4OBPA

Map4k4 in complex with inhibitor (compound 29), 6-(2-fluoropyridin-4-yl)pyrido[3,2-d]pyrimidin-4-amine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
298
structure length
285
Chain Sequence
b'IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Discovery of Selective 4-Amino-pyridopyrimidine Inhibitors of MAP4K4 Using Fragment-Based Lead Identification and Optimization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 285
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4obpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4obpA01
3ORTA 2O3PA 4D58A 3ZSIA 4KAOA 4GRBA 3RTPA 3C50A 4F4PA 2OWBA 4IB1A 5ETIA 2YACA 3RMFA 2F7XE 5BVOA 4DEHA 4JXFA 2ZJWA 3NSZA 4F9CA 4MQ2A 2OW3A 1Q8TA 3QLFA 4OGRA 3DKCA 3SA0A 1OIQA 1ZAOA 4QYGA 5D7VA 4EOLA 5M4UA 4FKIA 3LMGA 3WYXA 1WFCA 5GHVA 3AOXA 4BTFA 5BX0A 3HV7A 4GSBA 3N9XA 1H00A 3R01A 4W4XA 5EDPA 1XH6A 1JNKA 1XBCA 3VJOA 2C6OA 3CR0A 4L8MA 5GINE 4FKTA 2CN5A 3AMAA 4LQMA 4I5CA 3BE2A 4HVHA 3QD0A 3CGOA 1VJYA 2YITA 3P23A 4F7NA 2V22A 2VWUA 4KIKA 4M0ZA 4BTMA 2ONLA 4XH6A 5IQEA 5CASA 4JIKA 5CF6A 3C13A 4PMMA 3D7TA 5CAPA 2JFMA 4DFLA 4H1MA 2JGZA 4ANLA 2HY0A 3M1SA 3REPA 4BIEA 1CTPE 2ACXA 4L67A 3AG9A 3NUAA 3C0GA 2DYLA 3PRFA 4BWXA 4M68A 2WU6A 2RKUA 2ZYBA 4NCTA 4WUNA 3DNEA 2PE2A 3FLQA 3DXPA 3PJ8A 3TNPC 4CFXA 3VBXA 2W1FA 3NVKI 5EFQA 3ORXA 2REIA 2X1NA 4RWJA 2O65A 5L6PA 2Z60A 3FLWA 2XIZA 1P4OA 2HXLA 5IQAA 5I0BA 3HP2A 4FE2A 5FEDA 4LMNA 1SVEA 3COHA 2ITOA 5AM6A 4PL4A 2HELA 3R7YA 3VHKA 1PW2A 3OWJA 4XOZA 4RIXA 1KOBA 3UVQA 3KRRA 1UA2A 3D5WA 3IS5A 3ENHA 3EQHA 3OBGA 4AXAA 3KN5A 3MBLA 2B53A 4PRJA 3HUBA 1BUHA 4NM0A 4CQEA 2B7AA 1FOTA 4UY9A 3QTUA 1APME 2GS2A 4ONAA 4B99A 2C5NA 1WVYA 5BYLA 3O0GA 4JQ7A 4NEUA 2IN6A 2E2BA 3HRFA 4QMLA 4W9WA 1Q8WA 3NDMA 4BIDA 4YGAA 5IKWA 3ZFYA 5HQ0A 1Q3WA 4CMOA 5HI2A 4BWKA 3OFMA 2C6TA 2RIOA 5C9CA 4O7TA 3QQJA 4HCUA 1PMNA 2VX1A 5BVDA 2KULA 3Q9XA 4ARKA 1PYEA 3MV5A 1K2PA 4IX6A 1P2AA 4XG7A 2X7FA 1YDRE 3P7BA 1J1BA 3PA4A 4H58A 3RK9A 4RFYA 4EH2A 1GNGA 5JZNA 1SM2A 3JUHA 2VTNA 4GIIA 4NIFA 4B0GA 4QP7A 4D4YA 5CVFA 3DNDA 3UNKA 2J0JA 1YI6A 2WTKC 4X21A 3E3PA 4E6AA 4RX5A 3JR1A 2UZNA 4FV5A 1ZRZA 5KE0A 5DRDA 3FZTA 5KCVA 2VTOA 4C4IA 4ERWA 4R3CA 2PMIA 4FTNA 2WMQA 4YJVA 1Q8YA 4DFYA 2J0LA 3BYSA 4FTOA 3GT8A 4G3DA 3E8CA 5BMMA 5HE2A 2VWWA 4YUQA 1ZOHA 2PSQA 1NY3A 4JLCA 4FKVA 2YWVA 2P2IA 4C37A 3U6HA 2XYUA 2B55A 5L8LA 3TNIA 4D5HA 3RK7A 3V3VA 4CTCA 1WMKA 3FI2A 4FKPA 4EK3A 4M15A 4GG7A 3GFWA 4HJOA 4I24A 5CSPA 4B7TA 2OICA 3TZ7A 1H28A 4IB3A 4JBVA 4M12A 5DRBA 3FQSA 3EYGA 4IQ6A 4IM2A 4IFGA 3QTZA 3DQWA 2YIWA 3MWUA 4FF8A 2VUWA 4CD0A 5JRQA 4GCJA 3CPBA 1ZYJA 4CCUA 3EN7A 4XS2A 5FXQA 4P5QA 4DLIA 4UX9A 4XCUA 4ZTNA 3IW5A 4USFA 3JPVA 5C4KA 3UP7A 3D83A 3N4TA 3I81A 2VO6A 3RWPA 4WO5A 1GY3A 3K2LA 4YHJA 2R3MA 5IQDA 4KKEA 5CVHA 2XJ1A 3LZBA 3C5UA 5AAGA 4BBEA 4NT4A 5EQEA 2ESMA 3MFUA 4O22A 5M56A 3F88A 4JX3A 4I1ZA 4LI5A 4RQKA 3DQXA 1OL2A 3BU3A 4JBPA 4FSMA 2OIQA 3IECA 4XG4A 4FTUA 2QG7A 2WPAA 4OAUC 1Y6AA 4DH8A 3LW0A 4XG6A 2Y4IC 2NRUA 4GV1A 4F7JA 3EQCA 3W8QA 4AW0A 4RJ6A 4BDHA 5HORA 4F08A 2WO6A 5AR3A 2BKKA 3N4UA 2RGPA 3ZM4A 1OKYA 4FIIA 4XLVA 5T68A 4TW9A 4YTFA 1YXUA 1T46A 4DEDA 4MX9A 3RPVA 5F20A 4RVMA 5JFVA 5I5ZA 3FYJX 4KD1A 2I1MA 3W33A 3R63A 4MXOA 3RAIA 2FA2A 2C3IB 2R2PA 2GNHA 3MVJA 4L6QA 4TWCA 3V01A 2PWLA 4RLLA 3W16A 4P5ZA 3BEGA 3TJDA 3TM0A 3E88A 3KULA 3LQ5A 3KCKA 3H3CA 4FKUA 4ALUA 1XO2B 4TL0A 4Y72A 2A27A 3KXHA 3FSKA 5HEZA 4ZIMA 3AGMA 2XKCA 4PP9A 3PY1A 4GKHA 1WBVA 4U3YA 2P4IA 3EJ1A 5EKOA 5EKNA 3CTHA 2C3KA 2CPKE 3VS5A 2WELA 4DGOA 4MD8E 2YEXA 4X2FA 5CZIA 4RJ7A 3C9WA 3RAKA 3GOKA 2PVLA 5KX8A 4MD9E 3CQEA 4EYMA 2JDOA 4QQTA 5CEOA 4EC9A 3NIEA 3SW4A 4LMUA 1ZZ2A 2V7OA 4EOIA 3WZDA 3V6SA 4F6SA 1H01A 2W05A 4I0RA 2Z8CA 4EZ7A 3COMA 1GOLA 3WF7A 2RG5A 1PXKA 4FA2A 4EBWA 3QKKA 3GB2A 3NX8A 2WMXA 4U5JA 5D1JA 4JDHA 3F3WA 3TDWA 1GZKA 2W1HA 2ZV8A 4PDOA 5FTQA 4W4VA 4EBVA 4FKGA 4WBOA 4CRSA 2QC6A 4JAIA 5HGIA 3U8WA 4DG3E 5DGZA 4XBUA 5JFSA 3MH0A 3UO6A 3E87A 3F7WA 3OT3A 3BPRA 4ZMEA 3F2NA 1R3CA 1URWA 3DA6A 4X2GA 2GQGA 2EB3A 2YLFA 5HZNA 3MVLA 3IG7A 4XNEA 1WVXA 2G2FA 3TXOA 4FG7A 4A4XA 5EI2A 5EW8A 3VS7A 5BVFA 5EI8A 5E91A 2PVFA 3O8TA 3G5DA 2WQNA 5DVRA 4E5AX 1GJOA 1XBBA 4PX6A 3QTRA 5ANOA 5TO8A 3WF6A 5J79A 2GDOA 3DZQA 5EQPA 4OTHA 3FQHA 3K3JA 3LMIA 4L44A 4V04A 1XKKA 3ZSGA 3ORIA 5JK3A 3V8SA 5EQYA 4JX7A 4NJDA 3W2CA 5HIBA 4EEVA 1TKIA 4DCEA 1KE5A 2XYNA 4YP8A 4ID7A 3OWPA 3BE9A 3TUDA 3NMUF 3UIBA 5A14A 3KA0A 1PXLA 2UZEA 4CCBA 5B7VA 4CZYB 2AUHA 2PU8A 2QOLA 4ZP5A 2XKFA 1WCCA 2BRGA 4U8ZA 4AU8A 3KREA 2XK8A 3MFRA 4S31A 4CRLA 3ERKA 3F5UA 1DAYA 4I3ZA 3UNJA 3DU8A 4BB4A 2NNWB 4CSVA 1VYZA 2A0CX 3C51A 4IM0A 3UG1A 3VULA 4GEOA 5C1QB 2OZAA 5B0XA 3FKNA 3JXWA 2VO3A 2XNPA 3CCNA 3HX4A 2OJFE 3LJ1A 5E8TA 3Q52A 5CTPA 1PXJA 3ZLXA 3ZUUA 4AOTA 4I4EA 5HG8A 3UQCA 2W06A 3SW7A 4YHFA 4V05A 1BI7A 2R3FA 4FT0A 3C0IA 4NJ3A 2B0QA 3OWKA 2X7GA 4RIWB 4ZY6A 2P0CA 5ANEA 1YOLA 5IH4A 2GQRA 3TZ9A 2WEIA 3UPXA 3H4JA 4F6WA 1FBNA 5DYJA 4E73A 4M66A 4QTDA 3PWYA 5TOZA 3T3VA 5M51A 1J1CA 3O96A 2OIBA 2W4OA 3FKLA 4UXLA 2WMAA 5KMMA 3OXTA 