 2ACXA 2X9EA 4PTCA 3UG2A 3BHUA 2PPQA 4D2VA 1XJDA 4MNEB 2QD9A 2C1AA 5C8NA 1J91A 1F3MC 3IW6A 3ORZA 1PRYA 5KHWA 5IU2A 5HIBA 4WNKA 1SNUA 2WPAA 2ZVAA 1KUTA 4W4VA 4J53A 2V62A 3NLBA 4A9TA 1M7QA 3I4BA 4XJ0A 3UBDA 4DT8A 2C5YA 5EYDA 1W0XC 4AT4A 2XK3A 4O6EA 3U51A 2HY0A 2XNBA 4XV1A 1J1CA 2WZJA 3I5ZA 4PRJA 3Q6UA 3FYKX 4U3ZA 3V6RA 4H3BA 4RSSA 1TQPA 2CMWA 3CC6A 3ZEWA 4A7CA 2QLUA 3BPRA 2G2FA 2J5FA 3ALOA 4UALA 4NEUA 5JGAA 4EL9A 3OT3A 3NW5A 1MQ4A 4WG4A 5CI6A 4BCQA 4HCVA 4TYHA 2GPHA 4DFUA 5H9BA 2DS1A 1M2QA 3P86A 2OFVA 4XRJA 3T3UA 4IVBA 1M2PA 4GU6A 4HJOA 5HD7A 5H8GA 1JNKA 1FVVA 3P08A 4Q2AA 2B4SB 3C4WA 1S9IA 3PPKA 4FT7A 5DVRA 2W4KA 3IOPA 4LRMA 3VS6A 4U80A 4KRDA 3A60A 4NKAA 1JSUA 3ZSGA 1ZARA 3T9IA 3KRXA 3PE2A 3HV5A 4DEIA 5HQ0A 2WMTA 4M66A 2JFMA 3SRVB 2OH0E 3Q96A 3DKCA 3HGKA 1R39A 4J97A 4TYGA 5IDNA 2VTAA 4CQEA 1OBGA 4IM3A 1FINA 2OZAA 4R7IA 2J0KA 3QQFA 3GT8A 5EHYA 2R0UA 5E1SA 4C02A 5JH6A 3W10A 3CJFA 5KZ0A 3PUPA 4UMTA 1YOJA 2YDJA 4C34A 3F5XA 4V01A 5LVLA 3OOGA 2BZIB 4BKJA 4ACMA 4MNFA 4O7WA 1A9UA 3QKLA 4QO9A 3VBTA 3GNIB 3UP2A 2GCDA 2J4ZA 2F2UA 4U8ZA 4BCNA 4D4VA 4JOAA 3RHXA 3HLLA 1Z5MA 4F9BA 1QL6A 3COHA 4YO6A 2UW3A 2RFNA 2WQEA 3CQWA 3MVJA 3FZ1A 3JUHA 4Z7HA 5AFVA 1FMKA 4O7RA 3C9WA 4N57A 1WAKA 4U42A 3BCEA 5EM7A 5E8VA 1FGKA 2PY3A 3C4CA 4WOVA 2FSLX 1JWHA 4O7LA 2RL5A 5BQ0A 4XS2A 4ZTRA 1URWA 4CRLA 5JMSA 4QMUA 2A0CX 1BL6A 3BU6A 4JJRA 4PDOA 3MH2A 2BILB 3C13A 4NM3A 4Y46A 4DFLA 5DFPA 3A7FA 4RT7A 3WIGA 3H3CA 4ASXA 5IQDA 3LFAA 5I9YA 1ZY5A 4I23A 3REPA 1J1BA 2O8YA 3KMMA 2HZ0A 3K3IA 5AP1A 3EQHA 3RPYA 4RFMA 2XNGA 4UXLA 4EKKA 1E1XA 3RKBA 4G9CA 2I0EA 4IE9A 3L8PA 4B99A 5AP0A 1XH8A 5AV4A 4BDIA 3FEGA 1UWHA 3FLNC 4UV0A 4BCFA 5IA2A 3TJDA 3N4VA 4JIKA 4CD0A 5LJJA 2UZTA 3NW7A 5D7VA 5DT0A 5CU0A 3KK8A 4E4LA 3CTHA 3TDWA 3HVCA 2QVSE 2HZ4A 4K11A 2IZRA 3DBFA 3FZOA 3ZBXA 2YISA 5FBNC 5EQEA 2JBOA 4FIJA 4BBMA 1UWJA 2RF9A 5LMKA 3A8XA 1XBCA 2XJ0A 3I6WA 4EK3A 2IVUA 5M51A 4TYJA 2OF2A 4O0WA 3SOAA 3W16A 2X7OA 4RWJA 3QQKA 3UVPA 3TI1A 4ERWA 5M57A 5J9LA 4L67A 3SA0A 3VBWA 4Z55A 3GB2A 4OBOA 4EYJA 3FE3A 5BVKA 3FY2A 4ZOGA 5AA8A 3ERKA 4Y95A 2FB8A 1XWSA 1GZKA 4DH7A 4I21A 4EK5A 5IQHA 1JBPE 3Q4ZA 1XH5A 2OG8A 2UZBA 3D5VA 3PA3A 5E91A 3RWPA 4CT2A 2CKPA 1H8FA 2EWAA 3BIZA 3FZSA 4ZLOA 3DKFA 1QPEA 4E6DA 2GMXA 3QCYA 4HGLA 4RRVA 3F5PA 3UJGA 3VS5A 4CSVA 4FSRA 4R77A 3EIDA 2W1DA 3MPAA 3SD0A 2WMSA 1H1QA 1RQQA 3MTFA 4HVDA 4ZZNA 5L3AA 2YAAA 1YWRA 2ZAZA 1PW2A 1QPCA 2X4ZA 