4OBPA

Map4k4 in complex with inhibitor (compound 29), 6-(2-fluoropyridin-4-yl)pyrido[3,2-d]pyrimidin-4-amine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
298
structure length
285
Chain Sequence
IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Discovery of Selective 4-Amino-pyridopyrimidine Inhibitors of MAP4K4 Using Fragment-Based Lead Identification and Optimization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 285
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4obpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4obpA01
4FKGA 4QMSA 2XNGA 2VO0A 3VRYA 4O84A 3U87A 2HZIA 2KTYA 5CI7A 2VTMA 3Q9WA 4D9TA 1SM2A 5KZ0A 1ZLTA 5LWNA 3A7FA 4XUFA 5CSHA 3VRZA 2YACA 5JK3A 2OZAA 3HA8A 5L2QA 3ORLA 4RT7A 4BCOA 5A6NA 3MVHA 3UNZA 1VYWA 4WRSA 4I92A 3FMNA 2OIDA 4FUYA 2PE2A 3CTQA 3GU8A 3ERKA 4RIYA 3R7OA 1GZNA 5BUJA 2PUPA 3DB8A 2ZAZA 2C0TA 3OY3A 2OFVA 2E9OA 5TT7A 3KXMA 3SG9A 2X0GA 1NY3A 3QRTA 4ZLYA 5KUPA 2VWXA 4GU9A 4JOAA 5FBNC 3BPRA 3F69A 5AUYA 4C58A 4QMPA 4XNEA 2C6TA 4ANSA 4ZLOA 5CX9A 4R7IA 5E7RA 2DWBA 2PVMA 3KF7A 3IOPA 3CQEA 3PJ1A 1DAWA 4RJ7A 3V01A 4KD1A 5GZ8A 4DFUA 1JWHA 2Z8CA 4GEOA 4RRVA 2XRUA 4FKVA 4X3JA 2IPXA 4J8NA 5JSMA 4CMOA 3D5WA 4RC4A 2F7ZE 3SAYA 4DG3E 3VS1A 3F9NA 3K2LA 2ITXA 3O50A 2W4JA 5GJFA 1BLXA 2WMVA 3TNQB 2RG6A 3S3IA 4A9RA 5C4KA 3FYJX 4QP3A 3P4KA 3ZMMA 1RDQE 4L45A 2X2LA 3C50A 2X81A 5I9WA 4GFMA 3CD3A 4BTMA 1H26A 4FNYA 3RAKA 4OR5A 1WBPA 5DT0A 4DINA 2A2AA 4IAYA 4U45A 5LARA 1SNUA 3MPAA 3HX4A 4KUJA 2PVJA 5H8BA 4IB1A 4EWQA 1ZRZA 2J0LA 3PG1A 5KMKA 2O2UA 2UZWE 5EM8A 1H1QA 2V0DA 2VU3A 3QKLA 3N4TA 5CEPA 1H27A 3G90X 4Z16A 3EH9A 3MPTA 3UNKA 4UN0C 3MH3A 4FKLA 4UYNA 3VUHA 4YC6A 4BGQA 1NA7A 4QD6A 4EH3A 4EK4A 5LQFA 2R0IA 2X9EA 4QP4A 2X8DA 3D9VA 3G51A 4BYJA 4KSQA 1G3NA 3NGAA 2UW4A 4GG7A 2C6OA 4NSTA 1WMKA 5M4FA 4TTHB 3UQFA 2OU7A 3U6IA 4JG6A 2BPMA 3FZOA 4IEBA 4LGDA 4E4XA 3EMGA 3AOXA 3MESA 4QMMA 4FTJA 4D4VA 2X6EA 1NVSA 4CFFA 3EN7A 4JVGA 5I9XA 3PLAE 3QHRA 4XS2A 3S1HA 4MF1A 5LVMA 3WF7A 3OTVA 4WUAA 1H0WA 2Y6OA 2C3IB 5C01A 3P7BA 3UMXA 4CZTA 2W05A 5ANIA 2UW9A 4DFZE 1F5QA 4JAJA 5IMXA 3AXWA 2WQMA 4XG9A 3LXLA 4O7ZA 2PVFA 3HP2A 2BDWA 4II5A 1XH7A 3V51A 3VHKA 3ALOA 3KY2A 5E8ZA 2BR1A 2Y8OA 3SX9A 3UP2A 3LMHA 1XJDA 2J90A 3OOGA 5TF9A 2V7AA 4MXOA 3WILA 4DBNA 4HVGA 4W8EA 2R3RA 1FINA 3NIEA 4P90A 4D4RA 1H28A 3C1XA 2A0CX 1ATPE 4FIFA 2CGXA 3LAUA 3DQWA 4U42A 3RPYA 4BIDA 3GFWA 2XKEA 3C7QA 4Q9SA 4AAAA 1RQQA 3ZLWA 3MA6A 4FNWA 4P5QA 1CSNA 5HLPA 4S34A 4OTDA 2GS2A 2YAKA 5EI6A 4JBOA 1JPAA 4PL4A 4ALUA 3FQEA 2WZJA 4E1ZA 3BBWA 3RZFA 3C0IA 2JITA 1PXLA 5M4IA 4UALA 3DTCA 5HNIX 2W5AA 2YZLA 2JLDA 5I9YA 4L7FA 2CLQA 4GIIA 2XB7A 3LFAA 4O0XA 2XNNA 2WMSA 4XRLA 4ZY4A 3NWWA 3BX5A 5AP6A 2VWIA 3BLQA 3OCTA 3MH1A 3T9IA 3IDBA 3LHJA 3JXWA 3DOGA 4GT4A 4N0SA 3IDCA 3A2CA 2Y9QA 5D41A 3HV6A 4CMTA 4RLKA 4BF2A 4YR8A 3OCSA 4F7NA 4CTBA 2J6MA 2P33A 1YDSE 3R63A 4IM3A 1FOTA 2EXEA 3SRVA 4AT5A 5HU3A 4I5PA 4O0WA 3OTUA 5ANDA 2YIWA 3BQCA 5FEDA 3PP1A 4F4PA 4RJ4A 5FBOA 4H05A 2F7EE 3CY2A 2X7FA 3UVQA 3UYSA 1QPEA 1OGUA 3MH0A 1FPUA 5AP3A 5IG1A 4YU2A 1U59A 3UC3A 4PTEA 4IMYA 4K1BA 3VUTA 1P14A 2XVDA 3H9RA 2PVYA 4NM5A 1P2AA 4EOLA 4KNBA 2HY81 3WIKA 1OBDA 4A4XA 4TYEA 4HZRA 3UIBA 2C1AA 4IVDA 5BUIA 1YI3A 3W18A 3UPZA 1J7IA 5FTOA 3DXQA 3GT8A 3A7GA 5G6VA 2XNPA 5HD7A 3I6WA 3U9CA 3DU8A 2WNTA 4M68A 2JAMA 1LUFA 2B53A 5K0KA 3VJNA 4IH8A 1XHAA 3E3PA 3QQLA 2YZAA 5CVFA 5HTBA 4D1ZA 4EONA 1H00A 2QOLA 4FTTA 4A9TA 4U9AA 4FKWA 2HENA 3FI3A 2C1BA 4ENYA 4TT7A 5BVEA 3DKGA 4GVAA 4YNOA 1ZYDA 3FL5A 4O96A 5AEPA 3DAKA 1PF8A 4FC0A 3QC4A 5K4JA 1E1VA 1HOWA 4E6CA 2CKOA 4DEEA 4QTBA 5CS6A 5DFPA 2HCKA 4UBAA 4UX9A 2YCRA 3PRIA 3DK3A 3ZUVA 5H2UA 3ORZA 5AV1A 4NFNA 3UP7A 4GKHA 4BTFA 2PU8A 5CEQA 4DEAA 4IAKA 2JKKA 5DEWA 5HGIA 4QMNA 2OZAB 2HXLA 4E3CA 5JGDA 5A4EA 2NP8A 4F0IA 3WOWA 3K3IA 2Q0BA 3VQUA 4KBAA 3BEAA 4CD0A 3IW5A 2PZYA 3AMYA 3AD4A 4FVRA 5M4CA 4DCEA 3OXZA 4YLJA 4C8BA 4J1RA 4DEHA 4RQKA 4I6QA 2JBPA 3C0GA 4QP8A 2XS0A 2QO7A 4O7RA 4R78A 5IQHA 4W4YA 4YJOA 5DNRA 2QR7A 3HMOA 4JIKA 5CAUA 4FEVA 3NR9A 3IO7A 4UMQA 5EM5A 4BIEA 1JAMA 3FQSA 4QYFA 4RIXA 4O2ZA 4XV1A 3U4UA 2VTTA 2E2BA 3EB0A 4BDEA 4EUTA 3D5XA 3QGYA 3F5PA 4I6HA 4IQ6A 4UWYA 2Z7QA 3HMIA 4RPVA 1WFCA 4UWCA 4G6OA 3UBDA 2GNHA 4BBFA 2NRUA 3ZLXA 1Q8ZA 3VAPA 5I5ZA 4UMTA 2HWOA 4EZ7A 5EHOA 1TKIA 2JIIA 1FBNA 2CCHA 3LFDA 1Q99A 3BHVA 4ORKA 5DG5A 1YHWA 3QQFA 3KVXA 3ZCLA 2DQ7X 4AUAA 4YSJA 4TZRA 4MHAA 3VS6A 5JKGA 4X2GA 3OHTA 5CSXA 4EHGA 2OH4A 4GUBA 4CMUA 1LEWA 4PY1A 3TIYA 4A07A 2Y6MA 3ZU7A 3EKKA 5FDXA 1U4DA 4GW8A 4C59A 2BTRA 3PPJA 2ITYA 2VTQA 4PDPA 3TNIA 5M56A 4KBCA 3Q9XA 1RW8A 2HWPA 4FI1A 2JEDA 3MDYA 5J79A 3NUXA 1WBWA 2O8YA 4JDKA 4CT2A 5A3XA 4L68A 3FQHA 4KKHA 2CKPA 3FZSA 3Q2JA 3F7ZA 4Y83A 4JX3A 5HIBA 3PFQA 2B9IA 5HO8A 4W8DA 2C6MA 5IH6A 3O2MA 2WOUA 2R3MA 4M12A 4A06A 4Y5HA 3TACA 2PTKA 3Q3BA 3QTIA 3ROCA 2V7OA 2W1HA 3SXFA 2FUMA 2UV2A 5HU9A 3BYSA 2X39A 3CGFA 5DN3A 4FV2A 2ACXA 5C9CA 2Z7LA 5GZAA 3LFQA 2C5NA 4O7VA 3FE3A 2ZM1A 3LFCA 3IQ7A 4YUQA 5IQCA 2ZDUA 3P1AA 4AN2A 4FTAA 2CNQA 4TKSA 4XMOA 2RFSA 3QTQA 1ZOEA 