3O8PA

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
336
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILGFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
total genus 110
structure length 336
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o8pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o8pA01
3S3IA 1O6KA 2PMLX 3EB0A 3VS5A 3BLQA 2XF0A 3SDJA 4MHAA 1XBCA 3QRTA 4TNDA 1UU7A 1FINA 2CMWA 3NCGA 5H8GA 4NSTA 5GJFA 1H1SA 2PSQA 4PDSA 2F7ZE 4KIPA 4AZEA 2GNGA 4BVUA 5LWMA 1I09A 3ENHA 3W2OA 5E9EA 5EHOA 1U54B 2JGZA 4BIEA 5IA2A 3T8OA 1H01A 4UWYA 4BF2A 3C9WA 3BRBA 5CAVA 1JSUA 3HMIA 2I1MA 4NTSA 2BKKA 4F6UA 4PF4A 2YDIA 4EQMA 2BHHA 3O8UA 3PWDA 4IDVA 2BVAA 4JBQA 4QTDA 5T3QA 5FEDA 3F5PA 3UGCA 3V8SA 3OS3A 3KFAA 4EH5A 2YDKA 3OMVA 4WG5A 5HHWA 3T3UA 3R7UA 4BDHA 4TYGA 3FUPA 3AGMA 5M4CA 2JDVA 4NZWB 5EDRA 3QD0A 5EI6A 4Z3VA 2PUNA 3QZIA 3E7OA 5FWKK 4MNEA 5FXRA 4Q9ZA 4QQJA 4E93A 3RNYA 3P5KA 4IWPA 2X81A 4RVMA 2ETKA 4UBAA 5C8MA 3U6IA 3F5GA 4YJUA 2R7IA 4FEQA 4X21A 2YIWA 5ITAA 1DI9A 1L3RE 4FIEA 4UMQA 3BQRA 1YXUA 1J1BA 3IQ7A 2JAMA 3IW6A 2R3IA 4FVQA 4HVHA 4LG4A 4JBPA 3KXNA 3QUEA 3SLSA 4GFGA 2VN9A 2QG5A 3LXPA 3P79A 5CEMA 1YXVA 4R3PA 3CTJA 4KIQA 3EKNA 2WB8A 2A1AB 3IO7A 3NUNA 4RWKA 4ZP5A 1ZLTA 3LJ0A 2OJFE 4O0TA 4QO9A 5LQFA 1OIUA 4YC6A 3DBFA 5C9CA 2PVNA 4QMVA 5HICA 4KKEA 2VTIA 2UW4A 4XG2A 4EHGA 4F9WA 3WILA 1L8TA 3U87A 3GB2A 3KB7A 4AE6A 4BDFA 3ZDUA 3EQBA 3JY9A 4D55A 2B52A 1T45A 4Z7GA 5AP1A 5CTPA 5AV2A 4DG0E 5HKMA 3ZZWA 5G6VA 4D2PA 4TPTA 4GIIA 1TQPA 2PY3A 2JDSA 4U41A 5CX9A 3TXOA 4IAZA 1M2PA 2BILB 2V7AA 4BI0A 4NYEA 4CMTA 3SXSA 3RI1A 3VF8A 2ITZA 5EW8A 4GUBA 4U79A 4IW0A 2OJGA 4MXYA 2CSNA 3MS9A 4BHZA 4PTEA 1U54A 4M0YA 1OL2A 3NYVA 3UO4A 3V6SA 2QHMA 3U51A 5F95A 4FKVA 4TY1A 5IQEA 3ZEPA 4TN6A 1ZY4A 4GFMA 4AXAA 3VUMA 3O2MA 2WMAA 3IKAA 4WNOA 3WE8A 3BV3A 4U44A 4HZSA 4WO5A 4DE4A 5DT3A 1NVSA 3FZSA 4CLJA 4FSRA 3P86A 4AZSA 1ZMVA 4PMMA 4RG0A 3R7VA 2R3GA 3RBWA 3ZUUA 5E90A 5IKWA 4YZ9A 2BZKB 3RINA 3LFCA 4RT7A 4ACMA 3V01A 4XRJA 4QPMA 3NUPA 4O83A 2BIKB 3K2LA 3DLZA 1ATPE 3KCKA 2X8DA 3QU0A 4ZOGA 5I3OA 4HVGA 4QOXA 4MCVA 3C0IA 4ASDA 2UVXA 4HGEA 4NUSA 3ULIA 2OIQA 3NDMA 3NNXA 3OWLA 5IA1A 2C0IA 4DFZE 4ID7A 2BTSA 3CS9A 3QQKA 5AAFA 3EHAA 4UV0A 4FKGA 3EQPA 3I5NA 4EYJA 4NIFB 3OBGA 5EM7A 2YEXA 4FG9A 5D12A 5HE1A 2Y4IC 4BCPA 5IZFA 4FKTA 1KUTA 2VO6A 1OL7A 4O1PA 3SG8A 2CKPA 3SC1A 3C4ZA 3DAKA 4H39A 1YQJA 2YIQA 2WFYA 3N51A 3DBQA 5CNOA 3UYSA 3TV4A 4WKQA 5DR2A 3RGFA 5ICPA 3AT2A 3LJ2A 2ZMDA 1Q8WA 5HG5A 4PL5A 4LOQA 3WIKA 4G31A 4K2RA 2QCSA 2HY81 2X7GA 3CCNA 3HUCA 4I0RA 3QZHA 4TZRA 5HEZA 4G1WA 5HVYA 4C2VA 2J51A 1YDTE 3OCGA 3FLQA 3FLWA 3MJ1A 4OBQA 5LVOA 3ZSGA 5EDPA 1QMZA 3TKIA 3ZRLA 2QU6A 5JFVA 2RF9A 4D4YA 4R1YA 2RFDA 1FOTA 1UA2A 3PA5A 5BUIA 3ZZEA 3HRBA 4DHFA 3ZLYA 1OM1A 4FKIA 2CKEA 1H25A 3AC3A 5ETIA 2PVJA 3GCVA 3THBA 4A9TA 3DU8A 4I4FA 3FWQA 3QRKA 4ASZA 5CU0A 5GINE 4ZY4A 3F61A 3HLLA 1UWJA 3EFWA 3QKLA 1ZYSA 4WA9A 3R9NA 5EKNA 4BDGA 4X2JA 2CCIA 3D9VA 2XS0A 4DBXA 4O2ZA 2A19B 4BWKA 4NFMA 3V5QA 2C6MA 3PZHA 4FGBA 4DN5A 4FSNA 3WYXA 5IDPA 3LFNA 2A2AA 4BR3A 4FC0A 3JXWA 2YAAA 4DT9A 3DXQA 3A4OX 3QRJA 5EHYA 1CM8A 3KXMA 3S4QA 2XA4A 4AN2A 5E8VA 3UDBA 4KSPA 3VBXA 5IQFA 2WU6A 4W9WA 3Q6UA 2BAQA 3C4XA 3GU6A 3RK9A 3MSSA 3O96A 4QMOA 3TCPA 4BGHA 4EZ5A 5HCYA 1JPAA 1H1PA 4IC7A 4QQ5A 1KV2A 3D2KA 4RSSA 2GDOA 3H4JA 3DDPA 4ORKA 4R78A 2HCKA 2ITXA 3UG2A 4CQEA 2JFLA 3A2CA 3F2NA 3AGLA 2YM7A 4FTIA 1WZYA 2KTYA 3ATSA 3PFQA 2XNNA 4YZCA 4C35A 4F65A 4KUJA 4LGHA 2OZOA 3RK7A 1KV1A 4EOMA 3GQIA 3GI3A 3ZU7A 2OH0E 4F9BA 4V05A 3UOKA 3QWKA 2W06A 2OU7A 3PIYA 4ANBA 1YI6A 4DH8A 2IG7A 3QD3A 1UU3A 3QD4A 4ZZNA 3F3TA 2VO7A 3HMNA 5LVNA 3TM0A 4DEDA 2XJ2A 3LXLA 2WQMA 1WBVA 2F7EE 2VWZA 3FHIA 4TKSA 3BYUA 5IA5A 5K0KA 4ASXA 1Q99A 1M14A 2XB7A 1YDSE 4MWIA 3UODA 5IG1A 1P4FA 4FX3A 2VTSA 1Q8TA 1WBSA 5ANOA 1NVQA 3D2IA 3DQXA 3BYMA 2IJMA 4QMZA 5AX9A 2PVYA 5DWRA 4OTWA 3ULZA 2ITVA 4F64A 2ZV8A 2PUIA 4C38A 4C0TA 2YLFA 3C13A 4JI9A 2C3IB 2V55A 4L01A 4F7SA 4MD8E 4O38A 1OIYA 2QOFA 3EWHA 5M44A 1UVRA 3BBTB 3HEGA 1RW8A 4RFZA 4I6FA 3WYYA 2X4ZA 3F7ZA 4W9XA 1XKKA 5DT0A 4ERKA 4HVSA 3NEWA 3NPCA 5BVEA 4B8MA 2QURA 4D4SA 3G6HA 3Q9ZA 4FZ7A 4JRNA 5IQIA 3KRWA 1J1CA 1SNXA 3F2AA 4GK4A 3QGYA 1YWRA 2NRUA 5KZ0A 2B7AA 3ZCLA 4A9SA 5IH5A 4NKSA 1Q4LA 3QXOA 2W96B 4YO4A 2XBAA 5EW9A 4LRMA 5JFXA 3DNDA 4WOVA 3GP0A 3DKFA 3DBDA 4Z7HA 1KE8A 4L9IA 4RVLA 5AUYA 2O8YA 3EQHA 4P2KA 4KKGA 3P7AA 3ANRA 3C4FA 4JDHA 4BCKA 1GZ8A 5KMIA 4L42A 4A06A 3LCTA 4PNKA 3VHEA 4J98A 2ERZE 5GNKA 4EQUA 1JQHA 3FQSA 3OOMA 3PE1A 4GMYA 1ZOHA 2WMUA 5AWMA 2XNPA 4ALWA 2C1BA 3PVGA 3ODZX 1WFCA 2ZDUA 4JIKA 2JIVA 4NCTA 5CZHA 3VUDA 3OHTA 1Y6AA 4QP4A 3WZDA 5KMNA 3AT4A 3MH0A 4DINA 5BYLA 3QD2B 4I6QA 3DFAA 4DYMA 1M52A 1ZYCA 3O8PA 1H00A 4NM3A 5EK7A 2PULA 5LVMA 2H96A 4DCAA 4OGRA 3UVRA 3OUKA 4RJ4A 3WF5A 4EOPA 4EOJA 3D5UA 2CLQA 4PDOA 3Q4CA 3BYOA 1MQBA 3MH3A 4Q2AA 2G1TA 2OG8A 4FNZA 4FTKA 4K6ZA 4W8EA 5DA3A 2WMVA 5JFWA 4OTHA 1XJDA 3I81A 3R7GA 3C50A 2OO8X 2G2IA 3LFAA 4G9CA 5EM6A 3TEIA 3FZ1A 2VTJA 4BCHA 3I4BA 1OB3A 