2XF0A 1DS5A 4KBKA 4X3FA 5FEEA 1AQ1A 3EN5A 3HAMA 4O7NA 5BVDA 5KX8A 5EFQA 5F4NA 4EC8A 3VS0A 4NCTA 4L3JA 4BFMA 4P4CA 4FKPA 4MXOA 1K9AA 4E3CA 1OITA 3SG8A 4HCUA 4YZNA 4CFNA 3TV7A 4ZTNA 4GW8A 3LW0A 2A19B 3K54A 4M97A 4QYFA 2PUPA 1QMZA 3I60A 2UW7A 4QQCA 4U45A 3COIA 4FTNA 3FMLA 5F95A 4M68A 4ONAA 2V5QA 4ZTSA 3KXXA 3PTGA 2BTRA 3HDNA 1UNLA 5IUIA 4IIRA 4FZ6A 3KA0A 3SXFA 3ZH8A 5BUIA 2Q0NA 4IB3A 5GZ9A 3OXZA 5ACBC 3HKOA 3FPQA 4O81A 3FMEA 3V5JA 2P3GX 2R3LA 5JEBA 3F2NA 4LG4A 4C4JA 4FKUA 5L6WL 3ZM9A 4YJPA 2V22A 4FIHA 4MH7A 1SVHA 3CGOA 4LV5A 4AGWA 3LVPA 3OEFX 1JLUE 3HUBA 5C8MA 4EC9A 5JQ8A 4L44A 1TQMA 3A62A 5CWZA 2BFYA 3ZC6A 3QRKA 5CT0A 1H26A 3VQHA 4CEGA 2B0QA 3OUKA 3FLYA 2BR1A 5DT4A 4IJPA 4GYIA 4BBFA 4QNYA 3DK3A 5LVPA 2QQ7A 4X3FB 1YRPA 3LM5A 1SZMA 5CZIA 3PJ2A 3KU2A 4LRKA 5HU9A 4CKRA 3PP0A 3EN4A 3FV8A 3W8LA 4FV8A 3PLAE 4K77A 4YPDA 4KIKB 1W84A 3MN3A 1OUYA 2R3PA 3CSVA 1GJOA 4O7YA 1EH4A 2Y4PA 3DXQA 3KXHA 3TUCA 4G6NA 3UIMA 2QG7A 1CM8A 2ETMA 2VTHA 4LUEA 5CS6A 4UWBA 1PXJA 2VD5A 4RBLA 1VYZA 4N4SA 4B9DA 2XK4A 3LCTA 2QI8A 1RDQE 4M13A 4JAJA 3RINA 3UZPA 4TL0A 5L2QA 3LCOA 4JDKA 3SHEA 3R8LA 2VX1A 3F69A 2YM5A 3LMIA 5AP6A 3S3IA 5GIPE 3E8NA 3P78A 3PRFA 4IAAA 2Y4IB 4Y83A 3ZU7A 3PG3A 5GINE 2WTDA 3LXNA 4BWXA 2PZIA 2J0JA 3L9NA 4IB1A 3V01A 2YDIA 2BTSA 5AUVA 3SXSA 3PXFA 3RHKA 2QKWB 3TCPA 4BDFA 4CCBA 5CT7A 4U43A 4I94A 4PDPA 4PDSA 3ITZA 2NNWB 4EJNA 4HNIA 5EDPA 2EB2A 4FTCA 4XYFA 2E9OA 3LQ8A 4G5PA 1H0WA 3A61A 3V5PA 4Z16A 5HIEA 5HZNA 3EQDA 4AW1A 2J0LA 4BCHA 2QOFA 4FEQA 2W06A 2XNNA 4ITJA 5BVWA 3WZJA 3W18A 3E93A 4YHTA 5DE2A 3KN6A 3A8WA 3VW8A 2YLEA 3W2SA 2C68A 2Z7QA 2B9FA 3LKMA 3N4TA 4IANA 3G6HA 4BDGA 3R21A 2YAKA 3VS4A 3UP7A 5T6KA 5HBEA 1XBAA 3QQHA 5K9IA 4WD5A 3UGCA 1U46A 3L9MA 3OY3A 5IEVA 3PJ3A 2PVYA 5IQEA 5HNBA 3QD0A 3RNYA 2ERZE 3QXOA 4FZ7A 3IW7A 3UVRA 5IPJA 3U6IA 1GIHA 3BGZA 3EL8A 4L45A 5HE3A 4OAVB 1UNHA 3KCFA 2XM9A 4MWHA 3UNJA 4BWKA 3PPZA 5HX8A 1AGWA 2HW7A 2ZV7A 4ID7A 4IX5A 2PUUA 2CDZA 5DOSA 5AEPA 2ZM3A 5EM6A 2JDSA 5CSWA 3R2YA 4WSYA 4NW6A 5T68A 4CNHA 1UVRA 4O83A 2I1MA 3FJQE 1FGIA 3PVUA 3DBDA 4MAOA 5CSXA 1PMEA 4WNMA 5AADA 2R5TA 3LFCA 4LL0A 3D0EA 3U4UA 4X6RA 3R9DA 5J7BA 2HELA 5A9UA 4P90A 3LCSA 2JDVA 2BAJA 3AMBA 4TWOA 4XG6A 1ZLTA 1BKXA 4YLJA 4AT3A 1H01A 3HV4A 3SQQA 1AD5A 2CGWA 3MY1A 3MVMA 1ZMWA 4M7IA 5DBXA 4A4XA 3COMA 2UW8A 2PMNX 4R5YA 2B55A 2B9JA 3DZQA 1L8TA 5AR4A 3S95A 2IZUA 4I5HA 4EH6A 1P2AA 4BCMA 2YITA 3R8VA 4PNIA 3OG7A 3QBNA 