3LFFA 4MNEB 1W83A 3CKWA 5TKDA 2PK9A 4FSZA 4R5SA 3WF9A 4LRKA 4ZSJA 3D9VA 1ZY5A 3DB8A 5HE3A 3VW6A 4XP0A 3F9NA 3FMJA 4MNFA 2C6IA 2CMWA 1WZYA 5HHWA 3LFDA 3PSBA 4CMTA 2R3LA 2C3LA 2C6EA 2C5OA 1OKVA 2XK3A 2SRCA 4FNXA 5IA5A 2YWPA 5E90A 3OTUA 3E8DA 5M06A 2X2MA 3QRTA 3EFLA 3P86A 1Y57A 2QURA 3QQGA 4OTIA 3COIA 3AT3A 3VBQA 4QP1A 5AP4A 3QA0A 4BHZA 5LVNA 1PKDA 3DPKA 4WG3A 4FK6A 4L00A 3S95A 3SV0A 3UIUA 4GT4A 4UALA 4D5KA 1B38A 3AC4A 3W18A 4O2PA 2QOKA 3BYUA 4RBLA 4X2JA 5GJGA 2WMSA 1WBOA 2WNTA 4EJNA 3AD6A 5EHLA 3S4QA 4BDKA 5LMAA 4AN3A 3TWJA 3QZGA 4D4RA 1OECA 5HCXA 1LUFA 3OW4A 4HPUE 2W9FB 4IEBA 4MD7E 2QKRA 4NTSA 2RFDA 4OR5A 2UW7A 4RLKA 1UKHA 4HVGA 4RJ5A 1LPUA 3I6WA 3ENMA 5AJQA 4ALWA 1G8AA 2R7IA 1H1RA 3TNHA 1OIYA 1MRYA 5DG5A 4WKQA 4WUAA 4W8DA 3ROCA 1LEWA 4QYEA 2WEVA 3TUCA 1GIJA 2QU5A 4AGDA 5A4QA 3EHAA 4I6BA 2VGOA 4BDBA 4KUJA 2OJIA 3G9NA 1MQBA 3MA3A 2IZRA 2VTMA 3ZZEA 3GQLA 3D0EA 3QD4A 5DT3A 3ZM9A 5ETCA 1PF8A 3A8WA 2BAQA 2J9MA 2LGCA 4WT6A 1G8SA 2BALA 2QHNA 4EONA 4EQMA 5AP7A 1PJKA 4IANA 4P4CA 1O6KA 1Q5KA 1G5SA 3CJGA 4ANNA 4E93A 4FKSA 2GNJA 2GNFA 2W4JA 4A9SA 3VO3A 3A7GA 5CXHA 4EH4A 5H3QA 1J7LA 4G17A 3BWFA 5HO6A 2JKOA 3LCKA 4WNMA 1XR1A 4F63A 4NYEA 1TVOA 4ZAUA 2C6MA 3HRCA 4YJRA 5CSHA 4BKYA 4D9TA 4PTGA 5GJDA 5M08A 5HVJA 5JKGA 4W4YA 5K5NA 4C4FA 3Q32A 4KBAA 2VNWA 4MBIA 4DLJA 5CT7A 4BWPA 3KB7A 4HYIA 3VUMA 4D2VA 4O6EA 4QMYA 3TEIA 2E9OA 2OBJA 2UZDA 4QPSA 3BCEA 3G51A 3AD4A 1JQHA 2A4LA 3PFQA 4TKSA 4WRGA 5HBJA 5M57A 4FEUA 2J5EA 4M3QA 3I4BA 3ZLYA 5C8KA 1SNUA 2YDIA 2UZOA 2CSNA 4APPA 3GXLA 4QQ5A 4O91A 2W0JA 3VVHA 4XMOA 4FV8A 4OTFA 4FKOA 5M55A 3R9RA 2EWAA 3L8XA 4CG8A 4QP2A 2ZM3A 4PNKA 3ORZA 4EHVA 5HG7A 5IA2A 3B8RA 2XJ0A 2PUNA 3RPSA 4D1XA 2HENA 3MTLA 4F0GA 3RZBA 4GUBA 3AC5A 3DTWA 5CY3A 4EK6A 1U54B 3R8VA 1BYGA 4R77A 3GCVA 4Y73A 1RW8A 4FSRA 3WARA 2YFXA 2JD5A 3VUDA 4KNBA 4JDKA 4BR3A 3B2TA 3ULIA 4W9XA 4X3JA 2EXCX 3SC1A 4ANOA 4YJTA 5CU4A 3RGFA 1H26A 1L8TA 1U5RA 4ERKA 5HESA 3BV3A 4DFUA 3IKAA 4BCIA 3HGKA 3D15A 3NYNA 4KIPA 4EH3A 3RALA 2ZB0A 3FC2A 1QMZA 4F65A 5TT7A 4L68A 4BGHA 4LOPA 4EH5A 3POOA 3TL8A 1TQPA 4AZFA 2O64A 1FVRA 4RG0A 2WXVA 4M7IA 4FX3A 5K0KA 2OH4A 3FY0A 3JVRA 2OJJA 5LMKC 3P0MA 2CLQA 3SG8A 2C1AA 3PLSA 4O27B 3VAPA 2Z7LA 3MFTA 3MY0A 3PJCA 4PPCA 4YZBA 4ZSGA 4CZTA 3E92A 4YJSA 3EH9A 3U9NA 3FHRA 3TTJA 3FV8A 4X3FC 4LGDA 3IW7A 3LCDA 3HV3A 4Y95A 5CNNA 2PVJA 3HA6A 2G2HA 2YM4A 3QGWA 3ZFMA 1WBNA 2ITYA 4PTEA 3ZRLA 4L42A 2XUUA 1XH8A 3L9LA 3U51A 1OL1A 1ZOEA 4QP4A 3AT4A 2CNVA 2VTAA 3I5ZA 2W5BA 4CV8A 4C59A 3EIDA 1UWHA 2HWPA 4UMPA 5AR8A 2IVVA 3QKMA 4O0VA 3R2BA 2VX0A 3FQEA 2UW8A 4EHZA 4WBBB 3ZBXA 4C4EA 2YIQA 3F69A 3VS2A 3OXZA 1LR4A 3KXXA 4H39A 4TT7A 4YTHA 5TF9A 5AUWA 4II5A 3NYXA 5AUVA 5DR6A 5HLWA 2R9SA 3HV4A 4ZK5A 5CU6A 3FE3A 3KXMA 1WVWA 2NO3A 2UV2A 3KXGA 4B8MA 2UW4A 4MXYA 3RM7A 3WE8A 4ANMA 4BCMA 1JKSA 3MPTA 4J7BA 4DH7A 2VTRA 2W5HA 3C1XA 2RFSA 3BV2A 4AA4A 2PMNX 2GTNA 5ANDA 4CKJA 3NUYA 4IE9A 2H96A 3TTIA 3V5TA 4IJ9A 3KF4A 4JT3A 4LUDA 4XLIA 4RA5A 1PRYA 5J5SA 2UUEA 3K5VA 4JNWA 3P7CA 3M11A 4GVAA 3I0OA 4FSUA 4BBFA 2B9FA 3ANQA 2XK6A 4WG4A 5EDQA 4C4HA 3GQIA 3HV6A 4TXCA 5K5XA 4DT8A 5AAEA 4NCTC 4FR4A 4BBMA 5ETAA 5A4CA 5A4LA 3GCSA 3I79A 3RNYA 4DCAA 4N0SA 2ETRA 1WBSA 5ACKA 3SRVA 4DHFA 5BPYA 3ORPA 3U6IA 4CEGA 4A06A 1LP4A 5DH3A 3R7EA 5LVOA 4D2PA 2YABA 4R5YA 3WZJA 4I93A 1RDQE 4O7VA 3U55A 2WMWA 5LMKA 4RFMA 3FI4A 5AWMA 2OZOA 3NZ0A 2A2AA 2ITQA 3CIKA 5ETFA 2F49A 4NW6A 1W0XC 4PDYA 3PIXA 3V04A 3LFEA 3G0FA 1R78A 1TQIA 3BZ3A 1UNGA 3GU7A 5AV1A 4O7LA 5DT0A 3W2RA 5CLPA 1IRKA 4P90A 4ZTHA 1JKKA 3FMHA 4ITIA 4ZLYA 2W5AA 5JQ8A 3QGYA 2ETKA 1PMUA 1YXXA 4BDCA 4KB8A 3WZUA 5G1XA 4EZ3A 5A4TA 5CXZA 5DMZA 1IAHA 5FP6A 3UOLA 4JDIA 1MUOA 1CKPA 4JQEA 5CSXA 2C1BA 4ZTQA 3MH2A 2WQBA 3T8OA 2XNMA 4DGGA 1GZOA 4XP3A 1Y8GA 5FGKA 3MN3A 4ZZMA 5T6KA 3P5KA 3BX5A 2ITUA 5CSVA 4LOOA 1PXOA 3PYYA 5KZ0A 4C36A 4FTQA 4ITHA 1KUTA 4PNIA 3RPYA 2XKEA 4ANQA 4L43A 5CVGA 4EK4A 3IDCA 4KIQA 3QTWA 5M44A 2BCJA 3LXPA 4K33A 5E8ZA 3SKCA 5HNBA 3TIZA 4C3FA 2C6LA 2ZM4A 3UC3A 3VWAA 3BHYA 3QZIA 3EFWA 2A1AB 5D41A 4PMPA 3Q3BA 5IEVA 4U43A 3CP9A 5LOHA 4FV9A 3G0EA 1V0BA 4FSTA 4V01A 3PRIA 3H9RA 2GHMA 3EMGA 2BTRA 5T3QA 1UNLA 3F5XA 4ACMA 4O7SA 2JDTA 4S2ZA 3W2QA 3FUPA 5LCJA 3F3VA 4I94A 4UN0C 2C6DA 3TV4A 2XK7A 5FBOA 4DINA 4G3CA 3UQGA 3PTGA 4TZRA 1M7NA 4ZSEA 3SXFA 2HW7A 3AT2A 3AXWA 3ZH8A 4BTKA 3QTIA 5K4JA 2CKEA 3O23A 4OTDA 3DB6A 4V0GA 4E20A 5BVNA 5CALA 1OVEA 5A4EA 2XZSA 3VUKA 5M07A 5JGBA 1OITA 3MYGA 3CJFA 3DGKA 4FKLA 4CFVA 3ZUTA 2C69A 3CKXA 2OK1A 4J99A 4LRMA 4M69A 3OUKA 3TJCA 5ICPA 5JFXA 2I0YA 3F5GA 4BCGA 4F0IA 2VTIA 3NPCA 1YDSE 4MF0A 4PPAA 2WTKB 3Q4ZA 2IW9A 1FVTA 4XHKB 4CNHA 4FMQA 3BI6A 4UMUA 2W1EA 4EQUA 3H30A 3ORNA 2GQSA 3BHVA 3A7IA 3HDMA 4W8EA 1UU9A 2CN8A 5L2WA 3QX2A 5AFVA 4XRLA 4YPDA 4XP2A 4ZY4A 1QL6A 4JJRA 3HYHA 4U7ZA 2YM5A 1BMKA 4OBPA 3KU2A 3V6RA 5LVMA 3HKOA 4OUCA 3QWJA 2C5YA 3O71A 2OXXA 2AC3A 3QC9A 5CI6A 4AAAA 2GHLA 1E9HA 4E4LA 2IJMA 1CKJA 3FI3A 2P55A 3TV7A 1Y91A 3P4KA 1H1WA 4NUSA 1STCE 4I5HA 4ZTSA 2O0UA 3CEKA 4BKZA 4C33A 4C38A 4NZWB 4CXAA 3P7AA 3HV5A 4PF4A 2Y9QA 