4XV9A 2XKEA 1Y57A 5FBNC 5IISA 2EB3A 3EZRA 1WMKA 5EH0A 4AQCA 3NLBA 3UQGA 3P0MA 2VTOA 4KNBA 4O6EA 4S33A 4IWQA 3HV5A 2CKQA 4APCA 4ZLOA 3QGWA 2P33A 2QU5A 2ZV7A 3F5UA 5JMSA 2VTHA 4IADA 3TN8A 2IZSA 3IOPA 4ZTMA 5AR4A 3MPAA 5FD2A 2Z7QA 3HA6A 4Y83A 4IIRA 2R2PA 1FBNA 4MXZA 2XK9A 2B54A 3OCSA 3BU5A 5AR2A 2X9FA 5E8TA 4FZFB 5HOAA 4E1ZA 3UNZA 1JOWB 2W4JA 5AR8A 2JDRA 2UW7A 3NR9A 5AAEA 3F69A 3OXZA 4YU2A 2C5XA 3I7CA 3DT1A 4IAIA 4YJQA 3QZGA 4LV5A 5E8SA 1BUHA 5K0XA 3UOLA 4AGUA 2GQRA 4JX7A 3HKOA 4CCBA 1XH5A 5DT4A 4BICA 2R3JA 2WMWA 4R5SA 5KHWA 3MFRA 4NJ3A 4CCUA 4G2FA 5DYJA 2XP2A 4XYFA 3TZ8A 3K5VA 4QRCA 3ZRKA 4DH1A 4I92A 4HOKA 2ZB1A 3CY3A 3SV0A 2E9PA 3KMMA 4AOTA 4C2WA 2J7TA 3NUSA 5AUZA 5L8LA 1H0WA 3BGPA 2Z60A 3GFEA 3Q6WA 3BGZA 4I0SA 3A4PA 5CYIA 3D0EA 5C03A 3KULB 3CTHA 5CZIA 4MBIA 4JQEA 4ZY6A 4M12A 4Q5HA 2J0LA 3HP5A 3U54A 5M08A 4H05A 1KE9A 4FKPA 3RM6A 2R3OA 4EH9A 2OW3A 5LCJA 2B0QA 5KUPA 1K9AA 3FZOA 3MYGA 4BKZA 3O23A 3QAME 3SXRA 4IXPA 4R6VA 3C4WA 4AACA 3D7TA 3CP9A 2PMIA 4NEUA 1PXKA 3O50A 3ORTA 4G3EA 2OH4A 2BAJA 4QP2A 3OWKA 3FAAA 4F09A 3PE2A 4L68A 2HXQA 4XX9A 3E63A 4FBXA 5DEWA 2GQGA 4N6ZA 4A9UA 1Q8UA 5EYKA 3G9NA 1P14A 4XH6A 4EUUA 5C8NA 2J4ZA 3R1YA 5EM8A 4BDBA 2VX0A 5KBQA 1U46A 3AC5A 4I1ZA 4Q5EA 2BHEA 4RJ3A 1LR4A 5M06A 4IZ5A 1O9UA 2XK6A 2NRYA 2VO3A 1ZOGA 3VUKA 5CALA 4MYGA 5IQDA 2XKCA 3ZRMA 4YC3A 1UNGA 3ANQA 5A54A 2J90A 3Q04A 5FRIA 3NYNA 1NW1A 3BLRA 4NFNA 5AJQA 1JSVA 2WMQA 3P7CA 3QCQA 3OXIA 4FKWA 2UW8A 4IVBA 4WRGA 4BWXA 5I9VA 4JDJA 1G8AA 2ZJWA 4UX9A 2CPKE 4K18A 2XKDA 3LJ1A 4S2ZA 5FGKA 4W4VA 3OFMA 3RNIA 4D2SA 3DAJA 3UYTA 4LMUA 3G33A 4XP3A 2I0YA 3LFDA 1FPUA 3EZVA 3SRVB 4AUAA 2W1IA 2UZWE 2HZIA 3RK5A 3VS0A 3G0FA 4EK8A 3B2TA 4FTCA 4EBWA 4DFNA 2J5FA 3LM0A 4DG3E 3VC4A 5DBXA 1WBNA 5CXHA 2O63A 4YP8A 5CAQA 3E62A 2C69A 5JZJA 5FP5A 1LEZA 5D7VA 5AP4A 3KXZA 3V04A 5FDPA 3GC0A 4QMQA 3VVHA 3MY0A 1YVJA 3TNIA 4OTIA 3Q53A 3RALA 3VBVA 3QYWA 4IVAA 2ZB0A 5AUUA 4YC8A 2CN5A 3BGQA 3FY0A 3Q60A 3DAEA 1CTPE 4GCJA 3KULA 3ACJA 3QUDA 4IVDA 1ZMUA 3A7FA 3ZFYA 4O0VA 2QG7A 3Q32A 4AP7A 3N4TA 4AZTA 2LGCA 4ANSA 4E5AX 1FGKA 3LQ3A 2C6OA 3H9RA 1XH7A 1S9IA 2XCHA 5CF4A 2PMNX 1E9HA 4QQTA 4XEYA 3QKKA 2BZIB 1QPEA 4JS8A 4QPAA 2X39A 4XG7A 2W99B 3HA8A 3QCSA 3R22A 2WOUA 3BHYA 1OZ1A 2AC5A 3EN7A 3IECA 5IA4A 2YISA 2QKWB 4MBJA 4B9DA 3CEKA 3DFCB 4EC8A 2QODA 4M15A 2FYSA 4DH5A 4FIIA 3ERKA 2BRGA 3C7QA 3K54A 3S2PA 3EIDA 3Q4TA 2XZSA 3L1SA 2JAVA 3DLSA 4FSZA 1M2QA 2E9OA 4FTLA 2E9VA 4D5KA 1YOLA 4XLIA 4C3FA 3KREA 5HO6A 5D10A 5A6OA 2F2CB 4RC4A 3W8LA 3CTQA 3VRZA 1XR1A 2I40A 1KE6A 3BV2A 3MDYA 4PY1A 3SAYA 4ZMFA 2ESMA 4DEBA 4HZRA 4JG7A 2I0EA 5LWNA 1GJOA 3KVXA 3R02A 2XNGA 3EFJA 4FG7A 2WQEA 3W32A 1JKKA 3I60A 3IGGA 4QMWA 1R3CA 4USEA 4UXQA 3ZC6A 3C0HA 4NTTA 4QQCA 5FXSA 3DK3A 4BC6A 4UEUA 4EZ3A 4AGDA 4L45A 3RM7A 5K3YA 5IQHA 3PWYA 4G5PA 5IUIA 3FC1X 4BYJA 4D2WA 3NRMA 4E6AA 4DEGA 3A62A 4GV1A 3LVPA 3AMBA 5EM5A 5M4UA 5E8WA 5AIRA 4ZZOA 1ZYJA 4J97A 4O2PA 3ZUTA 4L3JA 4DGGA 4EWHA 4M67A 5TT7A 3LLAA 5DI1A 5GZ9A 5B0XA 5AAGA 4PX6A 4CV8A 2QC6A 5KE0A 4FNXA 4BTMA 3NYOA 2GNIA 2P55A 5T6KA 3KK9A 3UVQA 1H8FA 2GHLA 2Z2WA 4BGGA 3O8TA 3OUNB 4G6NA 2JDOA 4JT3A 1KE7A 3K5UA 4G3CA 5AP3A 1DAYA 1HOWA 2YIYA 2GNFA 3GFWA 4TWCA 3OY1A 4D1XA 3OTUA 3PA3A 3PXYA 2QLQA 3F3VA 5TF9A 4FT9A 4DF3A 1OECA 2OFUA 2RFEA 3MN3A 4W4YA 2G2FA 4L46A 5JRSA 5TKDA 3VS2A 2BRNA 1PW2A 2Z7LA 2X8EA 4FZDB 4QYYA 4IJ9A 3VS6A 4FV9A 5BUJA 4GSBA 4HGSA 3SA0A 2CDZA 4ZTQA 2IZUA 5AEPA 3DOGA 3G0EA 3Q3BA 4J52A 4EOOA 2ZVAA 4ZAUA 5K4JA 4ACCA 4AF3A 4CKJA 1GZOA 2DS1A 1OGUA 3UJGA 3WOWA 4QT1A 4FVRA 2PZRA 3RCJA 1JKSA 3FMNA 2WD1A 1YDRE 1OKWA 1T46A 2ZM1A 2O64A 1W8CA 4JOAA 3W18A 2C3LA 1GZNA 1BKXA 3VN9A 3V6RA 4J71A 3HAVA 3Q2JA 4HYUA 4O7WA 4FL1A 4HVDA 3EQRA 4AN3A 3GQLA 3QC9A 4OT5A 5HTBA 3V3VA 1IA9A 3D5WA 5DG5A 3F2RA 3WIGA 4GT4A 5BX0A 3FEGA 2XBJA 5CVHA 3C4CA 1UNLA 2DYLA 3UG1A 4EOLA 4FKSA 3U8WA 5IH4A 3C0GA 2B9HA 2VZ6A 2PMOX 3VJOA 3NIEA 5GJGA 1XQZA 3FQHA 4K8AA 1OKZA 5T68A 2R3KA 5CVFA 2REIA 3D5VA 2NO3A 3HV7A 1YWNA 5TO8A 4D1SA 4D2TA 3E8CA 4IH8A 4QMTA 3KQ7A 4L43A 2GS7A 4NM0A 4EEVA 2C5YA 4FV5A 3PP0A 3HV3A 4XBRA 2HXLA 2KULA 4KINA 4QMMA 4FTUA 3GT8A 2IW8A 3RWPA 4DTKA 2QOCA 4RVKA 3VW6A 4ONAA 4IX6A 1U4DA 4XV1A 3TKHA 4DFBA 3MY1A 3WZKA 3COKA 4GYGA 4IM3A 2XRUA 4OR5A 3EQCA 1SZMA 2QO7A 3OY3A 4RRVA 5CY3A 5C4KA 4V0GA 4N57A 2UZDA 3GGFA 3HNGA 4FSWA 2WTCA 4UY9A 4WHZA 4RZWA 4GL9A 2FH9A 3DKOA 4YSJA 4O7RA 1G5SA 4QTBA 4F1TA 4BBEA 2EVAA 4RX8A 5AP7A 1MQ4A 1MRUA 4DITA 2W9ZB 4GJ3A 4X3FA 1E1XA 4NH1A 4FTNA 3G2FA 3R73A 2C0TA 1GIIA 4FIJA 2Y0AA 5HNBA 3VJNA 4CMOA 4RMZA 2PK9A 3W55A 4C34A 4IAAA 3O51A 3BZ3A 2PE2A 3I7BA 1BX6A 4CXAA 4DGLC 4I6HA 1Q8YA 4X6QC 3V5JA 4CTCA 2XJ1A 4D9TA 5J1WA 4PDYA 3UZTA 2VTQA 2B9FA 4XLVA 4UWCA 5JN2A 1GIHA 2GQSA 4CFFA 2HOGA 4J8MA 4LOPA 4RIWB 4IEBA 3D83A 5ETAA 5B2KA 2R0UA 2JBOA 3COIA 5LMAA 1ZZ2A 3ZUVA 3ZOSA 5M57A 1W7HA 4PP9A 1VEBA 3NYXA 4KRCA 3TNWA 2QOKA 4BDJA 4M84A 4CV9A 4G9RA 4YJNA 3PJ2A 1GZKA 3FY2A 3COMA 3KXGA 3AMYA 3AD5A 2X7FA 1CKPA 4XG3A 5C27A 3FPQA 5L4QA 4FEXA 2WKMA 4YJVA 3L8XA 3UVPA 3NVMB 4N6YA 