4DTBA 1CKIA 1ZOEA 4D55A 4EOKA 4FG7A 4QMVA 5CNOA 1O6LA 4EOOA 2PVLA 1WBWA 3DNDA 1Y8GA 2GS6A 3PXQA 4FV3A 4JBOA 2C3KA 3LIJA 5M56A 4PQNA 2CSNA 4RJ6A 1APME 2VWZA 5HLNA 3D83A 4PMSA 1UNGA 4HYSA 3UZRA 3UIXA 5JKGA 4FV9A 3ZFXA 4DHFA 3O0GA 3QUDA 2F57A 5BUEA 2BRHA 4EBWA 3UO5A 3V5QA 5CQWA 2QLQA 4C4GA 2FGIA 3TACA 2P55A 3JXWA 4JVGA 3R1SA 1IR3A 3CTJA 3OS3A 3H10A 3TWJA 4AT5A 3KEXA 4FUYA 4ERKA 2X6DA 4D9UA 4FSQA 2OK1A 3VUGA 5HNGA 4EKLA 4DTAA 2Y9QA 3DTWA 5JT2A 5A4CA 4U9AA 3LXKA 3PVGA 3EJ1A 3Q6WA 5EI8A 4GS6A 4MBJA 3Q53A 3WILA 3LOKA 2H9VA 1ZXEA 4FVRA 3N4UA 3RPOA 1OL5A 3LCKA 5BYYA 3KKVA 1W98A 5D11A 3CS9A 3E7OA 4YBKA 4AAAA 1Q61A 2C69A 3EN6A 4O22A 1J7UA 2GHLA 2X1NA 4UEUA 2BFXA 3C50A 3D7ZA 2OIQA 5AP5A 3VAPA 4CGAA 2OXYA 2PVMA 4ANNA 1KOAA 4C8BA 4YC8A 3BU5A 5KHXA 3G0FA 4A9SA 3T9TA 4DFYA 1ZOHA 2UZWE 3ZCLA 5DMZA 5DRDA 5L2TA 2OFUA 3AQVA 2WGJA 4ZMEA 1RW8A 4K0YA 4L46A 5IKWA 1CSNA 3SGCA 3R2BA 4JIAA 4AGCA 5JZJA 4HCTA
chains in the Genus database with same CATH superfamily
2R3JA 4L9IA 4JNWA 5M4CA 3CJGA 4BZDA 4D58A 2WTKC 3BWJA 3EKNA 3QD2B 4KS7A 3E5AA 2W96B 4DTKA 3I5NA 1A06A 4JLCA 5AAFA 2WELA 4A06A 3KCKA 4NFNA 4HVGA 3MBLA 1H1SA 3PFQA 5T3QA 3RNIA 3MJ1A 2IW6A 4RWKA 4BGHA 2QOHA 3DCVA 3H0ZA 4TT7A 3UYSA 1W2DA 5ANKA 2BMCA 3I1AA 1CKJA 2EVAA 1FPUA 5D12A 5TT7A 3V6SA 4GIHA 5EI2A 3IK3A 1WVWA 3MH0A 1FOTA 3ZRMA 5K5NA 4DT9A 1OMWA 2X81A 4RLLA 4K33A 3CP9A 5K4IA 2GU8A 2B7AA 2QURA 4O0XA 4DITA 2HWOA 2W4JA 2PSQA 2OGVA 3F88A 3OP5A 2UW6A 1UU3A 5JSMA 4FKQA 2JEDA 4JQEA 4QMTA 5DEWA 4X2KA 4P5QA 5HOAA 4BDDA 1P4OA 2O2UA 3BX5A 3PJ8A 4OBQA 2QU5A 5KBRA 4GH2A 4BJJB 3BV2A 4YTCA 4UBAA 1KE5A 4XEYA 5AUXA 4BDKA 3BHHA 2P2HA 1LP4A 3A7IA 3G5DA 4AGDA 4ALVA 4G5JA 2YN8A 4QT1A 4C3PA 2SRCA 3AKLA 4E5BA 3C4EA 4QQTA 5E1EA 3FPMA 2C5OA 4X0MA 2WU6A 3OTVA 4CQGA 1FVRA 1H08A 3W2RA 5IA3A 1Y6BA 2O5KA 3F7WA 1NA7A 1ZZLA 2W7XA 3WZKA 1OM1A 4LUDA 4KABA 4ITIA 4CKIA 1V1KA 2XKEA 3VN9A 5BYLA 4YJSA 5CY3A 3BGQA 3G51A 3PXKA 5AMNA 3IW4A 4FI1A 4W4WA 2GQSA 3F61A 4U6RA 4YZBA 5L8LA 4AXCA 1BMKA 4CLIA 4KIOA 5HIDA 1TQIA 3HRCA 3QAME 4FKVA 1PF8A 4K9YA 3RAIA 4O0RA 4CZTA 4FKWA 1JKSA 3HMNA 3QWKA 5ANGA 3FBVA 5HESA 5AM6A 3Q5ZA 4O27B 3IPHA 3LFEA 5CQUA 2X7FA 3BYUA 4HYIA 4IZAA 3V8WA 3AKKA 2HIWA 3AC4A 3MIYA 4U40A 4NIFA 2PE0A 5HKMA 3HYHA 5D1JA 4KKHA 3NNUA 5ANEA 4KIKA 3WYYA 3EZRA 1GY3A 3HMMA 3AD6A 3W0PA 1IA9A 2XJ2A 3NCGA 3QC9A 4FODA 2C47A 4QMLA 4XLVA 5AR3A 2QHNA 4IB0A 4CFFA 3BBTB 4QDEA 5J1VA 4HVIA 3EN9A 