4OBPA

Map4k4 in complex with inhibitor (compound 29), 6-(2-fluoropyridin-4-yl)pyrido[3,2-d]pyrimidin-4-amine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
298
structure length
285
Chain Sequence
IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Discovery of Selective 4-Amino-pyridopyrimidine Inhibitors of MAP4K4 Using Fragment-Based Lead Identification and Optimization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 285
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4obpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4obpA01
4OAUC 3S95A 3V5WA 4DH3A 2O64A 4XV3A 5HG9A 1FBNA 2XNNA 3KXGA 4F09A 1YXVA 2XJ2A 3A99A 3Q53A 4FF8A 4ZZOA 4MKCA 5LJJA 3QZFA 4DINA 5L6OA 1Q41A 3MFSA 4NUSA 1KOAA 5DR2A 3QD0A 4ACCA 4C7TA 4GS6A 2OG8A 5IEXA 1MQ4A 5H2UA 2NPQA 4AFEA 1ZAOA 4IMYA 5EI6A 4RVTA 5CF4A 5CTPA 1ZYDA 2DUVA 4ZSGA 4IAKA 5HX8A 4R6VA 4WHZA 5AMNA 4NT4A 3D7TB 5D11A 5BUJA 2YZAA 4W4WA 3QTIA 4F6UA 1XR1A 4W9WA 4FKPA 1QPCA 4BIBA 4U45A 4EC9A 5IA4A 5F1ZA 1WZYA 3U9CA 3UG2A 5IZFA 3BHVA 3OW3A 2DYLA 4O6EA 4YC8A 1MRUA 3CCNA 3EIDA 4AF3A 3EQGA 4MQ2A 3CQUA 2JKMA 2YERA 2CKOA 3DU8A 2R2PA 1GIJA 2PVKA 2ITTA 4F9CA 4PTCA 4U8ZA 5HQ0A 2UW3A 3BBTB 2HCKA 3C4FA 3UOHA 2REIA 2RFEA 2GU8A 4OW8A 3ORKA 4LM5A 4E7WA 4EK3A 1PXPA 4I3ZA 3TV4A 5ETCA 3U4WA 4AGWA 3NUAA 4FI1A 5CSVA 4AA4A 4QP1A 5BVNA 3NGAA 4NM7A 4BTMA 5F4NA 4EUTA 5BVFA 4F4PA 3GNIB 3QUEA 5FG8A 3ZUUA 4TZRA 2ETMA 4MXZA 4IZ7A 3TL8A 2IVSA 4CQEA 1GOLA 4IB0A 2P0CA 1W8CA 5HKMA 4X3FA 3TEIA 1W82A 1H27A 4FTUA 5CAUA 3E64A 3QTUA 5K0XA 3PWDA 3TACA 4LMUA 1BLXA 1DAWA 5HCYA 4GUEA 3V8WA 1LEZA 4G6OA 3IONA 4J71A 4P2KA 1OZ1A 5KMIA 5M57A 1REJA 2QOCA 4GT5A 4BBEA 4BCHA 3P86A 3LJ2A 3FZOA 4FTTA 3AC3A 5GZ8A 2VNWA 4L00A 3BHUA 4EH2A 4ENYA 1OM1A 4WT6A 4FOCA 5HI2A 4E8AA 3POOA 3BQCA 2UZLA 1O6YA 3DKOA 4FKQA 1G3NA 4GYGA 5FDXA 4CTCA 4EOKA 4DA5A 