3VQHA 5A3XA 4OAVB 3PPZA 2HW6A 3S95A 2C30A 4ZS0A 3PUPA 4NK9A 2WGJA 4XOZA 3PVBA 4PUZA 4K11A 5AV1A 3A60A 2F9GA 2ITUA 2W1GA 3AC8A 2WHBA 3RWQA 3MH2A 2IVVA 3FL5A 5IUHA 3FJQE 4FIFA 3A7HA 5EKOA 3R7OA 5BVFA 1YXSA 4L3LA 3UNJA 4C59A 4YZNA 1OBGA 2X2MA 4OLIA 3LQ8A 3GC8A 1IRKA 3R8MA 1BYGA 4BCFA 2VWWA 5CEIA 5E8ZA 1JLUE 1JVPP 2J0JA 4DC2A 1UU8A 3OG7A 2X2LA 2QOLA 4FYNA 4FKUA 4EBVA 2WQOA 5JQ5A 3PG1A 3MB7A 4IHPA 4C8BA 4B6LA 3NUAA 4OAUC 3R0TA 4TXCA 4YJOA 2OICA 4E4MA 3GCSA 3R8LA 3FSKA 4C4GA 2P2HA 2GNJA 2C3KA 2CGVA 3O7LD 1RJBA 4MEDA 4R8QA 4CFVA 5I9XA 2JITA 3QQJA 3VBYA 5IMXA 4F7JA 2YWVA 2VNYA 2VNWA 3DTCA 5DR9A 3FKOA 1ZOEA 2XIXA 3GU8A 3PSCA 3VNTA 2WZJA 3MVJA 3QTQA 5AM7A 2WTJA 2BFYA 3PVUA 4A9YA 3F3WA 3IG7A 3LZBA 4O27B 3TWJA 4EH2A 4F1MA 2Y8OA 3NAYA 2H6DA 5CI7A 3D14A 5D9HA 4CVAA 2Z8CA 5A9UA 2XRWA 4MF1A 5GIOE 3VUHA 2VWYA 4ZLYA 3VS3A 4IANA 4K1BA 3AC2A 1LEWA 5AP5A 2B9IA 3OC1A 2HZ4A 4F9YA 2C0OA 1X8BA 4EJNA 3TZ7A 4FT5A 4N4SA 5KO1A 4MXCA 5F20A 1OUKA 3EFLA 4USDA 4FV6A 4YJTA 5L6WL 1FGIA 3CGFA 3RVGA 4BCJA 1RE8A 4FICA 2ZAZA 4RJ8A 5HI2A 4ANLA 3ORPA 2W7XA 4X7QA 5DHJA 4RJ5A 4CNHA 5CASA 1DAWA 3QQFA 5BYYA 3QZFA 4FEWA 5BUEA 4KBAA 4Y85A 3ZLWA 4TWNA 4CG9A 4BY9E 3RZBA 3PRFA 4U3YA 3R8VA 3F3UA 4FT7A 4YTCA 3CJFA 5DGZA 4BBFA 1KWPA 3R7EA 4X2GA 4XCUA 4CFWA 2PVMA 4C33A 1WVXA 5ANDA 4CSVA 2ZM4A 4CT2A 4DCEA 2BCJA 4GK3A 3O0GA 4E8AA 4O91A 4JNWA 2EXMA 3A7JA 2OFVA 1OPJA 1W82A 4FKLA 3NS9A 5EG3A 3KMUA 3C4EA 2ZYBA 2GS6A 2AUHA 3AD6A 3TDVA 1B38A 4JDIA 4FV1A 3SG9A 3C1XA 4OTDA 3MGYA 4YGAA 5CSHA 2ERKA 3ALOA 3AXWA 4EC9A 3PG3A 4HGLA 3LXKA 3QA8A 3LOKA 4UMRA 4CFXA 5AIKA 3TUBA 1BMKA 3GC9A 2FGIA 4WNKA 4MXAA 3L9MA 3BWJA 3L8PA 4QMXA 4QNAA 4L52A 2BUJA 1OL5A 5M55A 5A46A 1WBPA 1Z5MA 4XMOA 2UZEA 4WBOA 5ANEA 3GU7A 2VU3A 3FMEA 4DGNA 1GIJA 3NZ0A 4XV2A 4CZTA 4O81A 4O84A 3GU5A 5K4IA 1ZARA 3KVWA 3LCOA 2PU8A 2EXEA 2XJ0A 2WTVA 4LL5A 4PPBA 4DTBA 5D11A 3QTZA 3NUXA 1J7UA 4FZAB 2J0MB 5EHLA 5AADA 4EZ7A 2BPMA 3VQUA 3G9LX 2YZLA 2V5QA 1H28A 3L9PA 5L2QA 4O7ZA 3KRXA 4EH8A 4F9AA 3G90X 3MIAA 4DG2E 5F94A 3GU4A 4AZVA 4NW5A 5JQ8A 3FLSA 4YMJA 4FF8A 4HYHA 4DFYA 2HIWA 4UALA 4FA2A 2XIZA 2R3LA 2VUWA 1GY3A 3SD0A 3TTIA 2XIYA 3POOA 2WTKB 3OZ6A 1WVYA 4OTQA 2UZBA 4G17A 5M51A 3AMAA 2NNWB 4NKAA 5LMBA 4RA4A 5CEQA 5JGBA 2HY0A 4L7FA 1SNUA 2HELA 4RLKA 5LMKC 4NIFA 3OWJA 5CU6A 3PY3A 4ZLZA 4I0TA 3DA6A 5BNJA 5EQPA 1SM2A 3ROCA 2Z02A 2PZIA 4GJ2A 3VF9A 4D9UA 1PYXA 2J5EA 5HTCA 4YHJA 5BYZA 1QPJA 4F08A 3LW0A 3ZO4A 3NW6A 5LVPA 4C4IA 4O0RA 4RIOA 5FEEA 3U6JA 4GIHA 4ZSLA 3M2WA 1NY3A 3TNPC 3UIMA 2R3HA 2XIRA 3ENMA 3VUIA 2QOBA 4JAIA 4XV3A 2QNJA 5BVNA 4I5PA 5AM6A 2R3QA 1JAMA 4PMPA 5M4FA 2C6TA 2OLCA 4OBPA 3FYJX 2FSLX 4BDCA 4FV0A 3BIZA 3V8TA 5AUTA 5JSMA 5I0BA 3R8UA 3PJ3A 1CKIA 3R21A 2OBJA 3AQVA 3EQGA 3AC1A 1Q62A 5J9LA 4QMSA 2W5BA 1QL6A 4AW2A 5KNJA 3CJGA 1QPCA 3QTSA 4LUEA 4O0UA 4U5JA 4KWPA 5ETFA 2X4FA 1W83A 4XRLA 5AP6A 3PJ1A 3Q96A 3ORKA 2QQ7A 3EL7A 5CAUA 3WF7A 4FT0A 3QRUA 2H8HA 4QMNA 4W4WA 3E8DA 2P4IA 3R6XA 4EQCA 5M4IA 5HBJA 4D5HA 2WU7A 2YLEA 3OEZA 4MK0A 4XG6A 4D58A 3Q9XA 3OXTA 2QOHA 1KSWA 3DK6A 3GBZA 3GCUA 1LUFA 1Q5KA 2GNHA 3Q52A 4RIXB 4U9AA 1PXMA 4EOKA 3V51A 2W9FB 2XK4A 3CQUA 3DJ7A 2BFXA 5H8EA 4UB7A 3TIYA 4HGTA 4GW8A 1ZWSA 5HE2A 4FV8A 3ROYA 2ZV9A 3S1HA 3B2WA 2HZNA 4QP7A 4N0SA 2C1AA 5CT0A 3UPXA 3IONA 3OF0A 2ZOQA 3TNQB 4EK3A 1H1WA 4RJ6A 5D41A 4JG6A 2VTLA 4YUQA 4ZTRA 5M56A 1KE5A 3TUCA 3LHJA 2RSVA 4HPTE 4M69B 2C6LA 2Y6MA 4YTIA 5HU3A 2UVZA 3Q5IA 4TNBA 3EYGA 2JKMA 2RKUA 1MRYA 3MPTA 5IEYA 3NWWA 3EL8A 3PDTA 1S9JA 4C37A 1ERKA 4AZWA 1OMWA 4YNOA 1H26A 2R0IA 3ZO2A 4BCGA 3KXHA 4J95A 3PP1A 3BLHA 4A07A 4ARKA 3CPBA 3RKBA 1WCCA 2WNTA 4IE9A 3W1FA 5A4LA 3CSVA 4KBKA 3DZQA 1YWVA 5GZ8A 4AWIA 3ZBXA 5J7BA 2JLDA 5CF6A 5CS6A 2CN8A 5A4EA 4JQ7A 2ETMA 3RPSA 4NJDA 3MPMA 4KSQA 4ZJIA 3UOHA 4B8LA 1H1RA 3Q5ZA 1MP8A 1ZY5A 4XG9A 4DGMA 4NW6A 5E8YA 3ZH8A 2HENA 3UTOA 4BKYA 4EONA 3JR1A 4YO6A 5HLWA 5J7HA 5HX8A 2F7XE 4QP1A 4HNIA 4XNEA 3MESA 2HK5A 4C57A 3RPOA 3N9XA 3UIXA 2QONA 2YDJA 4IB0A 3KRRA 5IEVA 4ENYA 5L8KA 3FKLA 5HBHA 2V0DA 1UWHA 2WAJA 4D2RA 4XP2A 1OKYA 4BCNA 4BDEA 4GKIA 3QCXA 1PXPA 2UW0A 2YITA 4GT3A 2HZ0A 1IASA 3FZRA 4J96A 3UZRA 5M09A 3U4UA 3UMXA 3TI1A 1W84A 4U81A 2G9XA 3R01A 5AUXA 1FVVA 4L53A 3NW5A 4BZOA 1R1WA 1XHAA 1PY5A 3EN4A 4OTGA 3RJCA 2WMBA 4FL2A 4FE2A 3CR0A 3EOCA 2VTNA 1YRPA 3KXXA 3MJ2A 3CD8A 3FYKX 4JIAA 4F7NA 3UMWA 2NP8A 4GVJA 3JUHA 3HMOA 5IA0A 3L9LA 3D5XA 3O17A 2VGOA 3MH1A 3QHRA 5CQWA 5F1ZA 3WZEA 2WQBA 3KY2A 2W1HA 4RIXA 5CLPA 4AE9A 4BB4A 4EH7A 3PRIA 4I5MA 4IACA 5C8KA 1HCLA 5CI6A 4UYNA 4BCOA 4LFIA 3UBDA 4O7VA 3DV3A 5E1EA 3U6HA 4FMQA 4CG8A 5AUVA 4YPSA 4ZSEA 2RGPA 3EYHA 3GC7A 3JVRA 4NWMA 2ITTA 3A99A 3FZPA 2FSOX 4V01A 4BI1A 2QKRA 1V0BA 4S31A 5DE2A 5B2MA 2ITNA 2PVRA 5M07A 2WMRA 5LJJA 4M66A 2YIXA 1RQQA 3LXNA 5L6PA 2YWPA 3DK7A 3BHUA 1H08A 3LIJA 1GAGA 2F49A 4FR4A 5CF8A 5JRQA 2GHMA 3LKMA 1PMEA 4C7TA 5FTOA 3QBNA 3NNVA 4LQMA 4H1JA 4ALUA 4MQ2A 2OXDA 2JEDA 3UNKA 4U40A 4GT5A 5KMKA 2GHGA 4FKOA 4WNPA 5KMOA 4O22A 1BI7A 2X6EA 5CQUA 3KN5A 4FOCA 4CKIA 3R8ZA 2OZAB 3FC2A 4AW5A 1Q97A 