4LGDA 1OB3A 4GFOA 3VS7A 3A4PA 4BTJA 4U41A 4F7LA 4RIYA 2ZDUA 1GNGA 4X3FC 2CGUA 4KS8A 5FTQA 4YC6A 3C51A 2VWWA 1MRVA 4YBJA 4WO5A 3QZFA 4O96A 3WARA 5HI2A 2QOBA 4R3PA 3QXPA 4RX8A 5JFWA 5KMMA 1PXNA 2JDRA 3R8MA 4EOJA 4TPTA 4TYHB 5FGKA 1Y8YA 3NPCA 2PVJA 3KULA 1FBNA 2EU9A 4LM5A 1H00A 1ZYSA 2HZNA 3C5UA 4U44A 2BRMA 4X2GA 3AXWA 3F66A 2JFLA 1SNXA 4QP6A 4XCUA 3CPBA 2YA9A 3KFAA 4BCKA 4CLJA 5J79A 4U79A 3UO6A 1PXKA 4ANMA 3QX2A 2XRUA 3VRYA 1BI8A 2JKKA 4C4FA 4ZY5A 2GTMA 3LCDA 2YZLA 5KMKA 4V04A 4XOZA 4BZOA 3OD6X 4PPAA 5FEDA 3G15A 2ITQA 3W2PA 1B38A 3VS1A 3ELJA 2I40A 3CY3A 5E8XA 4E8AA 1UA2A 4UMUA 5AAEA 4S32A 5A3XA 4C59A 2RFEA 4HGTA 4RIWA 2Y8OA 4QMSA 4FIGA 4AX8A 4EWQA 1NVRA 2UVYA 4GK2A 4TWCA 3R7YA 3EMGA 3FI2A 4QQJA 4D1XA 3FC2A 4FGBA 3DLSA 4GT4A 3FZRA 3QQJA 4GSBA 4W4YA 3JVRA 3TXOA 2OIDA 5A6OA 3QQUA 3HV3A 2X4FA 2HENA 1U54A 3F3ZA 3FHRA 2C6DA 3A7JA 2WB8A 4FTIA 3MS9A 4KIPA 2QOLA 3E87A 4F64A 1WMKA 1W2FA 3MI9A 4BYJA 1F5QA 2OU7A 2UUEA 3G0EA 4FKIA 5DWRA 2YCRA 4G3EA 4D2WA 3HMOA 3CY2A 3KVWA 4BR3A 2OZAB 2E9UA 4F6WA 4IW0A 3OCBA 4F99A 2DYLA 3QTSA 4JR3A 4O2ZA 4OTRA 4C58A 2CNVA 4GKHA 4G3GA 3BL7A 4G1WA 3NVMB 4Z9LA 3KIOC 4AOTA 4Z7GA 3ZXTA 3HDMA 4F78A 4QYHA 4CV8A 4A9RA 3OWKA 1H1WA 4DGLC 5CU4A 2VTMA 1WFCA 1DAYA 3HUCA 2UW0A 5FM3A 3RZFA 3U8WA 3UPXA 4W8DA 4NM7A 2W5AA 3S00A 2EUFB 5KMNA 4L3PA 4KB8A 4W4XA 4D9TA 2QOOA 5DGZA 5I3RA 5HE2A 4DAWA 4E4XA 4UB7A 4KD1A 4I22A 4FIEA 3EQRA 4N70A 2EB3A 2ZB1A 3DTCA 3NX8A 3ZLWA 2X8DA 4C3FA 3DLZA 3QRIA 3LLTA 3EHAA 4O7TA 4IHPA 4EOPA 3NRMA 2IZSA 2R2PA 4FGRA 1BLXA 5EG3A 4CZUA 4JRNA 4BGQA 3W0QA 2JKMA 4JQ8A 4L01A 4BDAA 5FTGA 5HGIA 3RTPA 3HP2A 4OTGA 1CKPA 4DFNA 2WNTA 5DT3A 4F6SA 4J95A 2X39A 1YXUA 2WTVA 2X6EA 2V55A 4JDIA 4C35A 5DH3A 4TW9A 4APPA 5FTOA 2I0YA 3A7GA 2OZOA 3ZMMA 4C7TA 4EOMA 2G1TA 3GU8A 3F7ZA 3ULZA 4NTTA 3G9LX 4U5JA 5ANJA 4RJ3A 4EH2A 2OJFE 4F09A 3VONA 3EYHA 2OBJA 4QNAA 1REKA 3WF7A 1OL6A 1Z57A 2ZB0A 1XMMA 5TO8A 2Z7SA 4YSMA 1OL2A 3FMKA 4XG9A 4FSZA 5CVGA 2XA4A 2CKOA 3ZYAA 1Q62A 3P4KA 3UO4A 4LYNA 2J7TA 2VU3A 1M7NA 1GZ8A 3I0QA 4GK4A 1OL1A 3BHTA 3O50A 3EN7A 4GVAA 1ZRZA 5K3YA 5A54A 3LQ3A 3PY3A 5EYKA 3BYMA 4RVKA 1LEZA 1Q8WA 3BYSA 2ITNA 4IWOA 2RSVA 4FG9A 2Z2WA 1U5QA 3VWAA 3QFVA 2GNIA 3NUYA 4PUZA 3BHYA 1W83A 2OH4A 4CVAA 3MFRA 1U54B 4RVMA 4M8TA 5CF4A 1H4LA 3ZO3A 5GJDA 3RMFA 4K18A 4EK6A 4XMOA 3C4FA 1QCFA 2R7BA 4LMNA 5CSPA 5IUHA 3UPZA 4YJRA 1PKDA 3ZLXA 5EI6A 1ST4A 2ITXA 4C57A 4CFUA 1H1PA 4IVDA 3U9CA 4QMQA 