3O8PA

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
336
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILGFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 336
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o8pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o8pA01
5AP1A 5L4QA 1R1WA 4I5PA 3Q32A 3R8MA 3LOKA 4DFYA 4TTHB 2RL5A 2R7IA 4QPMA 1QCFA 2CHLA 5FDXA 1PKGA 3BYUA 3COKA 3P86A 3EQPA 1M7QA 2XK4A 4GK3A 2ESMA 3MIYA 3NNXA 4X2KA 5KKRB 5KBQA 4CFNA 3T9IA 1MQ4A 4FGBA 3RPSA 1O6KA 4IACA 4DH7A 4BTMA 1XH5A 4FNZA 4BBMA 4EONA 5ACBC 3TM0A 4FVPA 2XK8A 4GRBA 3ZSIA 1ATPE 5BVFA 2XM9A 5HNGA 4D5KA 2BZHB 1TKIA 2YABA 2VU3A 4ONAA 3WZUA 5HESA 2W5HA 3PLAE 3LFSA 3H30A 4EHVA 3IECA 1GZKA 4DG2E 2BZIB 2A4LA 1Q8YA 2H6DA 3EYGA 4AZEA 5H2UA 5HO7A 4C7TA 5HORA 3GVUA 3JR1A 3AMYA 2OGVA 5CVHA 4KA3A 1S9JA 3QC4A 5DT3A 1K3AA 4KSPA 4P90A 4OTRA 1RQQA 3QD0A 3DBFA 3IK3A 4RSSA 3PA4A 4QYEA 3OF0A 4YSJA 5IH4A 5M09A 3C7QA 2OICA 3ZZWA 2WMSA 5C8MA 3DKFA 3G0EA 4C02A 2OIQA 4G9CA 1H07A 2GPHA 3IW5A 4J98A 5E8TA 4EH6A 3DK6A 4F99A 3U6HA 2PPQA 3PZEA 3P4KA 5FBNC 4XOZA 3RGFA 1S9IA 2WMRA 1GZ8A 3RVGA 5AV0A 5CYIA 4J8NA 4WRSA 3FL5A 4BHZA 2R5TA 4LL0A 4YHTA 5I9YA 3ALNA 2B52A 1H28A 3G9NA 2OJJA 3BEGA 3PSBA 3FXZA 5L6PA 2W1GA 4EZ5A 4D55A 4WRGA 3E7VA 3W33A 3COHA 4Y72A 3TN8A 4AGUA 5IQDA 3FKNA 3LIJA 2OBJA 3DTWA 1PXJA 1LEWA 3C4ZA 4AZVA 4RJ6A 3NIZA 4YGAA 3D4QA 3ZFMA 2V55A 4J96A 4GJ3A 3RKBA 2BROA 4QMWA 2YIWA 5DEYA 1E1XA 1PW2A 4NCTA 4FSYA 4NJ3A 3EOCA 3FHIA 4AOTA 1T45A 1BX6A 2W1EA 5JKGA 4I92A 2C68A 1BMKA 5D9HA 5AUXA 3TT0A 4BI1A 1B6CB 2G9XA 1YHSA 4IC8A 1WCCA 2YIRA 4YJTA 3AQVA 3C51A 5E92A 2VGPA 3WIKA 4AWIA 3L1SA 4CFWA 5GJDA 5EW8A 3UQCA 4G1WA 3WE4A 1UA2A 2VTSA 1R39A 1H26A 3FLSA 3FLNC 3LFBA 3OZ6A 2X2LA 5TT7A 4BC6A 1ZYLA 5BVKA 4ACHA 4Z7HA 4DFNA 5M4CA 3RPOA 4WG5A 3WF9A 3V8TA 2Z7SA 4OAUC 4XV9A 2H96A 3EQBA 5M53A 3DBEA 5A4QA 4G3FA 3AOXA 2QO2A 5CEKA 4YJNA 2OZOA 4PQNA 2CNQA 4XG3A 3I1AA 4IB1A 4ZZMA 2RFDA 2HELA 3OG7A 2F57A 3DQWA 1FGIA 2FGIA 2QQ7A 2C0TA 4B8LA 4C38A 1H1SA 3MH3A 3SXRA 2ZDTA 4FMQA 2BRGA 4XBUA 4ZS0A 5JEBA 4BF2A 4B8MA 2E9NA 2R4BA 2OJFE 4O38A 3VS2A 3EL8A 4YO6A 3ZMMA 4ERWA 2XNPA 3ZCLA 1QMZA 1YWNA 3Q9YA 4XG7A 5C4LA 4XLIA 2J0MB 2HWOA 4AXAA 3RZFA 3SVVA 5CX9A 5CAQA 2R3OA 4KINA 4FIIA 3OW4A 5EW3A 4EBVA 2R9SA 2X81A 3OY1A 4ZY4A 1J3HA 4RIWB 4C2VA 2VNWA 4HYSA 1PMUA 3GB2A 4M67A 4E4NA 3V5TA 5FTOA 5AM7A 3AC2A 1CM8A 1OBGA 3II5A 4L45A 4MWIA 4DA5A 5AP6A 4UYAA 5EI8A 3U9CA 3KCKA 3HV4A 2WMAA 3L8SA 2VTQA 1M7NA 2EU9A 3U87A 1KUTA 3W1FA 1ZLTA 3C0HA 3DV3A 3KF7A 5IISA 3QTSA 1NT2A 2Q0NA 4FKGA 4QMOA 4AZWA 3WI6A 4DG3E 3GT8A 5ANJA 2P55A 2RKUA 4O27B 4N4SA 3MDYA 5AMNA 1Y6BA 3IDBA 5EH0A 3MPAA 4V0GB 1YI6A 1Q3DA 4RWIA 3UOJA 1FBNA 1XWSA 4GT4A 2NRUA 2YERA 2VWZA 4FZ7A 5DNRA 2FH9A 4IH8A 3OOMA 5BMSA 3PRFA 4EH7A 3BE2A 5EQPA 3MB6A 1JAMA 3NUNA 3ZHPC 4FNXA 4MX9A 4O7TA 2GHLA 4EHGA 4IAIA 2WZJA 4TYHB 4IAZA 4MNEB 3MFSA 5CZIA 3PXRA 2XNGA 3ZYAA 3LFCA 5JRSA 2V7AA 3G0FA 2QC6A 4G2FA 3UNZA 4BVUA 3D7TB 5HU3A 3QXPA 4MHAA 3OCSA 4RZVA 4YC3A 1SVGA 4H1JA 4AOIA 1G8SA 3PZHA 1XBCA 4U0IA 5IA2A 3UIUA 4KIOA 4YLJA 4U3YA 4ZJIA 2C5XA 1H0VA 1WBNA 5TO8A 5D12A 3W2OA 2VD5A 3H4JA 2OG8A 4L42A 2ITXA 4RJ4A 4R77A 3RM6A 3RBWA 5J7BA 2OLCA 3GC7A 4L6QA 3HL7A 4QMYA 4L43A 3A61A 2VX3A 4EOSA 1IAHA 5JZJA 4RIXA 4IX6A 5HHWA 1YXUA 1YDSE 1XHAA 4U45A 5KMOA 3ZZEA 5KMJA 1PMNA 1CSNA 4X2FA 3C5IA 3C0GA 4DTBA 2HXQA 4TWOA 2BRBA 3EH9A 2W99B 4S30A 3JUHA 2VWIA 4KIPA 3PDTA 4H1MA 2WEVA 5C9CA 4OBPA 5HGIA 2DWBA 3HP2A 2WD1A 4K8AA 3TKUA 2I0VA 2J0IA 3KK8A 2CCHA 1OL6A 3AC4A 2W1IA 3FMKA 4FYOA 4NJDA 4OTIA 3L8XA 5CSWA 5CWZA 3R8PA 3VUHA 2HW7A 4IVBA 3ZONA 3B2TA 5IMXA 2ITUA 1IG1A 4RQKA 3QQLA 4QPAA 3PA3A 3PXKA 3NWWA 5CI7A 2UVYA 1OPKA 5AP2A 3QQGA 2JDRA 3IGOA 3ANQA 1CKPA 2FA2A 3B2WA 4O0VA 5DHJA 4YPSA 5H8GA 4V04A 4D0WA 3QQHA 1BKXA 1YXTA 3NCZA 4KIKA 5AR4A 3S3IA 4G9RA 2W1CA 4CMTA 2WU6A 1UV5A 4EL9A 3FSFA 4R5SA 3PIZA 2QOHA 1H00A 4FVRA 2NNWB 3IOPA 5CU4A 1P4OA 4HCTA 3FWQA 5LVNA 2GS7A 2C0OA 4GK4A 5ETAA 1LUFA 4II5A 3W2RA 4BCNA 5C4KA 2R3IA 1HCLA 3QTWA 5LVMA 3DT1A 2YDIA 3E7OA 1TQIA 3L9MA 4TXCA 1DM2A 2X0GA 1KOBA 1RW8A 3RMFA 5AFVA 2OXYA 5F94A 4ZS4A 4BDAA 4C36A 3A8WA 4BDKA 2RIOA 5ITAA 4JBQA 4ANMA 4AN3A 3U9NA 4X7QA 2IVTA 2UV2A 1WBTA 3TJCA 3CD8A 4YZNA 3OUNB 4FIEA 3HMPA 3KRRA 4AUAA 3QRKA 4M13A 4KBKA 5EM6A 1OITA 3BHVA 4JLCA 4YMJA 1NW1A 4A9YA 2WMTA 2VO0A 1OKVA 3A7FA 5LJJA 2CN5A 2PVRA 4FODA 4U81A 3VBYA 3QRIA 4QP9A 3ORNA 3ERKA 3TKIA 5BUEA 5K9IA 4GT5A 4BKYA 4RC4A 3ZC5A 5I3RA 4IAFA 3DDQA 1VR2A 2R2PA 3D15A 4XCUA 4AS0A 5GZ8A 1XBAA 3PXZA 2X2MA 1Q3WA 2BTRA 2QOBA 4RIOA 1NVQA 5IMEA 4BDIA 3ROYA 2VTJA 3PJ2A 4I5CA 3JVRA 3MS9A 4MBJA 1OL1A 1W98A 4EH5A 4O0WA 3NUXA 1OKZA 5ANIA 1JKTA 5K0XA 4QO9A 5CEQA 3TEIA 4IW0A 4K1BA 4U40A 3LXLA 2VV9A 3B8RA 4O2ZA 2WMBA 3L9NA 4D2RA 5EOLA 1Q8ZA 2UW3A 3IONA 4OUCA 3QKKA 4FSZA 2HZIA 3R1QA 5E4HA 4IDVA 4FI1A 3TV4A 2I1MA 4IZAA 3WARA 2JAVA 2YIXA 4BCFA 4XBRA 5EOBA 3EB0A 4L8MA 3MA6A 4XP3A 3RAKA 3CTHA 4HJOA 1IAJA 4ZAUA 4HCUA 1IEPA 2XB7A 3R9OA 4FNWA 1MRYA 3U4UA 4PDPA 1GIIA 3R7EA 