3V5WA 2CKQA 3OMVA 3BHHA 3E64A 4F64A 3NVMB 4R77A 3K5UA 3HV4A 3P7CA 3RPSA 4I0RA 4ZJVA 3DKFA 4GYIA 4EZ5A 4UMUA 3KRRA 4YHFA 5AAFA 5HE1A 3FI8A 4QTCA 3LXKA 4FYOA 4YJNA 1A9UA 5CU4A 4YJVA 3V8WA 5DR2A 4AT4A 4HYSA 3WARA 3PWYA 1U46A 4BZOA 1BL6A 3QTXA 5HHWA 4BDJA 5K3YA 3C4WA 2JIUA 5M06A 4ZTMA 1CMKE 4FVPA 2OH0E 2PZ5A 2Y4IC 2UZTA 3KMWA 2IVUA 2R64A 4FG9A 5EKOA 4QNYA 1M2RA 3CJGA 2HZ4A 4GVJA 2FYSA 3FMHA 4F6SA 3RM6A 5EYMA 1OIYA 2YJRA 4XYFA 5H8GA 2I1MA 4I6BA 1R39A 4XP0A 5JRQA 5KNJA 4IB0A 4IZYA 2GNLA 3QQGA 4OT6A 3QZHA 2J0IA 4A9YA 5LCJA 4BDCA 1BX6A 3AGMA 3G9LX 3LJ0A 4E93A 2EXMA 3FSFA 1YXXA 4AZFA 2BZJA 2AUHA 4PDYA 3UOHA 4CG8A 5I3RA 4MBJA 5CEIA 1Y8YA 2X9FA 4IADA 4MEDA 3RK9A 3D7TB 1QPJA 4BCQA 4G34A 5HE2A 3BV3A 4X2NA 3DBFA 5AUUA 4AFJA 3JS2A 3D2IA 1XBBA 4I0SA 1YXTA 3ANQA 4KWPA 1O9UA 4U97A 4L46A 4RC3A 2VV9A 4GYGA 4IDVA 1OUYA 4QPMA 5E8YA 3UOKA 4D0XA 3ITZA 5CASA 3GNIB 4MNEB 4NTSA 5KKRB 3ZFMA 3VN9A 3GU4A 2JFMA 2C5XA 2Z7SA 3F5GA 3R73A 4FUXA 4TPTA 3VS3A 4BCNA 5DVRA 3PYYA 4KIOA 4BCJA 2OLCA 5A4CA 1M17A 2CGWA 3ZM4A 1NW1A 4ZSAA 4C38A 3DPKA 1AQ1A 1T46A 2QO9A 4WUNA 3RCDA 4X6RA 1WBVA 2RIOA 4ACCA 2OIBA 1S9IA 2YIRA 3CKXA 3QRUA 3ATSA 3GGFA 3RM7A 4DTBA 3EQHA 3LCKA 2O5KA 3HMMA 4A4LA 4I5HA 3WZUA 4PP9A 2YLFA 3CQWA 5DHJA 2VX1A 2REIA 4EH2A 4L52A 2UZLA 5LMKC 3LM0A 4OTRA 5BUEA 1IAJA 3F88A 3R9RA 4WHZA 5BVNA 1PXJA 3EQBA 1ZOHA 4FSYA 2QVSE 4DGOA 2WO6A 1XH9A 4MCVA 4DN5A 3F3VA 3DZOA 2VTNA 4C2VA 4TYIA 3SA0A 1PW2A 2JKOA 4QMOA 3ZDUA 4IVBA 5DI1A 5I9UA 1ZMVA 4OTQA 1GNGA 2R3IA 5ETIA 2XJ1A 5CU2A 3R8PA 3ORXA 3P78A 1CTPE 3WIGA 3W1FA 3QD3A 4IM2A 3HUCA 4HGTA 3BRBA 3DXPA 5CU6A 5AR8A 4I4EA 5EOBA 3AMBA 4AN3A 2XBJA 3N51A 3UO6A 3CC6A 3GXLA 4BBMA 4HVDA 5CAOA 2ITQA 3BLHA 2B52A 2ZM3A 3LM5A 3OBJA 5D11A 5HNBA 4PP7A 4O7LA 5HD4A 4CQEA 1OKWA 4PMPA 2JKQA 3PXYA 3UO4A 5FUTA 4XH6A 5AMNA 5JQ5A 4X3FA 4G6NA 2OSCA 2C68A 1J91A 3EQDA 4FEWA 3WF8A 2EXCX 3V5LA 5EG3A 2IVTA 3F6XA 4F09A 2YHVA 1BKXA 2OJJA 3CPCA 3CY3A 4IWPA 4PWNA 5IQFA 2YFXA 5T68A 3TZ7A 5C8NA 5KHXA 3RPOA 2HYYA 2W99B 3F5UA 1I44A 4H1JA 4P5ZA 3NX8A 3P08A 3OXTA 3JY9A 2WTCA 4EJNA 3K54A 4U80A 4PRJA 4NL0A 3ACJA 3HRBA 2XEYA 3ZSHA 3AC2A 1MRYA 4IWDA 4O7WA 3NSZA 4ALWA 4FX3A 4U81A 5HO6A 4TW9A 4L3JA 4BL1A 2EB2A 2C3JA 2GNFA 3ENHA 3POOA 2VTPA 3C4ZA 3MA3A 5T3QA 2VN9A 5E92A 5A9UA 3QQKA 1L8TA 3IPHA 2WMBA 3D15A 3AC8A 4RIXB 3OT8A 4FR4A 5AV0A 3SXSA 1YXSA 5L8KA 3ULIA 3W2RA 1DM2A 3UYTA 4EC9A 5M4UA 2BRHA 3GCQA 4FZFB 3FI4A 5F1ZA 4DH8A 2XKCA 4NWMA 5F95A 3MTLA 4FEXA 5ANJA 1XQZA 3RK7A 2UUEA 3DJ7A 3ACKA 4XG7A 4FZ7A 2GNIA 3R9OA 2QOIA 4KKGA 1PJKA 4M14A 4FTQA 4U5JA 3Q6UA 3A99A 3TN8A 4ZJIA 4EH7A 5K4IA 4FTLA 2YM6A 4ZK5A 2BMCA 4EL9A 2VGPA 3RJCA 2PMLX 4KRCA 3QF9A 4YJPA 2QG7A 3ZLYA 3UZTA 3CR0A 3OBGA 3LQ3A 2B1PA 2CGUA 4N4SA 5J7HA 3PA3A 4OAVB 3RKBA 3ATTA 3KRLA 4IVAA 5IA0A 5T6KA 3M1SA 3F3UA 3UNJA 3IOKA 1FGKA 4RBLA 3KB7A 4KABA 4I41A 4L44A 2C30A 4QTAA 4XRJA 1PXOA 4EWHA 2R2PA 5LVPA 2VTRA 4GT5A 3QRIA 2I0YA 3VUDA 3NZ0A 4EEVA 4E6QA 3LQ8A 3GUBA 3CSVA 2HZNA 5AJQA 4GUEA 1OL7A 4ZZMA 4GH2A 4DT8A 2XYNA 1NVQA 2NNWB 4FL3A 2BZHB 4I22A 4AA5A 5HLWA 4I23A 5IQDA 4O91A 4OBQA 3KRWA 5AM6A 4XBRA 3Q52A 3TNPC 4J98A 3CXWA 2GQRA 2IN6A 4TL0A 5CAVA 3QFVA 3VBYA 3E5AA 3QZGA 4IIRA 3W8LA 4FT3A 5GJGA 3H30A 3FXZA 4C7TA 2H9VA 2ZYBA 3EZVA 4EUUA 4QP7A 4NW6A 4JX7A 1OL1A 4HGSA 3CCNA 3ZSIA 2WMXA 2HW7A 4NUSA 2W1EA 1UU3A 5HG5A 4BGGA 4RX5A 3E3BX 1G8AA 2WU7A 5B2KA 3L8XA 4EH6A 4EH5A 4WBBB 3HNGA 3U55A 2UZEA 1ZY5A 1Y6AA 3AC4A 5DRDA 4YTCA 1Z9XA 3GQLA 3IDPA 4I24A 4K6ZA 3DBDA 1V0OA 4HYHA 3VBTA 3BELA 5E8UA 3BHTA 3FMKA 1SVGA 5CY3A 2VO3A 1WZYA 4BIBA 5BX0A 1FVVA 3TDVA 3EIDA 3NMUF 1NVRA 5AUTA 5DEYA 4YPSA 4U43A 4KINA 4M66A 3KL8A 3HGKA 3AD6A 1YI4A 4FIJA 5AP1A 4YZMA 2BUJA 1OL5A 4AT3A 5EM6A 4FVQA 4DTKA 2VWVA 3HRCA 4YNEA 4PNIA 2C6EA 2JC6A 3IW8A 4IBMA 3TL8A 2VAGA 2QOKA 4QPSA 5HICA 5HCZA 3O23A 3T9TA 5HIEA 2FO0A 3A8XA 3KEXA 4AOIA 5AIKA 4PX6A 4HGEA 3Q60A 5FTQA 3A60A 2WTVA 1BMKA 3ORTA 1V0BA 4G9CA 5HIDA 3DV3A 3PVUA 4G16A 2G2IA 3QYWA 1O6YA 4D2TA 5L2IA 3TZ9A 4RFMA 4F7LA 3LJ1A 3QBNA 1A48A 2FVDA 4OTIA 2WMTA 4ACMA 4DH5A 1W82A 3QKKA 2UW0A 3L9PA 3EN6A 3CPBA 3FC2A 4FEQA 4IC8A 2IVSA 4K0YA 3FL4A 2UW5A 4WT6A 3FPQA 1GIJA 3K3JA 4Z3VA 1Q5KA 4S32A 3MFSA 4DEDA 5IA1A 4E73A 2WU6A 3OD6X 1YKRA 2V55A 3A7JA 3MS9A 3R1NA 2X7GA 3LIJA 5DT4A 4G3GA 4AN9A 2Q0NA 4RJ8A 3ROYA 5J5TA 3G6HA 4IM0A 4EJ7A 4ERKA 4HYUA 2HXQA 4IZAA 5ANOA 2W06A 3W16A 4E5BA 3AQVA 4EOKA 3TJCA 3RCJA 4XG3A 4C4JA 4M67A 5TR6A 3R8ZA 4F6WA 1QPCA 1PYXA 2YM8A 4BFMA 2QG5A 4C4EA 3KKVA 4D5KA 2GQSA 3KK9A 3KN6A 3PZEA 2XJ0A 4FV9A 3UTOA 4APPA 3TWJA 2ZV9A 3OOMA 3ZSGA 1SZMA 4OTFA 5HBHA 3IGOA 1CM8A 3LPBA 4GFGA 4QP2A 4IZ7A 2O64A 5BYLA 4C62A 4AZVA 3PSCA 2QOHA 3VW8A 2PYWA 4DF3A 1P4FA 1CDKA 4IW0A 5LCKA 2WQOA 1MP8A 4FL1A 4C4FA 5JFXA 2ZMDA 4QMXA 1BYGA 2WMQA 1OPLA 1JKKA 4ANOA 4BDHA 3TCPA 4XLVA 4X3FB 3ZO3A 3A4OX 1OB3A 4ZS0A 4D2WA 3F2RA 5ACKA 3R22A 3ZO2A 4LG4A 3QKMA 3D2KA 2P55A 4G5PA 1YW2A 3VUKA 4ACHA 2QR8A 2ITWA 4D2RA 3PIZA 4BDKA 3LZBA 2UZBA 4GJ2A 3GI3A 2KULA 1PKDA 3C13A 4FIEA 4IJ9A 3LFNA 2WIPA 3IONA 4H36A 1H8FA 4BDAA 4EHEA 4TWNA 3S2PA 2WXVA 4GV1A 