3HA8A 3TIZA 2ZJWA 3O2MA 4IVAA 3RZBA 4YTFA 3OWJA 2CN8A 1NVQA 2J5EA 4JQ7A 4EZ5A 4DHIB 2WTWA 5BMSA 5AV2A 4EH9A 5FDPA 4ZZMA 5LOHA 3PY0A 4FKGA 3DBCA 4QTBA 5BNJA 3K2LA 5CEMA 3KK9A 3MGYA 5C26A 4OAUC 3D2KA 3PIZA 2BZHB 3WI6A 4I0TA 5EH0A 3V3VA 4M67A 3GGFA 4I24A 4XLIA 3R30A 2ZDTA 4BKZA 4DINA 5LXMA 4TYIA 2VGPA 1J7IA 1G8AA 5C8KA 3A2CA 4UZDA 5AUYA 2YJRA 1ZYLA 5E7RA 1NT2A 2PL0A 3HNGA 5HG5A 3ZOSA 3NCZA 3OMVA 3EOCA 2WD1A 2WU7A 2IEWA 4J8NA 2B9HA 4KKGA 4KSPA 5H8EA 4E6AA 3BLRA 5IA5A 4ENYA 4S34A 2O3PA 4EUUA 2ZOQA 4ZSLA 3CD3A 3KXGA 4DEHA 2W5BA 1IRKA 4P5ZA 4BB4A 3ZXZA 4DEAA 3HP5A 3VJNA 2BAQA 2FUMA 1OIRA 4C4EA 2C6LA 4JRVA 4L68A 2H34A 4GKIA 4BGGA 3MA3A 5IA4A 3U4WA 4XG3A 2VTNA 1YOLA 4XBRA 3UMXA 3LFFA 3Q9XA 5CENA 3TZMA 3W0RA 2A4LA 2C0OA 3O23A 3OCSA 3ZFMA 3BYOA 4YZDA 4EYMA 2GSFA 4XX9A 4AFEA 4S31A 3EZVA 4R8QA 3QTRA 3SAYA 2I7QA 3JR1A 5M44A 4J7BA 3EFLA 2C6KA 4QPSA 4A4OA 2PVFA 2ETRA 3KMWA 3EQCA 2IVVA 4NJDA 1G8KA 2ITTA 3FQHA 4TXCA 2IW9A 5J9YA 4QTCA 3KF4A 4V0GA 5J5TA 3TNPC 2YLFA 3ORPA 3R00A 2B52A 4AZFA 4DN5A 2ITUA 3GQLA 5J9ZA 4YJUA 4XHKB 2XALA 3POZA 3AKJA 2YJSA 3TNQB 4I4EA 2OW3A 3ZRLA 4ANSA 2PE1A 3Q9WA 4I20A 4L53A 5DYJA 2EXMA 2BAKA 4IDVA 1Q4LA 5JZNA 4EOIA 2FH9A 4ITHA 4BDCA 5FUTA 5FP5A 3V8TA 4MXXA 5AR5A 2R3OA 3L8SA 5AUTA 3CBLA 5D10A 3CE3A 4DEGA 5M4IA 4M15A 5L2IA 3SVVA 4GK3A 4J52A 5CEPA 3R1NA 5EHOA 3NWWA 4FC0A 1H1RA 2XKDA 4ZSGA 2CCIA 2XK9A 3G6GA 3LXPA 3I6UA 3VNTA 3E64A 1Q24A 3C4XA 1FMOE 3K5UA 3NYVA 3KRWA 3H30A 3B8RA 3RPSA 4G16A 4EZ7A 1YI6A 3TEIA 3GC0A 1MP8A 3QRJA 4IB5A 5HE0A 4RVTA 4XNEA 4PMPA 3DXPA 5IH5A 2XB7A 4XRLA 3MTLA 2E2BA 4KWPA 5FXSA 3F6XA 2HY81 3OTUA 3R01A 1IASA 5JK3A 3IDPA 1OL7A 3F5GA 2F4JA 2W1ZA 2XK7A 4ZK5A 4E1ZA 3Q32A 4G9RA 1WVXA 2ITPA 5FXQA 3CIKA 2IW8A 2WXVA 4TKSA 3T8OA 5M53A 2WTJA 4AA0A 3F2RA 2JD5A 2HYYA 2YIQA 1M17A 4BKYA 2X7GA 3NYNA 1PXMA 2BDJA 3F82A 4DLIA 2J9MA 5KMOA 3P5KA 3VC4A 5EYCA 2JIIA 2VX0A 3PSCA 3HV6A 2VWXA 1SMHA 4JI9A 3PVBA 3PSBA 3UG1A 3DPKA 4YJQA 2YM8A 1P14A 1UU7A 1BX6A 2WQNA 3AC1A 3I81A 3MJ2A 4L7FA 2ZM4A 1VYWA 3O8UA 4QMNA 4O84A 3PZEA 5CVHA 2HZIA 2G2HA 1P4FA 5DI1A 2OICA 4FX3A 4FYOA 1TVOA 4PY1A 3O96A 4JX7A 5FEQA 3I0OA 3FZPA 2WKMA 3ORTA 4XUFA 5AJQA 4FBXA 5AP2A 3UE4A 5HLWA 4AXFA 4JDHA 3MY5A 3M2WA 3Q9ZA 4GCJA 3ATSA 5IQIA 3MA6A 3QA0A 4OBPA 3GOKA 4FNYA 3MIAA 4MF1A 4H1MA 4EK4A 4BBEA 5CAVA 3QTUA 2WMVA 4JG7A 5HCZA 3PIXA 4O1PA 4I6QA 3OOMA 5F9EA 2QO2A 4FV1A 3KXNA 1ZWSA 4H58A 2XS0A 2QU6A 5CYIA 4G17A 2XK6A 