1XWSA 2ZV2A 3DV3A 2UW5A 3CLYA 3E3BX 3FSFA 4XG9A 2X6EA 5M4IA 2YAAA 4UYNA 4BGGA 4BRXA 4AW2A 2GU8A 3ZC6A 2W96B 4BDJA 3DBFA 4MWIA 4C4GA 4CFWA 3Q9WA 3RZFA 3MH3A 3VUIA 2I6LA 4YBKA 5FTGA 2NPQA 2FSTX 3NNWA 3KL8A 3ZSHA 3LQ8A 4E26A 4HVIA 4O83A 3VUTA 5BMSA 3LFQA 4GU6A 4LGHA 1YWRA 2ZDUA 2CGXA 4MK0A 4C8BA 2QCSA 3Q5ZA 2Y6MA 2XNGA 4QMTA 4CLIA 3EKKA 4ZS4A 3K5UA 4YZCA 5DOSA 4P7EA 3RAHA 4PP7A 3VW8A 3SHEA 3ZU7A 3D2KA 4L9IA 5D11A 3DAKA 4AOIA 3KK8A 2J50A 5C8MA 3PG3A 4O0RA 4OLIA 2Y4IB 5BVEA 1GZ8A 2G2IA 2A19B 2JEDA 4NU1A 4C62A 4Q9ZA 3B8QA 2UZTA 1GAGA 4YLJA 1S9IA 3HECA 2OXYA 5AA8A 5GZ8A 5IDPA 4EUTA 5J9YA 3PE2A 3C5IA 3GVUA 4BI2A 3ITZA 4AG8A 4EOQA 3KFAA 2BKZA 3R7OA 4R3PA 1Q61A 2JDVA 3PZHA 3BU5A 5B2LA 4AX8A 3U6JA 4LYNA 3D14A 2YM7A 4Z9LA 4ZSAA 5L8KA 2CKOA 4QMZA 4FGBA 3MY5A 4FZ6A 4O81A 3R1SA 4DH1A 4IM3A 4TYHB 5HTCA 4RZVA 4U6RA 3G6HA 3R7GA 1IA9A 1AQ1A 2XEZA 4FVQA 1UU8A 2HZ4A 3HLLA 4FKQA 4TPTA 3SXSA 4JAJA 2IG7A 2R3RA 1W8CA 1KSWA 3LKMA 4FVRA 4EC8A 2R0IA 4AE6A 5FM3A 3SXRA 5J9LA 3O50A 3E63A 4RIYB 4RSSA 4FG9A 4FEXA 1ZARA 4KSPA 2CGUA 1JKLA 1Z9XA 5JMSA 4RJ8A 3F2AA 4JQ8A 2HW6A 1CM8A 2O63A 3LXLA 4DGNA 4LRJA 4XV3A 2PZIA 4BCFA 4JRVA 4YC6A 5EH0A 3UMXA 4IAYA 5IA0A 3E8NA 3QXPA 3AC8A 3A62A 4FIFA 3JY0A 3EL7A 4R3RA 3E7OA 5C03A 4IC7A 1M2PA 3FZ1A 3S3IA 4FODA 3VS1A 3EQDA 3S1HA 1SNXA 4FI1A 3KK9A 2GMXA 2V0DA 5HE0A 2QO7A 4IDVA 5EHOA 2FO0A 3LJ0A 5CX9A 3ZDIA 4AN9A 5HLNA 4PV0A 3RPOA 4BCJA 5I3RA 4ZXTA 3GP0A 2JAVA 3D2IA 4GS6A 4DGLC 2OU7A 3Q04A 5KMLA 2ZMCA 3AC2A 5KNJA 3V5QA 4C3PA 1XH5A 5CU2A 5I9YA 2XBAA 3TG1A 1V0OA 5CQWA 3WIKA 4GW8A 2YA9A 4EWQA 3UPZA 2H34A 4UYAA 4BYIA 3R2YA 3QTQA 1OI9A 3Q60A 5AIRA 4CYJA 3MIYA 4QMXA 5K0XA 2OKRA 5DE2A 4D2RA 5JSMA 1I44A 5H2UA 2CJMA 5AAFA 4BZNA 4C61A 5B2MA 2QQ7A 5DNRA 5D9HA 4USEA 3TV6A 4Q9SA 5BVKA 1E1VA 3P08A 1OL5A 5BUEA 2YHVA 1HCKA 4E7WA 4KS8A 4MBJA 5IA3A 5KMOA 4DF3A 4J8NA 2QOHA 3ACJA 4YSMA 2W17A 5EG3A 3TZMA 1J7IA 5A54A 3QQUA 3S2PA 4HCTA 2VGPA 5IQIA 5IF1A 2W99B 1VEBA 1YVJA 4GG5A 4E3CA 2QOFA 3W2PA 4RVKA 5AX3A 2F9GA 3KRJA 4JRNA 3TT0A 1Q8UA 4IAAA 4APCA 3LPBA 1ZZLA 3VUHA 2XM8A 4F09A 4O7ZA 4OW8A 3R9OA 5GZAA 4HGEA 1FGKA 3VS4A 1S9JA 2CNQA 3TNQB 2YM8A 4DTKA 4R78A 5GIOE 4HGLA 4AOJA 4FUYA 4GIHA 2OF2A 2QOIA 3UO5A 3LQ3A 2QNJA 1ZYCA 2ZB1A 4NFMA 3A4PA 4G9RA 4USDA 5A3XA 3R21A 4QMQA 2XP2A 4YURA 4C34A 1BL6A 2YLEA 3MGYA 5HIDA 2W4KA 1JLUE 4IX5A 1NA7A 4GVJA 3HMIA 3IDBA 4ZLOA 2WOTA 4ZY5A 5JGAA 2IVSA 3FLSA 2Z7SA 3FMKA 3FZRA 4B8LA 3BYOA 1BX6A 1IG1A 4E5BA 1YXVA 3TACA 4ACHA 4CTBA 3ZZWA 2HZNA 2PMOX 2YJRA 3UTOA 2VTPA 3WBLA 2R3HA 3QF9A 4F9WA 4ZEGA 4EK5A 2BDFA 1ZMVA 2XVDA 5AX9A 4QYFA 4ASDA 5J9ZA 1L3RE 4FYNA 4FG8A 3LM0A 3PLAE 2IZSA 4FOBA 2Z2WA 4BHNA 4FT7A 4K6ZA 2JIVA 3H10A 3BHHA 5CEIA 5A6OA 1JPAA 3NIZA 2JDRA 3LXKA 4ENXA 4RPVA 2X39A 1BKXA 4GL9A 2BRMA 3ANRA 4FSYA 4XV2A 5C26A 1Q41A 4FVPA 3G15A 4FSWA 2WMTA 4KKHA 3IQ7A 1JVPP 1PKGA 4R7BA 4GKIA 4GUEA 3L9MA 2CHLA 1ZYDA 4JS8A 4QMPA 4U45A 5TR6A 4GH2A 4G1WA 2C0IA 3PXFA 4YJPA 3IONA 4L7FA 2XNNA 2BHEA 3W8LA 3R0TA 4YTCA 3HEGA 2YIRA 3ALNA 3Q4UA 3QCXA 3TKHA 2VWVA 4LV5A 4QP6A 2ZM1A 1PXMA 2B9JA 1JBPE 5IQFA 3O8UA 4IFCA 1OGUA 1REJA 2FH9A 1OMWA 4K2RA 1WBTA 4YNOA 5LQFA 1A06A 4WIHA 3QTSA 3FLZA 4EORA 4O0WA 2PUPA 4FSQA 4FV2A 1OB3A 1MRUA 2OFUA 4I5MA 4XRJA 4Y83A 2CGWA 3W55A 4YSJA 3D4QA 2O2UA 2XK4A 5CNOA 1URCA 4CYIA 4YLLA 2PZPA 5GNKA 1F0QA 1RJBA 2VWYA 3VBTA 4D2SA 2WIPA 3VQHA 4O96A 3GOPA 2XM9A 5EYMA 3I1AA 2XNEA 3FPMA 2XK9A 3QALE 4ZTLA 3EKNA 3KC3A 3PXYA 4FV4A 5CAVA 4F7LA 3R04A 4K1BA 5H9BA 3DFAA 3ATSA 4QP3A 2HYYA 3F61A 4O0UA 3VS0A 4CFMA 3W10A 2QKWB 4DEAA 4FYOA 4ZJVA 4DH5A 4EHEA 3LAUA 2Q0BA 2BFYA 3RPRA 2X81A 1KE7A 4CV9A 4CVAA 4XV1A 3V5WA 2I7QA 1WBWA 3DBCA 4J8MA 4RVTA 3I60A 2UW9A 1U5QA 3PSDA 4GT5A 3II5A 3MH1A 2R64A 4MBLA 2BDJA 3NWWA 4FICA 1H24A 2F57A 3QBNA 1KE8A 1B6CB 3IW4A 4KSQA 4XBRA 3OXIA 1OUKA 3LFAA 4J71A 3VF9A 4HNFA 3L8VA 4PQNA 2GCDA 5FWKK 3PVGA 4CKIA 2R3KA 3QX4A 4C2VA 5KHWA 5M09A 2QD9A 4MYGA 2R5TA 2VD5A 4BCOA 1SMHA 4JL9A 4FTKA 5EOBA 3IGGA 3OP5A 4H3PA 4HYHA 2E9NA 3QUEA 2P2HA 1GZNA 4O0TA 2BAJA 3MJ1A 3NEWA 5E1SA 5E7RA 5E9EA 3PG1A 3BLHA 3R8ZA 2WD1A 1X8BA 3UE4A 5AP0A 4FV3A 4G9CA 3EQGA 4AZTA 2E9UA 3BGZA 4BGQA 5JGDA 1DS5A 3THBA 3M42A 4NKAA 4EK8A 1OBDA 5EM6A 5CAUA 3PVUA 1OZ1A 3GU5A 3HMNA 4FTAA 3LMHA 3BYMA 3QAME 3QLGA 3DBDA 4FNZA 3P9JA 5DIAA 2BRBA 5IG1A 4AGCA 5E8YA 3VF8A 3H9OA 2VWBA 4AFJA 5CI7A 2RFEA 2B52A 3ZXZA 2FSMX 1UV5A 4DFZE 3DT1A 4EH7A 4O2ZA 4PTCA 4MTAA 4QTBA 4DEBA 2NRYA 3LM5A 5JT2A 5EM8A 5GJFA 1YHVA 3GCUA 4ASXA 3O17A 4MXCA 5H8GA 3R8UA 2OIDA 2WMUA 3VUGA 3PA3A 3UC4A 5KUPA 4NL0A 2QOBA 2WKMA 1CKIA 3EFJA 4M67A 5IA1A 2AYPA 3M2WA 2B54A 3PXKA 5JN2A 5IQHA 2BIYA 3WZEA 5DFPA 5J95A 2PHKA 4YZ9A 5LVPA 4YJQA 4IAIA 1J91A 4C57A 1Q62A 1PXNA 4Z16A 5KMJA 5CU0A 4TTHB 4ZTMA 3QHWA 2JC6A 2PL0A 2OXDA 3QRJA 4O0YA 4F7SA 3QZHA 2PMLX 2WHBA 3VBYA 4MQ1A 4AS0A 5KBRA 4FZDB 1AGWA 1GIHA 3FMNA 4I6FA 4FSNA 5DBXA 1IR3A 2QR7A 2UVYA 3IPHA 4FUXA 5AR7A 5FXRA 3GU4A 4NM5A 4O0SA 4I23A 1V1KA 1OKWA 4TRLA 4MKCA 2YCRA 2RG6A 3ODYX 2GPHA 4L53A 2G1TA 4LV8A 3VRYA 4QMMA 3RM6A 2X0GA 1R1WA 3E5AA 3ROYA 2VZ6A 3CBLA 3HP5A 