4PMTA 4WA9A 4F1MA 2NRYA 2BHEA 4O81A 2QOFA 5BVFA 3OCBA 4CFVA 4AA0A 4TN6A 3R7IA 4EBVA 2P2IA 3U8WA 3I0OA 3O7LD 5CNOA 3VF9A 4FTNA 3QGWA 2F49A 4AZEA 4QQJA 3MY5A 2BAQA 4NYEA 3BYMA 1F0QA 4EQMA 2C3LA 3FXXA 3O0GA 4X2FA 2FSMX 4CVAA 3ZZWA 1H24A 1L3RE 4I20A 2VX3A 4FKTA 1OVEA 4LV8A 4AGWA 3OP5A 3KMMA 1H1WA 4GT3A 3FHIA 5EI2A 2YEXA 3RNYA 4BC6A 5GJDA 1XH6A 2OF2A 3O7LB 2AYPA 4O7SA 5LWMA 1AD5A 3ZM9A 3DDQA 2C6LA 4CRSA 2WB8A 4M0ZA 3EL8A 4JBQA 4J7BA 4EI4A 4A4OA 2XUUA 4CKRA 4C3RA 2OGVA 3SGCA 1ZY4A 5F94A 3R7UA 3ZOSA 3ID6C 3LFBA 5F4NA 4AX8A 2QCSA 2YAAA 3ZRMA 2OJIA 3NAYA 4X0MA 2QHNA 3LCSA 5ICPA 3VBXA 1IRKA 3B2WA 1GY3A 4LUDA 3NUPA 3BGZA 3ZRKA 4ZEGA 4EHZA 2RFNA 5EK7A 2BALA 1JSUA 5LVOA 2GFSA 5EKNA 4FIIA 1WBSA 5IH4A 5J95A 3RHXA 4YLKA 3WZKA 3NDMA 3GP0A 4ZXTA 5JZNA 3R21A 2WOTA 5BVDA 4R5YA 2H6DA 5IU2A 2PSQA 5AR4A 4KIQA 4RG0A 4DG0E 3FUPA 1IR3A 3R2YA 3VHEA 1BUHA 3TXOA 3ZXZA 4D5HA 1Q8YA 4EQUA 4UB7A 2PUNA 1ZYCA 5AR5A 2C6KA 2W1CA 4MKCA 3REPA 1CKJA 2J9MA 4AW5A 4CV9A 2BRMA 5CTPA 1URWA 3D7TA 4RWLA 4TWPA 3UVRA 4LOQA 4FTOA 3BIZA 1FGIA 3SLSA 3JY0A 4Z9LA 2I0EA 5J7BA 1OITA 4NU1A 5AM7A 2Y0AA 2R3QA 1VJYA 4YZBA 3QWJA 2YCSA 2W1GA 1UU9A 2R7BA 3FMJA 4MNEA 2PMIA 5CAPA 3TUBA 3SG8A 2WEVA 4IC7A 3VQHA 4BKZA 3HEGA 3LQ5A 1T45A 3ORKA 4RJ5A 4YO6A 2XZSA 3GOPA 4L8MA 4WNOA 3SDJA 2CMWA 3R01A 3QQHA 3T3VA 3C51A 5EYDA 4K8AA 3RWPA 3MVMA 3O96A 1Q8UA 4B0GA 3FZTA 5HCXA 1UWHA 3H9FA 3H0YA 3PY3A 5AIRA 1NXKA 5KMMA 3QTRA 5EOLA 3U9NA 1ZYSA 5ETFA 4B9DA 3TT0A 3T3UA 4X6QC 4E6AA 3BYUA 3ZTXA 4D4YA 1M7NA 3P5KA 2VWUA 4O0SA 5C8KA 4JDJA 4LGHA 4JBPA 5DOSA 3QC9A 3PE2A 5HG9A 4E5AX 2WTKC 1SVEA 4KIPA 3JVSA 3KXZA 4NIFB 4RIOA 3PPKA 4BZDA 4YJRA 1YXUA 4BHZA 2QKRA 2YM3A 5CXZA 5GINE 2YDIA 2E9UA 3BHUA 1XR1A 2YJSA 1GAGA 4DFYA 5JN2A 1WVWA 2CN8A 3ZFXA 2HY0A 4ACGA 3I5NA 4N6YA 3ODZX 4FSRA 4G17A 3GEQA 3G0EA 3HLLA 4BR3A 4YZNA 2HW6A 1OI9A 4LRMA 5LMBA 2F2CB 3ELJA 3FZ1A 1W8CA 3EN5A 5DH3A 1JVPP 4CCBA 5I3OA 3FY2A 2LGCA 1QPDA 1YWRA 3EYHA 2PVKA 3P9JA 3GQIA 2IZTA 4QYYA 3PXKA 3EFWA 3UIUA 5AV4A 1PKGA 4F7SA 2B55A 4UV0A 2R7IA 3O8UA 3AT2A 2QURA 1GJOA 3WZDA 1BI7A 4UXQA 4ASXA 1LEZA 3KVWA 4IFGA 5A4TA 1UVRA 2YIXA 3QX4A 4F0FA 4IANA 4X2KA 3JPVA 3HDMA 3W2SA 1IA8A 5J9ZA 5CF5A 4FICA 3MW1A 2B9FA 2W7XA 3FY0A 2R3NA 3LCOA 5IISA 5KMNA 3ZO1A 1OKZA 3FZPA 4HCTA 4JR3A 3TNHA 5BVOA 2FSTX 5L6OA 4USDA 2X4FA 4FKUA 1H4LA 4BCIA 2GHLA 3UC4A 4O1PA 3R02A 2R3HA 5HI2A 1KSWA 3PVGA 5I4NA 5HE3A 5TKDA 3AC3A 4RWJA 3RINA 4Z7GA 2ERKA 3LFEA 3DCVA 2ETMA 2OK1A 3DNDA 4R3RA 4P4CA 1YWVA 4O1OA 3VF8A 3AMAA 2C5OA 4XG8A 1YXVA 2QU6A 4RVMA 4W4XA 1JKTA 4R3PA 4DAWA 5HOAA 3WBLA 2R3PA 4CLJA 5KO1A 3WF9A 1ZARA 2I40A 4HYIA 3PXZA 4BI2A 2WTWA 4AF3A 4FIGA 3TUDA 4IZ5A 2QLQA 2R3KA 4YC8A 3UQGA 4EBWA 4FG8A 3JR1A 4O0VA 2G2FA 5IQBA 5C03A 2QU5A 4ANLA 3ET7A 5A4QA 3I1AA 5ACBC 2QNJA 2GNJA 2XCHA 5DGZA 3TJDA 4PL5A 3EFLA 4I3ZA 5AAGA 3TV7A 4CEGA 3KF4A 4YO4A 1ZMUA 5B0XA 3EZRA 4FSMA 1H1SA 1Z57A 4AW0A 5AR3A 4FTKA 3R7EA 4C57A 4C02A 2HK5A 2OJ9A 1PXIA 5GZ9A 3QTWA 4DC2A 1A06A 2CDZA 2JBOA 1PXPA 2RL5A 3IW7A 3NAXA 3P0MA 3QCXA 5E1EA 3RI1A 1I09A 4EH4A 3W2OA 3POZA 5BPYA 2CSNA 2R3FA 3GOKA 5AUWA 4EKKA 1H25A 5KMJA 2C5VA 2XF0A 4XHKB 3ZUTA 2QONA 5HESA 5AR7A 4LRKA 4AGDA 4BWPA 2W5HA 2GSFA 1MRUA 3U4WA 5B2LA 3PG3A 2X1NA 5L2TA 3TNWA 3RMFA 4C3FA 5K5NA 1Q24A 3HVCA 2C69A 2I0VA 3ANRA 2CJMA 3NS9A 4Q5HA 1OPKA 2XMYA 3BGQA 5GNKA 4ZY6A 2PULA 2OXXA 2OW3A 4D58A 4HVHA 4LQMA 2AC5A 4FZDB 2YERA 4LL5A 3P86A 4FSQA 1R0PA 2ZJWA 4YLLA 3B2TA 4NM3A 2G1TA 4M7IA 3Q2MA 4TNBA 5CT0A 3F7WA 3ZDIA 5B2MA 4GKIA 4EORA 4R7BA 4DT9A 2ONLA 4WNKA 5FDPA 5LXMA 3S00A 4J71A 4MD9E 3R71A 1RE8A 3WZJA 4BTKA 3ZHPC 4TYJA 2QQ7A 4I21A 4RVLA 1P5EA 4O0YA 2IVVA 4UWBA 2EWAA 5CLPA 5JH6A 4D28A 4JT3A 4MXXA 1OIRA 2Z02A 2XP2A 3PY0A 3QCQA 4FTCA 3KK8A 1GZOA 4CFMA 4JDIA 3SV0A 3OG7A 2GNGA 3GU7A 5JRSA 2ZMCA 4YURA 2JIVA 2JFLA 4LFIA 3F2NA 4I4FA 4QMLA 4RJ6A 4LUEA 2OWBA 3I5ZA 1H0VA 3LFSA 4WSQA 1SNXA 3EN4A 4O38A 5CVGA 3VULA 4FE2A 3ZEPA 2F57A 2IW6A 4FGRA 5FTGA 3JVRA 2ITNA 3D14A 3L8VA 5IDPA 4EK8A 3FHRA 3WE8A 4O7YA 4M15A 4LMNA 4ZSJA 3U6HA 2DYLA 2P2HA 3B8QA 4RZVA 4DHFA 5HO7A 1NT2A 3QD4A 3F66A 3KREA 3ZO4A 3VUGA 4BICA 2GS7A 5DYJA 4NKAA 4AQCA 4AG8A 5HORA 1Q3WA 2ESMA 5BYYA 4G3EA 4BDFA 2RG5A 1QMZA 4KIKA 3ZC5A 4X7QA 3AC5A 4XJ0A 3V8SA 4AWIA 4RX7A 4GK4A 2HOGA 4MXAA 4NKSA 4I6FA 4WD5A 4O86A 2OXDA 3P23A 5CQWA 2OJGA 5TOZA 3R8MA 3R0TA 3Q6WA 3QHWA 4YJSA 2Z2WA 2ETRA 3I4BA 1ZZLA 4U41A 2ZM4A 3NYVA 1ZYJA 3KXXA 3WYYA 4B8LA 2WHBA 2PL0A 3EKNA 3PIYA 3MN3A 4F9AA 5AR2A 3TKUA 1KWPA 4UMPA 3GC0A 3II5A 3PWDA 4NCTC 3IKAA 5AUVA 4Q9ZA 5IA3A 5IPJA 2UZUE 3V5JA 2BVAA 5IMEA 2CN5A 3OC1A 3ORMA 2FSLX 5ANEA 4GK2A 5AP5A 2J5EA 2X4ZA 4MWIA 4WNMA 1YOMA 1VYZA 4FGBA 4ZIMA 4FODA 5EYKA 1MQBA 1UWJA 4FV0A 4O27B 4DEBA 3KXHA 5CT7A 5DR6A 3BGPA 1E9HA 4QMWA 2JKMA 3QX2A 2YA9A 1IAHA 1O6KA 3FYKX 2JAVA 1OPJA 3MIAA 2JDRA 2PY3A 4C33A 3V5PA 5JFSA 1XBAA 4LMUA 3FI2A 2VWBA 2ETKA 4L53A 4PMSA 5HKMA 3FLQA 4BDDA 5K0XA 2BKKA 2W5BA 1Q4LA 2W1DA 1YHVA 2BKZA 4QQ5A 3UODA 4F9CA 2E9NA 2IO6A 1JSTA 1JOWB 5CVHA 4CLIA 3FLYA 2WPAA 3D5VA 2UW6A 3MIYA 2DS1A 1REJA 3R7VA 3PVWA 3O17A 4HVSA 