5K0KA 4I3ZA 3SRVA 5C4KA 1YDSE 1PHKA 2W4OA 5ETIA 5J7HA 2RGPA 3RPVA 2HCKA 5LWNA 1O6KA 3KRJA 3IQ7A 3TM0A 2HW6A 3WF6A 3UNKA 1ZMUA 1OZ1A 3BQRA 5EYMA 4P7EA 4NK9A 2YCSA 4HW7A 1YXTA 4PNKA 3UDBA 3UMWA 3BELA 4RC4A 4YLKA 1U4DA 4BCOA 1I44A 2P33A 3QL8A 3HX4A 4KBAA 4YGAA 3FMHA 5AV0A 3D7TA 4FG8A 4O7VA 4DCEA 5DPVA 5A4EA 3EL7A 4O82A 2BVAA 4MD9E 3NNXA 4F6UA 4U97A 4UYNA 2UW9A 4DEEA 3QCQA 4ALWA 4YO4A 4HPTE 3WF8A 3ZO4A 3GCQA 4WRGA 4F9WA 4BDEA 5EHLA 2JDOA 3F3UA 3R63A 5A4TA 3PYYA 5KZIA 3NAYA 3JYAA 3CD8A 5HG9A 3MY0A 2OJGA 5L6PA 4OTDA 3VF8A 2W1EA 4RGJA 3HL7A 4AN3A 3VVHA 3ZLYA 4AWIA 1YVJA 3TNIA 5HG8A 2XMYA 4EBVA 4FEXA 3DKOA 2PZRA 4XH6A 3TTIA 5CXHA 4E5AX 3U9NA 4BDBA 4M84A 5IH4A 4RX7A 4C2WA 5B2MA 4XV9A 3KL8A 2JLDA 3PIYA 3GEQA 3ATTA 4P2KA 1XH6A 3ORXA 2XEZA 3GFEA 4RG0A 4E26A 3PFYA 2W1FA 3TZ8A 1OIQA 1Q8UA 3E8EA 3ANRA 1IG1A 2X2LA 1ND4A 2ITVA 4F4PA 1UKHA 1W7HA 2QCSA 4CFWA 1YI3A 2BROA 2IN6A 3NUXA 4FL3A 4AU8A 3IONA 3GU6A 2UZOA 3R73A 5L8KA 2VTLA 4M69B 1OI9A 3JPVA 5IMEA 1R0EA 3VS3A 1QPDA 1WZYA 4IAFA 2YFXA 2FO0A 2XUUA 3RK7A 5L2WA 1U5RA 1SM2A 3VUTA 4EHZA 2A98A 4RJ8A 4DYMA 2RG5A 4GT3A 3U54A 2P4IA 4DH1A 5HVYA 2R3KA 2BIKB 3UVQA 4QP2A 4I41A 5EK7A 4YP8A 4FVPA 3ALNA 4LI5A 3QD3A 3OHTA 3R04A 3GCUA 5A46A 4WKQA 4DGGA 1R0PA 1OGUA 4QYYA 1YWNA 5AP7A 4FL2A 5F1ZA 1XH7A 1YW2A 4FTAA 4IJ9A 4O4BB 5CF8A 2X8EA 4EONA 3PZHA 4KRCA 1OIYA 2XCHA 3P79A 2CCHA 4FZAB 1GZNA 2OJIA 4CMOA 5LCJA 3PLSA 3C7QA 4LGGA 5DN3A 5BYZA 5KKRB 3BEGA 3QRUA 4EH7A 2UZDA 5C27A 1JPAA 2C3JA 4WUAA 4FK3A 3ZDIA 3UODA 5DR2A 2Z60A 3VUKA 4MX9A 5ANIA 1JQHA 2QG5A 4YJOA 3NSZA 3RAKA 3UOHA 3LM0A 4EI4A 3QX4A 5JFSA 2XAMA 3FQEA 3LAUA 4O91A 1UU8A 1ZOGA 3Q2MA 5IUGA 2VO3A 3MPMA 1PXPA 1OKYA 4UWCA 5DEYA 2NRYA 4D2RA 4X2JA 4ZP5A 4NT4A 5EOLA 2XNMA 3QQGA 4WT6A 4IX6A 4QRCA 2YCFA 3IECA 1KE8A 4DBNA 4I6LA 3FUPA 4CT1A 4JL9A 3OEZA 5CU2A 2XIKA 2W1GA 4JAIA 2P0CA 4FT5A 4ZTHA 3PE1A 2VAGA 2UW4A 2WHBA 5I9UA 3IO7A 2IJMA 4FF8A 4HVSA 4YNOA 5CVFA 3RAWA 4FMQA 2PHKA 2BRGA 3EFJA 3R02A 2XRWA 3TT0A 3ZC5A 3LLAA 4HGEA 3QCXA 4FV5A 2BRNA 4TNDA 4RPVA 4D4SA 3TKIA 2W05A 3F3VA 3VUHA 3LJ1A 1PMVA 5EQYA 1YXVA 3S1HA 3MFUA 3SOCA 4GVJA 2GNFA 3NNVA 2VTTA 4E73A 4BC6A 4E7WA 3H4JA 5AIRA 3WZDA 5HHWA 4EJ7A 2WIPA 3C0HA 5FRIA 3QZIA 4FTJA 3MDYA 5FBOA 4UWYA 3QU0A 3EFWA 5BUJA 3QKKA 3MVLA 4CMTA 2X2MA 2PVRA 2BUJA 3R71A 4UMRA 2YHVA 2AEGA 3TNWA 5L6OA 3W2OA 1JKTA 4MBLA 1G5SA 3E62A 2C6MA 3EFKA 2VNYA 5CX9A 2VWIA 1JSVA 2A27A 3DGKA 4LDTA 1H28A 