4WOVA 2JFLA 4BCQA 4YJOA 5HICA 3QFVA 2BZJA 1W82A 5FQDC 2I0EA 2XCKA 3NCZA 3PIZA 4A7CA 1F3MC 2OGVA 3UNZA 1SVGA 2C30A 1JOWB 1P5EA 2IW6A 3R02A 2WZJA 2X8EA 4RFZA 4RIWA 3RBWA 4ACGA 3JY9A 5HX6A 4A4LA 4AF3A 3KY2A 3UZPA 3DK6A 4WNOA 4TYGA 5EYKA 3Q96A 3LLAA 4GT3A 5I9UA 4G6LA 2QONA 4I20A 4X3FB 3ACKA 4UBAA 2G01A 3U4WA 4BF2A 2HY81 5AR4A 4ZTRA 1R0PA 3ZO3A 4E6DA 3OCGA 5EW3A 2VTQA 3SOAA 3JVSA 3OZ6A 4I22A 4QMUA 5CWZA 2DWBA 3OUNB 3R8MA 4MNEA 5I9XA 2PVHA 5FBNC 4AT5A 4DA5A 2IVTA 2BILB 2VNYA 3OROA 3T3UA 1T45A 4DFXE 5J7HA 3VNTA 2PZYA 4EOPA 5KKRB 1DI9A 4J97A 2OLCA 4ZLZA 5IISA 5IDNA 5AIKA 2CKQA 2XJ2A 4FTJA 3PIYA 4K9YA 3KCFA 3OW3A 3BYVA 4RRVA 4U44A 4IZAA 4HNIA 4BI0A 4AGUA 5FM2A 2BROA 2YCQA 3CC6A 5EOLA 3R9NA 3NUUA 3FJQE 3EQBA 3FC1X 3I7CA 5IH5A 3DKOA 1YWNA 4L3PA 3BQRA 5LMBA 3F6XA 3EFKA 2EVAA 3PWDA 4UXQA 3QUPA 5HIEA 4KINA 4MAOA 2B4SB 5HNGA 5L8JA 3FMEA 4PMSA 3ZTXA 5M4CA 2R3NA 5CEKA 3W32A 3CGFA 2CNUA 5AR5A 3JS2A 4TYIA 1RQQA 3FPQA 2WTVA 4PY1A 2WMRA 5AADA 3ORLA 1KOAA 3R71A 5F4NA 4J52A 1OBGA 1UWJA 4LM5A 2WTCA 3DJ7A 3ZS5A 2X7OA 1FQ1B 3LOKA 4Z7GA 3W1FA 4BCKA 4IMYA 3RAWA 1H07A 3QU0A 2JLDA 2YAKA 3LHJA 4BTJA 3E93A 4LFIA 5FG8A 4KIKB 4QP8A 4KS7A 3HUCA 3A60A 3DJ5A 4FV7A 4XUFA 2O8YA 5C8NA 3QWKA 3D7TB 5DT4A 3DFCB 3UZRA 3KVXA 4IWOA 3MPMA 3SG9A 5DHJA 3DDPA 3RI1A 2QHMA 4N6YA 4BCPA 3EZVA 3TDVA 2W1CA 1H25A 3BWJA 4CFNA 3OCSA 1FPUA 4IHPA 3ZBFA 5E1EA 2PE0A 2W7XA 5DN3A 5ANJA 3V51A 5BNJA 2Z7RA 5CQUA 1VR2A 4J95A 5D12A 4I41A 2YDJA 2V5QA 4WSYA 1YHSA 3IDPA 1GIIA 4KRCA 2RSVA 4AUAA 4FGRA 3KXNA 3QUDA 1YW2A 4CG9A 4LOQA 4NTTA 3RWQA 4EOOA 2ITNA 4PUZA 3R83A 1Q8ZA 1QPDA 4FTIA 2YZLA 1YQJA 3EN9A 4DTBA 3CD3A 3AMYA 3D5VA 2YCFA 3Q2MA 1M2RA 3UO4A 3DOGA 3R8PA 2DQ7X 3QYZA 1Y8YA 2F7EE 2HZ0A 2HZIA 3DK7A 2F4JA 4G6NA 4RIXB 3E62A 4B6LA 3PVBA 5AV4A 2WIHA 2LAVA 5FEQA 4I4FA 3D5UA 1Q97A 2VN9A 3H0ZA 5AUYA 3O7LD 4BY9E 4U41A 2CGVA 4C02A 4WA9A 5GIPE 2UW0A 4G34A 4F70A 5FTOA 3I6UA 4BN1A 4W4WA 5G6VA 4C58A 4YU2A 4B9DA 5L2IA 2J51A 4WSQA 3GEQA 4BFMA 5ANIA 3FMLA 2UZBA 3EL8A 3QTXA 4X0MA 3BEAA 3GC7A 3PJ1A 3UMWA 5DEYA 3QHRA 2QG5A 3EN4A 1YOJA 3QZFA 3W2SA 4EH9A 4NWMA 3F82A 2IPXA 4I5PA 5EYDA 4QQJA 3HAMA 3A99A 5K3YA 4AN2A 3VRZA 5ANKA 4F9AA 4YZNA 1KE9A 4JIAA 4L46A 5KHXA 4NIFB 3CQUA 3HRBA 2HXQA 3V8TA 4E1ZA 3L1SA 4D55A 4PMTA 5CENA 5EW9A 4GJ3A 4HGTA 3TKIA 2XMYA 3A61A 2X8DA 3MA6A 3I5NA 3C4FA 4FZ7A 3UYSA 4G6OA 1AD5A 3OCBA 5L2SA 4TYEA 3BGPA 4Y85A 4FTTA 4U42A 5E4HA 3VBVA 2J6MA 2NP8A 3K3IA 3PZEA 4AW5A 5HX8A 3R7UA 3U87A 2I0HA 4U79A 2GTMA 4EKKA 2H6DA 2R3QA 4AZSA 5HNIX 4H1JA 4O7YA 3CPCA 3FL5A 3KMMA 3EYHA 4A9UA 4Z3VA 4O7WA 2OJ9A 5FDXA 3PY0A 2C0OA 4EOKA 3VS3A 1H08A 1U54A 4QD6A 3OC1A 3KKVA 5E8UA 4E4XA 4F9BA 4FEVA 3MVHA 4M8TA 5CF8A 2DUVA 5CS6A 3KQ7A 2PUUA 5EHYA 4IX4A 4UMTA 3TIYA 3R1YA 3ZUVA 3R28A 4MXZA 2FSLX 3GNIB 4YO6A 3ZONA 4KA3A 3SLSA 1IA8A 1REKA 1OUYA 4G2FA 4EHGA 3OEFX 1JSTA 4RQVA 4Z55A 3EQRA 3NAXA 3ZRKA 3DTCA 4QYHA 2BRNA 5IU2A 2BFXA 5JQ5A 2JBOA 3KEXA 4IZYA 5AEPA 4RGJA 4FTMA 4C0TA 3L9NA 3UOKA 3FZPA 2F2UA 4FL3A 4YNEA 5HTBA 4MF1A 2VWXA 3DZOA 4IX3A 5HCYA 1QCFA 5JZJA 4BI1A 3QYWA 3ZRMA 2BZIB 4OT5A 1SYKA 3NNUA 3NNVA 1NW1A 2AC5A 3WF8A 2GFSA 3DCVA 4U97A 3GFEA 4R8QA 2VTSA 1OM1A 3VJNA 3SD0A 2P3GX 5HVYA 2VWIA 4IVCA 5FEEA 1W98A 4YLKA 3DXQA 4FL2A 3GI3A 5BUJA 4JVGA 4X2NA 3NW6A 2XNOA 5FXSA 1NVQA 2UZLA 3P79A 3PJ3A 4R6VA 4AA0A 2J0KA 2QU6A 3QQKA 3R1QA 3U9CA 5DEWA 3CS9A 4FIHA 3HMPA 4GU9A 3OT8A 4ZJJA 4LGGA 2UVZA 4O1OA 4CFUA 1RE8A 4UWBA 1LEZA 3OG7A 1O6LA 1YHWA 4RX8A 1FINA 2PE1A 4U0IA 1ZLTA 3SX9A 3QD2B 4ZSLA 2GFCA 5LVLA 3V5JA 4F99A 5K4IA 1M17A 1ZXEA 2ZV9A 3DBEA 3F7ZA 4KWPA 4ACDA 3LFBA 4YC8A 5EM5A 2HK5A 2WTDA 3KULB 3FMDA 2FVDA 4FOCA 5ANGA 4DFNA 1H8FA 4AA5A 2UW3A 1UVRA 4A9TA 3E7VA 5CSWA 3DKFA 2QI8A 3BBTB 3FWQA 2QLUA 2QODA 3JYAA 3UBDA 4BDGA 4KRDA 1A48A 5JFWA 3A7HA 4M97A 4P2KA 2GSFA 1H0WA 4R1VA 2B1PA 2WTJA 2XA4A 4EYJA 4WNKA 4FIJA 3SGCA 2Y7JA 4HVDA 2PYWA 2OI4X 3HL7A 3TUBA 3GC8A 3FHIA 2WTIA 2W9ZB 5EI6A 4DTAA 1M7QA 4QMOA 2C5XA 1FMKA 3A8XA 4FT5A 4ORKA 4DEGA 1PYXA 4TWNA 5AUZA 1Q24A 3LIJA 4UEUA 3MS9A 3A2CA 4ENYA 5HO8A 1G3NA 4HYUA 4BCHA 4DAWA 5LJJA 2YERA 3LVPA 4ANBA 3A7FA 4AZEA 4NH1A 5CF4A 3SAYA 1PHKA 2ITPA 4C3RA 1XHAA 4RX7A 3NVMB 4N4SA 2Y8OA 3LJ2A 3R30A 2WAJA 1NT2A 2B9IA 5AP2A 2C3JA 4X7QA 4BDDA 1HOWA 5FDPA 4UV0A 3G6GA 3O51A 4O1PA 4E4MA 1U59A 2Y0AA 5IA4A 3ETAA 1NXKA 2WQMA 2UZWE 2WU7A 2YDKA 4FV0A 2VTLA 4FEWA 4IADA 2JIUA 4GYGA 3KVWA 1BLXA 2ZDTA 1VYWA 1ZYLA 2IZTA 4H36A 4RMZA 4I21A 3R7IA 1Q4LA 3BQCA 3MPAA 2BZKB 4JBOA 1V0PA 3BRBA 2X4ZA 3HNGA 5AV3A 2BTSA 2XIRA 2EUFB 4UMQA 4XG2A 5DR9A 4IZ7A 2VV9A 5CEPA 3CXWA 4L7SA 2XIKA 5LWNA 3FXXA 5E8VA 2WFYA 3UYTA 2J4ZA 2UZVA 3POZA 3Q53A 3R6XA 4XJ0A 5CZHA 4A9YA 2C6KA 4UMRA 4CMUA 3ZDUA 3DLSA 3P1AA 3R1NA 2QOQA 5AP5A 3CQWA 2ITZA 2QO9A 4U80A 2XBJA 5J87A 4F9YA 3OF0A 3GUBA 4FNWA 5AM7A 3W2OA 5I9VA 3NUXA 2PZ5A 3MY1A 2JITA 2H8HA 2WOUA 4TYJA 4BDFA 2E9PA 1DAWA 2UW6A 4O38A 3FEGA 5AP6A 3B2WA 5I9WA 3VIDA 4HGSA 5CYIA 1XQZA 4BDEA 2XIYA 3C7QA 2OZAB 2V62A 5E8WA 2ITWA 2EXMA 4EUUA 1ZMWA 5HD7A 3P78A 1OIRA 3HMMA 4FTRA 3VS6A 4YC3A 5I4NA 3DAJA 2GNGA 3AGLA 5HG5A 