4AA0A 2BR1A 3PSBA 2UZNA 2CJMA 5I4NA 1V1KA 4APPA 3WF6A 4JR7A 5L8JA 3B8QA 4EKLA 5DNRA 4O6LA 4MD9E 4N70A 4C58A 1LP4A 5K9IA 2I0VA 4RQVA 5IMEA 4YBJA 1JKTA 3ORXA 1PRYA 3PZEA 4XS2A 5J9YA 4U0IA 4FYOA 4FKRA 3DDQA 3O7LB 1TQIA 4BIDA 3SX9A 4KABA 3GXLA 3H0YA 3L8VA 2CHLA 4BHNA 3CE3A 3OP5A 3V8WA 3T9TA 4M68A 5L3AA 3TDWA 5CT7A 4AOIA 1P4OA 5I9UA 4G5JA 5LMKA 4NT4A 2R3FA 4M13A 1K2PA 3OT3A 3D4QA 3U4WA 4FKJA 4PPCA 2XEYA 4JLCA 5BVOA 4IDTA 2OK1A 2ZM3A 4BIBA 3CD3A 1G3NA 3CQWA 1V0OA 3BQCA 3F82A 4QD6A 5L2WA 3S0OA 5CF5A 4IWDA 4E5BA 3MVLA 5F4NA 3UC3A 4NU1A 2XMYA 2Z7SA 4B4LA 4CRLA 4IAYA 4HCUA 5HZNA 4RIYB 2QD9A 2UVYA 4OTPA 4PP7A 4XOYA 3DB6A 4RVTA 4EK5A 3PA4A 4QYGA 3H10A 3FPMA 3GCPA 3KC3A 4P5QA 2W1ZA 5HG9A 5CENA 4AGCA 3E88A 2EUFB 3TZMA 3W33A 2VGPA 3FMHA 3BEAA 5KZIA 3RAIA 4F7LA 1Y8YA 5GIPE 3E3PA 2JDTA 5AR5A 3WBLA 4ZK5A 4F70A 4QMLA 2DQ7X 2WMSA 2C3JA 2AC3A 3P23A 4FL3A 2R3PA 4FTMA 5HIEA 4BFMA 4QTEA 2C47A 4RX9A 3BEGA 2OJ9A 4TYJA 5AP0A 4LI5A 3FQEA 4IB5A 2OXYA 3LE6A 4C4FA 1JBPE 3ZFMA 2WPAA 4BN1A 5HU9A 3NNWA 3UIUA 4GFOA 1PXNA 2VAGA 4UWBA 5HNIX 2BIYA 5FTQA 4OTRA 5HTIA 5FG8A 4DTAA 4BGQA 4RX5A 1STCE 4FV4A 2VWVA 5BMMA 3FLYA 4AZFA 5HD4A 4Y73A 1OI9A 3WZJA 1F3MC 2PVHA 4IQ6A 5M53A 3T3VA 2XK7A 3ZONA 4EKKA 4FUYA 3FL4A 3A61A 4V04A 4CKRA 4LRJA 5FP6A 3WZUA 3UP7A 4J7BA 4JDKA 4LGGA 2B53A 4O1OA 4F63A 2C5OA 2V62A 2ZMCA 4MWHA 2EB2A 4Y46A 5CVGA 2J2IB 5HESA 2B4SB 4WNMA 1W98A 4FEVA 1YXXA 4ACDA 4CD0A 3BE9A 5H2UA 2VTRA 5H8BA 1AGWA 3M42A 3MY5A 4MVFA 4YLKA 4ZMEA 2WEIA 3HDNA 3RHKA 4FNYA 1IAHA 4ZSAA 2FVDA 4E6DA 2PZYA 5HX6A 1XH6A 2BAKA 4FUXA 4ACHA 3PIZA 2Y6OA 2VX1A 4AOJA 4E7WA 4CYIA 3FMKA 2YA9A 3SRVA 2E9NA 1A06A 2C4GA 2C6DA 1H27A 4GG5A 4BKJA 1ZAOA 4ERWA 1OKVA 2BDJA 1AQ1A 1OVEA 3IGOA 3FE3A 4FTQA 4R77A 3R83A 2VWIA 3I79A 2QHNA 3NIZA 3BYVA 4E4LA 5HO7A 4X3JA 5LVLA 4AT3A 1VYWA 3ZMMA 3DQWA 4YSMA 3ZDIA 4RIYA 1A48A 2DUVA 4FGRA 1PKDA 1ZYLA 2YM5A 1XBBA 1H07A 3G5DA 4Z55A 2YABA 2XNMA 1REKA 3QTRA 4L67A 2X7OA 3WE4A 1PMUA 1U59A 1SVEA 3F6XA 3JPVA 4HVIA 4FTAA 1EH4A 4IAFA 4YTHA 5EI8A 5HO8A 4I3ZA 5CSXA 5HCZA 5HVJA 5D7AA 1J7LA 4QTAA 5ANGA 4EK4A 5JK3A 4X2KA 4CRSA 2UZOA 4O7TA 4M8TA 4C4JA 4AW0A 3FZTA 3TTJA 5B7VA 1B6CB 2RFNA 3SXFA 3MA3A 4QYEA 4TT7A 2HWPA 1PYEA 3ZC5A 3BBWA 4CFNA 4UMUA 4UZDA 2ITQA 2R7BA 2X9EA 4LOOA 4FTJA 4WG4A 5CWZA 4BZNA 1IAJA 3QHWA 3QTUA 4JR3A 4HJOA 1AD5A 5JEBA 4ZXTA 2C6EA 2UZVA 5A4CA 4Y95A 4O82A 3ZO3A 2XK3A 4GRBA 3IW8A 2PYWA 2HYYA 1O6LA 2GTMA 5DH3A 3NUUA 4USFA 1VJYA 4MNEB 4O0YA 4RBLA 1GNGA 2VO0A 3VW8A 1GOLA 5AA8A 3ATTA 4UZHA 5C26A 5HG8A 4IB3A 2PVLA 5AV0A 4BTJA 2Q0NA 5HE0A 4EH6A 5E91A 2JD5A 3MI9A 2XYUA 3R28A 4FIGA 1URCA 4KB8A 4QNYA 4PQNA 3DS6A 5J87A 4QP3A 3UPZA 4CZYB 1XH9A 2J50A 3N4VA 4A9RA 5KX8A 3E87A 5E7RA 5CAPA 2GCDA 2XCKA 3JVSA 4L8MA 4YPDA 2PL0A 2UZUE 3DJ6A 2HW7A 4UN0C 2O3PA 4JBOA 4BCIA 1SVGA 4EK6A 1WBWA 2PVKA 1DM2A 3HX4A 3UE4A 4CQGA 5J95A 5TR6A 2FSTX 4MTAA 4IX3A 4GG7A 5FLFA 3I0OA 4YHFA 1R78A 4ITJA 4E6CA 2BROA 4HNFA 2O5KA 5KBRA 4TL0A 4Y8DA 4U80A 3LFBA 5ANKA 3HL7A 5IH6A 2VX3A 4J53A 2BALA 2W4OA 4C62A 2PWLA 4ZY5A 5B2LA 5FQDC 3SW7A 3CBLA 5CSWA 3R9RA 4ZS4A 4HCVA 3TJCA 3RPVA 1VZOA 4IAKA 3R9DA 4D4RA 3AD4A 3I6UA 1Z57A 3O71A 4AA4A 5L2SA 5BVWA 4IZAA 2JKOA 3V5TA 5TOZA 2VWXA 2XVDA 3VUGA 4AFJA 3V5LA 4U45A 4IM0A 4F6WA 4RC3A 3WF9A 5L2IA 4FVPA 3PJCA 3P1AA 3CGOA 3QTXA 5I9WA 4AX8A 3UZPA 3QC4A 4ZSGA 4G3FA 4WD5A 2WO6A 4QP8A 3BHTA 3RMFA 4I6BA 4H3BA 4MX9A 4RLLA 4WRSA 2W0JA 4R7HA 3H0ZA 4EHVA 4JXFA 4BTKA 4KKHA 5E8XA 4EOIA 1BL7A 3ACKA 4L3PA 4FSUA 2JBPA 1UNHA 4KA3A 2WXVA 4AN9A 2F4JA 4MH7A 1ZRZA 2G01A 1R39A 2RFSA 3HYHA 2XM9A 1MUOA 3PXQA 2WMXA 5H9BA 1O6YA 2W5AA 4XUFA 3V5PA 4MD7E 3EFKA 4G3DA 4FIHA 5IF1A 3OT8A 3UO5A 1Y8GA 4I20A 1PXIA 5AV3A 3IDPA 2Q0BA 4B7TA 3UOJA 3F9NA 2W05A 5K5XA 3E7VA 3DXPA 4II5A 3KU2A 4J8NA 4LRKA 4C3RA 3LM5A 5FM3A 4C02A 3I6WA 5HORA 3ZFXA 3HDMA 2GNLA 3NX8A 4MKCA 4I23A 4GYIA 1BLXA 3FMJA 3ZXZA 3EKKA 5BQ0A 3IW5A 5LOHA 3ZTXA 4BL1A 4NL0A 5A4QA 2PPQA 3E8NA 4TTHB 5AP2A 2NPQA 3QX2A 4L00A 4IFCA 2O65A 2WTKC 4CLIA 4F99A 3ZEWA 4E4XA 2BMCA 2HAKA 3KMWA 4CTBA 2GFCA 3R9OA 2W1CA 4TYEA 3DTWA 3HGKA 4FTRA 3TNHA 1JWHA 3VS4A 4D0WA 2YM8A 2GPHA 1XBAA 3FMLA 4NCTC 3QALE 1YW2A 3P9JA 2VTPA 1YI3A 3ORZA 4PMSA 3QUPA 3OTVA 4PPAA 1WVWA 4UMTA 4IFGA 5KHXA 1MRVA 4D4VA 3RAHA 2V22A 4FG8A 4F6SA 2BDWA 4W4XA 4X2NA 4EI4A 1IA8A 3IOKA 4RFMA 3I5ZA 2X1NA 1OPLA 4WSQA 1YOJA 4GUEA 3FI8A 4O7NA 2RIOA 3TIZA 1URWA 3HV4A 4XBUA 1UKIA 3NAXA 3ZSIA 4DFLA 1XWSA 5TE0A 2YCFA 4PWNA 3KF4A 3AOXA 5FM2A 4BI2A 2CNVA 4RIWA 2OIBA 3BHVA 3NUYA 3PIXA 3R8PA 3VRYA 3ZHPC 3NMUF 4EH4A 3JY0A 4BDAA 1CSNA 3DCVA 1U5QA 1CMKE 2R64A 3TZ9A 2XIKA 2QVSE 3NGAA 4DEAA 4Z16A 2H34A 4W8DA 4FSMA 5CXZA 2F2UA 2YM6A 4TYHB 3IW7A 3R1QA 4AW1A 4KAOA 5HIBA 1UKHA 4QTCA 5AX3A 1LPUA 3EN9A 4HCTA 5AR7A 4DEEA 4ZTLA 5GZAA 2XUUA 4DGOA 3PXKA 5A6NA 5J79A 3VBTA 3FDNA 2YCQA 4TRLA 3JYAA 1REJA 2R9SA 2XK8A 4ZZMA 4RGJA 2B9JA 2ITPA 2ZDTA 4Y5QA 3RZFA 3PTGA 1OPKA 3A7IA 3AT3A 4I5HA 2R5TA 3QXPA 4EYMA 3QQGA 3QQHA 3QTWA 4FKQA 3TJDA 4E5WA 5EDQA 4Y5HA 3W2QA 3ZXTA 1UV5A 5AV4A 4C36A 2R3RA 4O0XA 4IVCA 2R4BA 4G16A 