2HOGA 2BZKB 4D2WA 1BL6A 4UMPA 3NYNA 4NKAA 3HMMA 1OKYA 3D5UA 2OJIA 3GC8A 3TTIA 4IFCA 5EHLA 3DBDA 3DDPA 4FTTA 4EH8A 3JPVA 4H05A 3BCEA 1W82A 3Q4ZA 4W4VA 4AA5A 2J5EA 4I24A 1L3RE 4C3RA 4CRLA 4YZCA 4BCQA 3KC3A 4QD6A 4WUNA 2GNLA 4W4XA 1Z5MA 2QG5A 5DBXA 3UBDA 1GOLA 3AT2A 4RWLA 2UW9A 4QMPA 2JIVA 4R1YA 3S1HA 2A1AB 2XKCA 5AX3A 1OM1A 2C5NA 4K77A 3KXXA 3ZTXA 3VAPA 4LOOA 4D58A 2PVHA 3FQHA 4RIYA 1HCKA 4XG8A 5IA0A 5J5TA 4CTBA 3UPZA 4Y46A 1V1KA 3BHHA 3EN6A 1ZZ2A 3BYSA 4YR8A 5B2LA 5IEVA 4OLIA 4Q9ZA 4U3ZA 2EWAA 2VO7A 2JAMA 3VS0A 3EIDA 3KCFA 1KE9A 3NRMA 2X8IA 1XH9A 2ZMCA 4RA5A 5BVDA 1APME 5K0KA 3QLFA 1DAWA 2BDJA 2HXLA 5CNNA 1U46A 3E5AA 1REKA 4GJ2A 4S2ZA 5AUUA 3C0IA 5JRQA 4F0FA 5C1QB 1SNXA 4ZJVA 5FG8A 3E88A 5H8EA 4OTDA 1PXMA 4NM3A 2A19B 5EYDA 2C6IA 3PY3A 2ETRA 3RAIA 5CEMA 2OZAA 5EHOA 3EQRA 3WF6A 3Q60A 2WTKC 3PSDA 4TY1A 3PUPA 4MD9E 1KE7A 3ZLXA 3GU4A 4YJUA 4A4XA 1YVJA 5M4IA 4AG8A 5I9ZA 4UMRA 1H1WA 2WMQA 3I6WA 3BLHA 4HVHA 5JT2A 4OT5A 2XYNA 3SLSA 3VUMA 1PXNA 4B7TA 4A9TA 3OMVA 2YM4A 1H1PA 4L44A 3ZDUA 5D7VA 4CFXA 4YHFA 1LPUA 3D0EA 3UYSA 3UYTA 2CGWA 2WQEA 5TKDA 4ANLA 3CCNA 1OPJA 4IX5A 1O6YA 3D5XA 2P3GX 2VN9A 4RFYA 3VUKA 3COMA 4GW8A 4NM5A 5EDQA 4FSNA 3FKOA 4ZXTA 4I0SA 5TF9A 3T9TA 3UTOA 4F9AA 4ZTMA 3HAMA 3FZOA 1WVWA 2QOFA 1Y8GA 4NIFA 4QTDA 5IQGA 4JXFA 4LGGA 4C37A 2UZVA 3HMNA 4DEIA 1UU9A 1J7LA 2B9JA 2W1ZA 4X2JA 4HYUA 5G1XA 5A14A 3D9VA 4FOBA 3H9OA 3UG2A 4EBWA 3V5QA 1PXIA 1SNUA 3NS9A 4FTNA 3I7CA 4FT5A 4AZSA 3PP1A 2O5KA 3UP2A 4FEQA 4GVJA 3TUDA 3QTXA 4UXQA 2HZ4A 5I3OA 3G51A 3BELA 3QUPA 4EOQA 2QI8A 4FZ6A 1NXKA 3ZM9A 2WQBA 2UZNA 4G5PA 4O6EA 3VHEA 3FMDA 3W18A 4D5HA 4KBCA 3HDMA 4M84A 4GMYA 2AC5A 3QZGA 3VF9A 5BYYA 3O71A 3HV3A 4LOPA 4RX7A 5LWNA 3HVCA 4UWBA 2XS0A 4ZSJA 3DXQA 4AZFA 4EK8A 5A4EA 5IF1A 2QR7A 3C4WA 4ZIMA 3VWAA 2UW7A 4IXPA 3WBLA 4UX9A 3MESA 2YACA 5FWKK 2WTVA 5HCYA 2BAJA 4YURA 5BX0A 5DN3A 3BX5A 4F9CA 2UZDA 3R22A 3F3VA 4GYIA 3AC3A 4N70A 4O0TA 5CSPA 2G15A 3ENMA 2ITTA 3VS4A 1Q97A 2ZVAA 4AA4A 4GV1A 3SC1A 2C6TA 3CE3A 3ZSGA 5HE1A 3DFAA 3K5UA 3RNYA 5IQBA 2CLQA 2PSQA 3PY0A 3AGLA 5JQ8A 3LKMA 5F4NA 4EK3A 4ERKA 5IU2A 2EVAA 4AT5A 3GENA 5BUIA 4K9YA 4KUJA 2CMWA 3VF8A 3R8ZA 3SRVA 3A60A 4DH8A 5I9VA 3OHTA 2X8EA 5CANA 5ETFA 4K18A 3BBTB 4MXZA 3PA5A 3O7LD 4W8DA 5DH3A 1VZOA 5E1SA 5EI2A 4BDGA 3HAVA 2H8HA 3DA6A 2BFYA 3UOLA 2B53A 2UW6A 2YCQA 3R2BA 5IA3A 2JFMA 3CLYA 4TWNA 5HIBA 4XRLA 5J9YA 3GCSA 5AP5A 4G6LA 4I41A 3CKXA 4EEVA 4EH2A 5HBJA 4CFFA 2GTMA 4U41A 4YUQA 2PZYA 3NNWA 3TNWA 4IMYA 4AZTA 5L3AA 4H3PA 4USFA 4BKZA 4M66A 3K2LA 3MH1A 4NTTA 4A9SA 3MIAA 4P7EA 2YIYA 4IB5A 3JY0A 2IVUA 3UPXA 4ANNA 3W55A 2QU5A 3HV7A 4WSYA 2X7GA 4LRKA 4ACMA 4EI4A 1J1BA 3ZSHA 4EJ7A 2Y7JA 3MYGA 4G5JA 4I20A 1GIJA 3U6JA 4U80A 4AGDA 2UZUE 3OY3A 3QRJA 4QMVA 1JKKA 2J90A 3G6GA 5CASA 4F9WA 4FG7A 3QYZA 3VC4A 5CAPA 2VRXA 3FY0A 3VJOA 1H1RA 4MK0A 1F5QA 4O0YA 2GU8A 2EXEA 3O0GA 5HE2A 2VWBA 2LAVA 3NVKI 1YXSA 2PVJA 3F3UA 4GKHA 2FSOX 2HY0A 2G2IA 5FXSA 2W4OA 4M69A 3EN9A 4I6QA 1FVVA 2Y8OA 3QBNA 2FSMX 1YRPA 3OTVA 4YTIA 5HCXA 3VQHA 4F6WA 2HENA 5GJGA 3VUIA 1I09A 3A8XA 2VX1A 4LGDA 4PDOA 3OXTA 5T3QA 5IQHA 4NFMA 3FYJX 1UU8A 4L7FA 4CKJA 5KBRA 4IANA 3I79A 2C6DA 2XF0A 3OXZA 1XKKA 4CYIA 4ZLYA 5IG1A 2PUIA 3KL8A 3QWKA 4FNYA 4HYIA 5CU0A 3GC0A 5AUVA 4XV2A 2VTHA 2R3QA 3CGFA 4Q2AA 3BHYA 3VQUA 4XJ0A 4FKOA 4K33A 3DAJA 2XNEA 3LQ3A 1DI8A 2IO6A 3Q6WA 4USEA 5KMNA 2VTMA 3BWJA 5E8ZA 2J51A 3C13A 3NAXA 4I6BA 2BIKB 5HNIX 4L46A 4DYMA 4EJNA 5JGDA 4P2KA 3RI1A 3R00A 1H0WA 2W7XA 3FI3A 3PY1A 3UZPA 3Q96A 4AU8A 1QPEA 4NFNA 5DE2A 2O64A 3UZRA 2VWXA 4FTAA 4AW5A 2W5BA 3H3CA 4FTUA 5LMAA 2BVAA 1H27A 3QKLA 3C4FA 4FKUA 4NCTC 4R1VA 5CZHA 5E91A 5HBHA 4YTFA 3TG1A 1WBOA 5AV2A 1U5RA 1BUHA 2IZTA 3I7BA 4PWNA 5M07A 2HZNA 2J7TA 2J50A 4P4CA 5CEIA 3QHWA 5HG9A 5AAGA 1BYGA 2R3LA 3DK7A 2H34A 3BIZA 4HVGA 4RIWA 3V8SA 4FSRA 3R02A 3MPTA 5FD2A 5J1VA 1E9HA 2GCDA 2ITPA 2WMUA 3R1YA 3SDJA 3ZBFA 4DTKA 3FZ1A 1KE5A 4B9DA 2PWLA 4L53A 4F1MA 1SM2A 2C6KA 5IUHA 3MFTA 4EUTA 4FKJA 4D4YA 3DJ6A 5HZNA 4CZUA 4OR5A 4IZYA 4D2TA 3ZXTA 5HTCA 4D1ZA 4CKIA 2YIQA 5LWMA 3D83A 4MF0A 1KE6A 5DRBA 2PUUA 2XA4A 4FL1A 2HK5A 1CKIA 3EQCA 4YJOA 4O83A 3UO4A 3OEZA 1FMKA 3IDPA 3OROA 5EDRA 2IG7A 2QONA 2J0LA 4IB3A 3FXXA 3H10A 4IJ9A 3ORLA 3AMAA 4V0GA 1PF8A 2WFYA 3MGYA 3NCGA 4ID7A 2QOKA 4KS7A 4RX8A 4FE2A 2RFNA 3QCYA 5AV1A 4CXAA 5DMZA 3UVQA 4J1RA 5T6KA 3DJ5A 3ZH8A 5EI6A 2DUVA 2R3JA 4FTCA 3ITZA 4Y83A 4CFUA 3V01A 2QO7A 4CLIA 2WQOA 4F65A 4BI2A 3IDCA 3ZBXA 3WYXA 4CRSA 1R3CA 4ENXA 4PY1A 4TYHA 2GHMA 1H25A 1WVYA 4DHFA 4E1ZA 3AMBA 3EQFA 3LCOA 4MNEA 5D10A 5LARA 2UW4A 3CIKA 3G2FA 3MBLA 4EOIA 4ITJA 4R3RA 1Y91A 4A07A 5CS6A 3D7TA 3SAYA 5LVLA 1URCA 5KZ0A 1KOAA 3S00A 2XRWA 4O96A 1XO2B 4ZLOA 4DFLA 3DKCA 4AE6A 1YWRA 2PVFA 3RP9A 3W16A 2IPXA 3LFDA 4FV2A 3FKLA 3QCXA 2X7OA 3Q4UA 4IX4A 4NK9A 4F63A 4I5MA 4CVAA 3ZFYA 3ZLSA 4FTIA 3VS3A 1GAGA 3D2IA 3O8TA 1MQBA 4CCBA 5J1WA 3TV7A 4O7VA 4GT3A 4GU6A 5HG5A 3SG9A 4TYGA 4G34A 3MTLA 5E8XA 4FBXA 5ETCA 3VBQA 4L3JA 5FGKA 2WTKB 5HG7A 3F82A 3NZ0A 4LI5A 2PVKA 3OEFX 4PP9A 1XH7A 2YCRA 4FF8A 4AW1A 