5CEQA 3PUPA 5H8BA 4ANSA 3Q4CA 4G3EA 4WNPA 3TKUA 2BPMA 3F5PA 3N4VA 3F2RA 4UZDA 3K54A 2R3JA 2G9XA 4UZHA 4E6QA 3GC0A 1JSUA 5L2QA 2CCHA 1IEPA 3FZOA 3IOKA 1YDTE 4E4NA 3WE4A 5HKMA 4DEIA 4F6UA 1JWHA 3A4OX 3PPJA 1HCLA 3WILA 3ATTA 3F3ZA 3UZTA 2IWIA 4TNDA 3TN8A 4AW1A 4XEYA 4IDTA 3RK5A 1JKTA 2J0MB 3AQVA 3QQLA 2X2KA 4ITJA 3FXZA 4BCNA 4DITA 1Z5MA 5EDRA 2R3PA 4K18A 3OS3A 3GC9A 5DI1A 3ODZX 4RC2A 3UOJA 2F7ZE 2EXEA 3CTJA 3DJ6A 3F3TA 4IB0A 4ASEA 2JKMA 4NM3A 5HLPA 3PY3A 2HIWA 4BC6A 3U54A 2OJGA 2ETMA 1BI8A 3RHXA 3HDNA 4NKSA 1M52A 3Q9ZA 4O6LA 3H0YA 4FBXA 4YO4A 4ZS0A 5CT0A 2QO2A 4JOAA 2PZRA 1JAMA 1FMOE 3KN6A 2V55A 3ZO4A 1J3HA 4IJPA 4QT1A 1OL7A 1H27A 4PDSA 4F0FA 4FNYA 4OAVB 4Y8DA 2HWOA 3ZCLA 1M2QA 3KRWA 3R73A 4H3QA 4Q5EA 3HZTA 3RCDA 4G5PA 5E8SA 3KGAA 4OBOA 3G90X 3GCQA 1E1XA 3MB7A 4Y5HA 1OL6A 5F9EA 3IOPA 3TI1A 4G16A 3IO7A 4S30A 5L4QA 1ZYSA 2YZAA 2CLXA 4FZFB 4ALVA 4PDPA 2H9VA 4BDIA 3CSVA 3EWHA 4IACA 3N51A 4FZAB 4JR7A 4QOXA 1NVRA 4IH8A 5IPJA 5IUGA 4HOKA 3A7JA 2ZMDA 4JDJA 1PMEA 4NW5A 5JH6A 2FUMA 5M4FA 4C2WA 1Z57A 5IH6A 4S33A 1JSVA 2BIKB 4G3GA 5IQCA 1ZMUA 3OOMA 4O86A 4RA4A 3RJCA 3PPZA 2R4BA 5J7BA 3QQFA 5F94A 4DG0E 4BVUA 2W1DA 4UB7A 3FBVA 4C4JA 1R39A 3BU6A 4D9UA 2F2CB 2IO6A 4S32A 3C4CA 4MVFA 3DAEA 3UODA 2C4GA 2WGJA 3ORMA 5HOAA 2IVUA 3MJ2A 4MHAA 4IIRA 4DE4A 4Y5QA 4E6CA 3VC4A 4BZDA 2BRHA 5M53A 3ORKA 3KMWA 1TQMA 1SVHA 4IXPA 4Q2AA 3Q6UA 5KO1A 3GENA 3O7LB 5TE0A 1KV1A 2BZHB 4CLJA 3OY3A 3VQUA 4O7NA 4DFBA 3PDTA 1YI3A 2YM3A 4RVLA 4PPBA 4DGMA 4CZUA 4XYFA 1QPCA 2BUJA 3DK3A 4AFEA 2JIIA 4IW0A 2XNBA 2PVKA 2YISA 3C0HA 3NW7A 5HG9A 3V5LA 4BDAA 5E92A 5AUXA 1UKIA 4FL1A 3R22A 4FV6A 4HCVA 4A07A 3PA5A 3H9FA 4LL5A 4D1SA 5IMXA 3EQPA 4AWIA 3EQIA 3TCPA 4CT1A 5HO7A 2J90A 3QL8A 5D10A 3BLQA 4I0SA 2X2LA 2FGIA 2Y6OA 2ERKA 3GU6A 3KRLA 3VHEA 4X6QC 1MQ4A 3L9PA 1F5QA 5IEXA 1IAJA 4I92A 5AV2A 3UVPA 4OTQA 4TYHA 2HOGA 2YM6A 3BLRA 4B4LA 2C47A 3PXRA 5IUIA 5KBQA 2PUIA 4X6RA 5IUHA 5C27A 4QP9A 2Y4PA 3NLBA 4R1YA 4ZZOA 2P33A 2Q0NA 4EH8A 3E64A 2XH5A 4HPTE 4RIYA 5J8IA 3ZEPA 1W84A 3UIMA 1MRVA 4QMSA 3CY2A 5JRSA 5CANA 3PJ2A 1H1SA 2X4FA 4FK3A 3KMUA 5J1WA 4Y46A 5BYZA 3R00A 4QMWA 4KBCA 2YCSA 2BDWA 4JG7A 4YHTA 5HU9A 4YBJA 1O6YA 4KKGA 3UG2A 4AZWA 4GJ2A 3S00A 4QNYA 3ZYAA 2KTYA 3AC3A 3BELA 4IWQA 5GZ9A 4RX9A 1CSNA 3OD6X 4M84A 5IMEA 5AMNA 2ITXA 2WMBA 4Q5HA 1CDKA 2J7TA 4TNBA 4QRCA 3UVRA 3EQFA 5DWRA 5HVKA 4D0XA 4KIOA 3BGQA 4GK3A 4EI4A 4CGAA 3C4EA 4OTWA 3LE6A 1A9UA 3RKBA 3VN9A 2PULA 3MFSA 3NCGA 1NVSA 3NGAA 3DLZA 5AA9A 4CFFA 4QMNA 5KMNA 4U9AA 1ZWSA 4YPSA 3PSCA 2BVAA 3FL4A 3LCSA 4IAZA 5L6OA 4I6HA 3ZOSA 4R7HA 3WZKA 5HU3A 3MB6A 4YMJA 1B39A 5D7AA 4MCVA 2XS0A 3BKBA 4E5WA 2QOCA 2PVYA 4M0YA 3PPKA 3OCTA 4QMVA 5KMKA 2Z02A 4FTCA 2PPQA 3RHKA 2VTTA 3ZO1A 4ZOGA 4YJNA 4ZJIA 3AMBA 2ERZE 4IWPA 4RC3A 2JBPA 4F1OA 2X8IA 2OSCA 3QCYA 3BBWA 4FT9A 3NYOA 4XG8A 1OPLA 1FVVA 3UIXA 1Q3DA 4ZMFA 5EM7A 5L2TA 4IAFA 1K3AA 5A9UA 1H1QA 5AV0A 2QLQA 4EH6A 4D2TA 3TNWA 2XCHA 2WQOA 4O82A 5B2KA 4RZWA 3D7ZA 3OEZA 4ZZNA 4CT2A 3QQHA 2PVRA 4GFOA 4AACA 1K9AA 4K8AA 3V5PA 4FEQA 4IVBA 5CAOA 2BAKA 3CE3A 1KWPA 3MTFA 4QPAA 4RWLA 5I3OA 4FT3A 2W1ZA 1J7UA 3F3UA 4FV1A 4IZ5A 5EYCA 3NNXA 4AT4A 3AD5A 4LG4A 4G31A 3FLYA 2WMVA 3EN6A 3L8PA 2GHGA 4L3LA 5CU3A 1YOMA 3L8SA 3LXNA 2OG8A 3OBJA 4EWHA 5EK7A 2ZAZA 3OY1A 4EOMA 3WF5A 2IW8A 2C0TA 3G9LX 5HE1A 3R9DA 3F66A 4YTIA 2B9HA 4K77A 4C35A 2EB2A 4RWIA 2I40A 3LCTA 4O0XA 5ITAA 3COKA 2VTHA 3TZ8A 2J5FA 3UQFA 4DH3A 2GNIA 4RIOA 2X9EA 2R3GA 1ERKA 4BYJA 3UP2A 2I0VA 3RCJA 3Q5IA 4RWKA 2R7BA 5A6NA 2RFNA 5HCZA 4HVSA 5LXMA 3UOHA 5IZFA 4K0YA 1OKZA 2JDSA 2R3OA 3NAYA 4HYSA 5L6WL 5IEYA 2UZUE 2OF4A 3RNIA 3VBWA 4WHZA 3BIZA 2RF9A 3KF7A 3SRVB 1OPJA 5AP1A 2J2IB 3NUPA 3FDNA 3WYYA 2CKPA 4IWDA 1CMKE 1H4LA 2GNLA 2ZOQA 2PVMA 1VZOA 4DEEA 2PVNA 4DG2E 4EL9A 2W1IA 4N6ZA 4TY1A 4WG5A 4DC2A 4CKRA 2VO7A 2R3IA 4HW7A 3G2FA 1PXIA 3EN5A 3IGOA 3NUNA 3OWLA 3PE1A 4KABA 2YIYA 4UWCA 1XH4A 3LFNA 4ACCA 1MP8A 2ITVA 4IC8A 5KMIA 3KXZA 4IVAA 4FC0A 3IW6A 3OTVA 3FMMA 3I0QA 4RJ4A 1U46A 3RVGA 4L45A 3QCQA 1KE6A 3LFSA 2VO0A 3UGCA 3PP0A 4E8AA 4Z7HA 4H05A 3C4WA 4S34A 4BKJA 4IBMA 5IQBA 3QXOA 5BYYA 4AQCA 4HZRA 1I09A 4I0TA 1KV2A 3D5XA 1WAKA 2X9FA 1ATPE 3NUSA 3QRKA 1YKRA 4PWNA 5HBEA 3R7VA 4X2KA 4BZOA 5BUIA 4IAKA 4MWHA 5DR2A 4A9RA 2JAMA 4KBKA 2JKKA 3AC1A 1UU7A 3WIGA 3DDQA 3HVCA 1H1PA 3LFCA 3LLTA 4BIBA 4QYYA 2QOOA 4O7RA 3PVWA 3FY2A 4GK2A 4NM7A 2EU9A 5DA3A 3O8PA 4L3JA 5HD4A 2CCIA 2V7AA 3MVMA 3LCOA 2VTJA 4XX9A 4TWPA 4O84A 3R9HA 2XRUA 5DLSA 1QPEA 2FSOX 4JG6A 4RJ3A 4OTPA 1QPJA 2ZV7A 4TN6A 4U81A 3FZSA 3T9IA 4BL1A 3KRXA 4C7TA 4EOJA 4F1MA 5AP3A 3QRUA 4JI9A 4ASZA 4GK4A 1XH7A 5J5TA 2VX3A 3RINA 4I6QA 4PL5A 4TWOA 3SQQA 5L3AA 5HBHA 3PXZA 3HMOA 2HCKA 5CAQA 3V8WA 4L01A 2ITTA 4QO9A 5A46A 4QTCA 3IW8A 4CQGA 3GCPA 5K9IA 5AR2A 3R8LA 4OTRA 4JG8A 3GBZA 3ID6C 4EOSA 4PL3A 2DS1A 3RP9A 1FGIA 3QRIA 3ULZA 2Q83A 5F95A 3ET7A 4IB5A 4U40A 3NS9A 1YRPA 3MSSA 2JKQA 2WB8A 3MIAA 3ZFXA 1IASA 1XH9A 4XOYA 2QVSE 3FAAA 3GGFA 4O21A 1YWVA 5F1ZA 2XEYA 1EH4A 1PMVA 2OO8X 1H0VA 4GFGA 2C68A 5H8EA 4EQCA 4RC4A 3ZHPC 4RT7A 4AGWA 5KKRC 3DS6A 3HAVA 3C4ZA 