4LUDA 3PXRA 2VD5A 3LFEA 3A7GA 3A8XA 4GK2A 3R63A 4E6QA 1FMOE 2E9UA 3PSDA 3KKVA 4BCQA 3NSZA 3OW3A 4EUTA 4DFUA 3R7YA 3P78A 4TW9A 4BDIA 5JFSA 1J7IA 4QYHA 4PL3A 4BTFA 2ETRA 3HRFA 4TWOA 3ALNA 3GOKA 4ZTHA 3QTIA 3PY1A 3FSFA 3TV7A 1FVTA 3ZLSA 4QP6A 3FLZA 3GUBA 1TVOA 2J9MA 3PPKA 1G8SA 4O0WA 1HCKA 3UP2A 2BRHA 4ZTNA 1J91A 4GVAA 3G51A 5IEXA 3HVCA 4K9YA 1H24A 4RZVA 4KRDA 4J1RA 4XHKB 4O7YA 5FUTA 4RFYA 4MNFA 4P5ZA 2IWIA 5JZNA 1H0VA 5EYDA 3R9HA 4IM2A 4F0GA 3EH9A 1P5EA 2YM4A 2PUPA 1H1QA 5CEPA 3SVVA 1ZYDA 3BX5A 5BPYA 4KIKB 3OCBA 2Y9QA 4YTFA 2YJSA 4EL9A 4IB1A 3MFSA 4R3CA 4PDPA 3R7IA 2FSMX 4C4EA 2ITYA 2J0IA 1F0QA 1WAKA 2C68A 1APME 4G34A 3GENA 2AYPA 3EN6A 5BVKA 4MBLA 3RTPA 3W16A 4HW7A 4I24A 4GKHA 2UW5A 4EH3A 2XH5A 1E1VA 2W1FA 3QCYA 3PVWA 4Q9SA 4ASEA 4LV8A 4YZDA 3COHA 5DPVA 4TYHA 2QOIA 3LCDA 4WSYA 4D28A 3G6GA 1A9UA 5J1VA 5EQEA 1WBTA 3Q4UA 2PUUA 4I22A 3BELA 3W2SA 3SGCA 4PTCA 2C6KA 4YHTA 2OWBA 4JX3A 4QMYA 2QR8A 2GU8A 1YHVA 3UQCA 2BKZA 2E2BA 3CQEA 3MVMA 2OI4X 3TKUA 3PXFA 4CMUA 4IC8A 1Y91A 5IQBA 3R2BA 4HYSA 4WIHA 4X0MA 3ZBFA 4BDKA 3P7BA 4I4EA 1OIQA 2QI8A 2RG5A 4FSQA 3LMGA 4IWOA 5BMSA 3V5WA 2OJJA 4IX5A 2IVSA 1VR2A 4TWPA 3FI3A 4M97A 3W2CA 1JSTA 4ENXA 5CU4A 3VWAA 4CYJA 5L2TA 3DZOA 3BPRA 3MTFA 1YXTA 4HYIA 4ANQA 1IG1A 1UU9A 4G6LA 1F5QA 1CKJA 4ANOA 2VWBA 2XEZA 5HNGA 2P2IA 3E5AA 1OL6A 3FKNA 3TV6A 3IS5A 1OITA 2IZRA 4NM5A 2SRCA 2VTMA 4FK6A 4AFEA 4AT4A 4F1OA 4D0XA 1M2RA 2YCSA 3WARA 3BCEA 3P08A 4J99A 2Y4IB 2VRXA 4E20A 2WEVA 3GVUA 4EORA 2UZTA 3LPBA 5A4TA 2JFMA 3NNUA 5FXQA 5HIDA 4O7SA 1XO2B 3EQDA 4U6RA 5KCVA 4KS8A 3ORNA 3AG9A 2VTTA 4YURA 4ZIMA 3VUTA 5E8UA 4O86A 2X2KA 3MV5A 5CSPA 3MB6A 2X8IA 3HP2A 3PPJA 5J9ZA 4S34A 4LL0A 4GH2A 3D94A 3QLGA 4BDDA 2XNBA 3MFUA 2W1EA 1SYKA 3ITZA 5AR3A 4KIKA 4DBNA 4ITIA 5DN3A 3QQUA 4I5CA 3BWFA 4MXOA 3E92A 3ETAA 4WUNA 3KK8A 4X2FA 5GHVA 2B55A 4LYNA 5IA3A 1DS5A 5D1JA 3RP9A 4O21A 1PF8A 2JKKA 5E4HA 3VBWA 2O2UA 3CKWA 3RHXA 4JQ8A 5HLPA 3W10A 2YN8A 2YZAA 4MF0A 2OKRA 3M11A 4RA5A 3R1NA 2CCHA 3II5A 3PJ8A 4PNIA 4WUAA 4Z9LA 4DT8A 2EXCX 5IPJA 2IO6A 4OTFA 2PE0A 3CC6A 4S32A 3SOCA 4EJ7A 2R3NA 3FI2A 2J0KA 2R3MA 1Q41A 2V7OA 2WQNA 3MTLA 3OWPA 4H3QA 2ONLC 3D7TB 3DBCA 2ZV2A 4U42A 3ZLXA 3EJ1A 3BE2A 3I0QA 4JRVA 3QKMA 4E26A 4FNWA 4IZ7A 4JJRA 3ZYAA 1VYZA 1KOAA 3UO6A 5BVDA 1IEPA 3WF8A 2A4LA 2JIUA 5IU2A 1V0PA 5EQYA 3ODYX 2QOOA 5DFPA 4EOQA 5C01A 3E93A 4YZMA 2UW6A 2WIPA 4QPSA 1W0XC 4FSYA 2PVFA 5F9EA 5EOBA 4EHZA 2A27A 1FMKA 1ZMWA 3K3JA 4U97A 3DBEA 2J6MA 3D7ZA 5DVRA 1NT2A 2OJIA 4XJ0A 5GJDA 2IVUA 5DLSA 5DEYA 3FI4A 3PLAE 4H58A 1BL6A 3LFQA 2BZJA 5J5TA 2UW3A 3CXWA 1M7QA 4L6QA 3BYSA 2OIDA 4A7CA 2C6IA 4DH7A 4DLJA 2WIHA 3VAPA 2DWBA 2WOTA 4ALVA 5KKRC 4BRXA 4O96A 5A14A 3OCTA 5I9ZA 1SMHA 2EU9A 2ITOA 4F9CA 3ORLA 1YHWA 3LMHA 5EFQA 2P3GX 3FBVA 3RCDA 2QOQA 3QYZA 4F0IA 3FLNC 3MBLA 1PMNA 5JH6A 5IDNA 4FEUA 1YI4A 4YBKA 5K5NA 3GCQA 5HVKA 3HUBA 3LLTA 4OT6A 2YHVA 1XH4A 1OUYA 3PYYA 2WELA 1RDQE 3HECA 2OGVA 5E92A 2JC6A 4I93A 5CU2A 4M69A 5IQAA 1NXKA 4R1VA 3KL8A 3W2RA 3FXXA 2CNUA 5LCKA 4CFMA 1Q8ZA 4BCMA 5CEOA 4ITHA 4P4CA 4RWLA 3SW4A 2LAVA 2YAKA 3VIDA 3SKCA 1XH8A 1YKRA 4U3ZA 4FSTA 3IPHA 4C3PA 3FMDA 2UV2A 1OIRA 2IW6A 4XG8A 3G15A 4H3PA 3RAWA 2GSFA 2RL5A 3MW1A 4PMTA 4YLLA 4AT5A 3ZS5A 4BBMA 2W1DA 2BDFA 2YERA 3P4KA 4FODA 3CLYA 3UC4A 4QP9A 3QL8A 2UUEA 5AUWA 2PE1A 5I3RA 2BRMA 2CGWA 4DAWA 4X6RA 1M7NA 4BWPA 2JIIA 5HE3A 3OW4A 2BZHB 2CLXA 5FBOA 4YR8A 5DRBA 3HMPA 4WG3A 5EW3A 5G1XA 4ACGA 4O0SA 4E4NA 4RX7A 5LXMA 1OL1A 4FZ6A 3ORIA 1ZZLA 3FHRA 3VS7A 4DH3A 3HMMA 2UW9A 4HPUE 3UQFA 5ANIA 4BZDA 3VS1A 4K0YA 1PHKA 4YJRA 4E3CA 3L8SA 3GOPA 2CGUA 3R30A 4MQ1A 4NM7A 2GTNA 2OXXA 4FT3A 3SQQA 4ANNA 5EI2A 2ACXA 3W2PA 1NA7A 3OD6X 3DGKA 3ID6C 1FVRA 4AGWA 4ZEGA 3ZO1A 2B1PA 5FEQA 2H9VA 2VTAA 3IDCA 4S30A 1PXJA 3D15A 2BTRA 3LFSA 4IMYA 2YFXA 3VO3A 4I41A 2Q83A 4F4PA 1FQ1B 1PJKA 4X3FC 4RWJA 3HRCA 1R0EA 3MA6A 2WTWA 3CPCA 2C5VA 2IVTA 3H30A 4AG8A 2WMTA 3ELJA 2VV9A 4WBBB 4R7BA 3BKBA 4FK3A 5HGIA 3RPRA 2QR7A 4M0ZA 3LAUA 4MAOA 2YACA 3DNEA 5KMJA 2WTIA 3DJ5A 3KGAA 3BU6A 3BU3A 2IZTA 4GU9A 5CU3A 5AFVA 4ZJVA 3ZM4A 4ANMA 2A0CX 1B39A 3IW4A 4AU8A 5H3QA 1IR3A 4DEIA 2JKQA 3QFVA 2UZLA 3TT0A 3R71A 3GNIB 1QPDA 2GFSA 3L9NA 4DA5A 4QYFA 5CNNA 2W17A 4Y72A 5JT2A 5IQGA 2P0CA 1PXOA 2I6LA 5I5ZA 5CAOA 4FTOA 4C61A 2PZPA 5KKRB 3QQLA 3S00A 1YHSA 2FA2A 4R5YA 4JL9A 4B0GA 3TG1A 4H1MA 4LM5A 3LQ5A 3MVHA 1QCFA 4U43A 3E3BX 5CEKA 5EYMA 2Y4PA 3NCZA 3SOAA 3KN6A 5E1SA 3F88A 4CGAA 2QO9A 3U55A 2OZAA 3IDBA 1Q3DA 4GEOA 5ANJA 5JGDA 3C51A 3AC4A 4P7EA 4L7SA 4H36A 3CIKA 4YLJA 5J8IA 1PMVA 2YJRA 4EWQA 1K3AA 3A8WA 4KIOA 3QA0A 3HZTA 3Q2MA 4DFXE 2OSCA 4L44A 3W8QA 4P90A 4FV2A 2PZ5A 5HCXA 3HAMA 3LCSA 4UXLA 3NVKI 3RPYA 4A4XA 3JS2A 4PL4A 3HV6A 2WTDA 3Q4ZA 4C4HA 1TQMA 5KMLA 4OUCA 3DPKA 5EOLA 3T9IA 3EQIA 3EQFA 1Q24A 4TYIA 1SVHA 3EMGA 5JKGA 3ET7A 2IN6A 2GMXA 3MIYA 5DMZA 2YM3A 4M3QA 4R3RA 5HBEA 3H9FA 3R1SA 4IBMA 4KS7A 4UYAA 2XKFA 2VWUA 2Z7RA 3CKXA 3CY2A 4U8ZA 4CFUA 3F7WA 3QF9A 2ONLA 3I1AA 3E8EA 3F3ZA 3EN5A 1KOBA 3TL8A 2XYNA 3PLSA 2PHKA 2QLUA 4RQKA 1ND4A 5ETCA 4DEHA 3F5XA 