4F9YA 3FMEA 1UWJA 2UVXA 4XMOA 3TCPA 3FMNA 1PKDA 2PTKA 2BKZA 1OL5A 5CSVA 4EHEA 4OTGA 4L7SA 3QGWA 3F5GA 4C33A 3QD4A 3RJCA 5TE0A 3GXLA 2UZLA 3S2PA 4I23A 4NH1A 2XUUA 3RZBA 3ZFXA 5IDPA 1AQ1A 1M2RA 3CEKA 2KTYA 3V8WA 3U54A 4YJPA 5CAUA 1JSUA 3HNGA 4AW2A 3UDBA 4IAYA 4BTFA 3PG1A 3JY9A 4RT7A 4DE4A 4OGRA 2BR1A 3SOCA 4GIIA 2WTDA 4BN1A 3CQUA 3TNQB 5AP0A 3PJ8A 4BGHA 4K0YA 1OGUA 3W2SA 2Z8CA 4XP2A 4W4WA 1W0XC 4PMTA 2QOCA 4I0RA 4DINA 4L52A 4U7ZA 4O7SA 5T68A 4HW7A 2EB2A 3JYAA 3GNIB 2E9VA 5CQUA 3ZO3A 3UNJA 5JGAA 5KUPA 1X8BA 3D2KA 1IR3A 4FZAB 4ZTQA 3QRTA 5CSHA 1JBPE 1YDRE 1FGKA 4ZTNA 4M97A 1R0EA 5L2TA 4CZTA 3CY2A 4ZTHA 4DH5A 4DT9A 3UE4A 4ZSLA 3QQUA 2J0KA 3QD2B 3R2YA 4FKVA 3O17A 4GG5A 3DY7A 2VTAA 2Y4IB 3Q9XA 3QHRA 1R78A 4DEHA 4F09A 1UWHA 3M42A 3CC6A 4WNKA 2C5OA 3LFFA 1LEZA 3Q5IA 3R73A 3V5PA 2C6OA 3W8LA 4C8BA 5CEPA 4UV0A 3VVHA 1QPCA 4S31A 2GNHA 3OCBA 4X2NA 4EH4A 3DXPA 4GYGA 2C30A 2PHKA 3HYHA 2XKFA 4QNAA 3CTJA 3ZS5A 2C69A 1U5QA 4E5WA 5HTIA 4DFUA 1WBSA 2C3KA 3G33A 3EFWA 3V51A 4DEAA 3QZIA 3PFQA 3DBQA 4EZ3A 4FZFB 5ANKA 1U54A 3KY2A 5FTQA 5BVEA 4J52A 4ZZOA 5IPJA 4G31A 3PJCA 3SXFA 4Z16A 4WG4A 2YWVA 4FTLA 1J7IA 1YHWA 2W1DA 1Q8WA 2BRMA 3AD5A 1UNLA 2W06A 3ZU7A 4G17A 3TDVA 4PTCA 3GOPA 4BTJA 2VUWA 3FZTA 3LLTA 2VO6A 3QZHA 3TZ9A 1OIUA 4X2GA 3E92A 3ORIA 3ZO2A 4V01A 1GZOA 3KULA 3R04A 1ZARA 3QGYA 5HIEA 3O50A 4HGLA 4WIHA 2VTOA 3P1AA 3BI6A 4EOMA 4GIHA 2ZV7A 3QC9A 3EFKA 2ITOA 2PVLA 4FKWA 5CAOA 1Q99A 1OB3A 2Z7QA 1GNGA 1JKSA 4B6LA 2FB8A 5K3YA 3E8NA 2HWPA 4DEBA 2SRCA 2XJ2A 4RZWA 4CD0A 1OECA 3UIXA 2VTTA 4O0SA 2A2AA 4F64A 3LVPA 3F5PA 1ZMVA 3BLRA 3OP5A 5AA8A 3O51A 3ANRA 5HI2A 2PZPA 2Q0BA 3AC5A 4QP7A 3UOHA 4APCA 4CTCA 3GGFA 2R3FA 4TYJA 4BCMA 2YM3A 2XBAA 4M68A 5ETIA 4GVAA 3ZEWA 2X4ZA 3ZOSA 4C4GA 4N6YA 2BHHA 1STCE 2PL0A 4JDKA 4BZNA 4ASXA 1G8AA 5L2QA 3RCDA 3IPHA 2Z7RA 1MRVA 3AGMA 3NNVA 4OTWA 3VBVA 5JQ5A 3S95A 3VS6A 2WGJA 2F7EE 4FG9A 5JMSA 1RJBA 4C4IA 2I0YA 2ZDUA 2VWUA 3QQFA 4UBAA 4W8EA 4FVQA 3EL7A 3KN5A 1IA8A 4ALVA 2OW3A 2PE0A 4FV4A 4USDA 4NW6A 2B0QA 3KVXA 4FL2A 1JLUE 3NUYA 2WAJA 2XK3A 2ZB0A 3WOWA 4EOJA 4OTPA 5AIRA 4RFMA 5I5ZA 5JFWA 2IW6A 2ZV8A 4FTKA 1NA7A 1NY3A 4HNIA 3P08A 2XVDA 5CQWA 3UIMA 2OJGA 5EM8A 3VBTA 4LOQA 3LFEA 4H36A 4ASEA 3GI3A 1YI4A 4BDJA 3L8VA 4CT1A 3U8WA 3QALE 5CF5A 5J5SA 2X9FA 2YDJA 3PJ3A 2E9PA 1ZZLA 3IW6A 5EQEA 4I5HA 5IQAA 4G3CA 3TV6A 2RFSA 4ZMEA 4IE9A 2IW8A 3VS5A 4DTAA 3U55A 4JDIA 5FUTA 4CKRA 4CG8A 4BY9E 3QA8A 4FV8A 4ENYA 4BGGA 5DRDA 1JOWB 4CYJA 3QD3A 1A06A 2XKDA 3BHUA 2WIHA 4YP8A 3KGAA 4JDJA 4ARKA 5FDPA 4HGEA 4Y85A 5IEXA 3KRXA 5M44A 3F66A 3P78A 1WBPA 3QA0A 3QUEA 3W2PA 1OBDA 4MEDA 2IZUA 5CSXA 5E8UA 3R9DA 3KXZA 4GG7A 3NYXA 3A2CA 2F4JA 4RJ7A 3BYVA 5A3XA 4YZBA 3PPZA 4A7CA 3PG3A 3VHKA 4F0GA 4CLJA 4H39A 3Q9ZA 3F3ZA 4A4LA 5DWRA 4IAKA 3IW8A 4LV8A 4TZRA 1SZMA 2BAKA 2CGVA 2I6LA 3KXMA 4JR3A 4FV7A 1J1CA 4U9AA 5KMKA 3BV2A 4U6RA 3ORKA 4YZMA 4NTSA 4QQJA 5EFQA 3UZTA 3BE9A 3ZDIA 4ASDA 5DGZA 3F5UA 2F7ZE 3AC1A 2ACXA 1Q24A 3TUCA 3E64A 3LFQA 4G16A 3TNPC 4EZ7A 3NUAA 2JFLA 3MVJA 3R7GA 2NP8A 3R9NA 3A62A 3NVMB 3UC4A 2QNJA 2ITQA 3BGPA 5ANOA 4AW0A 3RTPA 4E20A 2B9HA 3CR0A 3WF5A 3SA0A 4QMLA 4ITHA 3KREA 3Q9WA 3ETAA 4XLVA 2WB8A 4WT6A 3DKGA 3MWUA 3UODA 5E90A 5FEDA 4PRJA 4GK2A 4QMSA 3MVLA 5DR6A 5JK3A 3MB7A 1P5EA 3HUBA 4YLKA 5HLWA 3C9WA 5H3QA 2CNUA 4DH3A 3N51A 3IG7A 3OWKA 3FI4A 4FR4A 2Y6MA 4RBLA 2QD9A 4CV8A 2V62A 2C6MA 5DT0A 1M2PA 5IQCA 4DLJA 4EYMA 4JQ8A 4ORKA 3DBCA 4I1ZA 2DS1A 4CGAA 1O9UA 3H9FA 4NKSA 1H1QA 3B8QA 1SMHA 2FYSA 4YTHA 5TR6A 3NIEA 4L00A 4BTKA 1KV2A 4FEUA 2UZOA 5M4FA 4OBQA 3TDWA 1RDQE 3PE2A 4U5JA 2JLDA 4YPDA 4F7SA 4FUYA 2XEZA 2PULA 4PV0A 4X3JA 2CGXA 3UVRA 5CF8A 4BGQA 5IEYA 4WO5A 4EC8A 4WSQA 2QOOA 2C6LA 4YJQA 2I0HA 5DPVA 4ZTSA 2B55A 4IIRA 2XBJA 4WG3A 3PVBA 4J8MA 5C03A 3RPYA 4D9UA 4DEEA 4JBOA 2Z2WA 4PDSA 3ZRKA 2WTIA 4MD7E 1MRUA 1Y6AA 1MP8A 4X3FA 5BVOA 3U51A 4O1PA 3R7YA 3ZRMA 4BCKA 4O7NA 3LMGA 4LL5A 2HAKA 4QMUA 1J7UA 1XR1A 4P5ZA 4Y95A 3UG1A 3UQGA 1URWA 3IGGA 4B0GA 4EH9A 4C59A 3TZ7A 3A99A 3LM0A 4CMOA 4U42A 1ZYSA 3CGOA 2B7AA 4RG0A 4DG0E 5BVWA 4FT0A 5DLSA 4ANSA 2OO8X 5EYMA 4ZP5A 3HMOA 4ALUA 1BLXA 1PXLA 2I7QA 3BRBA 3NUSA 3UGCA 5A46A 2PMIA 4I4EA 4I3ZA 3EQGA 3WF8A 2CKOA 4FA2A 3LCDA 3BV3A 3LJ1A 3WZKA 4MQ2A 5EM7A 1LP4A 4PPBA 4R7HA 3V3VA 2X4FA 4C58A 1YWVA 3AXWA 4WNPA 4NSTA 4PMPA 4LYNA 3VBXA 4J99A 5L6OA 2VTLA 5LVPA 4HNFA 4RIXB 3P0MA 5DIAA 3MH2A 4PL4A 2BFXA 5M06A 1I44A 4JX3A 3QTQA 3F69A 4NUSA 4JBVA 4D1XA 4L3PA 4OBOA 4XRJA 4Y5QA 3QXOA 3NLBA 5M08A 3ELJA 2HIWA 4BWKA 2BILB 4I94A 5KHWA 4GL9A 4D9TA 4CCUA 2CKEA 2O3PA 1F0QA 5FLFA 1OIYA 5AAFA 3E3BX 4IWQA 4O2PA 3D5WA 5EKOA 3ZO1A 4BWXA 1UNGA 4D28A 4QYYA 1Q62A 4JG7A 5AEPA 3O96A 5AUWA 4PL5A 4WA9A 5CU2A 2IN6A 3FI8A 4I6FA 5CT7A 3TNHA 2R3GA 2HW6A 4IFGA 3BU3A 4F9BA 4HPTE 4DH1A 5L2WA 4G6OA 3FZSA 2ZB1A 3FPQA 3P7CA 4WUAA 3BYOA 2YWPA 4EH3A 4BDFA 2OJ9A 3M2WA 1PRYA 3VNTA 2ERZE 4DLIA 4TN6A 3CKWA 2ZV9A 4UMUA 4QQ5A 3NDMA 5C8KA 5HVYA 4NEUA 2Y4PA 2PUPA 2E9OA 4L3LA 1FOTA 5ACKA 2HZ0A 4FEVA 4L9IA 5KHXA 2BRHA 2W5AA 5DA3A 2YCSA 5AV3A 2VTRA 2GNIA 2EXMA 