4EKLA 1JBPE 4IX5A 3TM0A 4B4LA 4PNKA 3ZH8A 3RAIA 4G3FA 5IEYA 5FM2A 1S9JA 4J96A 4R3CA 4O2PA 2WAJA 5L3AA 3CJFA 4EOQA 2W1FA 1XH8A 4XG6A 3FSKA 4TRLA 1OL6A 3UPXA 2B7AA 3ALNA 2X2MA 3I6UA 4FT5A 3D4QA 2IG7A 3I7BA 4MBIA 2XIYA 3BKBA 3CP9A 3DT1A 3PY1A 2UW3A 3BYOA 3RK5A 5EW3A 4E4NA 4TNDA 5JGAA 3PVBA 1GZKA 2RF9A 2UZDA 5E8WA 5KHWA 4XCUA 3R00A 1LR4A 4R1VA 3HAMA 2WTDA 3D5UA 4MH7A 3W32A 3DAJA 4FKPA 4YPDA 4DTAA 3KRXA 3S4QA 3DLSA 2VTLA 5L4QA 4JRVA 4L67A 4TWCA 4DEGA 3DAEA 2ZB0A 3QRJA 4ZSEA 5DT3A 3VO3A 4JQEA 4E26A 3MPMA 4RGJA 4F7JA 4IWQA 3FKOA 4ALVA 4UZHA 4AACA 3VBVA 1ZYLA 3A7HA 1WVXA 2J2IB 4L3PA 4MQ2A 3DDPA 2JDTA 4Y46A 5DIAA 3O51A 3EFKA 1TQIA 2IW9A 2J4ZA 3Q4ZA 3MJ2A 5J87A 2IWIA 3NIZA 2CPKE 1OKYA 4N70A 4FV6A 4U3ZA 4LI5A 3RPVA 3SOCA 4WG4A 5DA3A 3MY0A 2R0UA 3RAWA 1M2PA 2C0OA 4V0GA 5DLSA 5M57A 3S0OA 4BKJA 1QL6A 5FXRA 4R5SA 5D12A 5EFQA 3ZBXA 3ZRLA 4GK3A 1Y57A 1J3HA 5HVJA 5CZHA 1JKSA 1OKVA 4I93A 4P2KA 3MWUA 2P0CA 3LXPA 4CFXA 4XV9A 4D2PA 3QQUA 3E7OA 5D10A 1WBNA 1PXNA 2HIWA 3VS5A 4EOSA 4YBKA 5BMSA 4WRGA 4YZDA 4YTFA 4HJOA 3BHYA 3OW3A 4DA5A 5C4LA 5M44A 2WTJA 5KX8A 3AT4A 3EQRA 2WKMA 4IHPA 5A54A 3A61A 1U54B 4IWOA 4PTCA 4CTCA 4QQCA 2XK3A 4H3QA 3KN5A 1J1CA 1TVOA 2W96B 3DK7A 3P79A 4WBOA 4I5CA 4FEUA 3E93A 5E91A 3KC3A 4ZAUA 2VZ6A 4HOKA 3TZ8A 2VGOA 3HMNA 4FKRA 3BLRA 1XO2B 2WQNA 1PXMA 3U51A 5K9IA 4IVCA 4LL0A 1MUOA 2W1IA 3OY1A 3LE6A 5AP0A 3G5DA 5EDRA 2UVYA 5EQYA 1P4OA 2UZOA 4PDSA 3FKNA 4JNWA 2GHMA 4I1ZA 3VC4A 4OBPA 2BIYA 5ANKA 3ZXTA 4FOCA 4MWHA 2I6LA 3E88A 5E4HA 4XLIA 1H01A 4FSZA 4X21A 3EQCA 4QPAA 4YZCA 4C3PA 2GTNA 4DEIA 4H3BA 4DH7A 3M11A 3MYGA 4CZYB 2GCDA 3UIMA 3E63A 3IK3A 3R2BA 4AOTA 3PIXA 2X6DA 4MBLA 5IQAA 2W4KA 5EHLA 3LW0A 1U5RA 4CKIA 4NZWB 3HAVA 4QMZA 4ZMEA 2PVRA 5CSPA 3CIKA 4FV5A 3QCYA 4IACA 5H9BA 1KE9A 3L9NA 1APME 3TEIA 4HCVA 5G1XA 4E20A 3LCTA 2Y4IB 2F7XE 2W9ZB 3NYOA 4GRBA 1Q8WA 2X8EA 3TDWA 4G1WA 2XK9A 2W9FB 4G2FA 4EOMA 4LOPA 5H8EA 5HBJA 3GU5A 4M84A 3MB6A 5D7AA 1MQ4A 2O65A 3D83A 3D0EA 4CG9A 4ZJJA 1IASA 5LOHA 3LKMA 3Q4TA 5IQEA 3FMEA 3NUYA 4BN1A 5HQ0A 2VTAA 4C4GA 4AZTA 2P3GX 4D2SA 2A27A 3TKHA 3Q32A 3H0ZA 3PJ8A 5DMZA 4BKYA 2ZV7A 3DBCA 1YI6A 4JDHA 5DR9A 3SVVA 4W4WA 4XG2A 3L1SA 5KCVA 4NIFA 5CF4A 2OG8A 3EQFA 3R6XA 4CSVA 1FQ1B 3L8PA 3NUAA 1ZOGA 3DFAA 2J5FA 4CRLA 4BGHA 5CQUA 1ZZ2A 1R3CA 2F9GA 2QOCA 3C4CA 3COKA 2XA4A 2QO2A 3HA6A 4KIKB 4LGGA 4YHTA 1GIHA 3NNVA 5A6OA 3HV3A 5IA2A 4ZSGA 3RBWA 2GFCA 4J99A 3UGCA 3RHKA 3V6RA 4FBXA 2RKUA 2FSOX 3KCFA 3ORPA 5IUGA 2VNYA 5EW8A 5IF1A 4BVUA 4YZ9A 3BQRA 5J1WA 3OVVA 4B99A 4RZWA 4FOBA 2QC6A 4BCMA 4OAUC 2V62A 2R9SA 4YC3A 2R3LA 4ZTLA 3F61A 4HGLA 3QLGA 2PZIA 5I9VA 4B6LA 2ZVAA 1Y8GA 2VTJA 2RFEA 3BYVA 2XK4A 4FYNA 2C6DA 4OW8A 3C4EA 3MJ1A 4BI1A 3QZFA 1J7UA 4ANNA 3SQQA 3AGLA 1Q61A 4FKOA 2ZV2A 5BQ0A 5FEQA 5FLFA 2WMWA 4UXLA 4BCKA 5BNJA 3MFRA 1DS5A 3DLZA 4IX3A 2VWZA 4ANMA 5LJJA 5AUZA 4CXAA 2YITA 3LMIA 1B39A 2FH9A 4F9YA 5HG8A 2IW8A 5H3QA 3FZRA 4ARKA 4D4SA 3RWQA 3OW4A 4NEUA 4EK5A 2CGVA 4AW2A 2NPQA 5JT2A 4IE9A 3D94A 5IZFA 3HP5A 1WAKA 4L43A 1WVYA 4BBEA 4B8MA 3IG7A 3FMLA 2PVNA 3C5UA 3OUNB 3QUPA 3PP0A 4QOXA 4O22A 5CEMA 4J97A 1YVJA 1H07A 3L9MA 3FBVA 2B9JA 4FNXA 5E8SA 5HG7A 3UG2A 2UZNA 3ORNA 3A8WA 2VNWA 3PE1A 4MX9A 3UO5A 3NW6A 5L2WA 5ANGA 4RX8A 3VUMA 2XK7A 3DZQA 5AX9A 3LMGA 3JYAA 3E8EA 4FV8A 4DCAA 4DGGA 5CENA 2BROA 3UZRA 3KULA 4IB3A 3TG1A 4FSUA 3UMWA 4MNFA 2QI8A 4ID7A 4K77A 2XM9A 2VUWA 4OGRA 3TV4A 4EK6A 5EQEA 2BIKB 4F65A 1YDRE 3ZYAA 2JD5A 2BDFA 2BHHA 2XNMA 3QA0A 4FV7A 4MTAA 4U8ZA 3UZPA 2PPQA 3DXNA 4BDGA 4BCHA 3LOKA 5BMMA 4BRXA 4BWXA 5A46A 5ITAA 4YSMA 2I7QA 4QTDA 2UZVA 5JFWA 5FG8A 3F2AA 5K5XA 2IJMA 4QMQA 4G3DA 4RLLA 1Z5MA 2BFYA 4S30A 4L42A 4BHNA 5F20A 4KRDA 4GIHA 2F2UA 3KXGA 4EYMA 3KFAA 4F9WA 3Q96A 5CU0A 4AW1A 3VNTA 2A4LA 2BAJA 1PMUA 2WGJA 2H96A 4F0GA 2PHKA 3EQIA 1W84A 4FTUA 4TWOA 3KXNA 4FV1A 5D7VA 3EQPA 3PA4A 4H1MA 2IZSA 2WTIA 3NUNA 2O0UA 3HKOA 5EHYA 2VTOA 2CHLA 3LJ2A 2UVXA 3MVJA 3MY1A 4BI0A 3PLSA 3FLSA 3IECA 3FMDA 4FK3A 2B0QA 3COMA 3RP9A 5IA5A 3PSDA 3WI6A 4RWKA 4RWIA 3FC1X 2YM5A 4XEYA 4IAAA 4XV3A 4BYIA 4DGMA 2YABA 4QMVA 4ACDA 2WD1A 3PJ2A 3KQ7A 4J52A 3DJ5A 4EOJA 2BRNA 5EYCA 4JLCA 2V5QA 1IG1A 3DK6A 3HECA 4WNPA 4Y95A 3FMMA 4V0GB 3U54A 1Q8TA 2PZPA 1STCE 3E87A 4CKJA 1B6CB 4M69A 3R9DA 2XNOA 2GQGA 3I60A 2BRBA 5CF6A 4R1YA 2C4GA 5I0BA 2VWWA 5AA9A 5M53A 5AA8A 1J7LA 1VEBA 3MGYA 3V8TA 3HDNA 4QYGA 5J5SA 4AFEA 3L8SA 3E92A 4USFA 5L6WL 3HV5A 4RFYA 4AS0A 4P7EA 1LPUA 2E9PA 3THBA 4W4VA 3LCDA 4ZMFA 1X8BA 4RA5A 2UW7A 4WKQA 4ITHA 4NJDA 5L8JA 3RAHA 4EQCA 3I7CA 3MTFA 4OT5A 4OTPA 4TXCA 4E4LA 2I0HA 1O6LA 1Q3DA 4GFOA 4O7NA 2G15A 3BZ3A 1JNKA 3GCUA 4XBUA 5FWKK 4UYAA 3V5QA 1BI8A 4O82A 3ZS5A 4C4IA 4C36A 2PVLA 3D7ZA 5AADA 4U0IA 4K2RA 3EFJA 4G9RA 4DLIA 4DGNA 5C8MA 3UQCA 1DI9A 3NEWA 4QP1A 4TY1A 3E8CA 5KZIA 1ERKA 4JBVA 4F99A 5HCYA 4BDIA 4ZSLA 4ZS4A 3BWJA 2G9XA 4RFZA 4W9WA 2RFDA 3ETAA 3GVUA 2BAKA 3ENMA 3R28A 3PZHA 4JQ8A 1ND4A 4ANQA 2J0MB 1WBTA 5FP5A 4FF8A 2EVAA 1PYEA 4QP6A 2J0KA 4IAFA 4LRJA 2WFYA 4ZOGA 3E7VA 2PWLA 4IAZA 3TTJA 3Q4UA 2PMOX 5JMSA 4OTGA 3BBTB 3NNWA 3FDNA 5KE0A 3M42A 3T8OA 