4MD7E 4FTCA 4JX3A 4PDOA 2IG7A 4O7YA 3U55A 2R64A 3SXFA 1OGUA 2W5AA 3LW0A 3FLNC 3RALA 2WD1A 4ONAA 1PXJA 3HUBA 4CFXA 1PXMA 5GZAA 1SVEA 3COKA 3QCYA 2JITA 3MV5A 2IJMA 3O8PA 4ZZMA 4R3RA 5CEPA 3THBA 4FGRA 3HLLA 4IVCA 1QL6A 4FZAB 4B8MA 5HVYA 2E9VA 1PXOA 5HIBA 3CEKA 2OK1A 4RWLA 5AV2A 3I5ZA 3AQVA 3CJFA 3BYVA 2WFYA 2HAKA 3KRRA 2C6DA 4U6RA 2RL5A 2UV2A 2WQEA 4D2TA 3EFJA 4U41A 2IPXA 3OMVA 4LRJA 1ZMVA 4WSYA 5H8GA 4ZSLA 3FV8A 4IDTA 5K5NA 4XBRA 2VGPA 3OWLA 3A2CA 3E62A 4IE9A 5FBOA 4GFOA 3QFVA 2E9NA 3EFLA 2YLEA 1UA2A 2J51A 4FIJA 3MBLA 3SGCA 2YCQA 1PMVA 4IHPA 3V01A 2CPKE 2C69A 4S2ZA 1NVQA 4HYIA 3D4QA 5K5XA 1PRYA 4X2GA 1R3CA 1PKGA 2F7ZE 2PUUA 5CS6A 3UVPA 5ICPA 2C3LA 2CGUA 3C0GA 2BAQA 1BL7A 5J8IA 3R7YA 3MH0A 4CMTA 1MUOA 1OI9A 3GU6A 3PP1A 3VUHA 3OFMA 4E4NA 5CNOA 3OW4A 3BIZA 2BRNA 1OBDA 2YM5A 2X7GA 2C6OA 4IB1A 3WF8A 3OCSA 3SG9A 5CQUA 4FSTA 4EC8A 4ZTLA 3ZEPA 5CU6A 4ZXTA 4K2RA 3NCGA 3FPQA 5TE0A 5KBRA 4ALWA 4BDEA 3AC1A 4WUAA 4FV5A 2VWYA 4C57A 3LZBA 4PUZA 4FV6A 3WE8A 4L9IA 2Y6MA 4DFLA 5I9YA 2Z7QA 1CDKA 2ZOQA 3NUYA 4MH7A 4EH9A 3NCZA 3KU2A 3MH1A 1OL5A 4RJ7A 3E7VA 2X9EA 5AP7A 2QG7A 4HYSA 2V55A 1CTPE 3IOPA 4AWIA 2W06A 2WMBA 3EOCA 3V8TA 3ZBFA 4ZLOA 1GIHA 2BFYA 2FO0A 3QYZA 4CRLA 1H00A 1NA7A 1U4DA 3ORIA 3VQHA 2UW0A 3GCSA 4G3CA 4R5YA 5FXRA 3IG7A 3R8VA 4R7HA 1YRPA 4NKAA 2B4SB 4Y5QA 4TT7A 2ITXA 3QRIA 3KY2A 5AAGA 3P0MA 4DG2E 5LMKA 3TNHA 3R9NA 2ONLA 5ETFA 3U87A 1MRYA 4AW2A 4MYGA 5AV4A 5FUTA 2WNTA 1VYZA 2I0EA 3FLSA 3ZXZA 4AP7A 5M4CA 3FHIA 2J90A 3U54A 4ZS4A 3ZOSA 2XIKA 1ZLTA 4D28A 4MXYA 3A4PA 2ZDTA 1ATPE 4EBVA 4PPAA 2I7QA 3ZRKA 4FTNA 3T9TA 4WRSA 4AZFA 2BZIB 3PLAE 4I23A 4V0GB 4WG3A 5E9EA 1URCA 2W05A 3EL7A 4OBQA 3FJQE 4AT3A 2PMNX 2C6LA 4YPSA 3BWJA 1J7IA 2UZDA 4HCVA 4TRLA 2RGPA 3S3IA 4BWPA 4EH3A 2FUMA 1UWHA 4OLIA 2PTKA 3KL8A 4D0XA 1GIIA 3LMIA 3NR9A 2GQSA 3KA0A 3PZEA 3DFAA 3OEFX 3HDMA 