3BKBA 4L67A 2IZSA 1OKWA 3Q53A 3R6XA 1VYWA 4KABA 4C61A 5LCKA 5J79A 4X6QC 3VBWA 4XG4A 3RK7A 4KAOA 2YLEA 3A7HA 2XM8A 2F9GA 1WFCA 3O2MA 3QCSA 4BIEA 2CPKE 4RFZA 4X6RA 3O8PA 2GQSA 4FTMA 4WD5A 5KMMA 2UZTA 4U44A 3RM7A 3GCVA 3R63A 3QQKA 5FEQA 3TI1A 4AA0A 2WO6A 3ZXZA 5CF6A 4QP8A 5KNJA 3O8UA 3HA6A 3HRCA 2O8YA 2IWIA 2BAQA 5F20A 1UKHA 5HOAA 5L8JA 3Q5ZA 1DI9A 4PTGA 3ZC6A 2KULA 1NVSA 2YM6A 5HLPA 2X6DA 4FKIA 4ANOA 4TNDA 4BCHA 4M15A 2AUHA 3SQQA 2ZM1A 4YNEA 4MH7A 5AJQA 3EZVA 3CJFA 5GZ9A 1CMKE 3NPCA 4DN5A 3TXOA 2BPMA 3FZPA 5EKNA 2EUFB 3OS3A 1H4LA 3KMWA 3EN7A 5IUIA 3WIGA 3F88A 1OMWA 4TPTA 4I4FA 3NUUA 3FL4A 4GS6A 3GU7A 4DEGA 2JEDA 2XIRA 3OXIA 4QPSA 3QX4A 3DOGA 3GU8A 4IEBA 4FL3A 4RGJA 1UU3A 5BPYA 2F49A 4HCVA 3C4XA 1YQJA 3MSSA 3QL8A 4BIDA 4H3QA 2R7BA 4MCVA 4A9RA 2B9IA 4FKQA 5HG8A 4EKKA 4KRCA 4D2VA 1UVRA 2EXCX 3BZ3A 3DKOA 3NYVA 4MWHA 2F2UA 4CG9A 5AUZA 2R64A 2O65A 4HGTA 4KNBA 3REPA 2J6MA 3T8OA 3ENHA 2Q83A 2BHEA 1UKIA 4E6CA 2YISA 1H08A 3ZLWA 5A6OA 2GDOA 3OCGA 4XX9A 4BCIA 4DGGA 2GNFA 3TTJA 4ZSAA 4AN2A 2B54A 2PVNA 2YITA 2CJMA 4FT3A 3BEAA 4H58A 4R7IA 3IQ7A 3N4TA 3NMUF 4EYJA 3HMIA 1AD5A 1GZNA 3FSKA 1KE8A 2UZWE 4RVTA 4HPUE 3E87A 4QTAA 4RIYB 3UVPA 5JFXA 1BI8A 4EOPA 1TQMA 2WHBA 5HD4A 2PU8A 2WMWA 2R3MA 3P9JA 2XJ0A 2XRUA 4FSMA 5I9WA 4FGRA 3WZDA 3QTZA 4FKPA 4R8QA 5AM6A 2JDTA 2O63A 4C2WA 3CSVA 2O2UA 1WMKA 4YNOA 4RA4A 3P23A 3HGKA 2V5QA 2ITVA 2BTSA 2OSCA 4DC2A 3T3UA 3KRWA 2X8DA 5I9UA 3H9RA 5F9EA 1Z57A 1PYXA 5IQEA 1H01A 4FSWA 4IADA 3R7OA 3ZUVA 3P7AA 4Z3VA 4IHPA 4AE9A 4ZEGA 1JSTA 5LMKA 3KK9A 4O7ZA 3N9XA 3R9RA 3GFWA 3ZO4A 3LCKA 2OZAB 2RGPA 1CTPE 3MPMA 4WKQA 3LJ2A 2QKWB 3QU0A 4IBMA 4TWPA 5CXZA 3W2CA 2P33A 4XV3A 5HTBA 3ZUUA 5BYLA 3MH0A 3UJGA 2I40A 4LMUA 5B2MA 3R83A 1PHKA 2JDSA 5AR2A 4XH6A 2E2BA 3EHAA 4PL3A 4TT7A 3HZTA 4DGMA 5KX8A 3UOKA 4UB7A 4PDYA 3K3JA 2XKEA 4QTBA 4J95A 4JG8A 5AV4A 4CFMA 2ITZA 2VTIA 3RPRA 4FIGA 4ZY6A 3FC2A 5AR7A 1Q8TA 4NYEA 5CEOA 1PJKA 2C3IB 5L2SA 2IJMA 1FPUA 2FSTX 3GU5A 3S4QA 4E4MA 4IC7A 4BDDA 4NW5A 1W7HA 2CLXA 2W4JA 1YKRA 2YM5A 3MI9A 3PIXA 4D4SA 5LQFA 2GQRA 2GSFA 3E63A 3KB7A 2PZ5A 5CU3A 5DEWA 3MFRA 3F2AA 4UWYA 4DCEA 2Z60A 2RF9A 1YW2A 4MF1A 4OW8A 3N4UA 4YZ9A 2UUEA 5EDPA 2AYPA 4NT4A 1W83A 4O84A 2VWYA 1YDTE 2VZ6A 3SGCA 5HO8A 4FSUA 1JKLA 2XCKA 3QLGA 4AOJA 3DGKA 3G90X 4OTQA 3PVUA 3MY0A 4C0TA 3PLSA 4Z9LA 3D94A 4CZYB 3ZM4A 3TJDA 1JPAA 1XH8A 4DAWA 2C6EA 5K5NA 5DR2A 5AR5A 5I9XA 3R7VA 2GNGA 4JR7A 4YLLA 1ZAOA 1PY5A 5I0BA 2XNNA 5LMBA 3UO6A 3ODYX 3VUGA 2DQ7X 5EHYA 4HOKA 1SVHA 3EMGA 4FKRA 4RJ8A 4YBKA 2PYWA 1CDKA 3KQ7A 4F6UA 5IQFA 1AGWA 4Q9SA 3PVGA 5CVGA 3VUTA 2IVSA 3VO3A 1A48A 3QQJA 1Y8YA 1V0PA 5IDNA 4O0RA 3KMUA 1MUOA 5E9EA 3FLYA 4EOLA 3CS9A 4IVDA 4NZWB 4X0MA 2PVYA 1FMOE 4FIJA 4S32A 1JSVA 4BI0A 2WOTA 4HVIA 4IVAA 4ASZA 3KU2A 4J71A 5HCZA 2RFEA 3OT8A 3QCQA 1VJYA 4FTJA 5J7HA 1QPDA 4R3PA 4QP4A 4AGWA 3LMHA 2PY3A 3ORXA 1OIRA 4G3DA 5GHVA 5TOZA 4ACGA 4AFJA 4NL0A 3CPBA 4AT4A 5CF4A 4Z55A 4YZDA 3WZEA 1ZYJA 2HY81 4XHKB 2C0IA 4IDTA 1QL6A 5CT0A 5EW9A 3JVSA 2XEYA 4FV9A 3RAWA 4WBBB 5DVRA 3HV5A 3Q4TA 3QRUA 5E8WA 3ATTA 1JVPP 3CXWA 4KRDA 4FZDB 2QOLA 1GJOA 4KIQA 3A7JA 4ZSGA 3SRVB 2R3KA 4EOKA 4GEOA 1Y57A 5DT4A 2UW8A 5FXQA 1K2PA 2P0CA 2YZAA 3UQFA 5M51A 4APPA 2V0DA 3I4BA 2YEXA 5E8VA 2QURA 3PXFA 2B4SB 4DGLC 4DGOA 4FEXA 2OK1A 4FV6A 4MD8E 3NX8A 4ZLZA 4MXOA 5FP6A 1PXPA 2QLUA 4O0UA 4RJ5A 3T3VA 1VYZA 4H3BA 2GQGA 2UVZA 3A4OX 4JX7A 2WU7A 3H0ZA 4QRCA 4ZZNA 2VWWA 4RWKA 2HYYA 2XNOA 4LUDA 2BMCA 3ZRLA 2WMXA 5GIOE 2ONLA 1R0PA 4KB8A 3VS7A 2AC3A 3DS6A 1IA9A 3LLAA 3FMJA 4WHZA 5IKWA 5J87A 4CQEA 1YOLA 2VAGA 4AF3A 1PXKA 3KVWA 5D41A 4MBLA 2DYLA 3PPKA 2X2KA 4IWDA 4C3PA 4F7NA 1IRKA 4IJPA 3GCUA 3MV5A 4NM0A 1OVEA 4HYHA 4ZMFA 4YU2A 3ATSA 3DXNA 1FINA 3F7WA 1YI3A 4TYIA 4PX6A 4PMMA 4RRVA 4OT6A 2XNBA 3AD6A 5CTPA 2C1BA 4EWQA 2C3LA 2YDKA 3V04A 4XV1A 2WMVA 1XBBA 3KXGA 2WNTA 4FV0A 4AGCA 5A54A 4WNOA 3VULA 3EFJA 3KRLA 3OWPA 3AT4A 4M69B 4C4EA 4UZHA 3VW8A 4CQGA 3VJNA 4FIFA 5K4IA 3F5XA 1ZWSA 2OKRA 4KD1A 5G6VA 3D7ZA 4QMTA 4QMXA 4QTEA 3KFAA 3R21A 4RQVA 2F2CB 4HZSA 4QP3A 2OH4A 1XJDA 4MBIA 2PZIA 4QNYA 5EQYA 4FV3A 4R78A 1U4DA 2YM7A 4EK4A 3V6RA 1H8FA 4DITA 2XIXA 4G3EA 4LRMA 1YOJA 5IUGA 2C3JA 2RG6A 2PVMA 2WTCA 4D0XA 2QG7A 3LJ0A 5IA4A 3CTQA 4R5YA 3RALA 3VN9A 1P14A 2JDVA 5CENA 4ZY5A 3LPBA 4E6AA 3OW3A 1ZOGA 3TZMA 4BCPA 4TYEA 5KCVA 4E26A 3NGAA 3R01A 4WNMA 3PWYA 4BKJA 4PP7A 4R7BA 3BGZA 5E8YA 4XS2A 5HICA 5L2IA 4O22A 4S33A 2ZM3A 4CMUA 3RHKA 4O86A 4GSBA 1UNHA 4RVMA 2G01A 3G5DA 4TNBA 3JXWA 4XG9A 4QT1A 3WE8A 4O7WA 3V5LA 1E1VA 3BQRA 4F1OA 5BNJA 4M14A 3N4VA 4BCGA 3AD4A 3I60A 4GUEA 2BUJA 2PMOX 3IW7A 2PUNA 4AX8A 1WBVA 4JNWA 2Z7LA 5EK7A 5FP5A 3KKVA 4I93A 4PNIA 4BR3A 3R8LA 5JZNA 4O7RA 5DI1A 3R1SA 5LVOA 4Q5EA 4F7JA 1SVEA 4QTCA 5LXMA 3LXNA 2O0UA 5EYCA 4LRJA 3BPRA 1TVOA 3O7LB 2YAAA 1F3MC 2R0IA 3FQSA 3E8EA 4F7LA 3FDNA 3EFLA 4HGSA 4C57A 3DCVA 3Q4CA 3WYYA 1Q61A 3VUDA 4QQTA 5ANEA 4XG6A 5HD7A 4BDBA 4UMTA 4EHZA 5E8SA 3HP5A 3NR9A 3W32A 2XZSA 1V0BA 2ZMDA 3POOA 1P2AA 4F08A 2V7OA 4I21A 2REIA 4U97A 1O6LA 4GU9A 4K6ZA 3SHEA 5KMIA 4WOVA 