1PMNA 5CU3A 2QKWB 3RPRA 2R3JA 5J9YA 3FAAA 2B4SB 4XOZA 2G2HA 1Y6BA 4MD7E 2YWVA 3W33A 2W1ZA 3CTJA 3OF0A 4ZTRA 4EOPA 5IEVA 2OFUA 2X7OA 3NCGA 4AZWA 4IDTA 1M2QA 4NW5A 4FA2A 1UKHA 1M52A 2XJ2A 4OTHA 3UOLA 3GFEA 4U6RA 1SVHA 5EI8A 4PQNA 1R78A 3V3VA 5KMOA 2A19B 4R7HA 5KBRA 1G8SA 2B54A 3DKOA 4K33A 5IUIA 4BB4A 5AX3A 3VS2A 2J0JA 3CEKA 3FXWA 3BCEA 2XK6A 5HTCA 1H1PA 5KBQA 4YTHA 1DAYA 2H8HA 5BVKA 5J9LA 4AGCA 2Y7JA 3FLNC 4GS6A 2XIRA 2XM8A 4AGUA 1M7QA 3PTGA 4FMQA 3BV2A 4FZAB 2HZ0A 3V5TA 2ZDTA 3DY7A 3MFUA 3R04A 4K9YA 4MXZA 4OTWA 3KU2A 2BILB 1QCFA 2CLXA 4G6LA 3RZBA 4FV4A 5E1SA 4DFBA 2R4BA 3NW5A 3NNUA 4MF0A 2OIQA 3R1SA 3QUEA 1H08A 5KKRC 3F5XA 5GHVA 4NH1A 1UNHA 4L9IA 3VS0A 5IQGA 5M51A 4IFCA 1LP4A 5FGKA 4CGAA 1ZAOA 3GB2A 1Q62A 4TYGA 5D1JA 3CQUA 4ZTQA 4DG2E 3OEZA 4N6ZA 3C4FA 4DBXA 5DWRA 4JR7A 3OFMA 3V6SA 4DH3A 4H39A 4Y5QA 3W55A 4FL2A 1K3AA 4A9SA 3PXFA 2Q83A 2GPHA 1UV5A 2QOQA 3COHA 4TYHA 5IQIA 3MFTA 4I0TA 4WOVA 4XV2A 4EH8A 5B7VA 4EYJA 4MK0A 3SW4A 1UNGA 1KV2A 2P4IA 2VO7A 4NTTA 3AD5A 3QQJA 4LM5A 1UU8A 4MXYA 4L7SA 4KBKA 3UIXA 1JLUE 4YGAA 4C61A 1XWSA 4J53A 5FXQA 4YJUA 4USEA 2ITVA 3QL8A 4AU8A 4WSYA 5FP6A 2A1AB 4M13A 4RIWB 4UZDA 4FT9A 3EL7A 4V05A 4RMZA 2C5YA 4ZTSA 3RNIA 5BVWA 2XKFA 4J8MA 2GS6A 1GZ8A 3JUHA 5CANA 5D9HA 4MVFA 5JEBA 2XBAA 3NRMA 4QMUA 4QYEA 4AE9A 4YTIA 1YWNA 3NVKI 4IX4A 4V01A 3VJOA 1EH4A 3S95A 4IXPA 3TI1A 4QT1A 5HVKA 1GOLA 1ZMWA 4RQVA 3UG1A 3BI6A 4ZY5A 1KE5A 2W4OA 3OXIA 1CKIA 2ZV8A 2FA2A 4ZP5A 5AUXA 2DUVA 3KGAA 3R8VA 3IS5A 3SOAA 3IGGA 4G31A 4Z55A 4QMYA 4FT0A 3F3WA 5IH5A 4QMTA 2C3KA 4K18A 5AV3A 3VBWA 3TZMA 2JDVA 3PJCA 3N4UA 5M08A 3F3ZA 1YOLA 3KULB 3WZEA 4AZSA 5C1QB 3BU3A 1SMHA 4K11A 2ZOQA 4RIYB 3R1YA 1XBCA 3NNXA 4FV3A 4PUZA 3LVPA 2XYUA 4YBJA 2JDOA 3LFFA 4PPAA 4UMRA 2GDOA 2XNBA 2WIHA 3HL7A 1FMKA 3O8TA 3R8UA 3UE4A 2VRXA 5GIOE 3TIZA 1GIIA 4D0WA 3QXPA 4O0TA 4ZLZA 2YM7A 2Z60A 3MH2A 2QODA 2F4JA 2BZKB 2WQBA 3EOCA 3QYZA 1U54A 3TUCA 4FKJA 2QOOA 4S31A 2YCFA 3EYGA 1SYKA 3I81A 4KA3A 5AWMA 3QD2B 4BCPA 3CGOA 4HW7A 3OWKA 3NCZA 3KRJA 3KCKA 2GMXA 4D9UA 4E4MA 2ERZE 3CE3A 2YIYA 3A62A 3ZLSA 4KS8A 2JDSA 3EJ1A 3H9OA 4FSTA 3GENA 4RJ3A 1JQHA 4BWKA 3DFCB 3VBQA 3IW6A 3LLTA 2XIZA 1PXKA 3MV5A 1V0PA 4EC8A 2GU8A 2YM4A 3PDTA 4U79A 1UNLA 3P7AA 3QZIA 4RSSA 4ITIA 2VTHA 4AA4A 1ZWSA 2W17A 3FPMA 5AP2A 3G9NA 4FTRA 4CNHA 2XH5A 5FQDC 3NYNA 4OBOA 1OBGA 2YLEA 3DBQA 3LLAA 5E9EA 4WIHA 4QYHA 4JAIA 4HVIA 5JQ8A 4MQ1A 1Q97A 4NFMA 4M69B 4AE6A 2OBJA 4JI9A 3FV8A 3HRFA 3PSBA 2C0IA 1J1BA 2C6IA 2Z7RA 3C0HA 3NPCA 4QTEA 3FEGA 3QD0A 5HX6A 3ORIA 4ASZA 1KUTA 2YIQA 3CTHA 1CKPA 4CFNA 2ITTA 1KE8A 5M09A 3E62A 3FJQE 2XIKA 3VW6A 4A7CA 4AOJA 4BCGA 4BCFA 3NUUA 4U44A 4WG5A 2XCKA 3WF5A 5FD2A 5LVLA 1R1WA 1OECA 1KV1A 3DQXA 3HYHA 4B7TA 5ETAA 5DPVA 3SXRA 1JSVA 2VTSA 4CFWA 2J7TA 2UW8A 3MB7A 4F70A 3QCSA 3RGFA 4DE4A 3R7YA 2ONLC 4X2JA 3O71A 1URCA 3ZEWA 5J8IA 3G33A 4FSNA 4CT1A 4ZTHA 4G5JA 3BWFA 3DNEA 4C2WA 4GJ3A 1KOAA 2PVHA 4XP2A 3PPZA 3GCVA 3WYXA 3W8QA 2EB3A 2HAKA 2FB8A 4IB5A 4LOOA 4QO9A 3TKIA 4ZZNA 1AGWA 3L9LA 4YJQA 5FEEA 1W98A 3QA8A 4LV5A 4O21A 1M14A 4FKQA 4S33A 4DH1A 3H3CA 4QNAA 3VS7A 4CFUA 3BE9A 2ITUA 1PHKA 4HNFA 4F1OA 3C9WA 1OL2A 2VX0A 4DLJA 1JKLA 3AG9A 4RA4A 4PL3A 5TO8A 4DYMA 4NCTA 3GU6A 4ONAA 4FKSA 2B9HA 2PE1A 3WE4A 1XH5A 3NUSA 3OROA 4ENXA 4N57A 4V04A 3QTSA 4R6VA 3V04A 4I94A 4FTMA 1IEPA 4APCA 2OKRA 3BU6A 4PMMA 3C4XA 4KAOA 2V22A 5AAEA 5HX8A 3NW7A 3Q5IA 5LMKA 2YDJA 3DBEA 3A4PA 2WTKB 3BEGA 4ITJA 4CQGA 3GCPA 3AC1A 4C35A 1FVRA 4D2VA 5CI6A 3BE2A 5J1VA 3M2WA 4F63A 1XH4A 2GHGA 3DA6A 4PTGA 1DI8A 3RALA 4ASEA 4EOIA 5I9ZA 2PK9A 4RC2A 4F9BA 5KMIA 3SRVB 3SW7A 4ASDA 3EHAA 4L01A 3CKWA 3KA0A 4HPUE 4OUCA 5CALA 4PDOA 3ZUUA 3E8DA 3QLFA 4FK6A 4E5WA 2VD5A 3QTZA 3ODYX 4DITA 2RGPA 4MXCA 2WQEA 5BYZA 4H58A 2PUIA 3SC1A 4U40A 2EU9A 4HPTE 1WBOA 4FSWA 5JZJA 4RVKA 3FKLA 4O83A 3PUPA 3O8PA 4O0UA 5FRIA 3GC8A 5CEOA 5EDPA 3VIDA 4Y73A 5HLNA 4TYHB 1Q41A 3ZFYA 4JRNA 4UEUA 4XP3A 5EH0A 4Q2AA 3OWPA 2C47A 3GC9A 4GMYA 2OZOA 1PRYA 5IEXA 2FGIA 3OZ6A 3Q5ZA 5L8LA 2WELA 4U7ZA 3R30A 4JQ7A 5AFVA 4Z7HA 1K2PA 5KMLA 5EM7A 3U6JA 1W83A 5CSVA 4JG7A 4QRCA 4DFNA 2SRCA 1KE7A 2O3PA 4ZZOA 3PXRA 2IZRA 4IJPA 4RX9A 5GIPE 4A9UA 4JS8A 4KKEA 3CD8A 3HMPA 4M97A 2NO3A 1VZOA 4AXAA 2YWPA 4XG4A 3R7GA 1IA9A 2WMUA 5CZIA 4FTIA 4JL9A 4E7WA 2YN8A 1UU7A 5CYIA 2R5TA 5HBEA 4Y72A 3OCGA 4KS7A 4CCUA 2PMNX 4EK3A 4M3QA 5HEZA 3C5IA 2WEIA 5E8XA 1FMOE 1W7HA 4F08A 4HZSA 3FLZA 4JXFA 1YQJA 5CSWA 4X3FC 1G5SA 3F82A 3CS9A 1TQPA 4QQTA 4PF4A 2W0JA 5DE2A 5M55A 3W2QA 3DS6A 3MVLA 4S2ZA 4PV0A 2GTMA 3QTUA 4GCJA 4JJRA 3UDBA 3EN9A 1HCKA 4NM0A 2VO6A 4CZUA 5C26A 4GL9A 4NT4A 5IA4A 3ZBFA 2IZUA 4FKIA 5AP7A 3CLYA 2WMRA 5AV2A 1RJBA 4WO5A 3UJGA 2YCQA 4YMJA 4U3YA 4UY9A 2BZIB 5DBXA 3RVGA 1YDTE 2XRWA 3RTPA 5E8VA 2LAVA 5EDQA 4Y85A 1TQMA 2QOBA 2YISA 3OT3A 3ZZEA 5L2SA 4BTJA 5F9EA 3LXNA 4DFLA 3G2FA 4IAIA 3OUKA 2BFXA 3QUDA 2OI4X 5CF8A 2HELA 3QXOA 3EWHA 2O63A 4NK9A 4I5MA 2QLUA 4EZ3A 1OMWA 4O6LA 4C4HA 3MI9A 4C37A 4L3LA 4GSBA 4L00A 3GCSA 1V1KA 5ETCA 5IDNA 4KB8A 3EQGA 2XEZA 3PA5A 2ITPA 4CV8A 3G0FA 2XNEA 3G6GA 4CYJA 1YOJA 1OIUA 3R8LA 2ZB1A 