3PLSA 1BYGA 3QTZA 3VJOA 2BROA 3GFWA 1JSTA 4RX9A 3O50A 4CT1A 3QWKA 2BTSA 3RCDA 4IC8A 3FY0A 1BI7A 4FT0A 5D1JA 2QQ7A 1W0XC 3I6UA 1CSNA 4EOMA 1OKZA 2OKRA 3R21A 4CFVA 4QMNA 3FC2A 5FLFA 3CPCA 5AX3A 3UQFA 3QGWA 1Q24A 4IZYA 2V0DA 4XCUA 4UXLA 4HPUE 2AC3A 3RK5A 4EZ5A 5CENA 2BHHA 5EHLA 2VWXA 5A3XA 4XLIA 5D12A 4KNBA 4JL9A 4U81A 5T6KA 4DG3E 4RJ4A 2A27A 4DN5A 1MP8A 4ZLZA 1Y57A 3N4TA 4DAWA 4AOIA 2XIXA 3BU6A 3WARA 4O0UA 1LUFA 2YIRA 4BZOA 3NSZA 2WPAA 4S34A 4EWHA 3LCKA 3VUDA 4BKZA 1XH8A 5CWZA 2NNWB 2F2CB 3HGKA 3ALNA 2QG5A 3UIBA 1U54B 4D2VA 4ANLA 2ZB0A 4L67A 4BCIA 4FV4A 2YFXA 4FIIA 2OSCA 2ZM1A 2WMVA 1OBGA 5GIPE 4ZY6A 4I0TA 1IEPA 2GTNA 4MD8E 3ZLXA 1H1RA 2PSQA 1XHAA 5IH5A 4IANA 1W84A 2OIDA 2R0UA 4GT4A 5DPVA 4ACGA 4V04A 4I92A 4I21A 3QGYA 5J95A 5EI2A 2GNJA 2Z7SA 5IUGA 3IKAA 5EW9A 4ZTQA 2X81A 3ID6C 5AP5A 2VRXA 4MBJA 2P2IA 5I9VA 4WSQA 4FZDB 3VS0A 3ZDUA 4AN9A 4KS7A 4JVGA 3KXHA 4AZEA 3BGPA 2R3PA 5CEIA 1V0OA 4DTAA 5JEBA 2J2IB 2HWOA 3BE9A 5LARA 2VTHA 3DTWA 5DFPA 3WZEA 2RFSA 3ZZWA 4YSJA 4IJ9A 3SV0A 4RVMA 1KE9A 5AV0A 1YW2A 3GENA 2CN8A 3ZMMA 5IH4A 4II5A 5CF8A 3ORMA 3PUPA 3NAXA 4E26A 4QMTA 4M84A 2IZUA 2R3GA 4DHFA 2VGOA 2WB8A 4FUXA 4K8AA 3GBZA 3NPCA 4P7EA 3OOGA 4A9SA 2C4GA 3V6SA 3GGFA 3MPTA 2SRCA 4YJVA 4YLLA 5BX0A 5J87A 4U9AA 3TZ9A 3I81A 4OR5A 3TUBA 4NH1A 4F99A 1ND4A 4E5BA 2F7EE 3R7EA 5FRIA 4ANNA 3ZS5A 3KK9A 4M69B 3NWWA 3AOXA 3F88A 2YAAA 3H9OA 4I41A 4JT3A 2W1DA 3SOAA 4LFIA 4QMWA 4XP3A 3UZPA 3VAPA 2VTIA 5KO1A 3MYGA 3FQSA 1PMEA 2V62A 3CGOA 3O2MA 1H1WA 4YJPA 2WEIA 4BVUA 4BDJA 2CGVA 4IACA 4HJOA 3MA3A 4ARKA 1PHKA 5FTQA 3ETAA 3F82A 3ODZX 3CBLA 3P1AA 4U42A 2QOHA 5ETIA 4H3PA 5DT4A 3N4UA 3CTJA 3IGOA 4HZSA 5KMMA 3QZHA 4Z16A 3PWYA 2WO6A 4QMZA 4A4OA 2YIXA 4YJNA 2YJSA 3A7FA 4QMMA 1H24A 4AXAA 2XKCA 1G8AA 5M08A 5DT3A 5I3RA 2X6DA 2FB8A 2XCHA 4CZYB 2PPQA 3EQDA 3IPHA 4F08A 2YITA 4FKWA 4NEUA 2VD5A 