5IZFA 3QTRA 3W10A 3P7BA 3G6HA 2R3PA 4XG2A 5HX6A 4PMSA 4UZDA 4QP6A 3G9LX 4FUXA 1YOMA 3Q2MA 3QTUA 2A27A 4JT3A 3RK9A 3V6SA 3EJ1A 3C4EA 3NUPA 4JQEA 4QOXA 4WBOA 5FQDC 3U4WA 2RG5A 2Y6OA 1PMEA 3LE6A 4FKLA 3FXWA 4IM2A 4I22A 3GUBA 3SOAA 5JFSA 3R0TA 4FOCA 1XH6A 4M3QA 2YHVA 4AN9A 4O1OA 3I6UA 2ITWA 4X21A 5HKMA 2XK9A 2CSNA 3KA0A 4O0XA 2HCKA 2NPQA 2I0EA 2OU7A 2W05A 3DZOA 4FK6A 4JS8A 4L01A 4TRLA 3R1NA 1RE8A 2PMLX 3MN3A 4R6VA 2BCJA 4XP0A 1W8CA 3DAEA 5KMLA 3EQIA 2UZEA 3RNIA 2QCSA 3KMMA 5ICPA 3DLZA 4FT7A 5CAVA 3GC9A 3MW1A 1KWPA 1J91A 5L8LA 4GH2A 2P2IA 3CQWA 3OUKA 2YA9A 3OT3A 3R28A 3DAKA 5FXRA 1GY3A 3BU5A 4X3FC 2NRYA 3DLSA 4FSTA 2YLFA 2JBOA 5ANGA 2P2HA 2X1NA 1OUKA 4GFMA 2PE1A 3PPJA 4D4VA 3NYOA 4YC8A 3TUBA 4HZRA 2PK9A 2GTNA 3LMIA 3QUDA 3KRJA 4E5AX 4DBXA 3QZFA 4TKSA 2ZAZA 3AC8A 5AP7A 4EWHA 4FTQA 2PE2A 2WIPA 4BYIA 2X9EA 2ITNA 3VRZA 2X7FA 4LG4A 4BCOA 4JL9A 4XEYA 4TWCA 3RINA 2R3NA 2XK6A 3DQXA 4RMZA 4C3FA 4PUZA 4F70A 4EOOA 2CCIA 5EG3A 4EK5A 4ANBA 5ANDA 5E7RA 4O91A 3FHRA 2BIYA 4JBPA 3BHTA 3FMMA 3Q52A 4UY9A 4E7WA 4CV9A 3FEGA 2ITYA 5CNOA 2C5YA 3A7GA 3LW0A 4ZOGA 4OAVB 4D4RA 4K11A 4FTRA 4E5BA 1Q4LA 4LQMA 1XH4A 3LFNA 3FZRA 3PJ1A 4E8AA 3F61A 4ZSEA 5JH6A 5HO6A 3IKAA 5BVNA 3V5JA 2QLQA 4O6LA 2IVVA 4GFOA 4PTEA 5A6NA 4O82A 4RLKA 5J8IA 5BUJA 3TWJA 1ZRZA 2XMYA 1OUYA 3F6XA 3PIYA 2W96B 3QF9A 3LCTA 5B7VA 4E93A 4FSQA 3RCJA 2FUMA 5HX8A 4BRXA 5BMMA 2EB3A 4L68A 2ZOQA 4TW9A 3GCQA 2Z02A 1JNKA 3F7ZA 2BRNA 2BKKA 4OTFA 5CVFA 4BYJA 1FVTA 2CN8A 2QODA 3MVMA 5H9BA 1ND4A 2FVDA 4LFIA 5JN2A 2XYUA 4RJ3A 3M1SA 2VGOA 2R0UA 3L9LA 4JAJA 2GMXA 4M0YA 1Q41A 4P5QA 3HRBA 4UXLA 5D1JA 2VWVA 2X6EA 5J9LA 1PYEA 2CDZA 3EQHA 1ZYDA 3GCPA 2R3RA 5E1EA 4XOYA 5FTGA 3U6IA 5A4LA 3F9NA 4FT9A 2JKKA 4YC6A 2NO3A 2YAKA 2UW5A 3PVWA 4RC3A 3ZLYA 3FV8A 4JAIA 1U54B 4BZOA 1WVXA 2QR8A 3I0QA 4BDCA 3E3PA 3AT3A 2R3HA 3TIYA 3ET7A 5B2KA 3RHXA 4C4JA 3F2RA 4RPVA 3IO7A 3SV0A 5AR3A 5KZIA 4MNFA 3QFVA 4D1SA 4IAAA 4E73A 4E3CA 3UMWA 5HVKA 3ORZA 3DPKA 4XNEA 2FSLX 4IZ7A 4QMQA 5IA1A 3KULB 4UALA 4UWCA 4LV5A 3PTGA 3UP7A 4PNKA 2XIKA 3Q04A 4FK3A 4EKLA 3BU6A 1OL7A 3RK5A 4U8ZA 2BDFA 5H8BA 5AP3A 3PSCA 1FVRA 3LAUA 4KWPA 2CKPA 1HOWA 2GNJA 3DB8A 4LUEA 2OH0E 4BBEA 4E6DA 4IM0A 2ZJWA 1WZYA 1H24A 3OTUA 5FEEA 3EWHA 3WF7A 1ZYCA 5FM3A 1Z9XA 3S0OA 2OF2A 4B99A 3HECA 3RAHA 3NSZA 1G3NA 2OF4A 3M11A 5IA5A 4QYFA 5A4TA 4RX9A 5C27A 4RLLA 4FYNA 3CBLA 4QMNA 3OWJA 2C4GA 4IX3A 3NAYA 3TACA 3RWPA 4RC2A 3QX2A 2J0JA 3LQ8A 5KKRC 4MVFA 2OIDA 4S34A 2BDWA 3PYYA 2J9MA 3FY2A 3FAAA 3ORTA 3OC1A 2YN8A 3P5KA 1PXOA 4FIHA 4DFXE 5CY3A 1DAYA 1A9UA 2WTJA 2QHMA 5A9UA 3DK3A 1G5SA 2OI4X 5BYZA 3PE1A 5JGBA 3PP0A 4FTOA 3E8DA 1OI9A 1ZY5A 2W4KA 3GOKA 3OVVA 3PXYA 1JWHA 5HBEA 2J2IB 2BALA 2QKRA 3DFCB 2QHNA 3L8PA 4NM7A 4EORA 3TNIA 1ZMUA 3F3TA 3OD6X 1K9AA 2W1FA 4ACDA 4HVDA 5L8KA 3EN5A 4UYNA 2JKOA 3SXSA 3C4CA 5KO1A 4YJSA 5IH6A 3EYHA 5AR8A 4EQUA 3I81A 1P4FA 4OTHA 3OWLA 3GFEA 3HA8A 3HX4A 2WPAA 3SD0A 4N57A 4J97A 4G6NA 3NW5A 2Y9QA 4YSMA 4LMNA 3R71A 5CLPA 2JDOA 4MTAA 3COIA 3IOKA 3R7IA 3RWQA 3TL8A 5A4CA 2OIBA 2JIIA 3MA3A 3D5VA 1L8TA 3AG9A 4A9UA 3FLQA 2VTNA 1W84A 2GFCA 2UZBA 4MXCA 4YHJA 3FE3A 3V5WA 3HV6A 3SW4A 2VX0A 4YBJA 3EQDA 2Y0AA 5AADA 4U43A 4KIKB 3DTCA 5AX9A 2QOQA 3DNDA 3ULZA 3ODZX 3FBVA 4E4LA 4DT8A 3OOGA 3DB6A 1IASA 4Z7GA 4AP7A 1PMVA 4GUBA 4QP2A 4JIAA 4CT2A 3LFAA 3I5NA 5EM5A 1Q5KA 4KKEA 3ROCA 2OFUA 3IW4A 5C26A 1B39A 1CKJA 3BYMA 4M0ZA 4O81A 2GS2A 5I4NA 1M52A 4BDEA 3CJGA 3VRYA 4KSQA 3FI2A 3FUPA 5J9ZA 5GIPE 4C34A 1KSWA 5IH5A 5LMKC 4O7LA 2J5FA 3KN6A 3W8QA 5HE0A 1ZOHA 3OCTA 4AFEA 5F95A 2C5VA 4NWMA 1ZMWA 4BFMA 5AA9A 4LGHA 2WQNA 2YJRA 4MXXA 3ALOA 4BB4A 3BBWA 3GQLA 3MFUA 5AP4A 5DR9A 4W4YA 3ORPA 4A4OA 3PXQA 4MXAA 3VS1A 4AQCA 3EKNA 4JQ7A 2QU6A 4U79A 4YJRA 5DFPA 5GJFA 2VNYA 4ZTRA 2H9VA 5M4UA 1ZOEA 4GCJA 2JD5A 4GFGA 4JI9A 3MTFA 3PWDA 4KBAA 1BL7A 2GS6A 3DJ7A 4IZ5A 2Y4IC 2CNVA 4XYFA 4FICA 1DS5A 4IM3A 2XP2A 1YXVA 4IWPA 2CGUA 2CKQA 4RWJA 4BBFA 3DNEA 3SKCA 3LZBA 3LXPA 3JS2A 4D2PA 5LCJA 4AAAA 3MJ2A 4EC9A 2FO0A 5CU6A 3D14A 3UC3A 1M2QA 2ZYBA 4CEGA 4F4PA 4F6SA 5HU9A 1WBWA 3FLWA 5GINE 4UMQA 3NW7A 4FX3A 4KS8A 4DBNA 3FMLA 4XUFA 4ZJJA 4N6ZA 4Y73A 4QMMA 1YHVA 5DG5A 5D7AA 5F1ZA 4N0SA 1UU7A 2G1TA 3Q3BA 1KV1A 4RVLA 2G2FA 4B4LA 4FKSA 3F3WA 3MY5A 3KXNA 4KKHA 4O21A 4HVSA 3C1XA 2GHGA 3IS5A 3K3IA 4JRNA 4K2RA 4ZTLA 4BDHA 4BHNA 4EQCA 2WELA 4JJRA 1Q8UA 3TIZA 3VW6A 4C4HA 1T46A 3HRFA 4IB0A 5HVJA 2WTWA 4J7BA 3MJ1A 3ID6C 3GQIA 3SG8A 3FQEA 5AAEA 5LOHA 3F2NA 5AIKA 2ERKA 4BIBA 2GFSA 5M57A 2W1HA 2JKQA 3HKOA 3NEWA 2LGCA 4CNHA 3GU6A 4IWOA 4UEUA 3LXKA 3A7IA 1U59A 4Q5HA 5CI6A 3UMXA 4EUUA 4DF3A 2VTPA 2ETMA 3I5ZA 3WILA 2JC6A 2OXDA 2WQMA 5JSMA 3BGQA 5GNKA 5CXHA 3ACJA 2W0JA 4MAOA 4YTCA 1XQZA 3K5VA 4IQ6A 4X3FB 4QMZA 3TKHA 4BCJA 5JFVA 3DU8A 1NVRA 3LM5A 2UW0A 3KXHA 3CP9A 4BL1A 3EN4A 3OBGA 4ITIA 3HEGA 4R3CA 1JQHA 2QO9A 1OL2A 3THBA 1BI7A 4FEWA 2WXVA 5J95A 2BZJA 4G3GA 4MYGA 4W9XA 2OWBA 1EH4A 4UN0C 2B9FA 4JOAA 4FV5A 4M7IA 2JIUA 4FV1A 4M8TA 1M17A 2B1PA 1ERKA 3E8CA 3HLLA 3MVHA 4MQ1A 1V0OA 4PPCA 5L6WL 3LHJA 3ACKA 5K5XA 3C5UA 