5LMAA 3R1QA 3B8RA 1UA2A 3DJ6A 3FWQA 4DFXE 4EH9A 4RVTA 3DTWA 4BDBA 5HE0A 5DRBA 3ZC6A 4R8QA 5HVYA 4YJTA 2R3GA 4JIAA 2CNVA 3G15A 4O0RA 1OM1A 3VWAA 4GG5A 1YHSA 1R0EA 3R9HA 2E9VA 5A14A 3QALE 3Q9YA 4IX6A 4E6DA 1OZ1A 2AC3A 2G01A 1YRPA 3PRFA 4KSPA 4ZTNA 3WF6A 3UVPA 4GU6A 2JGZA 3VVHA 2BTSA 3ULZA 2J51A 2VTIA 3R83A 1K9AA 3NLBA 3QWKA 1KE6A 3BU5A 3IW4A 1VR2A 3QU0A 2BRGA 4MYGA 4HCUA 5IKWA 1PY5A 3R9NA 4HNIA 1MRVA 5AP4A 4BY9E 2YDKA 3F3TA 5E8TA 4CYIA 5CEKA 4FT7A 2ITZA 5IUHA 5JFVA 2OICA 4FNZA 1WCCA 3QAME 3CBLA 3OS3A 2RSVA 2XK8A 3OEFX 2CKEA 3QRKA 3GBZA 4MD8E 4NJ3A 4YHJA 3W2PA 4M0YA 3HZTA 4JG8A 4F6UA 4XX9A 3OWJA 2CNUA 2BDJA 4YP8A 3H4JA 4E8AA 3Q9ZA 3TV6A 4MAOA 3MBLA 2J50A 2XKDA 1W0XC 1H1RA 4EHVA 3I79A 4ERWA 2BCJA 2X8IA 2XIXA 4Q5EA 4D1XA 5C27A 4AP7A 5CAQA 2PE0A 4FG7A 2UVZA 3TTIA 4PPCA 5L6PA 4C34A 2X2KA 3AT3A 4XOYA 1UKIA 1OIQA 3VS4A 1PMEA 4ANBA 3K5VA 5EW9A 3W2CA 5EQPA 5CNNA 3COIA 2OF4A 5HNGA 1ZXEA 4FZ6A 4O7TA 5FXSA 3DGKA 4F1TA 2CCIA 1BL7A 5CWZA 1OUKA 2QD9A 1HCLA 1REKA 3KMUA 3PJ3A 5TE0A 3DKCA 4FIHA 3Q4CA 3GC7A 2WMAA 5HZNA 3A7IA 4OLIA 3Q53A 4D1SA 1E1XA 2PUUA 2Y4PA 2EUFB 4WG3A 4DGLC 2PZRA 2OJFE 5M07A 3HUBA 3N9XA 4QP9A 3N4VA 2R3OA 4M8TA 1KOBA 3MSSA 1B38A 4NM7A 4O6EA 5A4LA 3ZONA 3I0QA 3HV7A 4J95A 3OWLA 4BZNA 5FM3A 3E8NA 4EOOA 4W9XA 1XKKA 3PXQA 4PPBA 2OXYA 4G3CA 5HTIA 3UOJA 1F3MC 1FVTA 4RIWA 2QHMA 3SHEA 2H34A 4D55A 5CXHA 1U5QA 4H3PA 3VUIA 4L6QA 3W10A 3DB6A 3Q04A 3SD0A 1PMVA 4Y8DA 4C0TA 5JGBA 5LVNA 5E90A 2ITOA 3FLWA 1Y91A 4LYNA 2OO8X 2VWYA 3SKCA 3NYXA 3H10A
chains in the Genus database with same CATH superfamily
4FKGA 4QMSA 2XNGA 2VO0A 3VRYA 4O84A 3U87A 2HZIA 2KTYA 5CI7A 2VTMA 3Q9WA 4D9TA 1SM2A 5KZ0A 1ZLTA 5LWNA 3A7FA 4XUFA 5CSHA 3VRZA 2YACA 5JK3A 2OZAA 3HA8A 5L2QA 3ORLA 4RT7A 4BCOA 5A6NA 3MVHA 3UNZA 1VYWA 4WRSA 4I92A 3FMNA 2OIDA 4DHIB 4FUYA 2PE2A 3CTQA 3GU8A 3ERKA 4RIYA 3R7OA 1GZNA 5BUJA 2PUPA 3DB8A 2ZAZA 2C0TA 3OY3A 2OFVA 2E9OA 5TT7A 3KXMA 3SG9A 2X0GA 1NY3A 3QRTA 4ZLYA 5KUPA 2VWXA 4GU9A 4JOAA 5FBNC 3BPRA 3F69A 5AUYA 4C58A 4QMPA 4XNEA 2C6TA 4ANSA 4ZLOA 5CX9A 4R7IA 5E7RA 2DWBA 2PVMA 3KF7A 3IOPA 3CQEA 3PJ1A 1DAWA 4RJ7A 3V01A 4KD1A 5GZ8A 4DFUA 1JWHA 2Z8CA 4GEOA 4RRVA 2XRUA 4FKVA 4X3JA 2IPXA 4J8NA 5JSMA 4CMOA 3D5WA 4RC4A 2F7ZE 3SAYA 4DG3E 3VS1A 3F9NA 3K2LA 2ITXA 3O50A 2W4JA 5GJFA 1BLXA 2WMVA 3TNQB 2RG6A 3S3IA 4A9RA 5C4KA 3FYJX 4QP3A 3P4KA 3ZMMA 1RDQE 4L45A 2X2LA 3C50A 2X81A 5I9WA 4GFMA 3CD3A 4BTMA 1H26A 4FNYA 3RAKA 4OR5A 1WBPA 2XANA 5DT0A 4DINA 2A2AA 4IAYA 4U45A 5LARA 1SNUA 3MPAA 3HX4A 4KUJA 2PVJA 5H8BA 4IB1A 4EWQA 1ZRZA 2J0LA 3PG1A 5KMKA 2O2UA 2UZWE 5EM8A 1H1QA 2V0DA 2VU3A 3QKLA 3N4TA 5CEPA 1H27A 3G90X 4Z16A 3EH9A 3MPTA 3UNKA 4UN0C 3MH3A 4FKLA 4UYNA 3VUHA 4YC6A 4BGQA 1NA7A 4QD6A 4EH3A 4EK4A 5LQFA 2R0IA 2X9EA 4QP4A 2X8DA 3D9VA 3G51A 4BYJA 4KSQA 3UDZA 1G3NA 3NGAA 2UW4A 4GG7A 2C6OA 4NSTA 1WMKA 5M4FA 4TTHB 3UQFA 2OU7A 3U6IA 4JG6A 2BPMA 3FZOA 4IEBA 4LGDA 4E4XA 3EMGA 3AOXA 3MESA 4QMMA 4FTJA 4D4VA 2X6EA 1NVSA 4CFFA 3EN7A 4JVGA 5I9XA 3PLAE 3QHRA 4XS2A 3S1HA 4MF1A 5LVMA 3WF7A 3OTVA 4WUAA 1H0WA 2Y6OA 2C3IB 5C01A 3P7BA 3UMXA 4CZTA 2W05A 5ANIA 2UW9A 4DFZE 1F5QA 4JAJA 5IMXA 3AXWA 2WQMA 4XG9A 3LXLA 4O7ZA 2PVFA 3HP2A 2BDWA 4II5A 1XH7A 3V51A 3VHKA 3ALOA 3KY2A 5E8ZA 2BR1A 2Y8OA 3SX9A 3UP2A 3LMHA 1XJDA 2J90A 3OOGA 5TF9A 2V7AA 4MXOA 3WILA 4DBNA 4HVGA 4W8EA 2R3RA 1FINA 3NIEA 4P90A 4D4RA 1H28A 3C1XA 2A0CX 1ATPE 4FIFA 2CGXA 3LAUA 3DQWA 4U42A 3RPYA 4BIDA 3GFWA 2XKEA 3C7QA 4Q9SA 4AAAA 1RQQA 3ZLWA 3MA6A 4FNWA 4P5QA 1CSNA 5HLPA 4S34A 4OTDA 2GS2A 2YAKA 5EI6A 4JBOA 1JPAA 4PL4A 4ALUA 3FQEA 2WZJA 4E1ZA 3BL7A 3BBWA 3RZFA 3C0IA 2JITA 1PXLA 5M4IA 4UALA 3DTCA 5HNIX 2W5AA 2YZLA 2JLDA 5I9YA 4L7FA 2CLQA 4GIIA 2XB7A 3LFAA 4O0XA 2XNNA 2WMSA 4XRLA 4ZY4A 3NWWA 3BX5A 5AP6A 2VWIA 3BLQA 3OCTA 3MH1A 3T9IA 3IDBA 3LHJA 3JXWA 3DOGA 4GT4A 4N0SA 3IDCA 3A2CA 2Y9QA 5D41A 3HV6A 4CMTA 4RLKA 4BF2A 4YR8A 3OCSA 4F7NA 4CTBA 2J6MA 2P33A 1YDSE 3R63A 4IM3A 1FOTA 2EXEA 3SRVA 4AT5A 5HU3A 4I5PA 3BL9A 4O0WA 3OTUA 5ANDA 2YIWA 3BQCA 5FEDA 3PP1A 4F4PA 4RJ4A 5FBOA 4H05A 2F7EE 3CY2A 2X7FA 3UVQA 3UYSA 1QPEA 1OGUA 3MH0A 1FPUA 5AP3A 5IG1A 4YU2A 1U59A 3UC3A 4PTEA 4IMYA 4K1BA 4O4FA 1P14A 3VUTA 2XVDA 3H9RA 2PVYA 4NM5A 1P2AA 4EOLA 4KNBA 2HY81 3WIKA 1OBDA 4A4XA 4TYEA 4HZRA 3UIBA 2C1AA 4IVDA 5BUIA 1YI3A 3W18A 3UPZA 1J7IA 5FTOA 3DXQA 3GT8A 3A7GA 5G6VA 2XNPA 5HD7A 3I6WA 3U9CA 3DU8A 2WNTA 4M68A 2JAMA 1LUFA 2B53A 5K0KA 3VJNA 4IH8A 1XHAA 3E3PA 3QQLA 2YZAA 5CVFA 5HTBA 4D1ZA 4EONA 1H00A 2QOLA 4FTTA 4A9TA 4U9AA 4FKWA 2HENA 3FI3A 2C1BA 4ENYA 4TT7A 5BVEA 3DKGA 4GVAA 4YNOA 1ZYDA 3FL5A 4O96A 5AEPA 3DAKA 1PF8A 4FC0A 3QC4A 5K4JA 1E1VA 1HOWA 4E6CA 2CKOA 4DEEA 4QTBA 5CS6A 5DFPA 2HCKA 4UBAA 4UX9A 2YCRA 3PRIA 3DK3A 3ZUVA 5H2UA 3ORZA 5AV1A 4NFNA 3UP7A 4GKHA 4BTFA 2PU8A 5CEQA 4DEAA 4IAKA 2JKKA 5DEWA 5HGIA 4QMNA 2OZAB 2HXLA 4E3CA 5JGDA 5A4EA 2NP8A 4F0IA 3WOWA 3K3IA 2Q0BA 3VQUA 4KBAA 3BEAA 4CD0A 3IW5A 2PZYA 3AMYA 3AD4A 4FVRA 5M4CA 4DCEA 3OXZA 4YLJA 4C8BA 4J1RA 4DEHA 4RQKA 4I6QA 2JBPA 3C0GA 4QP8A 2XS0A 2QO7A 4O7RA 4R78A 5IQHA 4W4YA 4YJOA 5DNRA 2QR7A 3HMOA 