4FZDB 4X6QC 2XYNA 5C03A 5M55A 3P7AA 2YIRA 2J0IA 3L9LA 5D7AA 4XG8A 3R9HA 4LMUA 5CASA 4G2FA 5GZAA 3R9RA 2PK9A 4MF0A 2R4BA 4G3CA 2QKRA 3WE8A 4F70A 5JQ5A 1PY5A 3RALA 4D0XA 2BZJA 3L8VA 3NS9A 5HICA 1IEPA 4FSTA 3LFSA 4F9CA 4FIFA 1YHWA 4O0TA 5HE1A 4EH4A 2IVTA 2JKQA 4FTUA 5E92A 1XO2B 4ASEA 4OUCA 1ATPE 3FLSA 2BPMA 3CEKA 3FMJA 1JSTA 3VBXA 4IZ7A 3OBGA 2J50A 4GFMA 4YUQA 3V8SA 4NFMA 2Y7JA 1BYGA 3LPBA 4FSUA 1KV1A 4Q5EA 4XV2A 4YNEA 4DH5A 1SVEA 3E8DA 1L3RE 3OXTA 4FTQA 3MVHA 2PMIA 3TV4A 1XH4A 2C6OA 3W1FA 5LVOA 3B8QA 2G01A 3ORMA 4GJ2A 4I93A 4JXFA 4LOPA 4M12A 2NPQA 3V04A 3ZUVA 4AZWA 2I0VA 5CTPA 2W0JA 3VHEA 4DC2A 3QGWA 4I5MA 1B39A 3LFBA 4AOIA 4GRBA 5JGDA 3FXWA 3KQ7A 3E88A 4RIOA 5CLPA 3VQUA 2IG7A 2UZLA 1P5EA 4FICA 3MB7A 5DNRA 3WF9A 3ACJA 4FV4A 1M14A 5DR9A 3KRLA 2BALA 4YJTA 3RJCA 3RWQA 4QDVA 4WSQA 1KE9A 4OTFA 3AC3A 3WBLA 5TKDA 2VO6A 5LMKC 4NYEA 1HCLA 1J3HA 3CXWA 2RFDA 4OTIA 3RM7A 1HCKA 5CF5A 3QYWA 4Y5HA 4YURA 4ZSAA 4ZMFA 1E1VA 3R83A 3L8XA 3TJCA 3AMYA 1WBSA 4GEOA 4RIXA 4YR8A 2ZMDA 4F9AA 4OR5A 3R1YA 1H27A 3Q60A 3RVGA 3ZBFA 4F1MA 4X2FA 4QPMA 4R6VA 3GU7A 2JAMA 4DH8A 4NW5A 4D4RA 4OLIA 2WMUA 3GCSA 3L9PA 3TIYA 4AZSA 2ZMCA 3W33A 4I0SA 4IX3A 4EEVA 5CEQA 2CKQA 3D9VA 5TF9A 2O65A 2R3GA 3TYKA 4WA9A 4NCTC 3QZGA 3PXYA 4YJNA 2E9NA 3IOKA 2G9XA 3QGYA 4FOCA 4K2RA 5LVNA 2F2CB 2F7ZE 1PKGA 1M52A 4USDA 5DRBA 4B8MA 5CF6A 3VBVA 3P1AA 2ITZA 3OY1A 1PJKA 3D94A 4MKCA 5ANDA 5H3QA 2WMRA 4UN0C 5IISA 2OWBA 3ANQA 4PPCA 3V5TA 4BDJA 4UYAA 4N6ZA 5BVOA 1DI9A 3IS5A 4L43A 1OUKA 5CAPA 5M08A 2PZPA 3LHJA 3R28A 4R1YA 4EHGA 3UQCA 4IAIA 3DDPA 2CPKE 2OO8X 3BLQA 2OJJA 2C1BA 4QMWA 4RZWA 2O63A 2WQOA 2OKRA 4EOQA 4O4FA 1T45A 3DXNA 4CYJA 4K6ZA 4XP2A 1BL7A 1W82A 3TDVA 1Y6AA 4RQKA 3PXRA 4PMTA 3CR0A 4EOLA 4EQUA 5EDRA 3GC8A 3GI3A 2WMBA 4M3QA 1JOWB 5I3OA 4IEBA 2RIOA 5EKOA 3CCNA 2YIWA 1W8CA 3BLHA 4QTEA 4ZJIA 2NP8A 5JGBA 1IAHA 4AGUA 4IM2A 1V0BA 2UZVA 3VULA 4C62A 3GXLA 2J51A 3I7BA 1Y91A 2A1AB 3W2CA 4WUNA 1MRYA 3AD4A 3VS2A 3DAEA 3DBQA 1VZOA 5B2LA 3EWHA 3TUDA 3EQIA 3I79A 4XBUA 2IF8A 1WBTA 1PMNA 3DAJA 4BCIA 2YABA 4WG3A 4RJ5A 1GIJA 4WIHA 4Y73A 4A9YA 4ACDA 3D7TB 3SW7A 5KUPA 3VF9A 2H6DA 3OVVA 5LARA 3RI1A 1WVYA 3ZS5A 3UYTA 2ZM1A 3ODZX 3GP0A 3JY9A 3UC4A 3WIKA 2VTSA 3OW3A 1XMLA 5KNJA 3DB6A 5BVFA 4L7SA 5J95A 2Y0AA 1ZYJA 5FM2A 3GUBA 3FQSA 4PP9A 4DLJA 5J1WA 4KKEA 4OTPA 2JC6A 2V0DA 4G6LA 4EQMA 4FVQA 4MTAA 4OGRA 4C61A 1X8BA 3QHWA 3SXRA 4C38A 3HMIA 4AW2A 4UMPA 4H1JA 3TKHA 4OTHA 