4ANQA 5HIDA 4PPAA 4Y8DA 3BWFA 4QYHA 5M55A 3Q6UA 2XH5A 4EQMA 1LR4A 2YCFA 4C4FA 4I0TA 1ZXEA 1QPJA 2JBPA 2JITA 4RVKA 1VEBA 3CPCA 3R30A 5D11A 4KKGA 3QAME 2IW9A 2JKMA 3E93A 4FG8A 4QYGA 4CSVA 2X39A 5HLNA 2C47A 4DFZE 3FYKX 3UNKA 4V05A 1REJA 3FMHA 4ALWA 5AWMA 4W9WA 3E62A 4BWPA 3UO5A 3QKMA 3OBJA 3OFMA 3WZJA 4C62A 2W9ZB 2YFXA 2YZLA 2ETKA 2PZRA 2QOIA 5C8NA 2QVSE 4JDHA 4QQCA 3KF4A 4JVGA 1YXXA 4TL0A 2WOUA 4DFBA 2W9FB 5B0XA 3LCSA 3R8VA 2P4IA 3ZUTA 3P79A 4AACA 4F0IA 4MKCA 3L9PA 2OXXA 4DEDA 4E6QA 5HEZA 3DZQA 3FPMA 3TZ8A 2ONLC 3PRIA 3R8UA 4JG6A 5AUTA 3CY3A 3ZEPA 4EK6A 2PMNX 3R7UA 4D2SA 4YO4A 4ZK5A 3GBZA 3QTIA 2XNMA 5DYJA 4NU1A 4PF4A 3VIDA 5GZAA 4DCAA 5IQIA 2WKMA 3GP0A 2F7XE 5FRIA 3UIBA 3C50A 1M14A 2XJ1A 4YJVA 4CFVA 3R9HA 1OPLA 5AUYA 4BICA 3BLQA 3Q2JA 4AT3A 5HNBA 3QYWA 4M12A 3FC1X 4NIFB 2XIZA 4LM5A 2J4ZA 4F1TA 3NW6A 3EZRA 2A0CX 3A4PA 3ULIA 5BQ0A 2WEIA 3NNUA 1OIQA 2G2HA 4GKIA 3FLZA 3H0YA 3CD3A 5M56A 1OZ1A 2E9UA 3POZA 4I6HA 1SYKA 2C1AA 3ORMA 3O23A 3EKKA 5FBOA 4C35A 4O7YA 3HDNA 3I0OA 1FQ1B 3LQ5A 5HE3A 2XK7A 3K54A 1GIHA 3GEQA 1ZY4A 2XIYA 2ZV2A 4FC0A 4ACCA 2W17A 4MXYA 3W2QA 4E4XA 2V22A 3SW7A 2OFVA 3G15A 2YJSA 1B38A 5CALA 1TQPA 5C01A 4JIKA 5DOSA 4JRVA 2IZRA 3SX9A 2YM8A 5HQ0A 3BQCA 3RPVA 5KE0A 4Y5HA 2JGZA 5EYKA 3QWJA 4BZDA 4QP1A 1WAKA 3CQEA 3HUCA 5FM2A 4A06A 2VO3A 2XCHA 2RSVA 3KEXA 4IVCA 4RX5A 2ZM4A 3MY1A 4DGNA 3FJQE 4J53A 5K4JA 4FKTA
chains in the Genus database with same CATH superfamily
5AP1A 5L4QA 1R1WA 4I5PA 3Q32A 3R8MA 3LOKA 4DFYA 4TTHB 2RL5A 2R7IA 4QPMA 1QCFA 2CHLA 5FDXA 1PKGA 3BYUA 3COKA 3P86A 3EQPA 1M7QA 2XK4A 4GK3A 2ESMA 3MIYA 3NFFB 3NNXA 4X2KA 5KKRB 5KBQA 4CFNA 3T9IA 1MQ4A 4FGBA 3RPSA 1O6KA 4IACA 4DH7A 4BTMA 1XH5A 4FNZA 4BBMA 4EONA 5ACBC 3TM0A 4FVPA 2XK8A 4GRBA 3ZSIA 1ATPE 5BVFA 2XM9A 5HNGA 4D5KA 2BZHB 1TKIA 2YABA 2VU3A 4ONAA 3WZUA 5HESA 2W5HA 3PLAE 3LFSA 3H30A 4EHVA 3IECA 1GZKA 4DG2E 2BZIB 2A4LA 1Q8YA 2H6DA 3EYGA 4AZEA 5H2UA 5HO7A 4C7TA 5HORA 3GVUA 3JR1A 3AMYA 2OGVA 1G8KA 5CVHA 4KA3A 1S9JA 3QC4A 5DT3A 1K3AA 4KSPA 4P90A 4OTRA 1RQQA 3QD0A 3DBFA 3IK3A 4RSSA 3PA4A 4QYEA 3OF0A 4YSJA 5IH4A 5M09A 3C7QA 2OICA 3ZZWA 2WMSA 5C8MA 3DKFA 3G0EA 4C02A 2OIQA 4G9CA 1H07A 2GPHA 3IW5A 4J98A 5E8TA 4EH6A 3DK6A 4F99A 3U6HA 2PPQA 3PZEA 4DDGA 3P4KA 5FBNC 4XOZA 3RGFA 4BJJA 1S9IA 2WMRA 1GZ8A 3RVGA 5AV0A 5CYIA 4J8NA 4WRSA 3FL5A 4BHZA 2R5TA 4LL0A 4YHTA 5I9YA 3ALNA 2B52A 1H28A 3G9NA 2OJJA 3BEGA 3PSBA 3FXZA 5L6PA 2W1GA 4EZ5A 4D55A 4WRGA 3E7VA 3W33A 3COHA 4Y72A 3TN8A 4AGUA 5IQDA 3FKNA 3LIJA 2OBJA 3DTWA 1PXJA 1LEWA 3C4ZA 4AZVA 4RJ6A 3NIZA 4YGAA 3D4QA 3ZFMA 2V55A 4J96A 4GJ3A 3RKBA 2BROA 4QMWA 2YIWA 5DEYA 1E1XA 1PW2A 4NCTA 4FSYA 4NJ3A 3EOCA 3FHIA 4AOTA 1T45A 1BX6A 2W1EA 5JKGA 4I92A 2C68A 1BMKA 5D9HA 5AUXA 3TT0A 4BI1A 1B6CB 2G9XA 1YHSA 4IC8A 1WCCA 2YIRA 4YJTA 3AQVA 3C51A 5E92A 2VGPA 3WIKA 4AWIA 3L1SA 4CFWA 5GJDA 5EW8A 3UQCA 4G1WA 3WE4A 1UA2A 2VTSA 1R39A 1H26A 3FLSA 3FLNC 3LFBA 3OZ6A 2X2LA 5TT7A 4BC6A 1ZYLA 5BVKA 4ACHA 4Z7HA 4DFNA 5M4CA 3RPOA 4WG5A 3WF9A 3V8TA 2Z7SA 4OAUC 4XV9A 2H96A 3EQBA 5M53A 3DBEA 5A4QA 4G3FA 3AOXA 2QO2A 5CEKA 4YJNA 2OZOA 4PQNA 2CNQA 4XG3A 3I1AA 4IB1A 4ZZMA 2RFDA 2HELA 3OG7A 2F57A 3DQWA 1FGIA 2FGIA 2QQ7A 2C0TA 4B8LA 4C38A 1H1SA 3MH3A 3SXRA 2ZDTA 4FMQA 2BRGA 4XBUA 4ZS0A 5JEBA 4BF2A 4B8MA 2E9NA 2R4BA 2OJFE 4O38A 3VS2A 3EL8A 4YO6A 3ZMMA 4ERWA 2XNPA 3ZCLA 1QMZA 1YWNA 3Q9YA 4XG7A 5C4LA 4XLIA 2J0MB 2HWOA 4AXAA 3RZFA 3SVVA 5CX9A 5CAQA 2R3OA 4KINA 4FIIA 3OW4A 5EW3A 4EBVA 2R9SA 2X81A 3OY1A 4ZY4A 4DDIA 1J3HA 4RIWB 4C2VA 2VNWA 4HYSA 1PMUA 3GB2A 4M67A 4E4NA 3V5TA 5FTOA 5AM7A 3AC2A 1CM8A 1OBGA 3II5A 4L45A 4MWIA 4DA5A 5AP6A 4UYAA 5EI8A 3U9CA 3KCKA 3HV4A 3W0PA 2WMAA 3L8SA 2VTQA 1M7NA 2EU9A 3U87A 1KUTA 3W1FA 1ZLTA 3C0HA 3DV3A 3KF7A 5IISA 3QTSA 1NT2A 2Q0NA 4FKGA 4QMOA 4AZWA 3WI6A 4DG3E 4AXCA 3GT8A 5ANJA 2P55A 2RKUA 4O27B 4N4SA 3MDYA 5AMNA 1Y6BA 3IDBA 5EH0A 3MPAA 4V0GB 1YI6A 1Q3DA 4RWIA 3UOJA 1FBNA 1XWSA 4GT4A 2NRUA 2YERA 2VWZA 4FZ7A 5DNRA 2FH9A 4IH8A 3OOMA 5BMSA 3PRFA 4QDVA 4EH7A 3BE2A 5EQPA 3MB6A 1JAMA 3NUNA 3ZHPC 4FNXA 4MX9A 4O7TA 2GHLA 4EHGA 4IAIA 2WZJA 4TYHB 4IAZA 4MNEB 3MFSA 5CZIA 3PXRA 2XNGA 3ZYAA 3LFCA 5JRSA 2V7AA 3G0FA 2QC6A 4G2FA 3UNZA 4BVUA 3D7TB 5HU3A 3QXPA 4MHAA 3OCSA 4RZVA 4YC3A 1SVGA 4H1JA 4AOIA 1G8SA 3PZHA 1XBCA 4U0IA 5IA2A 3UIUA 4KIOA 2X0PA 4YLJA 4U3YA 4ZJIA 2C5XA 1H0VA 1WBNA 5TO8A 5D12A 3W2OA 2VD5A 3H4JA 2OG8A 4L42A 2ITXA 4RJ4A 4R77A 3RM6A 3RBWA 5J7BA 2OLCA 3GC7A 4L6QA 3HL7A 4QMYA 4L43A 3A61A 2VX3A 4EOSA 1IAHA 5JZJA 4RIXA 4IX6A 5HHWA 1YXUA 1YDSE 1XHAA 4U45A 5KMOA 3ZZEA 5KMJA 1PMNA 1CSNA 4X2FA 3C5IA 3C0GA 4DTBA 2HXQA 4TWOA 2BRBA 3EH9A 2W99B 4S30A 3JUHA 2VWIA 4KIPA 3PDTA 4H1MA 2WEVA 5C9CA 1OGYA 4OBPA 5HGIA 2DWBA 3HP2A 2WD1A 4K8AA 3TKUA 2I0VA 2J0IA 3KK8A 2CCHA 1OL6A 3AC4A 2W1IA 3FMKA 4FYOA 4NJDA 4OTIA 3L8XA 5CSWA 5CWZA 3R8PA 3VUHA 2HW7A 4IVBA 3ZONA 3B2TA 5IMXA 2ITUA 1IG1A 4RQKA 3QQLA 4QPAA 3PA3A 3PXKA 3NWWA 5CI7A 2UVYA 1OPKA 5AP2A 3QQGA 2JDRA 3IGOA 3ANQA 1CKPA 2FA2A 3B2WA 4O0VA 5DHJA 4YPSA 5H8GA 2XAOA 4V04A 4D0WA 3QQHA 1BKXA 1YXTA 