4F0FA 3QWJA 4PRJA 4KD1A 4JAJA 2I0HA 4XG4A 2C5NA 2EWAA 5DIAA 5DOSA 3H3CA 3LFFA 1JKLA 3PXZA 3U9CA 5CANA 4LMNA 1U5RA 3C5UA 3NW7A 5J5SA 5ACKA 4FV3A 1OBDA 3R04A 1R0PA 4IZYA 2F57A 4G6OA 5IQCA 2OF4A 4UMPA 2X6DA 1PKGA 2QO2A 2IPXA 4PTGA 5CSVA 3SHEA 4EOSA 3M1SA 3R2YA 3QRIA 2IW9A 2RG6A 4V0GB 3OVVA 1J3HA 3REPA 5AA9A 4CEGA 4ZJJA 3KRLA 2ITWA 3K3IA 4D2VA 1TKIA 2XNEA 4XP0A 3BI6A 1Z9XA 3OOGA 5FTGA 2YIRA 2O0UA 2G15A 5EYCA 3H9OA 4O7LA 4RJ7A 2G2HA 4OW8A 4X3FB 2FO0A 5C1QB 4AA5A 4U7ZA 4A4LA 4JG8A 3U9NA 4CZUA 3DY7A 5KMMA 3TUDA 1I44A 3DKGA 3KCFA 4JBVA 1Q61A 3FMMA 3LCKA 1DI8A 4A4OA 3LMIA 1Q3WA 4JVGA 4OBOA 3DB8A 4D1ZA 4AS0A 3Q9YA 4EHEA 4KBCA 3QX4A 1H4LA 2GS2A 4M7IA 4RWIA 4WT6A 3MWUA 3OROA 3OEFX 4M14A 5HG7A 4IX4A 2YCRA 3DKCA 3TACA 3UIBA 4MXXA 4YJSA 3POZA 4I21A 4GU6A 2BRBA 1M17A 2X0GA 4K77A 1JNKA 1YOMA 4YJPA 4R7IA 5DR6A 4G3GA 3BHHA 3QLFA 3FXZA 4CT1A 4LGDA 4E73A 5HQ0A 1PXLA 1Y6BA 2CKOA 4K33A 1BI8A 3KEXA 4RC2A 4RPVA 4AAAA 3C5IA 3GEQA 4PV0A 3KRJA 2W5HA 5HLNA 4QMPA 2I7QA 2HWOA 3RAKA 5ACBC 3KF7A 4FV7A 5HD7A 3ZSHA 3VBQA 5L6OA 5JGAA 3KA0A 3PY0A 4QMUA 3R00A 2OF2A 3DXNA 5DRDA 3E64A 2PTKA 3FV8A 2FUMA 4GS6A 4ZSJA 5C4LA 3F66A 2CNQA 4I94A 4IJPA 2XNOA 1NVRA 3B8RA 4ZTSA 4YNEA 5AMNA 4FTTA 2XM8A 5LARA 5IUGA 3ZM9A 4FOBA 5I9YA 2W4KA 1WBOA 3FXWA 3OBJA 3ORMA 4FI1A 4YZBA 3VHKA 1CDKA 3N4UA 5FDXA 4BYIA 3WI6A 4B99A 4DLIA 3VULA 3IK3A 1P2AA 2CGXA 1ZXEA 2Y7JA 3MFTA 3Q9WA 2FB8A
chains in the Genus database with same CATH superfamily
3S3IA 1O6KA 2PMLX 3EB0A 3VS5A 3BLQA 2XF0A 3SDJA 4O4CA 4MHAA 1XBCA 3QRTA 4TNDA 1UU7A 1FINA 2CMWA 3NCGA 5H8GA 4NSTA 5GJFA 1H1SA 2PSQA 4PDSA 2F7ZE 4KIPA 4AZEA 2GNGA 4BVUA 5LWMA 1I09A 3ENHA 3W2OA 5E9EA 5EHOA 1U54B 2JGZA 4BIEA 5IA2A 3T8OA 1H01A 4UWYA 4BF2A 3C9WA 3BRBA 5CAVA 1JSUA 3HMIA 2I1MA 4NTSA 2BKKA 4F6UA 4PF4A 2YDIA 4EQMA 2BHHA 3O8UA 3PWDA 4IDVA 2BVAA 4JBQA 4QTDA 5T3QA 5FEDA 3F5PA 3UGCA 2AQXA 3V8SA 3OS3A 3KFAA 4EH5A 2YDKA 3OMVA 4WG5A 5HHWA 3T3UA 3R7UA 4BDHA 4TYGA 3FUPA 3AGMA 5M4CA 2JDVA 4NZWB 5EDRA 3QD0A 5EI6A 4Z3VA 2PUNA 3QZIA 3E7OA 5FWKK 4MNEA 5FXRA 4Q9ZA 4QQJA 4E93A 3RNYA 3P5KA 4IWPA 2X81A 4RVMA 2ETKA 4UBAA 5C8MA 3U6IA 3F5GA 4YJUA 2R7IA 4FEQA 4X21A 2YIWA 5ITAA 1DI9A 1L3RE 4FIEA 4UMQA 3BQRA 1YXUA 1J1BA 3IQ7A 2JAMA 3IW6A 2R3IA 4FVQA 4HVHA 3AKKA 4LG4A 4JBPA 3KXNA 3QUEA 3SLSA 4GFGA 2VN9A 2QG5A 3LXPA 3P79A 5CEMA 1ST0A 1YXVA 4R3PA 3CTJA 4KIQA 3EKNA 2WB8A 2A1AB 3IO7A 3NUNA 4RWKA 4ZP5A 1ZLTA 3LJ0A 2OJFE 4O0TA 4QO9A 5LQFA 1OIUA 4YC6A 3DBFA 5C9CA 2PVNA 4QMVA 5HICA 4KKEA 2VTIA 2UW4A 4XG2A 4EHGA 4F9WA 3WILA 1L8TA 3U87A 3GB2A 3KB7A 4AE6A 4BDFA 3ZDUA 3EQBA 3JY9A 4D55A 2B52A 1T45A 4Z7GA 5AP1A 5CTPA 5AV2A 4DG0E 5HKMA 3ZZWA 5G6VA 4D2PA 4TPTA 4GIIA 1TQPA 2PY3A 2JDSA 4U41A 5CX9A 3TXOA 4IAZA 1M2PA 2BILB 2V7AA 4BI0A 4NYEA 4CMTA 3SXSA 3RI1A 3VF8A 2ITZA 5EW8A 4GUBA 4U79A 4IW0A 2OJGA 4MXYA 2CSNA 3MS9A 4BHZA 4PTEA 1U54A 2XARA 4M0YA 1OL2A 3NYVA 3UO4A 3V6SA 2QHMA 3U51A 5F95A 4FKVA 4TY1A 5IQEA 3ZEPA 4TN6A 1ZY4A 4GFMA 4AXAA 3VUMA 3O2MA 2WMAA 3IKAA 4WNOA 3WE8A 3BV3A 4U44A 4HZSA 4WO5A 4DE4A 5DT3A 1NVSA 3FZSA 4CLJA 4FSRA 3P86A 4AZSA 1ZMVA 4PMMA 4RG0A 3R7VA 2R3GA 3RBWA 3ZUUA 5E90A 5IKWA 4YZ9A 2BZKB 3RINA 3LFCA 4RT7A 4ACMA 3V01A 4XRJA 4QPMA 3NUPA 4O83A 2BIKB 3K2LA 3DLZA 1ATPE 3KCKA 2X8DA 3QU0A 4ZOGA 5I3OA 4HVGA 4QOXA 4MCVA 3C0IA 4ASDA 2UVXA 4HGEA 4NUSA 3ULIA 2OIQA 3NDMA 3NNXA 3OWLA 5IA1A 2C0IA 4DFZE 4ID7A 2BTSA 3CS9A 3QQKA 5AAFA 3EHAA 4UV0A 4FKGA 3EQPA 3I5NA 4EYJA 4NIFB 3OBGA 5EM7A 2YEXA 4FG9A 5D12A 5HE1A 2Y4IC 4BCPA 5IZFA 4FKTA 1KUTA 2VO6A 1OL7A 4O1PA 3SG8A 2CKPA 3SC1A 3C4ZA 3DAKA 4H39A 1YQJA 2YIQA 2WFYA 3N51A 3DBQA 5CNOA 3UYSA 3TV4A 4WKQA 5DR2A 3RGFA 5ICPA 3AT2A 3W0SA 3LJ2A 2ZMDA 1Q8WA 5HG5A 4PL5A 4LOQA 3WIKA 4G31A 4K2RA 2QCSA 2HY81 2X7GA 3CCNA 3HUCA 4I0RA 3QZHA 4TZRA 5HEZA 4G1WA 5HVYA 4C2VA 2J51A 1YDTE 3OCGA 3FLQA 3FLWA 3MJ1A 4OBQA 5LVOA 3ZSGA 5EDPA 1QMZA 3TKIA 3ZRLA 2QU6A 5JFVA 2RF9A 4D4YA 4R1YA 2RFDA 1FOTA 1UA2A 3PA5A 5BUIA 3ZZEA 3HRBA 4DHFA 3ZLYA 1OM1A 4FKIA 2CKEA 1H25A 3AC3A 5ETIA 2PVJA 3GCVA 3THBA 4A9TA 3DU8A 4I4FA 3FWQA 3QRKA 4ASZA 5CU0A 5GINE 4ZY4A 3F61A 3HLLA 1UWJA 3EFWA 3QKLA 1ZYSA 4WA9A 3R9NA 5EKNA 4BDGA 4X2JA 2CCIA 3D9VA 2XS0A 4DBXA 4O2ZA 2A19B 4BWKA 4NFMA 3V5QA 2C6MA 3PZHA 4FGBA 4DN5A 4FSNA 3WYXA 5IDPA 3LFNA 2A2AA 4BR3A 4FC0A 3JXWA 2YAAA 4DT9A 3DXQA 3A4OX 3QRJA 5EHYA 1CM8A 3KXMA 3S4QA 2XA4A 4AN2A 5E8VA 3UDBA 4KSPA 3VBXA 5IQFA 2WU6A 4W9WA 3Q6UA 2BAQA 3C4XA 3GU6A 3RK9A 3MSSA 3O96A 4QMOA 3TCPA 4BGHA 4EZ5A 5HCYA 1JPAA 1H1PA 4IC7A 4QQ5A 1KV2A 3D2KA 4RSSA 2GDOA 3H4JA 3DDPA 4ORKA 4R78A 2HCKA 2ITXA 3UG2A 4CQEA 2JFLA 3A2CA 3F2NA 3AGLA 2YM7A 4FTIA 1WZYA 2KTYA 3ATSA 3PFQA 2XNNA 4YZCA 4C35A 4F65A 4KUJA 4LGHA 2OZOA 3NFFB 3RK7A 1KV1A 4EOMA 3GQIA 3GI3A 3ZU7A 2OH0E 4F9BA 2A98A 4V05A 3UOKA 3QWKA 2W06A 2OU7A 3PIYA 4ANBA 1YI6A 4DH8A 2IG7A 3QD3A 1UU3A 3QD4A 4ZZNA 3F3TA 2VO7A 3HMNA 5LVNA 3TM0A 4DEDA 2XJ2A 3LXLA 2WQMA 1WBVA 2F7EE 2VWZA 3FHIA 4TKSA 3BYUA 5IA5A 5K0KA 4ASXA 1Q99A 1M14A 2XB7A 1YDSE 4MWIA 3UODA 5IG1A 3W0NA 1P4FA 4FX3A 2VTSA 1Q8TA 1WBSA 5ANOA 1NVQA 3D2IA 