2Z02A 2QODA 3GOPA 5HBJA 4CTBA 3NUSA 1VEBA 4MXYA 4CCUA 4D2PA 3HRFA 2VO7A 2F7XE 4I4FA 2PULA 4D2SA 4N6YA 4M0ZA 3DA6A 4FSYA 3ET7A 3COKA 1YOMA 1LUFA 4LOOA 3W8QA 4XOYA 3FMNA 4W9XA 3E63A 1A48A 3ZTXA 1I09A 3NUUA 3ZLSA 4GMYA 4NL0A 4K8AA 3QA8A 1KSWA 3IW5A 4EK8A 5DIAA 4FSMA 1XKKA 4EORA 2W99B 4O6LA 2X0QA 2FVDA 5AA9A 2R3QA 3R7OA 5IZFA 2RG6A 3GU4A 1FVTA 3MH3A 4YC3A 3B2WA 2WMWA 4YJVA 5FG8A 4CMUA 2C5VA 2WMAA 4O86A 4GG7A 3UDZA 4DFBA 4H36A 2ONLA 2FSTX 2WEIA 2WIHA 5KO1A 3NVKI 2R7IA 1H07A 4FKJA 4FJVA 1J7LA 3N51A 4GFGA 4BWPA 4IQ6A 4FTOA 3FKNA 2VWUA 4E5WA 1STCE 5IDPA 5BX0A 2ZV8A 2YIXA 2E9PA 4C4IA 3QQLA 5EOBA 3MV5A 2WO6A 4WBOA 3TZ9A 4JG8A 4DEBA 2X0GA 5HX6A 2PTKA 4IDTA 3MPTA 4FNWA 5EW8A 2GS2A 4RC3A 5I4NA 5IQCA 2GDOA 4QQ5A 1U59A 5JN2A 2YM3A 3I7CA 4FTMA 3G33A 2ZV9A 3DKGA 4G3DA 5CSHA 3RK9A 4IWDA 4CFVA 4AFJA 4PTEA 1ZMVA 1Q99A 4FIIA 5HTIA 5AIKA 4M14A 5CANA 3NYOA 4FKRA 4QOXA 5BMMA 3ODYX 3SLSA 1Z9XA 3U6HA 4LV8A 4C33A 4PL5A 4YSJA 5LWMA 1NY3A 3D2IA 3EKKA 3FC1X 5HVKA 4MWIA 4MXZA 4V05A 3G2FA 4J8MA 4Q9ZA 1TKIA 5I9XA 2BIYA 3E3BX 2XH5A 2R3HA 4L8MA 3LMHA 5IA0A 3D5UA 1V0PA 2B53A 2JDTA 4IC8A 2CNUA 3Q4CA 4RFZA 1R1WA 4D1SA 3HECA 2VTJA 5M07A 3QTWA 1TZDA 4FK6A 3D14A 3ORIA 2UVZA 1HOWA 3EH9A 1UKIA 5LQFA 4ZSEA 2PMLX 5BPYA 3A7HA 4FTLA 4QMPA 4S33A 3KB7A 5AWMA 4ZY4A 4RWIA 2G15A 2XNOA 3KGAA 2W9FB 4XG2A 3GCVA 1LR4A 3PY1A 3WZUA 1ST0A 2VUWA 2C5NA 4ZAUA 3RP9A 3NGAA 5AP3A 5H8BA 4JT3A 3W0OA 4BI2A 2A2AA 3Q2JA 2CGVA 4FKSA 5JRSA 5M4FA 2EXEA 4U3YA 4HPUE 4U81A 4YMJA 3PDTA 1IA8A 4QP7A 2V7AA 4BTMA 3SC1A 4OTQA 4AW0A 4FTKA 4DF3A 3II5A 4J96A 5F94A 4QP4A 4MVFA 3OZ6A 4C36A 4PV0A 4Y5QA 4KBCA 5ETAA 4ZJVA 3MYGA 4FV2A 4KIQA 4DGMA 2FSOX 3G90X 4QMOA 4I92A 5JFXA 3S2PA 4JX3A 5A6NA 3H9OA 3CKWA 2XNPA 4AE9A 4ACHA 4BCGA 4I1ZA 4ANOA 3Q4UA 1UU9A 1GAGA 4NWMA 5HORA 4EZ3A 4RVLA 3FXZA 2XIXA 3ORKA 1G8SA 4RIYB 3A4OX 5K5XA 4CG9A 5B7VA 4O2PA 3ORNA 3JS2A 1PXLA 4C0TA 3UTOA 3BV3A 3ZZEA 3MESA 3GFWA 3F3TA 5AV1A 3UDSA 3FL4A 3ID6C 1PMUA 2IWIA 2G2IA 3MSSA 4RLKA 3CQUA 2JITA 3V5WA 1ZYDA 4D1ZA 2HXQA 4ANBA 2AYPA 2HAKA 4L6QA 2P2IA 3AT2A 4G34A 2XIZA 2KTYA 3IDBA 4KSQA 4NUSA 4D2TA 3UOKA 2QR8A 5AR7A 2XKFA 2YEXA 4BDHA 4EH3A 4D5KA 5F20A 3QRTA 5AM7A 4EWHA 4DG2E 4OTWA 5L4QA 2NYAA 2YM6A 2ITOA 4JBQA 3IGGA 4NM0A 4F1TA 5LCKA 3IW8A 3PXZA 3PA5A 2F9GA 4O0YA 4TTHB 1OPLA 3PA4A 4GIIA 4DA5A 4NU1A 3NUNA 4QYGA 1Q8ZA 2GHGA 4AP7A 3UZTA 2NO3A 3F5UA 4ACCA 3DDQA 5GNKA 2VZ6A 4Q9SA 3MFSA 3VHKA 3E3PA 3DAKA 1KWPA