3NCZA 4KIKA 5AR4A 3S3IA 4G9RA 2W1CA 4CMTA 2WU6A 1UV5A 4EL9A 3FSFA 4R5SA 3PIZA 2QOHA 1H00A 4FVRA 2NNWB 3IOPA 5CU4A 1P4OA 4HCTA 3FWQA 5LVNA 2GS7A 2C0OA 4GK4A 5ETAA 1LUFA 4II5A 3W2RA 4BCNA 5C4KA 2R3IA 1HCLA 3QTWA 5LVMA 3DT1A 2YDIA 3E7OA 1TQIA 3L9MA 4TXCA 1DM2A 2X0GA 1KOBA 1RW8A 3RMFA 5AFVA 2OXYA 5F94A 4ZS4A 4BDAA 4C36A 3A8WA 4BDKA 2RIOA 5ITAA 4JBQA 4ANMA 4AN3A 3U9NA 4X7QA 2IVTA 2UV2A 1WBTA 3TJCA 3CD8A 4YZNA 3OUNB 4FIEA 3HMPA 3KRRA 4AUAA 3QRKA 4M13A 4KBKA 5EM6A 1OITA 3BHVA 4JLCA 4YMJA 1NW1A 4A9YA 2WMTA 2VO0A 1OKVA 3A7FA 5LJJA 2CN5A 2PVRA 4FODA 4U81A 3VBYA 3QRIA 4QP9A 3ORNA 3ERKA 3TKIA 5BUEA 5K9IA 4GT5A 4BKYA 4RC4A 3ZC5A 5I3RA 4IAFA 3DDQA 1VR2A 2R2PA 3D15A 4XCUA 4AS0A 5GZ8A 1XBAA 3PXZA 2X2MA 1Q3WA 2BTRA 2QOBA 4RIOA 1NVQA 4AQKA 5IMEA 4BDIA 3ROYA 2VTJA 3PJ2A 4I5CA 3JVRA 3MS9A 4MBJA 1OL1A 1W98A 4EH5A 4O0WA 3NUXA 1OKZA 5ANIA 1JKTA 5K0XA 4QO9A 5CEQA 3TEIA 4IW0A 4K1BA 4U40A 3LXLA 2VV9A 3B8RA 4O2ZA 2WMBA 3L9NA 4D2RA 5EOLA 1Q8ZA 2UW3A 3IONA 4OUCA 3QKKA 4FSZA 2HZIA 3R1QA 5E4HA 4IDVA 4FI1A 3TV4A 2I1MA 4IZAA 3WARA 2JAVA 2YIXA 4BCFA 4XBRA 5EOBA 3EB0A 4L8MA 3MA6A 4XP3A 3RAKA 3CTHA 4HJOA 1IAJA 3AKLA 4ZAUA 4HCUA 1IEPA 2XB7A 3R9OA 4FNWA 1MRYA 3PUFC 3U4UA 4PDPA 1GIIA 3R7EA 2HOGA 2BZKB 4D2WA 1BL6A 4UMPA 3NYNA 4NKAA 3HMMA 1OKYA 3D5UA 2OJIA 3GC8A 3TTIA 4IFCA 5EHLA 3DBDA 3DDPA 4FTTA 4EH8A 3JPVA 4H05A 3BCEA 1W82A 3Q4ZA 4W4VA 4AA5A 2J5EA 4I24A 1L3RE 4C3RA 4CRLA 4YZCA 4BCQA 3KC3A 4QD6A 4WUNA 2GNLA 4W4XA 1Z5MA 1TZDA 2QG5A 5DBXA 3UBDA 1GOLA 3AT2A 4RWLA 2UW9A 4QMPA 2JIVA 4R1YA 3S1HA 2A1AB 2XKCA 5AX3A 1OM1A 2C5NA 4K77A 3KXXA 3ZTXA 3VAPA 4LOOA 4D58A 2PVHA 3FQHA 4RIYA 1HCKA 4XG8A 5IA0A 5J5TA 4CTBA 3UPZA 4Y46A 1V1KA 3BHHA 3EN6A 1ZZ2A 3BYSA 4YR8A 5B2LA 5IEVA 4OLIA 4Q9ZA 4U3ZA 2EWAA 2VO7A 2JAMA 3VS0A 3EIDA 3KCFA 3AKJA 3UDZA 1KE9A 3NRMA 2X8IA 1XH9A 2ZMCA 4RA5A 5BVDA 1APME 5K0KA 3QLFA 1DAWA 2BDJA 2HXLA 5CNNA 1U46A 3E5AA 1REKA 4GJ2A 4S2ZA 5AUUA 3C0IA 5JRQA 4F0FA 5C1QB 1SNXA 4ZJVA 5FG8A 3E88A 5H8EA 4OTDA 1PXMA 4NM3A 2A19B 5EYDA 2C6IA 3PY3A 2ETRA 3RAIA 5CEMA 2OZAA 5EHOA 3EQRA 3WF6A 3Q60A 2WTKC 3PSDA 4TY1A 3PUPA 4MD9E 1KE7A 3ZLXA 3GU4A 4YJUA 4A4XA 1YVJA 5M4IA 4AG8A 5I9ZA 4UMRA 1H1WA 2WMQA 3I6WA 3BLHA 4HVHA 5JT2A 4OT5A 2XYNA 3SLSA 3VUMA 1PXNA 4B7TA 4A9TA 3OMVA 2YM4A 1H1PA 4L44A 3ZDUA 5D7VA 4CFXA 4YHFA 1LPUA 3D0EA 3UYSA 3UYTA 2CGWA 2WQEA 5TKDA 4ANLA 3CCNA 1OPJA 4IX5A 1O6YA 4AXEA 3D5XA 2P3GX 2VN9A 4RFYA 4DHIB 3VUKA 3COMA 4GW8A 4NM5A 4O4CA 4FSNA 3FKOA 5EDQA 4I0SA 4ZXTA 5TF9A 3T9TA 3UTOA 4F9AA 4ZTMA 3HAMA 3FZOA 1WVWA 2QOFA 1Y8GA 4NIFA 4QTDA 5IQGA 4JXFA 4LGGA 4C37A 2UZVA 3HMNA 4DEIA 1UU9A 1J7LA 2B9JA 2W1ZA 4X2JA 4HYUA 5G1XA 5A14A 3D9VA 4FOBA 3H9OA 3UG2A 4EBWA 3V5QA 1PXIA 1SNUA 3NS9A 4FTNA 3I7CA 4FT5A 4AZSA 3PP1A 2O5KA 3UP2A 4FEQA 4GVJA 3TUDA 3QTXA 4UXQA 4DHJA 2HZ4A 5I3OA 3G51A 3BELA 3QUPA 4EOQA 2QI8A 4FZ6A 1NXKA 3ZM9A 2WQBA 2UZNA 4G5PA 4O6EA 3VHEA 3FMDA 3W18A 4D5HA 4KBCA 3HDMA 4M84A 4GMYA 2AC5A 3QZGA 3VF9A 5BYYA 3O71A 3HV3A 4LOPA 4RX7A 5LWNA 3HVCA 4UWBA 2XS0A 4ZSJA 3DXQA 4AZFA 4EK8A 5A4EA 5IF1A 2QR7A 3C4WA 4ZIMA 3VWAA 2UW7A 4IXPA 3WBLA 4UX9A 3MESA 2YACA 5FWKK 2WTVA 5HCYA 2BAJA 4YURA 4QDEA 5BX0A 5DN3A 3BX5A 4F9CA 2UZDA 3R22A 3F3VA 4GYIA 3AC3A 4N70A 4O0TA 5CSPA 2G15A 3ENMA 2ITTA 3VS4A 1Q97A 2ZVAA 4AA4A 4GV1A 3SC1A 2C6TA 3CE3A 3ZSGA 5HE1A 3DFAA 3K5UA 3RNYA 5IQBA 2CLQA 2PSQA 3PY0A 3AGLA 5JQ8A 3LKMA 5F4NA 4EK3A 4ERKA 5IU2A 2EVAA 4AT5A 3GENA 5BUIA 4K9YA 4KUJA 2CMWA 3VF8A 3R8ZA 3SRVA 3A60A 4DH8A 5I9VA 3OHTA 2X8EA 5CANA 5ETFA 4K18A 3BBTB 4MXZA 3PA5A 3O7LD 4W8DA 5DH3A 1VZOA 5E1SA 5EI2A 4BDGA 3HAVA 2H8HA 3DA6A 2BFYA 3UOLA 2B53A 2UW6A 2YCQA 3R2BA 5IA3A 2JFMA 3CLYA 4TWNA 5HIBA 4XRLA 5J9YA 3GCSA 5AP5A 4G6LA 4I41A 3CKXA 4EEVA 4EH2A 5HBJA 3W0MA 4CFFA 2GTMA 4U41A 4YUQA 2PZYA 3NNWA 3TNWA 4IMYA 4AZTA 5L3AA 4H3PA 4USFA 4BKZA 4M66A 3K2LA 3MH1A 4NTTA 4A9SA 3MIAA 4P7EA 2YIYA 4IB5A 3JY0A 2IVUA 3UPXA 4ANNA 3W55A 2QU5A 3HV7A 4WSYA 2X7GA 4LRKA 4ACMA 4EI4A 1J1BA 3ZSHA 4EJ7A 2Y7JA 3MYGA 4G5JA 4I20A 1GIJA 3U6JA 4U80A 4AGDA 2UZUE 3OY3A 3QRJA 4QMVA 1JKKA 2J90A 3G6GA 5CASA 4F9WA 4FG7A 3QYZA 3VC4A 5CAPA 2VRXA 3FY0A 3VJOA 1H1RA 4MK0A 1F5QA 4O0YA 2GU8A 2EXEA 3O0GA 5HE2A 2VWBA 2LAVA 3NVKI 1YXSA 2PVJA 3F3UA 4GKHA 2FSOX 2HY0A 2G2IA 5FXSA 2W4OA 4M69A 3EN9A 4I6QA 1FVVA 2Y8OA 3QBNA 2FSMX 1YRPA 3OTVA 4YTIA 5HCXA 3VQHA 4F6WA 2HENA 5GJGA 3VUIA 1I09A 3A8XA 2VX1A 4LGDA 4PDOA 3OXTA 5T3QA 5IQHA 4NFMA 3FYJX 1W2FA 1UU8A 4L7FA 4CKJA 5KBRA 4IANA 3I79A 2C6DA 2XF0A 3OXZA 1XKKA 4CYIA 4ZLYA 5IG1A 2PUIA 3KL8A 3QWKA 4FNYA 4HYIA 5CU0A 3GC0A 5AUVA 4XV2A 2VTHA 2R3QA 3CGFA 4Q2AA 3BHYA 3VQUA 4XJ0A 4FKOA 4K33A 3DAJA 2XNEA 3LQ3A 1DI8A 2IO6A 3Q6WA 4USEA 5KMNA 2VTMA 3BWJA 5E8ZA 1TFFA 2J51A 3C13A 3NAXA 4I6BA 2BIKB 5HNIX 4L46A 4DYMA 4EJNA 5JGDA 4P2KA 3RI1A 3R00A 1H0WA 2W7XA 3FI3A 3PY1A 3UZPA 3Q96A 4AU8A 1QPEA 4NFNA 5DE2A 2O64A 3UZRA 2VWXA 4FTAA 4AW5A 2W5BA 3H3CA 4FTUA 5LMAA 2BVAA 1H27A 3QKLA 3C4FA 4FKUA 4NCTC 4R1VA 5CZHA 5E91A 5HBHA 4YTFA 3TG1A 1WBOA 5AV2A 1U5RA 1BUHA 2IZTA 3I7BA 4PWNA 5M07A 2HZNA 2J7TA 2J50A 