4JIKA 5CAUA 4FEVA 3NR9A 3IO7A 4UMQA 5EM5A 4BIEA 1JAMA 3FQSA 4QYFA 4RIXA 4O2ZA 4XV1A 3U4UA 2VTTA 2E2BA 3EB0A 4BDEA 4EUTA 3D5XA 3QGYA 3F5PA 4I6HA 4IQ6A 4UWYA 2Z7QA 3HMIA 4RPVA 1WFCA 4UWCA 4G6OA 3UBDA 2GNHA 4BBFA 2NRUA 3ZLXA 1Q8ZA 3VAPA 5I5ZA 4UMTA 2HWOA 4EZ7A 5EHOA 1TKIA 2JIIA 1FBNA 2CCHA 3LFDA 1Q99A 3BHVA 4ORKA 5DG5A 1YHWA 3QQFA 3KVXA 3ZCLA 2DQ7X 4AUAA 4YSJA 4TZRA 4MHAA 3VS6A 5JKGA 4X2GA 3OHTA 5CSXA 4EHGA 2OH4A 4GUBA 4CMUA 1LEWA 4PY1A 3TIYA 4A07A 2Y6MA 3ZU7A 3EKKA 5FDXA 1U4DA 4GW8A 4C59A 2BTRA 3PPJA 2ITYA 2VTQA 4PDPA 3TNIA 1XMLA 5M56A 4KBCA 3Q9XA 1RW8A 2HWPA 4FI1A 2JEDA 3MDYA 5J79A 3NUXA 1WBWA 2O8YA 4JDKA 4CT2A 5A3XA 4L68A 3FQHA 4KKHA 2CKPA 3FZSA 3Q2JA 3F7ZA 4Y83A 4JX3A 5HIBA 3PFQA 2B9IA 5HO8A 4W8DA 2C6MA 5IH6A 3O2MA 2WOUA 2R3MA 4M12A 3KIOC 4A06A 4Y5HA 3TACA 2PTKA 3Q3BA 3QTIA 3ROCA 2V7OA 2W1HA 3SXFA 2FUMA 2UV2A 5HU9A 1G8KA 3BYSA 2X39A 3CGFA 5DN3A 4FV2A 2ACXA 5C9CA 2Z7LA 5GZAA 3LFQA 2C5NA 4O7VA 3FE3A 2ZM1A 3LFCA 3IQ7A 4YUQA 5IQCA 2ZDUA 3P1AA 4AN2A 4FTAA 2CNQA 4TKSA 4XMOA 2RFSA 3QTQA 1ZOEA 3V5WA 2CKQA 3OMVA 3BHHA 3E64A 4F64A 3NVMB 4R77A 3K5UA 3HV4A 3P7CA 3RPSA 4I0RA 4ZJVA 3DKFA 4GYIA 4EZ5A 4UMUA 3KRRA 4YHFA 5AAFA 5HE1A 3FI8A 4QTCA 3LXKA 4FYOA 4YJNA 1A9UA 5CU4A 4YJVA 3V8WA 5DR2A 4AT4A 4HYSA 3WARA 3PWYA 1U46A 4BZOA 1BL6A 3QTXA 5HHWA 4BDJA 5K3YA 3C4WA 2JIUA 5M06A 4ZTMA 1CMKE 4FVPA 2OH0E 2PZ5A 2Y4IC 2UZTA 3KMWA 2IVUA 2R64A 4FG9A 5EKOA 4QNYA 1M2RA 3CJGA 2HZ4A 4GVJA 2XAOA 2FYSA 3FMHA 4F6SA 3RM6A 5EYMA 1OIYA 2YJRA 4XYFA 2X0OA 5H8GA 2I1MA 4I6BA 1R39A 4XP0A 5JRQA 5KNJA 4IB0A 4IZYA 2GNLA 3QQGA 4OT6A 4FRFA 3QZHA 2J0IA 4A9YA 5LCJA 4BDCA 1BX6A 3AGMA 3G9LX 3LJ0A 4E93A 2EXMA 3FSFA 1YXXA 4AZFA 2BZJA 2AUHA 4PDYA 3UOHA 4CG8A 5I3RA 4MBJA 5CEIA 1Y8YA 2X9FA 4IADA 4MEDA 5BV3A 3RK9A 3D7TB 1QPJA 4BCQA 4G34A 5HE2A 3BV3A 4X2NA 3DBFA 5AUUA 4AFJA 3JS2A 3D2IA 1XBBA 4I0SA 1YXTA 3ANQA 4KWPA 1O9UA 4U97A 4L46A 4RC3A 2VV9A 4GYGA 4IDVA 1OUYA 4QPMA 5E8YA 3UOKA 4D0XA 3ITZA 5CASA 3GNIB 4MNEB 4NTSA 5KKRB 3ZFMA 3VN9A 3GU4A 2JFMA 2C5XA 2Z7SA 3F5GA 3R73A 4FUXA 4TPTA 3VS3A 4BCNA 5DVRA 3PYYA 4KIOA 4BCJA 2OLCA 5A4CA 1M17A 2CGWA 3ZM4A 1NW1A 4ZSAA 4C38A 3DPKA 1AQ1A 1T46A 2QO9A 4WUNA 3RCDA 4X6RA 1WBVA 2RIOA 4ACCA 2OIBA 1S9IA 2YIRA 3CKXA 3QRUA 3ATSA 3GGFA 3RM7A 4DTBA 3EQHA 3LCKA 2O5KA 3HMMA 4A4LA 4I5HA 3WZUA 4PP9A 2YLFA 3CQWA 5DHJA 2VX1A 2REIA 4EH2A 4L52A 2UZLA 5LMKC 3LM0A 4OTRA 5BUEA 1IAJA 3F88A 3R9RA 4WHZA 5BVNA 1PXJA 3EQBA 1ZOHA 4FSYA 2QVSE 4DGOA 2WO6A 1XH9A 4MCVA 4DN5A 3F3VA 3DZOA 2VTNA 4C2VA 4TYIA 3SA0A 1PW2A 2JKOA 4QMOA 3ZDUA 4IVBA 5DI1A 5I9UA 1ZMVA 4OTQA 1GNGA 2R3IA 5ETIA 2XJ1A 5CU2A 3R8PA 3ORXA 3P78A 1CTPE 3WIGA 3W1FA 3QD3A 4IM2A 3HUCA 4HGTA 3BRBA 3DXPA 1OGYA 5CU6A 5AR8A 4I4EA 5EOBA 3AMBA 4AN3A 2XBJA 3N51A 3UO6A 3CC6A 3GXLA 4BBMA 4HVDA 5CAOA 2ITQA 3BLHA 2B52A 2ZM3A 3LM5A 3OBJA 5D11A 5HNBA 4PP7A 4O7LA 5HD4A 4CQEA 1OKWA 4O4BB 4PMPA 2JKQA 3PXYA 3UO4A 5FUTA 4XH6A 5AMNA 3UDTA 5JQ5A 4X3FA 4G6NA 2OSCA 2C68A 1J91A 3EQDA 4FEWA 3WF8A 2EXCX 3V5LA 5EG3A 2IVTA 3F6XA 4F09A 2YHVA 1BKXA 2OJJA 3CPCA 3CY3A 4IWPA 4PWNA 5IQFA 2YFXA 5T68A 3TZ7A 5C8NA 5KHXA 3RPOA 2HYYA 2W99B 3F5UA 1I44A 4H1JA 4P5ZA 3NX8A 3P08A 3OXTA 3JY9A 2WTCA 4EJNA 3K54A 4U80A 4PRJA 4NL0A 3ACJA 3HRBA 2XEYA 3ZSHA 3AC2A 1MRYA 4IWDA 4O7WA 3NSZA 4ALWA 4FX3A 4U81A 5HO6A 4TW9A 4L3JA 4BL1A 2EB2A 2C3JA 2GNFA 3ENHA 3POOA 2VTPA 3C4ZA 3MA3A 5T3QA 2VN9A 5E92A 5A9UA 3QQKA 1L8TA 3IPHA 2WMBA 3D15A 3AC8A 4RIXB 3OT8A 4FR4A 5AV0A 3UDSA 3SXSA 1YXSA 5L8KA 3ULIA 3W2RA 1DM2A 3UYTA 4EC9A 5M4UA 2BRHA 3GCQA 4FZFB 3FI4A 5F1ZA 1ST4A 4DH8A 2XKCA 4JMQA 4NWMA 5F95A 3MTLA 3BLAA 4FEXA 5ANJA 1XQZA 3RK7A 2UUEA 3DJ7A 3ACKA 4XG7A 4FZ7A 2GNIA 3R9OA 2QOIA 4KKGA 1PJKA 4M14A 4FTQA 4U5JA 3Q6UA 3A99A 3TN8A 4ZJIA 4EH7A 5K4IA 4FTLA 2YM6A 4ZK5A 2BMCA 4EL9A 1ST0A 2VGPA 3RJCA 2PMLX 4KRCA 3QF9A 4YJPA 2QG7A 3ZLYA 3UZTA 3CR0A 3OBGA 3LQ3A 2B1PA 2CGUA 4N4SA 5J7HA 3PA3A 4OAVB 3RKBA 3ATTA 3KRLA 4IVAA 5IA0A 5T6KA 3M1SA 3F3UA 3UNJA 3IOKA 1FGKA 4RBLA 3KB7A 4KABA 4I41A 4L44A 2C30A 4QTAA 4XRJA 1PXOA 4EWHA 2R2PA 5LVPA 2VTRA 4GT5A 3QRIA 2I0YA 3VUDA 3NZ0A 4EEVA 4E6QA 3LQ8A 3VONA 3W0QA 3GUBA 3CSVA 2HZNA 5AJQA 4AXFA 4GUEA 1OL7A 4ZZMA 4GH2A 4DT8A 2XYNA 1NVQA 2NNWB 4FL3A 2BZHB 4I22A 4AA5A 5HLWA 4I23A 5IQDA 4O91A 4OBQA 3KRWA 5AM6A 4XBRA 3Q52A 3TNPC 4J98A 3CXWA 2GQRA 2IN6A 4TL0A 5CAVA 3QFVA 3VBYA 3E5AA 3QZGA 4IIRA 3W8LA 4FT3A 5GJGA 3H30A 3FXZA 4C7TA 2H9VA 2ZYBA 3EZVA 4EUUA 4QP7A 4NW6A 4JX7A 1OL1A 4HGSA 3CCNA 3ZSIA 2WMXA 2HW7A 4NUSA 2W1EA 1UU3A 5HG5A 4BGGA 4RX5A 3E3BX 1G8AA 2WU7A 5B2KA 3L8XA 4EH6A 4EH5A 4WBBB 3O5AA 3HNGA 3U55A 2UZEA 1ZY5A 1Y6AA 3AC4A 5DRDA 4YTCA 1Z9XA 3GQLA 3IDPA 4I24A 4K6ZA 3DBDA 1V0OA 4HYHA 3VBTA 3BELA 5E8UA 3BHTA 3FMKA 1SVGA 5CY3A 2VO3A 1WZYA 4BIBA 5BX0A 1FVVA 3TDVA 3EIDA 3NMUF 1NVRA 5AUTA 5DEYA 4YPSA 4U43A 4KINA 4M66A 3KL8A 3HGKA 3AD6A 1YI4A 4FIJA 5AP1A 4YZMA 2BUJA 1OL5A 4AT3A 5EM6A 4FVQA 4DTKA 2VWVA 3HRCA 4YNEA 4PNIA 2C6EA 2JC6A 3IW8A 4IBMA 3TL8A 2VAGA 2QOKA 4QPSA 5HICA 5HCZA 3O23A 3T9TA 5HIEA 2FO0A 3A8XA 3KEXA 4AOIA 5AIKA 4PX6A 4HGEA 3Q60A 5FTQA 3A60A 2WTVA 1BMKA 