3DQXA 3BYMA 2IJMA 4QMZA 5AX9A 2PVYA 5DWRA 4OTWA 3ULZA 2ITVA 4F64A 2ZV8A 2PUIA 4C38A 4C0TA 2YLFA 3C13A 4JI9A 2C3IB 2V55A 4L01A 4F7SA 4MD8E 4O38A 1OIYA 2QOFA 3EWHA 5M44A 1UVRA 3BBTB 3HEGA 1RW8A 4RFZA 4I6FA 3WYYA 2X4ZA 3F7ZA 4W9XA 1XKKA 5DT0A 4ERKA 4HVSA 3NEWA 3NPCA 5BVEA 4B8MA 2QURA 4D4SA 3G6HA 3Q9ZA 4FZ7A 4JRNA 5IQIA 3KRWA 1J1CA 1SNXA 3F2AA 4GK4A 3QGYA 1YWRA 2NRUA 5KZ0A 2B7AA 3ZCLA 4A9SA 5IH5A 4NKSA 1Q4LA 3QXOA 2W96B 4YO4A 2XBAA 5EW9A 4LRMA 5JFXA 3DNDA 4WOVA 3GP0A 3DKFA 3DBDA 4Z7HA 1KE8A 4L9IA 4RVLA 5AUYA 2O8YA 3EQHA 4P2KA 4KKGA 3P7AA 3ANRA 3C4FA 4JDHA 4BCKA 1GZ8A 5KMIA 4L42A 4A06A 3LCTA 4PNKA 3VHEA 4J98A 2ERZE 5GNKA 4EQUA 1JQHA 3FQSA 3OOMA 3PE1A 4MUQA 4GMYA 1ZOHA 2WMUA 5AWMA 2XNPA 4ALWA 2C1BA 3PVGA 3ODZX 1WFCA 2ZDUA 4JIKA 2JIVA 4NCTA 5CZHA 3VUDA 3OHTA 1Y6AA 4QP4A 3WZDA 5KMNA 3AT4A 3MH0A 4DINA 5BYLA 3QD2B 4I6QA 3DFAA 4DYMA 1M52A 1ZYCA 3O8PA 1H00A 4NM3A 5EK7A 2PULA 5LVMA 2H96A 4DCAA 4OGRA 3UVRA 3OUKA 4RJ4A 3WF5A 4EOPA 4EOJA 3D5UA 2CLQA 4PDOA 3Q4CA 3BYOA 1MQBA 3MH3A 4Q2AA 2G1TA 2OG8A 4FNZA 4FTKA 4K6ZA 4W8EA 5DA3A 2WMVA 5JFWA 4OTHA 1XJDA 3I81A 3R7GA 3C50A 2OO8X 2G2IA 3LFAA 4G9CA 5EM6A 3TEIA 3FZ1A 2VTJA 4BCHA 3I4BA 1OB3A 4XV9A 2XKEA 1Y57A 5FBNC 5IISA 2EB3A 3EZRA 1WMKA 5EH0A 4AQCA 3NLBA 3UQGA 3P0MA 2VTOA 4KNBA 4O6EA 4S33A 4IWQA 3HV5A 2CKQA 4APCA 4ZLOA 3QGWA 2P33A 2QU5A 2ZV7A 3F5UA 5JMSA 2VTHA 4IADA 3TN8A 2IZSA 3IOPA 4ZTMA 5AR4A 3MPAA 5FD2A 2Z7QA 3HA6A 4Y83A 4IIRA 2R2PA 1FBNA 4MXZA 2XK9A 2B54A 3OCSA 3BU5A 5AR2A 2X9FA 5E8TA 4FZFB 5HOAA 4E1ZA 3UNZA 1JOWB 2W4JA 5AR8A 2JDRA 2UW7A 3NR9A 5AAEA 3F69A 3OXZA 4YU2A 2C5XA 3I7CA 3DT1A 3BL7A 4IAIA 4YJQA 3QZGA 4LV5A 5E8SA 1BUHA 5K0XA 3UOLA 4AGUA 2GQRA 4JX7A 3HKOA 4CCBA 3ML1A 1XH5A 5DT4A 4BICA 2R3JA 2WMWA 4R5SA 5KHWA 3W0PA 3MFRA 4NJ3A 4CCUA 4G2FA 5DYJA 2XP2A 4XYFA 3TZ8A 3K5VA 4QRCA 3ZRKA 4DH1A 4I92A 4HOKA 2ZB1A 3CY3A 3SV0A 2E9PA 3KMMA 4AOTA 4C2WA 2J7TA 3NUSA 5AUZA 5L8LA 1H0WA 3BGPA 2Z60A 3GFEA 3Q6WA 3BGZA 4I0SA 3A4PA 5CYIA 3D0EA 5C03A 3KULB 3CTHA 5CZIA 4MBIA 4JQEA 4ZY6A 4M12A 4Q5HA 2J0LA 3HP5A 3U54A 5M08A 4H05A 1KE9A 4FKPA 3RM6A 2R3OA 4EH9A 2OW3A 5LCJA 2B0QA 4JMQA 5KUPA 1K9AA 3FZOA 3MYGA 4BKZA 3O23A 3QAME 3SXRA 4IXPA 4R6VA 3C4WA 4AACA 3D7TA 3CP9A 2PMIA 4NEUA 1PXKA 3O50A 3ORTA 4G3EA 2OH4A 2BAJA 4QP2A 4BJJB 3OWKA 3FAAA 4F09A 3PE2A 4L68A 2HXQA 4XX9A 3E63A 4FBXA 5DEWA 2GQGA 4N6ZA 4A9UA 1Q8UA 5EYKA 3G9NA 1P14A 4XH6A 4EUUA 5C8NA 2J4ZA 3R1YA 5EM8A 4BDBA 2VX0A 5KBQA 1U46A 3AC5A 4I1ZA 4Q5EA 2BHEA 4RJ3A 1LR4A 4AXFA 5M06A 4IZ5A 1O9UA 2XK6A 2NRYA 2VO3A 1ZOGA 3VUKA 5CALA 4MYGA 5IQDA 2XKCA 3ZRMA 4YC3A 1UNGA 3ANQA 5A54A 2J90A 3Q04A 5FRIA 3NYNA 1NW1A 3BLRA 4NFNA 5AJQA 1JSVA 2WMQA 3P7CA 3QCQA 3OXIA 4FKWA 2UW8A 4IVBA 4WRGA 4BWXA 5I9VA 4JDJA 1G8AA 2ZJWA 4UX9A 2CPKE 4K18A 2XKDA 3LJ1A 4S2ZA 5FGKA 4W4VA 3OFMA 3RNIA 4D2SA 3DAJA 3UYTA 4LMUA 3G33A 4XP3A 4DHIB 2I0YA 3LFDA 1FPUA 3EZVA 3SRVB 4AUAA 2W1IA 2UZWE 2HZIA 3RK5A 3VS0A 3G0FA 4EK8A 3B2TA 4FTCA 4EBWA 4DFNA 2J5FA 3LM0A 4DG3E 3VC4A 5DBXA 1WBNA 5CXHA 2O63A 4YP8A 5CAQA 3E62A 2C69A 5JZJA 5FP5A 4QEBA 1LEZA 5D7VA 5AP4A 3KXZA 3V04A 5FDPA 3GC0A 4QMQA 3VVHA 3MY0A 1YVJA 3UDSA 3TNIA 4OTIA 3Q53A 3RALA 3VBVA 3QYWA 4IVAA 2ZB0A 5AUUA 4YC8A 4AAYA 2CN5A 3BGQA 3FY0A 3Q60A 3DAEA 1CTPE 4GCJA 3KULA 3ACJA 3QUDA 4IVDA 1ZMUA 3A7FA 3ZFYA 4O0VA 2QG7A 3Q32A 4AP7A 3N4TA 4AZTA 2LGCA 4ANSA 4E5AX 1FGKA 3LQ3A 2C6OA 3H9RA 1XH7A 1S9IA 2XCHA 5CF4A 2PMNX 1E9HA 4QQTA 4XEYA 3QKKA 2BZIB 1QPEA 4JS8A 4QPAA 2X39A 4XG7A 2W99B 3HA8A 3QCSA 3R22A 2WOUA 3BHYA 1OZ1A 2AC5A 3EN7A 3IECA 5IA4A 2YISA 2QKWB 4MBJA 4B9DA 3CEKA 3DFCB 4EC8A 2QODA 4M15A 2FYSA 4DH5A 4FIIA 3ERKA 2BRGA 3C7QA 3K54A 2X0OA 3S2PA 3EIDA 3Q4TA 2XZSA 3L1SA 2JAVA 3DLSA 4FSZA 1M2QA 2E9OA 4FTLA 2E9VA 4D5KA 1YOLA 4XLIA 4C3FA 3KREA 5HO6A 5D10A 5A6OA 2F2CB 4RC4A 3W8LA 3CTQA 3VRZA 1XR1A 2I40A 1KE6A 3BV2A 3MDYA 4PY1A 3SAYA 4ZMFA 2ESMA 4DEBA 4HZRA 4JG7A 2I0EA 5LWNA 1GJOA 3KVXA 3R02A 2XNGA 3EFJA 4FG7A 2WQEA 3W32A 1JKKA 3I60A 3IGGA 4QMWA 1R3CA 4USEA 4UXQA 3ZC6A 3C0HA 4NTTA 4QQCA 5FXSA 3DK3A 4BC6A 4UEUA 4EZ3A 4AGDA 4L45A 3RM7A 5K3YA 5IQHA 3PWYA 4G5PA 5IUIA 3FC1X 4BYJA 4D2WA 3NRMA 4E6AA 4DEGA 3A62A 4GV1A 3LVPA 3AMBA 5EM5A 5M4UA 5E8WA 5AIRA 4ZZOA 1ZYJA 4J97A 4O2PA 3ZUTA 4L3JA 4DGGA 4EWHA 4M67A 5TT7A 3LLAA 5DI1A 4FRFA 5GZ9A 5B0XA 5AAGA 4PX6A 4CV8A 2QC6A 5KE0A 3W0QA 4FNXA 4BTMA 3NYOA 2GNIA 2P55A 5T6KA 3KK9A 3UVQA 1H8FA 2GHLA 2Z2WA 4BGGA 3O8TA 3OUNB 4G6NA 2JDOA 4JT3A 1KE7A 3K5UA 4G3CA 5AP3A 1DAYA 1HOWA 2YIYA 2GNFA 3GFWA 4TWCA 3OY1A 4D1XA 4AXCA 3OTUA 3PA3A 3PXYA 2QLQA 3F3VA 5TF9A 2IEWA 4FT9A 4DF3A 1OECA 2OFUA 2RFEA 3MN3A 4W4YA 2G2FA 4L46A 5JRSA 5TKDA 3VS2A 2BRNA 1PW2A 2Z7LA 2X8EA 4FZDB 4QYYA 4IJ9A 3VS6A 4FV9A 5BUJA 4GSBA 4HGSA 3SA0A 2CDZA 4ZTQA 2IZUA 4FJVA 5AEPA 3DOGA 3G0EA 3Q3BA 4J52A 4EOOA 2ZVAA 4ZAUA 5K4JA 4ACCA 4AF3A 4CKJA 1GZOA 2DS1A 1OGUA 3UJGA 3WOWA 4QT1A 4FVRA 2PZRA 3RCJA 1JKSA 3FMNA 2WD1A 1YDRE 1OKWA 1T46A 2ZM1A 2O64A 1W8CA 4JOAA 3W18A 2C3LA 1GZNA 1BKXA 3VN9A 3V6RA 4J71A 3HAVA 3Q2JA 4HYUA 4O7WA 4FL1A 4HVDA 3EQRA 4AN3A 3GQLA 3QC9A 4OT5A 