4P4CA 5CEIA 2X0QA 3QHWA 5HG9A 5AAGA 1BYGA 2R3LA 3DK7A 2H34A 3BIZA 4HVGA 4RIWA 3V8SA 4FSRA 3R02A 3MPTA 5FD2A 5J1VA 1E9HA 2GCDA 2ITPA 2WMUA 3R1YA 3SDJA 3ZBFA 4DTKA 3FZ1A 1KE5A 4B9DA 2PWLA 2AEGA 4L53A 4F1MA 1SM2A 2C6KA 5IUHA 3MFTA 4EUTA 4FKJA 4D4YA 3DJ6A 5HZNA 4CZUA 4OR5A 4IZYA 4D2TA 3ZXTA 5HTCA 4D1ZA 4CKIA 2YIQA 5LWMA 3D83A 4MF0A 1KE6A 5DRBA 2PUUA 2XA4A 4FL1A 2HK5A 1CKIA 3EQCA 4YJOA 4O83A 3UO4A 3OEZA 1FMKA 3IDPA 3OROA 5EDRA 2IG7A 2QONA 2J0LA 4IB3A 3FXXA 3H10A 4IJ9A 3ORLA 3AMAA 4FRFA 4V0GA 3W0RA 1PF8A 2WFYA 3MGYA 3NCGA 4ID7A 2QOKA 4KS7A 4RX8A 4FE2A 2RFNA 3QCYA 5AV1A 4CXAA 5DMZA 3UVQA 4J1RA 5T6KA 3DJ5A 3ZH8A 5EI6A 2DUVA 2R3JA 4FTCA 3ITZA 4Y83A 4CFUA 3V01A 2QO7A 4CLIA 2WQOA 4F65A 4BI2A 3IDCA 3ZBXA 3WYXA 4CRSA 3W0NA 1R3CA 4ENXA 4PY1A 4TYHA 2GHMA 1H25A 1WVYA 4DHFA 4E1ZA 3AMBA 3EQFA 3LCOA 4MNEA 5D10A 5LARA 2UW4A 3CIKA 3G2FA 3MBLA 4EOIA 4ITJA 4R3RA 1Y91A 4A07A 5CS6A 3D7TA 3SAYA 5LVLA 1URCA 5KZ0A 1KOAA 3S00A 2XRWA 4O96A 1XO2B 4ZLOA 4DFLA 3DKCA 4AE6A 1YWRA 2PVFA 3RP9A 3W16A 2IPXA 3LFDA 4FV2A 3FKLA 3QCXA 2X7OA 3Q4UA 4IX4A 4NK9A 4F63A 4I5MA 4CVAA 3ZFYA 3ZLSA 4FTIA 3VS3A 1GAGA 3D2IA 3O8TA 1MQBA 4CCBA 5J1WA 3TV7A 4O7VA 4GT3A 4GU6A 5HG5A 3SG9A 4TYGA 4G34A 3MTLA 5E8XA 4FBXA 5ETCA 3VBQA 4L3JA 5FGKA 2WTKB 5HG7A 3F82A 3NZ0A 4LI5A 2PVKA 3OEFX 4PP9A 1XH7A 2YCRA 4FF8A 4AW1A 4F9YA 3FMEA 1UWJA 2UVXA 4XMOA 3TCPA 3FMNA 1PKDA 2PTKA 2BKZA 1OL5A 5CSVA 4EHEA 4OTGA 4L7SA 3QGWA 3F5GA 4C33A 3QD4A 3RJCA 5TE0A 3GXLA 2UZLA 3S2PA 4I23A 4NH1A 2XUUA 3RZBA 3ZFXA 5IDPA 1AQ1A 1M2RA 3CEKA 2KTYA 3V8WA 3U54A 4YJPA 5CAUA 1JSUA 3HNGA 4AW2A 3UDBA 4IAYA 4BTFA 3PG1A 3JY9A 4RT7A 4DE4A 4OGRA 2BR1A 3SOCA 4GIIA 2WTDA 4BN1A 3CQUA 3TNQB 5AP0A 3PJ8A 4BGHA 3KIOC 4K0YA 1OGUA 2IEWA 2Z8CA 4XP2A 3W2SA 4W4WA 1W0XC 4PMTA 2QOCA 4I0RA 4DINA 4L52A 4U7ZA 4O7SA 5T68A 4HW7A 2EB2A 3JYAA 3GNIB 2E9VA 5CQUA 3ZO3A 3UNJA 5JGAA 5KUPA 1X8BA 3D2KA 1IR3A 4FZAB 4ZTQA 3QRTA 5CSHA 1JBPE 1YDRE 1FGKA 4ZTNA 4M97A 1R0EA 5L2TA 4CZTA 3CY2A 4ZTHA 4DH5A 4DT9A 3UE4A 4ZSLA 3QQUA 2J0KA 3QD2B 3R2YA 4FKVA 3O17A 4GG5A 3DY7A 2VTAA 2Y4IB 3Q9XA 3QHRA 1R78A 4DEHA 4F09A 1UWHA 3M42A 3CC6A 4WNKA 2C5OA 3LFFA 1LEZA 3Q5IA 3R73A 3V5PA 2C6OA 3W8LA 4C8BA 5CEPA 4UV0A 3VVHA 1QPCA 4S31A 2GNHA 3OCBA 4X2NA 4EH4A 3DXPA 4GYGA 2C30A 2PHKA 3HYHA 3AKKA 2XKFA 4QNAA 3CTJA 3ZS5A 2C69A 1U5QA 4E5WA 5HTIA 4DFUA 1WBSA 2C3KA 3G33A 3EFWA 3V51A 4DEAA 3QZIA 3W0QA 3PFQA 3DBQA 4EZ3A 4FZFB 5ANKA 1U54A 3KY2A 5FTQA 5BVEA 4J52A 4ZZOA 5IPJA 4G31A 3PJCA 3SXFA 4Z16A 4WG4A 2YWVA 4FTLA 1J7IA 1YHWA 2W1DA 1Q8WA 2BRMA 3AD5A 1UNLA 1ST4A 2W06A 3ZU7A 4G17A 3TDVA 4PTCA 3GOPA 4BTJA 2VUWA 3FZTA 3LLTA 2VO6A 3QZHA 3TZ9A 1OIUA 4X2GA 3E92A 3ORIA 3ZO2A 4V01A 1GZOA 3KULA 3R04A 1ZARA 3QGYA 5HIEA 3O50A 4HGLA 4WIHA 2VTOA 3P1AA 3BI6A 4EOMA 4GIHA 2ZV7A 3QC9A 3EFKA 2ITOA 2PVLA 4FKWA 5CAOA 1Q99A 1OB3A 2Z7QA 1GNGA 1JKSA 4B6LA 2FB8A 5K3YA 3E8NA 2HWPA 4DEBA 2SRCA 2XJ2A 4RZWA 4CD0A 1OECA 3UIXA 2VTTA 4O0SA 2A2AA 4F64A 3LVPA 3F5PA 1ZMVA 3BLRA 3OP5A 5AA8A 3O51A 3ANRA 5HI2A 2PZPA 2Q0BA 3AC5A 4QP7A 3UOHA 4APCA 4CTCA 3GGFA 2R3FA 4TYJA 4BCMA 2YM3A 2XBAA 4M68A 5ETIA 4GVAA 3ZEWA 2X4ZA 3ZOSA 4C4GA 4N6YA 2BHHA 1STCE 2PL0A 4JDKA 4BZNA 4ASXA 1G8AA 5L2QA 3RCDA 3IPHA 2Z7RA 1MRVA 3AGMA 3NNVA 4OTWA 3VBVA 5JQ5A 3S95A 3VS6A 2WGJA 2F7EE 4FG9A 5JMSA 1RJBA 4C4IA 2I0YA 2ZDUA 2VWUA 3QQFA 4UBAA 4W8EA 4DHZA 4FVQA 3EL7A 3KN5A 1IA8A 4ALVA 2OW3A 2PE0A 4FV4A 4USDA 4NW6A 2B0QA 3KVXA 4FL2A 1JLUE 3NUYA 2WAJA 4EOKA 2XK3A 2ZB0A 3WOWA 4EOJA 4OTPA 1XMLA 3PFYA 5AIRA 4RFMA 5I5ZA 5JFWA 2IW6A 2ZV8A 4FTKA 1NA7A 1NY3A 2A98A 4HNIA 3P08A 2XVDA 5CQWA 3UIMA 2OJGA 5EM8A 3VBTA 4LOQA 3LFEA 4H36A 4ASEA 3GI3A 1YI4A 4BDJA 3L8VA 4CT1A 3U8WA 3QALE 5CF5A 5J5SA 2X9FA 2YDJA 3PJ3A 2E9PA 1ZZLA 3IW6A 5EQEA 4I5HA 5IQAA 4G3CA 3TV6A 2RFSA 4ZMEA 4IE9A 2IW8A 3VS5A 4DTAA 3U55A 4JDIA 5FUTA 4CKRA 4CG8A 4BY9E 3QA8A 4FV8A 4ENYA 4BGGA 5DRDA 1JOWB 4CYJA 3QD3A 1A06A 2XKDA 3BHUA 2WIHA 4YP8A 3KGAA 4JDJA 4ARKA 5FDPA 4HGEA 4Y85A 5IEXA 3KRXA 5M44A 2XALA 3F66A 3P78A 1WBPA 3QA0A 3QUEA 3W2PA 1OBDA 4MEDA 2IZUA 5CSXA 5E8UA 3R9DA 3KXZA 4GG7A 3NYXA 3A2CA 2F4JA 4RJ7A 3BYVA 5A3XA 4YZBA 3PPZA 4A7CA 3PG3A 3VHKA 4F0GA 4CLJA 4H39A 3Q9ZA 3F3ZA 4A4LA 5DWRA 4IAKA 3IW8A 4LV8A 4TZRA 1SZMA 2BAKA 2CGVA 2I6LA 3KXMA 4JR3A 4FV7A 1J1CA 4U9AA 5KMKA 3BV2A 4U6RA 3ORKA 4YZMA 4NTSA 4QQJA 5EFQA 3UZTA 3BE9A 3ZDIA 4ASDA 5DGZA 3F5UA 2F7ZE 3AC1A 2ACXA 2XARA 1Q24A 3TUCA 3E64A 3LFQA 4G16A 3TNPC 4EZ7A 3NUAA 2JFLA 3MVJA 3R7GA 2NP8A 3R9NA 3A62A 3NVMB 3UC4A 2QNJA 2ITQA 3BGPA 5ANOA 4AW0A 3RTPA 4E20A 2B9HA 3CR0A 3WF5A 3SA0A 4QMLA 4ITHA 3KREA 3Q9WA 3ETAA 4XLVA 2WB8A 4WT6A 3DKGA 3MWUA 3UODA 5E90A 4FJVA 5FEDA 4PRJA 4GK2A 4QMSA 3MVLA 5DR6A 5JK3A 3MB7A 1P5EA 3HUBA 4YLKA 5HLWA 3C9WA 5H3QA 2CNUA 4DH3A 3N51A 3IG7A 3OWKA 3FI4A 4FR4A 2Y6MA 4RBLA 2QD9A 4CV8A 2V62A 2C6MA 5DT0A 1M2PA 5IQCA 4DLJA 4EYMA 4JQ8A 4ORKA 3DBCA 4I1ZA 2DS1A 4CGAA 1O9UA 3H9FA 4NKSA 1H1QA 3B8QA 1SMHA 2FYSA 4YTHA 5TR6A 3NIEA 4L00A 4BTKA 1KV2A 4FEUA 2UZOA 5M4FA 4OBQA 3TDWA 1RDQE 3PE2A 4U5JA 2JLDA 4YPDA 4F7SA 4FUYA 2XEZA 3W0OA <