3ORTA 1V0BA 4G9CA 5HIDA 3DV3A 3PVUA 4G16A 2G2IA 3QYWA 1O6YA 4D2TA 5L2IA 3TZ9A 4RFMA 4F7LA 3LJ1A 3QBNA 1A48A 2FVDA 4OTIA 2WMTA 4ACMA 1W2DA 1W82A 3QKKA 4DH5A 2UW0A 3L9PA 3EN6A 3CPBA 3FC2A 4FEQA 4IC8A 2IVSA 4K0YA 3FL4A 2UW5A 4WT6A 3FPQA 1GIJA 3K3JA 4Z3VA 1Q5KA 4S32A 3MFSA 4DEDA 3AKKA 5IA1A 4E73A 2WU6A 3OD6X 1YKRA 2V55A 3A7JA 3MS9A 3R1NA 2X7GA 3LIJA 5DT4A 4G3GA 3NFGB 4AN9A 2Q0NA 4RJ8A 3ROYA 5J5TA 3G6HA 4IM0A 4EJ7A 4ERKA 4HYUA 2HXQA 4IZAA 5ANOA 2W06A 3W16A 4E5BA 3AQVA 4EOKA 3TJCA 3RCJA 4XG3A 4C4JA 4M67A 5TR6A 3R8ZA 4F6WA 1QPCA 1PYXA 2YM8A 4AXDA 4BFMA 2QG5A 4C4EA 3KKVA 4D5KA 2GQSA 3KK9A 3KN6A 3PZEA 2XJ0A 4FV9A 3UTOA 4APPA 3TWJA 2ZV9A 3OOMA 3ZSGA 1SZMA 4OTFA 5HBHA 3IGOA 1CM8A 3LPBA 4GFGA 4QP2A 4IZ7A 2O64A 4DHZA 5BYLA 4C62A 4AZVA 3PSCA 2XARA 2QOHA 3VW8A 2PYWA 4DF3A 1P4FA 1CDKA 4IW0A 5LCKA 2WQOA 1MP8A 4FL1A 4C4FA 5JFXA 2ZMDA 4QMXA 1BYGA 2WMQA 1OPLA 1JKKA 4ANOA 4BDHA 3TCPA 4XLVA 4X3FB 3ZO3A 3A4OX 1OB3A 4ZS0A 4D2WA 3F2RA 5ACKA 3R22A 3ZO2A 4LG4A 3QKMA 3D2KA 2P55A 4G5PA 1YW2A 3VUKA 4ACHA 2QR8A 2ITWA 4D2RA 3PIZA 4BDKA 3LZBA 2UZBA 4GJ2A 3GI3A 2KULA 1PKDA 3C13A 4FIEA 4IJ9A 3LFNA 2WIPA 3IONA 4H36A 1H8FA 4BDAA 4EHEA 4TWNA 3S2PA 2WXVA 4GV1A 4PMTA 4WA9A 4F1MA 2NRYA 2BHEA 4O81A 2QOFA 5BVFA 3OCBA 4CFVA 4AA0A 4TN6A 3R7IA 4EBVA 2P2IA 3U8WA 3I0OA 3O7LD 5CNOA 3VF9A 4FTNA 3QGWA 2F49A 4AZEA 4QQJA 3MY5A 2BAQA 4NYEA 3BYMA 1F0QA 4EQMA 2C3LA 3FXXA 3O0GA 4X2FA 2FSMX 4CVAA 3ZZWA 1H24A 1L3RE 4I20A 2VX3A 4FKTA 1OVEA 4LV8A 4AGWA 3OP5A 3KMMA 1H1WA 4GT3A 3FHIA 5EI2A 2YEXA 3RNYA 4BC6A 5GJDA 1XH6A 2OF2A 3O7LB 2AYPA 4O7SA 5LWMA 1AD5A 3ZM9A 3DDQA 2C6LA 4CRSA 2WB8A 4M0ZA 3EL8A 4JBQA 4J7BA 4EI4A 4AXCA 4A4OA 2XUUA 4CKRA 4C3RA 2OGVA 3SGCA 1ZY4A 5F94A 3R7UA 3ZOSA 3ID6C 3LFBA 5F4NA 4AX8A 2QCSA 2YAAA 3ZRMA 2OJIA 3NAYA 4X0MA 2QHNA 3LCSA 5ICPA 3VBXA 1IRKA 3B2WA 1GY3A 4LUDA 3NUPA 3BGZA 3ZRKA 4ZEGA 4EHZA 2RFNA 5EK7A 2BALA 1JSUA 5LVOA 2GFSA 5EKNA 4FIIA 1WBSA 5IH4A 5J95A 3RHXA 4YLKA 3WZKA 3NDMA 3GP0A 4ZXTA 5JZNA 3R21A 2WOTA 5BVDA 4R5YA 2H6DA 5IU2A 2PSQA 4QEBA 5AR4A 4KIQA 4RG0A 4DG0E 3FUPA 1IR3A 3R2YA 3VHEA 1BUHA 3TXOA 3ZXZA 4D5HA 1Q8YA 4EQUA 4UB7A 2PUNA 1ZYCA 5AR5A 2C6KA 2W1CA 4MKCA 3REPA 1CKJA 2J9MA 4AW5A 4CV9A 2BRMA 5CTPA 1URWA 3D7TA 4RWLA 4TWPA 3UVRA 4LOQA 4FTOA 3BIZA 1FGIA 3SLSA 3JY0A 4Z9LA 2I0EA 5J7BA 1OITA 4NU1A 5AM7A 2Y0AA 2R3QA 1VJYA 4YZBA 3QWJA 2YCSA 2W1GA 1UU9A 2R7BA 3FMJA 4MNEA 2PMIA 5CAPA 3TUBA 3SG8A 2WEVA 4IC7A 3VQHA 4BKZA 3HEGA 3LQ5A 1T45A 3ORKA 4RJ5A 4YO6A 2XZSA 3GOPA 4L8MA 4WNOA 3SDJA 2CMWA 3R01A 3QQHA 3T3VA 3C51A 5EYDA 4K8AA 3RWPA 3MVMA 3O96A 1Q8UA 4B0GA 3FZTA 5HCXA 1UWHA 3H9FA 3H0YA 3PY3A 5AIRA 1NXKA 5KMMA 3QTRA 5EOLA 3U9NA 1ZYSA 5ETFA 4B9DA 3TT0A 2X0PA 3T3UA 2A98A 4X6QC 4E6AA 3BYUA 3ZTXA 4D4YA 1M7NA 3P5KA 2VWUA 4O0SA 5C8KA 4JDJA 4LGHA 4JBPA 5DOSA 3QC9A 3PE2A 5HG9A 4E5AX 2WTKC 1SVEA 4KIPA 3JVSA 3KXZA 4NIFB 4RIOA 3PPKA 4BZDA 4YJRA 1YXUA 4BHZA 2QKRA 2YM3A 5CXZA 5GINE 2YDIA 2E9UA 3BHUA 1XR1A 2YJSA 1GAGA 4DFYA 5JN2A 1WVWA 4LDTA 2CN8A 3ZFXA 2HY0A 4ACGA 3I5NA 4N6YA 3ODZX 4FSRA 4G17A 3GEQA 3G0EA 3HLLA 4BR3A 4YZNA 2HW6A 1OI9A 4LRMA 5LMBA 2F2CB 3ELJA 3FZ1A 1W8CA 3EN5A 5DH3A 1JVPP 4CCBA 2IF8A 3TYKA 5I3OA 3FY2A 2LGCA 1QPDA 1YWRA 3EYHA 2PVKA 3P9JA 3GQIA 2IZTA 4QYYA 3PXKA 3EFWA 3UIUA 5AV4A 1PKGA 4F7SA 2B55A 4UV0A 2R7IA 3O8UA 3AT2A 2QURA 1GJOA 3WZDA 1BI7A 4UXQA 4ASXA 1LEZA 3KVWA 4IFGA 5A4TA 1UVRA 2YIXA 3QX4A 4LV7A 4F0FA 4IANA 4X2KA 3JPVA 3HDMA 3W2SA 1IA8A 5J9ZA 5CF5A 4FICA 3MW1A 2B9FA 2W7XA 3FY0A 2R3NA 3LCOA 5IISA 5KMNA 3ZO1A 1OKZA 3FZPA 4HCTA 4JR3A 3TNHA 5BVOA 2FSTX 5L6OA 4USDA 2X4FA 1VLRA 4FKUA 1H4LA 4BCIA 2GHLA 3UC4A 1W2FA 4O1PA 3R02A 2R3HA 5HI2A 1KSWA 3PVGA 5I4NA 5HE3A 5TKDA 3AC3A 4RWJA 3RINA 4Z7GA 2ERKA 3LFEA 3DCVA 2ETMA 2OK1A 3DNDA 4R3RA 4P4CA 1YWVA 4O1OA 3VF8A 3AMAA 2C5OA 4XG8A 1YXVA 2QU6A 4RVMA 4W4XA 2XAMA 1JKTA 4R3PA 4DAWA 5HOAA 3WBLA 2R3PA 4CLJA 5KO1A 3WF9A 1ZARA 2I40A 4HYIA 3PXZA 4BI2A 2WTWA 4AF3A 4FIGA 3TUDA 4IZ5A 2QLQA 2R3KA 4YC8A 3UQGA 4EBWA 4FG8A 3JR1A 4O0VA 2G2FA 5IQBA 5C03A 2QU5A 4ANLA 3ET7A 5A4QA 3I1AA 5ACBC 2QNJA 2GNJA 2XCHA 5DGZA 3TJDA 4PL5A 3EFLA 4I3ZA 5AAGA 3TV7A 4CEGA 3KF4A 4YO4A 1ZMUA 5B0XA 3EZRA 4FSMA 1H1SA 1Z57A 4AW0A 5AR3A 4FTKA 3R7EA 4C57A 4C02A 2HK5A 2OJ9A 1PXIA 5GZ9A 3ML1A 3QTWA 4DC2A 1A06A 2CDZA 2JBOA 1PXPA 2RL5A 3IW7A 3NAXA 3P0MA 3QCXA 5E1EA 3RI1A 1I09A 4EH4A 3W2OA 3POZA 5BPYA 2CSNA 2R3FA 3GOKA 5AUWA 4EKKA 1H25A 5KMJA 2C5VA 2XF0A 4XHKB 3ZUTA 2QONA 5HESA 5AR7A 4LRKA 4AGDA 4BWPA 2W5HA 2GSFA 1MRUA 3U4WA 5B2LA 3PG3A 2X1NA 5L2TA 3TNWA 3RMFA 4C3FA 5K5NA 1Q24A 3HVCA 2C69A 2I0VA 3ANRA 2CJMA 3NS9A 4Q5HA 1OPKA 2XMYA 3BGQA 5GNKA 4ZY6A 2PULA 2OXXA 2OW3A 4D58A 4HVHA 4LQMA 2AC5A 4FZDB 2YERA 4LL5A 3P86A 4FSQA 1R0PA 2ZJWA 4YLLA 3B2TA 4NM3A 2G1TA 4M7IA 3Q2MA 4TNBA 5CT0A 3F7WA 3ZDIA 5B2MA 4GKIA 4EORA 4R7BA 4DT9A 2ONLA 4WNKA 5FDPA 5LXMA 3S00A 4J71A 4MD9E 3R71A 1RE8A 3WZJA 4BTKA 3ZHPC 4TYJA 2QQ7A 4I21A 4RVLA 1G8JA 1P5EA 4O0YA 2IVVA 4UWBA 2EWAA 5CLPA 5JH6A 4D28A 4JT3A 4MXXA 1OIRA 2Z02A 2XP2A 3PY0A 3QCQA 4FTCA 3KK8A 1GZOA 4CFMA 4JDIA 3SV0A 3OG7A 2GNGA 3GU7A 5JRSA 2ZMCA