4J1RA 4V0GB 4EZ5A 3G33A 1Q99A 4G5JA 1BL7A 4N57A 1SZMA 1XBAA 5E8XA 2XF0A 2R0UA 4FTLA 4K11A 3U4UA 3HA8A 4M69B 4G3FA 4M13A 2ZVAA 4NSTA 4QTEA 3UDBA 3CTQA 4QTAA 3CY3A 4FIGA 5FD2A 3CD8A 3DXNA 4AP7A 5AUTA 2BMCA 3Q9YA 1DI8A 2VU3A 5HTIA 4EJ7A 4H3BA 2X6DA 3ZEWA 4GYIA 2OH0E 1PXPA 1P4FA 4OT6A 5FLFA 2BR1A 4FKWA 4XV9A 2GS6A 2IZUA 2XIXA 5ACBC 4LL0A 5IQGA 4D28A 2WQEA 3WI6A 1Y6BA 1UNHA 3MW1A 4M14A 4L52A 4R7IA 4YZMA 4MH7A 1OPKA 3FXWA 4YJUA 5BVWA 4BICA 3T9TA 2PTKA 4NK9A 2YIXA 1ZY4A 3E8EA 4AE9A 5DPVA 3WOWA 1XJDA 4JBQA 1YI4A 2PY3A 3ZO2A 3BHUA 3Q6WA 3DBQA 3ALOA 3MDYA 4QPMA 5J1VA 4F64A 5FP5A 1W7HA 3OOGA 2ONLC 2RL5A 4UWYA 4XG3A 4D4VA 3D94A 3NR9A 3NRMA 5KZIA 4DYMA 1R0EA 3FKOA 4MXXA 1YXSA 2XKDA 2FYSA 1PY5A 1O9UA 3EOCA 4FIEA 4U3ZA 1ND4A 4OBQA 5BQ0A 4EKLA 3QD3A 2YN8A 4NFNA 3NW5A 4DT9A 4WRSA 3C4XA 3DY7A 2VWZA 1DM2A 2UVXA 2FB8A 4J53A 3GU8A 3Q4TA 4AZVA 3OVVA 2O5KA 3I7BA 5C01A 3SDJA 3QCSA 5JEBA 4LUEA 4IVDA 4DBXA 5I9ZA 4JR3A 4F1TA 4YZDA 2CDZA 3DKGA 2XRWA 3FLNC 4HZSA 1U4DA 2G15A 4GFMA 4J96A 5FRIA 3O2MA 1M14A 2HAKA 4D4SA 5LCKA 1WBPA 2OFVA 3EZRA 2C5VA 1UU3A 5LARA 3ZXTA 4DN5A 5CEMA 2VRXA 3OHTA 4FKRA 2W1GA 4AT3A 3PP1A 3MI9A 2VAGA 4D0WA 4DBNA 5LWMA 2E9VA 2YJSA 3IK3A 4X3FA 4D2WA 5FUTA 1YXTA 3UJGA 3QC4A 3MESA 4WD5A 2BHHA 1OIUA 2GS7A 2QR8A 2Z7QA 2WTWA 4QQCA 2XB7A 3SOCA 3FYKX 2J0IA 3OMVA 3QA8A 1ZOGA 4J98A 3S0OA 3FI8A 4QNAA 4N70A 3PXQA 4A4OA 3ZLSA 3QKLA 4D1ZA 3ZC5A 3NYVA 3EB0A 3BHTA 1P14A 3ZMMA 3ZLWA 4MEDA 5AUUA 4YR8A 4GMYA 4MXAA 5C4LA 4FKJA 4OTGA 5CF5A 3ELJA 3Q2JA 3SVVA
chains in the Genus database with same CATH superfamily
3ORTA 2O3PA 4D58A 3ZSIA 4KAOA 4GRBA 3RTPA 3C50A 4F4PA 2OWBA 4IB1A 5ETIA 2YACA 3RMFA 2F7XE 5BVOA 4DEHA 4JXFA 2ZJWA 3NSZA 4F9CA 4MQ2A 2OW3A 1Q8TA 3QLFA 4OGRA 3DKCA 3SA0A 1OIQA 1ZAOA 4QYGA 5D7VA 4EOLA 5M4UA 4FKIA 3LMGA 3WYXA 1WFCA 5GHVA 3AOXA 4BTFA 5BX0A 3HV7A 4GSBA 3N9XA 1H00A 3R01A 4W4XA 5EDPA 1XH6A 1JNKA 1XBCA 3VJOA 2C6OA 4BJJB 3CR0A 4L8MA 5GINE 4FKTA 2CN5A 3AMAA 4LQMA 4I5CA 3BE2A 4HVHA 3QD0A 3CGOA 1VJYA 2YITA 3P23A 4F7NA 2V22A 2VWUA 4KIKA 4M0ZA 4BTMA 2ONLA 4XH6A 5IQEA 5CASA 4JIKA 5CF6A 3C13A 4PMMA 3D7TA 5CAPA 2JFMA 4DFLA 4H1MA 2JGZA 4ANLA 2HY0A 3M1SA 3REPA 4BIEA 1CTPE 2ACXA 4L67A 3AG9A 3NUAA 3C0GA 2DYLA 3PRFA 4BWXA 4M68A 2WU6A 2RKUA 2ZYBA 4NCTA 4WUNA 3DNEA 2PE2A 3FLQA 3DXPA 3PJ8A 3TNPC 4CFXA 3VBXA 2W1FA 3NVKI 5EFQA 3ORXA 2REIA 2X1NA 4RWJA 2O65A 5L6PA 2Z60A 3FLWA 2XIZA 1P4OA 2HXLA 5IQAA 5I0BA 3HP2A 4FE2A 5FEDA 4LMNA 1SVEA 3COHA 2ITOA 5AM6A 4PL4A 2HELA 3R7YA 3VHKA 1PW2A 3OWJA 4XOZA 4RIXA 1KOBA 3UVQA 3KRRA 1UA2A 3D5WA 3IS5A 3ENHA 3EQHA 3OBGA 4AXAA 3KN5A 3MBLA 2B53A 4PRJA 3HUBA 1BUHA 4NM0A 4CQEA 2B7AA 1FOTA 4UY9A 3QTUA 1APME 2GS2A 4ONAA 4B99A 2C5NA 1WVYA 5BYLA 3O0GA 4JQ7A 4NEUA 2IN6A 2E2BA 3HRFA 4QMLA 4W9WA 1Q8WA 3NDMA 4BIDA 4YGAA 5IKWA 3ZFYA 5HQ0A 1Q3WA 4CMOA 5HI2A 4BWKA 3OFMA 2C6TA 2RIOA 5C9CA 4O7TA 3QQJA 4HCUA 1PMNA 2VX1A 5BVDA 2KULA 3Q9XA 4ARKA 1PYEA 3MV5A 1K2PA 4IX6A 1P2AA 4XG7A 2X7FA 1YDRE 3P7BA 1J1BA 3PA4A 4H58A 3RK9A 4RFYA 4EH2A 1GNGA 5JZNA 1SM2A 3JUHA 2VTNA 4GIIA 4NIFA 4B0GA 4QP7A 4D4YA 5CVFA 3DNDA 3UNKA 3W0MA 2J0JA 1YI6A 2WTKC 4X21A 3E3PA 4E6AA 4RX5A 3JR1A 2UZNA 4FV5A 1ZRZA 5KE0A 5DRDA 3FZTA 5KCVA 2VTOA 4C4IA 4ERWA 4R3CA 2PMIA 4FTNA 2WMQA 4YJVA 1Q8YA 4DFYA 2J0LA 3BYSA 4FTOA 3GT8A 4G3DA 3E8CA 5BMMA 5HE2A 2VWWA 4YUQA 1ZOHA 2PSQA 1NY3A 4JLCA 4FKVA 2YWVA 2P2IA 4C37A 3U6HA 2XYUA 2B55A 5L8LA 3TNIA 4D5HA 3RK7A 3V3VA 4CTCA 1WMKA 3FI2A 4FKPA 4EK3A 4M15A 4GG7A 3GFWA 4HJOA 4I24A 5CSPA 4B7TA 2OICA 3TZ7A 1H28A 4IB3A 4JBVA 4M12A 5DRBA 3FQSA 3EYGA 4IQ6A 4IM2A 4IFGA 2IF8A 3QTZA 3DQWA 2YIWA 3MWUA 4FF8A 2VUWA 4CD0A 5JRQA 4GCJA 3CPBA 1ZYJA 4CCUA 3EN7A 4XS2A 5FXQA 4P5QA 4DLIA 4UX9A 4XCUA 4ZTNA 3IW5A 4USFA 3JPVA 5C4KA 3UP7A 2XALA 3D83A 3N4TA 3I81A 2VO6A 3RWPA 4WO5A 1GY3A 3K2LA 4YHJA 2R3MA 5IQDA 4QDVA 4KKEA 5CVHA 2XJ1A 3LZBA 3C5UA 5AAGA 4BBEA 4NT4A 1ST0A 2ESMA 5EQEA 3MFUA 4O22A 5M56A 3F88A 4JX3A 4I1ZA 4LI5A 4RQKA 3DQXA 1OL2A 3BU3A 4JBPA 4FSMA 2OIQA 3IECA 4XG4A 4FTUA 2QG7A 2WPAA 4OAUC 1Y6AA 4DH8A 3LW0A 4XG6A 2Y4IC 2NRUA 4GV1A 4F7JA 3EQCA 2XAOA 3W8QA 4AW0A 4RJ6A 4BDHA 5HORA 4F08A 2WO6A 5AR3A 2BKKA 3N4UA 2RGPA 3ZM4A 1OKYA 4FIIA 4XLVA 5T68A 4TW9A 4YTFA 1YXUA 1T46A 4DEDA 4I6LA 4MX9A 3RPVA 5F20A 4RVMA 5JFVA 5I5ZA 3FYJX 4KD1A 2I1MA 3W33A 3R63A 4MXOA 3RAIA 2FA2A 2C3IB 2R2PA 2GNHA 3MVJA 4L6QA 4TWCA 3V01A 2PWLA 4RLLA 3W16A 4P5ZA 3BEGA 3TJDA 1VLRA 3E88A 3KULA 3TM0A 3LQ5A 3KCKA 3H3CA 4FKUA 4ALUA 1XO2B 4TL0A 4Y72A 2A27A 3KXHA 3FSKA 5HEZA 4ZIMA 3AGMA 2XKCA 4PP9A 3PY1A 4GKHA 1WBVA 4U3YA 2P4IA 3EJ1A 5EKOA 5EKNA 3CTHA 2C3KA 2CPKE 3VS5A 1G8JA 2WELA 4DGOA 4MD8E 2YEXA 4X2FA 5CZIA 4RJ7A 3C9WA 3RAKA 3GOKA 2PVLA 5KX8A 4MD9E 3CQEA 4EYMA 2JDOA 4QQTA 5CEOA 4EC9A 3NIEA 3SW4A 4LMUA 1ZZ2A 2V7OA 4EOIA 3WZDA 3V6SA 4F6SA 1H01A 2W05A 4I0RA 2Z8CA 4EZ7A 3COMA 1GOLA 3WF7A 2RG5A 1PXKA 4FA2A 4EBWA 3QKKA 3GB2A 3NX8A 2WMXA 4U5JA 5D1JA 4JDHA 3F3WA 3TDWA 1GZKA 2W1HA 2ZV8A 4PDOA 5FTQA 4W4VA 4EBVA 4FKGA 4WBOA 4CRSA 2QC6A 4JAIA 5HGIA 3U8WA 4DG3E 5DGZA 4XBUA 5JFSA 3MH0A 3UO6A 3E87A 3F7WA 3OT3A 3BPRA 4ZMEA 