5HTBA 3V3VA 1IA9A 3D5WA 5DG5A 3F2RA 3WIGA 4GT4A 5BX0A 3FEGA 2XBJA 5CVHA 3C4CA 1TFFA 1UNLA 2DYLA 3UG1A 4EOLA 4FKSA 3U8WA 5IH4A 3C0GA 2B9HA 2VZ6A 2PMOX 3VJOA 3NIEA 5GJGA 1XQZA 3FQHA 4K8AA 1OKZA 5T68A 2R3KA 5CVFA 2REIA 3D5VA 2NO3A 3HV7A 1YWNA 5TO8A 4D1SA 4D2TA 3E8CA 4IH8A 4QMTA 3KQ7A 4L43A 2GS7A 4NM0A 4EEVA 2C5YA 4FV5A 3PP0A 3HV3A 4XBRA 2HXLA 2KULA 4KINA 4QMMA 4FTUA 3GT8A 2IW8A 3RWPA 4DTKA 2QOCA 4RVKA 3VW6A 4ONAA 4IX6A 1U4DA 4XV1A 3TKHA 4DFBA 3MY1A 3WZKA 3COKA 4GYGA 4IM3A 2XRUA 4OR5A 3EQCA 1SZMA 2QO7A 3OY3A 4RRVA 5CY3A 5C4KA 4V0GA 4N57A 2UZDA 3GGFA 3HNGA 4FSWA 2WTCA 4UY9A 4WHZA 4RZWA 4GL9A 2FH9A 3DKOA 4YSJA 4O7RA 1G5SA 4QTBA 4F1TA 4BBEA 2EVAA 4RX8A 4DDGA 5AP7A 1MQ4A 1MRUA 4DITA 2W9ZB 4GJ3A 4X3FA 1E1XA 4NH1A 4FTNA 3G2FA 3R73A 2C0TA 1GIIA 4FIJA 2Y0AA 5HNBA 3VJNA 4CMOA 4RMZA 2PK9A 3W55A 4C34A 4IAAA 3O51A 3BZ3A 2PE2A 3I7BA 1BX6A 4CXAA 4DGLC 4I6HA 1Q8YA 4X6QC 3V5JA 4CTCA 2XJ1A 4D9TA 5J1WA 4PDYA 3UZTA 2VTQA 2B9FA 4XLVA 4UWCA 5JN2A 1GIHA 2GQSA 4CFFA 2HOGA 4J8MA 4LOPA 4RIWB 4IEBA 3D83A 5ETAA 5B2KA 2R0UA 2JBOA 3COIA 5LMAA 1ZZ2A 3ZUVA 3ZOSA 5M57A 1W7HA 4PP9A 1VEBA 3NYXA 4KRCA 3TNWA 2QOKA 4BDJA 4M84A 4CV9A 4G9RA 4YJNA 3PJ2A 1GZKA 3FY2A 3COMA 3KXGA 3AMYA 3AD5A 2X7FA 1CKPA 4XG3A 5C27A 3FPQA 5L4QA 4FEXA 2WKMA 4YJVA 3L8XA 3UVPA 3NVMB 3PFYA 4N6YA 3VQHA 5A3XA 4OAVB 3PPZA 2HW6A 3S95A 2C30A 4ZS0A 3PUPA 4NK9A 2WGJA 4XOZA 3PVBA 4PUZA 4K11A 5AV1A 3A60A 2F9GA 2ITUA 2W1GA 3AC8A 2WHBA 3RWQA 3MH2A 2IVVA 3FL5A 5IUHA 3FJQE 4FIFA 3A7HA 5EKOA 3R7OA 5BVFA 1YXSA 4L3LA 3UNJA 4C59A 4YZNA 1OBGA 2X2MA 4OLIA 3LQ8A 3GC8A 1IRKA 3R8MA 1BYGA 4BCFA 2VWWA 5CEIA 5E8ZA 1JLUE 1JVPP 2J0JA 3KIOC 4DC2A 1UU8A 3OG7A 2X2LA 2QOLA 4FYNA 4FKUA 4EBVA 2WQOA 5JQ5A 3PG1A 3MB7A 4IHPA 4C8BA 4B6LA 3NUAA 4OAUC 3R0TA 4TXCA 4YJOA 2OICA 4E4MA 3GCSA 3R8LA 3FSKA 4C4GA 2P2HA 2GNJA 2C3KA 2CGVA 3O7LD 1RJBA 4MEDA 4R8QA 4CFVA 5I9XA 2JITA 3QQJA 3VBYA 5IMXA 4F7JA 2YWVA 2VNYA 2VNWA 3DTCA 5DR9A 3FKOA 1ZOEA 2XIXA 3GU8A 3PSCA 3VNTA 2WZJA 3MVJA 3QTQA 5AM7A 2WTJA 2BFYA 3PVUA 4A9YA 3F3WA 3IG7A 3LZBA 4O27B 3TWJA 4EH2A 4F1MA 2Y8OA 3NAYA 2H6DA 5CI7A 3D14A 5D9HA 4CVAA 2Z8CA 5A9UA 2XRWA 4MF1A 5GIOE 3VUHA 2VWYA 4ZLYA 3VS3A 4IANA 4K1BA 3AC2A 1LEWA 5AP5A 2B9IA 3OC1A 2HZ4A 4F9YA 2C0OA 1X8BA 4EJNA 3TZ7A 4FT5A 4N4SA 5KO1A 4MXCA 5F20A 1OUKA 3EFLA 4USDA 4FV6A 4YJTA 5L6WL 1FGIA 3CGFA 3RVGA 4BCJA 1RE8A 4FICA 2ZAZA 4RJ8A 5HI2A 4ANLA 3ORPA 4O4EA 2W7XA 4X7QA 5DHJA 4RJ5A 4CNHA 5CASA 1VLRA 1DAWA 3QQFA 5BYYA 3QZFA 4FEWA 5BUEA 4KBAA 4Y85A 3ZLWA 4TWNA 4CG9A 4BY9E 3RZBA 3PRFA 4U3YA 3R8VA 3F3UA 4FT7A 4YTCA 3CJFA 5DGZA 4BBFA 1KWPA 3R7EA 4X2GA 4XCUA 4CFWA 2PVMA 4C33A 1WVXA 5ANDA 4CSVA 2ZM4A 4CT2A 4DCEA 2BCJA 4GK3A 3O0GA 4E8AA 4O91A 4JNWA 2EXMA 3A7JA 2OFVA 1OPJA 1W82A 4FKLA 3NS9A 5EG3A 3KMUA 3C4EA 2ZYBA 2GS6A 2AUHA 3AD6A 3TDVA 1B38A 4JDIA 4FV1A 3SG9A 3C1XA 4OTDA 3MGYA 4YGAA 5CSHA 2ERKA 3ALOA 3AXWA 4EC9A 3PG3A 4HGLA 3LXKA 3QA8A 3LOKA 4UMRA 4CFXA 5AIKA 3TUBA 1BMKA 3GC9A 2FGIA 4WNKA 4MXAA 3L9MA 3BWJA 3L8PA 4QMXA 4QNAA 4L52A 2BUJA 1OL5A 5M55A 5A46A 1WBPA 1Z5MA 4XMOA 2UZEA 4WBOA 5ANEA 3GU7A 2VU3A 3FMEA 4DGNA 1GIJA 3NZ0A 4XV2A 4CZTA 4O81A 4O84A 3GU5A 5K4IA 1ZARA 3KVWA 3LCOA 2PU8A 2EXEA 2XJ0A 2WTVA 4LL5A 4PPBA 4DTBA 5D11A 3QTZA 3NUXA 1J7UA 4FZAB 2J0MB 5EHLA 5AADA 4EZ7A 2BPMA 3VQUA 3G9LX 2YZLA 2V5QA 1H28A 3L9PA 5L2QA 4O7ZA 3KRXA 4EH8A 4F9AA 3G90X 3MIAA 4DG2E 5F94A 3GU4A 4AZVA 4NW5A 5JQ8A 3FLSA 4YMJA 4FF8A 4HYHA 4DFYA 2HIWA 4UALA 4FA2A 2XIZA 2R3LA 2VUWA 1GY3A 3SD0A 3TTIA 2XIYA 3POOA 2WTKB 3OZ6A 1WVYA 4OTQA 2UZBA 4G17A 5M51A 3AMAA 2NNWB 4NKAA 5LMBA 4RA4A 5CEQA 5JGBA 2HY0A 4L7FA 1SNUA 2HELA 4RLKA 5LMKC 4NIFA 3OWJA 5CU6A 3PY3A 4ZLZA 4I0TA 3DA6A 5BNJA 5EQPA 1SM2A 3ROCA 2Z02A 2PZIA 4GJ2A 3VF9A 4D9UA 1PYXA 2J5EA 5HTCA 4YHJA 5BYZA 1QPJA 4F08A 3LW0A 3ZO4A 3NW6A 5LVPA 4C4IA 4O0RA 4RIOA 5FEEA 3U6JA 4GIHA 4ZSLA 3M2WA 1NY3A 3TNPC 3UIMA 2R3HA 2XIRA 3ENMA 3VUIA 2QOBA 4JAIA 4XV3A 2QNJA 5BVNA 4I5PA 5AM6A 2R3QA 1JAMA 4PMPA 5M4FA 2C6TA 2OLCA 4OBPA 3FYJX 2FSLX 4BDCA 4FV0A 3BIZA 3V8TA 5AUTA 5JSMA 5I0BA 3R8UA 3PJ3A 1CKIA 3R21A 2OBJA 3AQVA 3EQGA 3AC1A 1Q62A 5J9LA 4QMSA 2W5BA 1QL6A 4AW2A 5KNJA 3CJGA 1QPCA 3QTSA 4LUEA 4O0UA 4U5JA 4KWPA 5ETFA 2X4FA 1W83A 4XRLA 5AP6A 3PJ1A 3Q96A 3ORKA 2QQ7A 3EL7A 5CAUA 3WF7A 4FT0A 3QRUA 2H8HA 4QMNA 4W4WA 3E8DA 2P4IA 3R6XA 4EQCA 5M4IA 5HBJA 4D5HA 2WU7A 2YLEA 3OEZA 4MK0A 4XG6A 4D58A 3Q9XA 3OXTA 2QOHA 1KSWA 3DK6A 3GBZA 3GCUA 1LUFA 1Q5KA 2GNHA 3Q52A 4RIXB 4U9AA 1PXMA 4EOKA 3V51A 2W9FB 2XK4A 3CQUA 3DJ7A 2BFXA 5H8EA 4UB7A 3TIYA 4HGTA 4GW8A 1ZWSA 5HE2A 4FV8A 3ROYA 2ZV9A 3S1HA 3B2WA 2HZNA 4QP7A 4N0SA 2C1AA 5CT0A 3UPXA 3IONA 3OF0A 2ZOQA 3TNQB 4EK3A 1H1WA 4RJ6A 5D41A 4JG6A 2VTLA 4YUQA 4ZTRA 5M56A 1KE5A 3TUCA 3LHJA 2RSVA 4HPTE 4M69B 2C6LA 2Y6MA 4YTIA 5HU3A 2UVZA 3Q5IA 4TNBA 3EYGA 2JKMA 2RKUA 1MRYA 3MPTA 5IEYA 3NWWA 3EL8A 3PDTA 1S9JA 4C37A 1ERKA 4AZWA 1OMWA 4YNOA 1H26A 2R0IA 3ZO2A 4BCGA 3KXHA 4J95A 3PP1A 3BLHA 4A07A 4ARKA 3CPBA 3RKBA 1WCCA 2WNTA 4IE9A 3W1FA 5A4LA 3CSVA 4KBKA 3DZQA 1YWVA 5GZ8A 4AWIA 3ZBXA 5J7BA 2JLDA 5CF6A 5CS6A