3F2NA 1R3CA 1URWA 3DA6A 4X2GA 2GQGA 2EB3A 2YLFA 5HZNA 3MVLA 3IG7A 4XNEA 1WVXA 2G2FA 3TXOA 4FG7A 4A4XA 5EI2A 5EW8A 3VS7A 5BVFA 5EI8A 5E91A 2PVFA 3O8TA 3G5DA 2WQNA 5DVRA 4E5AX 3BLAA 1GJOA 1XBBA 4PX6A 3QTRA 5ANOA 5TO8A 3WF6A 5J79A 4AXDA 2GDOA 3DZQA 5EQPA 4OTHA 3FQHA 3K3JA 3LMIA 4L44A 4V04A 1XKKA 3ZSGA 3ORIA 5JK3A 3V8SA 5EQYA 4JX7A 4NJDA 3W2CA 5HIBA 4EEVA 1TKIA 4DCEA 1KE5A 2XYNA 4YP8A 4ID7A 3OWPA 3BE9A 3TUDA 3NMUF 3UIBA 5A14A 3KA0A 1PXLA 2UZEA 4CCBA 5B7VA 4CZYB 2AUHA 2PU8A 2QOLA 4ZP5A 2XKFA 1WCCA 2BRGA 4U8ZA 4AU8A 3KREA 2XK8A 3MFRA 4S31A 4CRLA 3ERKA 3F5UA 1DAYA 4I3ZA 3UNJA 3DU8A 4BB4A 2NNWB 4CSVA 1VYZA 2A0CX 3C51A 4IM0A 3UG1A 3VULA 4GEOA 5C1QB 2OZAA 5B0XA 3FKNA 3JXWA 2VO3A 2XNPA 3CCNA 3HX4A 2OJFE 3LJ1A 5E8TA 3Q52A 5CTPA 1PXJA 3ZLXA 3ZUUA 4AOTA 4I4EA 5HG8A 3UQCA 2W06A 3SW7A 4YHFA 4V05A 1BI7A 2R3FA 4FT0A 3C0IA 4NJ3A 2B0QA 3OWKA 2X7GA 4RIWB 4ZY6A 2P0CA 5ANEA 1YOLA 3BL7A 5IH4A 2GQRA 3TZ9A 2WEIA 3UPXA 3H4JA 4F6WA 1FBNA 5DYJA 4E73A 4M66A 4QTDA 3PWYA 5TOZA 3T3VA 5M51A 1J1CA 3O96A 2OIBA 2W4OA 3FKLA 4UXLA 2WMAA 5KMMA 3W0SA 3OXTA 3LFFA 4MNEB 1W83A 3CKWA 5TKDA 2PK9A 4FSZA 4R5SA 3WF9A 4LRKA 4ZSJA 3D9VA 1ZY5A 3DB8A 5HE3A 3VW6A 4XP0A 3F9NA 3FMJA 4MNFA 2C6IA 2CMWA 1WZYA 5HHWA 3LFDA 3PSBA 4CMTA 2R3LA 2C3LA 2C6EA 2C5OA 1OKVA 2XK3A 2SRCA 4FNXA 5IA5A 2YWPA 5E90A 3OTUA 3E8DA 5M06A 2X2MA 3QRTA 3EFLA 3P86A 1Y57A 2QURA 3QQGA 4OTIA 3COIA 3AT3A 3VBQA 4QP1A 5AP4A 3QA0A 4BHZA 5LVNA 1PKDA 3DPKA 4WG3A 4FK6A 4L00A 3S95A 3SV0A 3UIUA 4GT4A 4UALA 4D5KA 1B38A 3AC4A 3W18A 4O2PA 2QOKA 3BYUA 4RBLA 4X2JA 5GJGA 2WMSA 1WBOA 2WNTA 4EJNA 3AD6A 5EHLA 3S4QA 4BDKA 5LMAA 4AN3A 3TWJA 3QZGA 4D4RA 1OECA 5HCXA 1LUFA 3OW4A 4HPUE 2W9FB 4IEBA 4MD7E 2QKRA 4NTSA 2RFDA 4OR5A 2UW7A 4RLKA 1UKHA 4HVGA 4RJ5A 1LPUA 3I6WA 3ENMA 5AJQA 4ALWA 1G8AA 2R7IA 1H1RA 3TNHA 1OIYA 1MRYA 5DG5A 2X0OA 4WKQA 4WUAA 4W8DA 3ROCA 1LEWA 4QYEA 2WEVA 3TUCA 1GIJA 2QU5A 4AGDA 5A4QA 3EHAA 4I6BA 2VGOA 4BDBA 4KUJA 2OJIA 3G9NA 1MQBA 3MA3A 2IZRA 2VTMA 3ZZEA 3GQLA 3D0EA 3QD4A 5DT3A 3ZM9A 5ETCA 1PF8A 3A8WA 2BAQA 2J9MA 2LGCA 4WT6A 1G8SA 2BALA 2QHNA 4JMQA 4EONA 4EQMA 5AP7A 1PJKA 4IANA 4P4CA 1O6KA 1Q5KA 1G5SA 3CJGA 4ANNA 4E93A 4FKSA 4MUQA 2GNJA 2GNFA 2W4JA 4A9SA 3VO3A 3A7GA 5CXHA 4EH4A 5H3QA 1J7LA 4G17A 3BWFA 5HO6A 2JKOA 3LCKA 1W2CA 4WNMA 1XR1A 4F63A 4NYEA 1TVOA 4ZAUA 2C6MA 3HRCA 4YJRA 5CSHA 4BKYA 4D9TA 4PTGA 5GJDA 5M08A 5HVJA 5JKGA 4W4YA 5K5NA 4C4FA 3Q32A 4KBAA 2VNWA 4MBIA 4DLJA 5CT7A 4BWPA 3KB7A 4HYIA 3VUMA 4D2VA 4O6EA 4QMYA 3TEIA 2E9OA 2OBJA 2UZDA 4QPSA 3BCEA 3G51A 5BV3A 3AD4A 1JQHA 2A4LA 3PFQA 4TKSA 4WRGA 5HBJA 5M57A 4FEUA 2J5EA 4M3QA 3I4BA 3ZLYA 5C8KA 1SNUA 2YDIA 2UZOA 2CSNA 4APPA 3GXLA 3W0NA 4QQ5A 4O91A 2W0JA 3VVHA 4XMOA 4FV8A 4OTFA 4FKOA 5M55A 3R9RA 2EWAA 3L8XA 4CG8A 4QP2A 2ZM3A 4PNKA 3ORZA 4EHVA 5HG7A 5IA2A 3B8RA 2XJ0A 2PUNA 3RPSA 4D1XA 2HENA 3MTLA 4F0GA 3RZBA 4GUBA 3AC5A 3DTWA 3PUFC 5CY3A 4EK6A 1U54B 3R8VA 1BYGA 4R77A 3GCVA 4Y73A 1RW8A 4FSRA 3WARA 2YFXA 2JD5A 3VUDA 4KNBA 4JDKA 4BR3A 3B2TA 3ULIA 4W9XA 4X3JA 2EXCX 3SC1A 4ANOA 4YJTA 5CU4A 3RGFA 1H26A 1L8TA 1U5RA 4ERKA 2XARA 5HESA 3BV3A 4DFUA 3IKAA 4BCIA 3HGKA 3D15A 3NYNA 4KIPA 4EH3A 3RALA 2ZB0A 3FC2A 1QMZA 4F65A 5TT7A 4L68A 4BGHA 4LOPA 4EH5A 3POOA 3TL8A 1TQPA 4AZFA 2O64A 1FVRA 4RG0A 2WXVA 4M7IA 4FX3A 5K0KA 4LV7A 2OH4A 3FY0A 3JVRA 2OJJA 5LMKC 3P0MA 2CLQA 3PFYA 3SG8A 2C1AA 3PLSA 4O27B 3VAPA 2Z7LA 3MFTA 3MY0A 3PJCA 4PPCA 4YZBA 4ZSGA 4CZTA 3E92A 4YJSA 3EH9A 3U9NA 3FHRA 3TTJA 3W0OA 3FV8A 4X3FC 4LGDA 3IW7A 3LCDA 3HV3A 4Y95A 5CNNA 2PVJA 3HA6A 2G2HA 2YM4A 3QGWA 3ZFMA 1WBNA 2ITYA 4PTEA 3ZRLA 4L42A 2XUUA 1XH8A 3L9LA 3U51A 1OL1A 1ZOEA 4QP4A 3AT4A 2CNVA 2VTAA 3I5ZA 2W5BA 4CV8A 4C59A 3EIDA 1UWHA 2HWPA 4UMPA 5AR8A 2IVVA 3QKMA 4O0VA 3R2BA 2VX0A 3FQEA 2UW8A 4EHZA 4WBBB 3ZBXA 4C4EA 2YIQA 3F69A 3VS2A 3OXZA 1LR4A 3KXXA 4H39A 4TT7A 4YTHA 5TF9A 5AUWA 4II5A 3NYXA 5AUVA 5DR6A 5HLWA 2R9SA 3HV4A 4ZK5A 5CU6A 3FE3A 3KXMA 1WVWA 2NO3A 2UV2A 3KXGA 4B8MA 2UW4A 4MXYA 3RM7A 3WE8A 4ANMA 4BCMA 1JKSA 3MPTA 4J7BA 4DH7A 2VTRA 2W5HA 3C1XA 2RFSA 3BV2A 4AA4A 2PMNX 2GTNA 5ANDA 4CKJA 3NUYA 4IE9A 2H96A 3TTIA 3V5TA 4IJ9A 3KF4A 4JT3A 4LUDA 4XLIA 4RA5A 1PRYA 5J5SA 2UUEA 3K5VA 4JNWA 3P7CA 3M11A 1TZDA 3I0OA 4FSUA 4GVAA 2B9FA 3ANQA 4BBFA 2XK6A 4WG4A 5EDQA 4C4HA 3GQIA 3HV6A 4TXCA 5K5XA 4DT8A 5AAEA 4NCTC 4FR4A 4BBMA 5ETAA 5A4CA 5A4LA 3GCSA 3I79A 3RNYA 4DCAA 4N0SA 2ETRA 1WBSA 5ACKA 3SRVA 4DHFA 5BPYA 3ORPA 3U6IA 4CEGA 4A06A 1LP4A 5DH3A 3R7EA 5LVOA 4D2PA 2YABA 4R5YA 3WZJA 4I93A 1RDQE 4O7VA 3U55A 2WMWA 5LMKA 4RFMA 3FI4A 5AWMA 2OZOA 3NZ0A 2A2AA 2ITQA 3CIKA 5ETFA 2F49A 4NW6A 1W0XC 4PDYA 3PIXA 3V04A 3LFEA 3G0FA 1R78A 1TQIA 3BZ3A 1UNGA 3GU7A 5AV1A 4O7LA 5DT0A 3W2RA 5CLPA 1IRKA 4P90A 4ZTHA 1G8KA 1JKKA 3FMHA 4ITIA 4ZLYA 2W5AA 5JQ8A 3QGYA 2ETKA 1PMUA 1YXXA 4BDCA 4KB8A 3WZUA 5G1XA 4EZ3A 5A4TA 4AAYA 5CXZA 5DMZA 1IAHA 5FP6A 3UOLA 3VONA 4JDIA 1MUOA 1CKPA 4JQEA 5CSXA 2C1BA 4ZTQA 3MH2A 2WQBA 3T8OA 2XNMA 4DGGA 1GZOA 4XP3A 1Y8GA 5FGKA 3MN3A 4ZZMA 5T6KA 3P5KA 3BX5A 2ITUA 5CSVA 4LOOA 1PXOA 3PYYA 5KZ0A 4C36A 4FTQA 4ITHA 1KUTA 4PNIA 3RPYA 2XKEA 4ANQA 4L43A 5CVGA 4EK4A 3IDCA 4KIQA 3QTWA 5M44A 2BCJA 3LXPA 4K33A 5E8ZA 3SKCA 5HNBA 3TIZA 4C3FA 2C6LA 2ZM4A 3UC3A 3VWAA 3BHYA 3QZIA 3EFWA 2A1AB 5D41A 4PMPA 3Q3BA 5IEVA 4U43A 3CP9A 5LOHA 4FV9A 4O4BB 3G0EA 4AQKA 1V0BA 4FSTA 4V01A 3PRIA 3H9RA 2GHMA 3EMGA 2BTRA 5T3QA 1UNLA 3F5XA 4ACMA 4O7SA 2JDTA 4S2ZA 3W2QA 3FUPA 5LCJA 3F3VA 4I94A 4UN0C 2C6DA 3TV4A 2XK7A 5FBOA 4DINA 4G3CA 3UQGA 3PTGA 4TZRA 1M7NA 4ZSEA 3SXFA 2HW7A 3AT2A 3AXWA 3ZH8A 4BTKA 3QTIA 5K4JA 2CKEA 3O23A 4OTDA 3DB6A 4V0GA 4E20A 5BVNA 5CALA 1OVEA 5A4EA 2XZSA 3VUKA 5M07A 5JGBA 1OITA 3MYGA 3CJFA 3DGKA 4FKLA 4CFVA 3ZUTA 4DHJA 2C69A 3CKXA 2OK1A 4J99A 4LRMA 4M69A 3OUKA 3TJCA 5ICPA 5JFXA 2I0YA 3F5GA 4BCGA 4F0IA 2VTIA 3NPCA 2X0PA 1YDSE 4MF0A 4PPAA 2WTKB 3Q4ZA 2IW9A 1FVTA 4XHKB 4CNHA 4FMQA 3BI6A 4UMUA 2W1EA 4EQUA 3H30A 3ORNA 2GQSA 3BHVA 3A7IA 3HDMA 4W8EA 1UU9A 2CN8A 5L2WA 3QX2A 5AFVA 4XRLA 4YPDA 4XP2A 4ZY4A 1QL6A 4JJRA 3HYHA 4U7ZA 2YM5A 1BMKA 4OBPA 3KU2A 3V6RA 5LVMA 3HKOA 4OUCA 3QWJA 2C5YA 3O71A 2OXXA 2AC3A 3QC9A 5CI6A 4AAAA 2GHLA 1E9HA 4E4LA 2IJMA 1CKJA 3FI3A 2P55A 3TV7A 1Y91A 3P4KA 1H1WA 4NUSA 1STCE 4I5HA 4ZTSA 2O0UA 3CEKA 4BKZA 4C33A 4C38A 4NZWB 4CXAA 3P7AA 3HV5A 4PF4A 2Y9QA 1XWSA 2ZV2A 3DV3A 2UW5A 3CLYA 3E3BX 3FSFA 4XG9A 2X6EA 5M4IA 2YAAA 4UYNA 4BGGA 4BRXA 4AW2A 2GU8A 3ZC6A 2W96B 4BDJA 3DBFA 4MWIA 4C4GA 4CFWA 3Q9WA 3RZFA 3MH3A 3VUIA 2I6LA 4YBKA 5FTGA 2NPQA 2FSTX 3NNWA 3KL8A 3ZSHA 3LQ8A 4E26A 4HVIA 4O83A 3VUTA 5BMSA 3LFQA 4GU6A 4LGHA 1YWRA 2ZDUA 1TFFA 2CGXA 4MK0A 4C8BA 2QCSA 3Q5ZA 2Y6MA 2XNGA 4QMTA 4CLIA 3EKKA 4ZS4A 3K5UA 4YZCA 5DOSA 4DDIA 4P7EA 3RAHA 4PP7A 3VW8A 3SHEA 3ZU7A 3D2KA 4L9IA 5D11A 3DAKA 4AOIA 3KK8A 2J50A 5C8MA 3PG3A 4O0RA 4OLIA 2Y4IB 5BVEA 1GZ8A 2G2IA 2A19B 2JEDA 4NU1A 4C62A 4Q9ZA 3B8QA 2UZTA 1GAGA 4YLJA 1S9IA 3HECA 2OXYA 5AA8A 5GZ8A 5IDPA 4EUTA 5J9YA 3PE2A 3BL9A 3C5IA 3GVUA 4BI2A 3ITZA 4AG8A 4EOQA 3KFAA 2BKZA 3R7OA 4R3PA 1Q61A 2JDVA 3PZHA 3BU5A 5B2LA 4AX8A 3U6JA 4LYNA 3D14A 2YM7A 4Z9LA 4ZSAA 5L8KA 2CKOA 4QMZA 4FGBA 3MY5A 4FZ6A 4O81A 3R1SA 4DH1A 4IM3A 4TYHB 5HTCA 4QDEA 4RZVA 4U6RA 3G6HA 3R7GA 1IA9A 1AQ1A 2XEZA 4FVQA 1UU8A 2HZ4A 3HLLA 4FKQA 4TPTA 3SXSA 4JAJA 2IG7A 2R3RA 1W8CA 1KSWA 3LKMA 4FVRA 4EC8A 2R0IA 4AE6A 3AKLA 5FM3A 3SXRA 5J9LA 3O50A 3E63A 4RIYB 4RSSA 4FG9A 4FEXA 1ZARA 4KSPA 2CGUA 1JKLA 1Z9XA 5JMSA 4RJ8A 3F2AA 4JQ8A 2HW6A 1CM8A 2O63A 3LXLA 4DGNA 4LRJA 4XV3A 2PZIA 4BCFA 4JRVA 4YC6A 5EH0A 3UMXA 4IAYA 5IA0A 3E8NA 3QXPA 3AC8A 3A62A 4FIFA 3W0PA 3JY0A 3EL7A 4R3RA 4BJJA 3E7OA 5C03A 4IC7A 1M2PA 3FZ1A 3S3IA 4FODA 3VS1A 3EQDA 3S1HA 3UDTA 1SNXA 4FI1A 3KK9A 2GMXA 2V0DA 5HE0A 2QO7A 4IDVA 5EHOA 2FO0A 3LJ0A 5CX9A 3ZDIA 4AN9A 5HLNA 4PV0A 3RPOA 4BCJA 5I3RA 4ZXTA 3GP0A 2JAVA 3D2IA 4GS6A 4DGLC 2OU7A 3Q04A 5KMLA 2ZMCA 3AC2A 5KNJA 3V5QA 4C3PA 1XH5A 5CU2A 5I9YA 2XBAA 3TG1A 1V0OA 5CQWA 3WIKA 4GW8A 2YA9A 4EWQA 3UPZA 2H34A 4UYAA 4BYIA 3R2YA 3QTQA 1OI9A 3Q60A 5AIRA 4CYJA 3MIYA 4QMXA 5K0XA 2OKRA 5DE2A 4D2RA 5JSMA 1I44A 5H2UA 2CJMA 5AAFA 4BZNA 4C61A 5B2MA 2QQ7A 5DNRA 5D9HA 4USEA 3TV6A 4Q9SA 5BVKA 1E1VA 3P08A 1OL5A 5BUEA 2YHVA 1HCKA 4E7WA 4KS8A 4MBJA 5IA3A 5KMOA 4DF3A 4J8NA 2QOHA 3ACJA 4YSMA 2W17A 5EG3A 3TZMA 1J7IA 5A54A 3QQUA 3S2PA 4HCTA 2VGPA 5IQIA 5IF1A 2W99B 1VEBA 1YVJA 4GG5A 4E3CA 2QOFA 3W2PA 4RVKA 5AX3A 2F9GA 3KRJA 4JRNA 3TT0A 1Q8UA 4IAAA 4APCA 3LPBA 1ZZLA 3VUHA 2AEGA 2XM8A 4F09A 4O7ZA 4OW8A 3R9OA 5GZAA 4HGEA 1FGKA 3VS4A 1S9JA 2CNQA 3UDSA 3TNQB 2YM8A 4DTKA 4R78A 5GIOE 4HGLA 4AOJA 4FUYA 4GIHA 2OF2A 2QOIA 3UO5A 3LQ3A 2QNJA 1ZYCA 2ZB1A 4NFMA 3A4PA 4G9RA 4USDA 5A3XA 3R21A 4QMQA 2XP2A 4YURA 4C34A 1BL6A 2YLEA 3MGYA 5HIDA 2W4KA 1JLUE 4IX5A 1NA7A 4GVJA 3HMIA 3IDBA 4ZLOA 2WOTA 4ZY5A 5JGAA 2IVSA 3FLSA 2Z7SA 3FMKA 3FZRA 4B8LA 3BYOA 1BX6A 1IG1A 4E5BA 1YXVA 3TACA 4ACHA 4CTBA 3ZZWA 2HZNA 2PMOX 2YJRA 3UTOA 2VTPA 3WBLA 2R3HA 3QF9A 4F9WA 4ZEGA 4EK5A 2BDFA 1ZMVA 2XVDA 4O4CA 5AX9A 4QYFA 4ASDA 5J9ZA 1L3RE 4FYNA 4FG8A 3LM0A 3PLAE 2IZSA 4FOBA 2Z2WA 4BHNA 4FT7A 4K6ZA 2JIVA 3H10A 3BHHA 5CEIA 5A6OA 1JPAA 3NIZA 2JDRA 3LXKA 4ENXA 4RPVA 2X39A 1BKXA 4GL9A 2BRMA 3ANRA 4FSYA 4XV2A 5C26A 1Q41A 4FVPA 3G15A 4FSWA 2WMTA 4KKHA 3IQ7A 1JVPP 1PKGA 4R7BA 4GKIA 4GUEA 3L9MA 2CHLA 1ZYDA 4JS8A 4QMPA 4U45A 5TR6A 4GH2A 4G1WA 2C0IA 3PXFA 4YJPA 3IONA 4L7FA 2XNNA 2BHEA 3W8LA 3R0TA 4YTCA 3HEGA 2YIRA 3ALNA 3Q4UA 3QCXA 3TKHA 2VWVA 4LV5A 4QP6A 2ZM1A 1PXMA 2B9JA 1JBPE 5IQFA 3O8UA 4IFCA 1OGUA 1REJA 2FH9A 1OMWA 4K2RA 1WBTA 4YNOA 5LQFA 1A06A 4WIHA 3QTSA 3FLZA 4EORA 4O0WA 2PUPA 4FSQA 4FV2A 1OB3A 1MRUA 2OFUA 4I5MA 4XRJA 4Y83A 2CGWA 3W55A 4YSJA 3D4QA 2O2UA 2XK4A 5CNOA 1URCA 4CYIA 4YLLA 2PZPA 5GNKA 1F0QA 1RJBA 2VWYA 3VBTA 4D2SA 2WIPA 3VQHA 4O96A 3GOPA 2XM9A 5EYMA 3I1AA 2XNEA 3FPMA 2XK9A 3QALE 4ZTLA 3EKNA 3KC3A 3PXYA 4FV4A 5CAVA 4F7LA 3R04A 4K1BA 5H9BA 3DFAA 3ATSA 4QP3A 2HYYA 3F61A 4O0UA 3VS0A 4CFMA 3W10A 2QKWB 4DEAA 4FYOA 4ZJVA 4DH5A 4EHEA 3LAUA 2Q0BA 2BFYA 3RPRA 2X81A 1KE7A 1W2DA 4CV9A 4CVAA 4XV1A 3V5WA 2I7QA 1WBWA 3DBCA 4J8MA 4RVTA 3I60A 2UW9A 1U5QA 2AQXA 3PSDA 3II5A 3MH1A 4GT5A 2XAMA 2R64A 4MBLA 2BDJA 3NWWA 4FICA 1H24A 2F57A 3QBNA 1KE8A