4BDBA 4JR7A 3A7HA 2XKEA 3REPA 5AM7A 3VUMA 4LUDA 4U44A 4X2KA 3DKFA 5DIAA 5EDQA 4FODA 5IQEA 4BTKA 3ORTA 5I5ZA 4ASXA 1KE8A 4BCKA 3QUPA 3F69A 3OROA 5CEKA 2VU3A 4K0YA 2O0UA 3IDCA 3FI8A 3HA8A 5EW8A 2X4FA 4UALA 4ZTMA 5IEVA 3TNPC 4XUFA 1NY3A 2QOBA 2ZB1A 5CX9A 4AT5A 2B7AA 3FMLA 4JQ7A 4C4JA 4JRVA 3TKUA 4OGRA 5CALA 2XNMA 2XMYA 2PE1A 2CJMA 5G1XA 3ZBXA 4HYHA 4F0FA 5FXQA 3FMHA 2ETRA 2OXDA 4PWNA 1QCFA 2PUPA 4GK4A 4FT5A 4BHZA 2QLQA 3C0HA 1RW8A 4U40A 4QMQA 5DMZA 5JQ5A 4O6LA 2R3IA 3AC8A 1W7HA 2PMIA 4GCJA 4G16A 3U9NA 3UPXA 4BI0A 4ZJVA 2QOKA 4YTIA 4PMSA 5FP6A 3WIGA 3L8SA 3AC4A 3VS5A 3RAWA 1PMUA 4RWKA 4EONA 1J7UA 1Z5MA 2ITUA 3P5KA 3ZXTA 4A9TA 1ZY4A 4CYIA 3HMMA 3K5VA 3MVHA 1YOLA 4YPDA 1W98A 3EQPA 4JBOA 2UW6A 4FSYA 5TR6A 4HVDA 3HV3A 1PYEA 2OIQA 2BAJA 4BCGA 2H8HA 3R1SA 3GU4A 4WNOA 2YCFA 1TVOA 4FC0A 3ULZA 5ANJA 1VZOA 2Y0AA 3A8WA 1YI6A 3DKGA 4OBPA 4C3RA 5BQ0A 4DH1A 2NO3A 4E5WA 4ANOA 2W1HA 3LFAA 2IO6A 2XUUA 3JPVA 4JAJA 3QA0A 4EZ7A 3NS9A 4O7SA 4HVHA 4GL9A 4L43A 1H07A 1U59A 4XMOA 2V5QA 2RFDA 4B4LA 2UW8A 2I0HA 3WF6A 4YZBA 4DTBA 2VN9A 3D7TA 4DEHA 4H36A 1A06A 5K4JA 4KIOA 4NCTC 4FV1A 5B2LA 4CLJA 3PZHA 3IOKA 3RVGA 4O81A 3FHRA 4J7BA 4WNPA 3QF9A 4E93A 2DS1A 4FV2A 5KHWA 2XK9A 3LFFA 3QD2B 4TWPA 4RA5A 3ORXA 5A6NA 1ZOHA 2F4JA 5EG3A 5HOAA 3PXZA 4KKGA 4AGUA 3ZU7A 3TNWA 5JRQA 5HIEA 2JIIA 3D5WA 5IQHA 2RIOA 4O96A 2HWPA 4LOOA 3RNYA 4BFMA 2JFLA 2FGIA 2FA2A 3C4EA 5JKGA 4DCAA 3DJ6A 3I0QA 3FQHA 4YZNA 2CNUA 4MF1A 4FTMA 5H8EA 3FSFA 3UMWA 3RAIA 4AAAA 4DH5A 2EUFB 4DG0E 4JX7A 2OWBA 3P7AA 4OTQA 2HYYA 1PMNA 2G2IA 3S00A 1WBSA 3R00A 3F5GA 5C8KA 2R4BA 3GC7A 2OJGA 2VX1A 5EDPA 1STCE 2JC6A 4I0RA 2Y4PA 2Y6OA 4NM5A 4U3ZA 4RIXB 5EHYA 3EYGA 4E6QA 2W4KA 3ZC5A 3KRJA 4IB3A 4X2NA 5EM6A 2EXMA 4BCOA 4EHGA 1UWJA 4A06A 5AUUA 3TUCA 4X21A 4IAYA 5T3QA 3GOKA 4FTJA 4GYIA 3PPJA 4IH8A 3MW1A 4KKHA 4NSTA 3VF9A 2C6EA 4J8MA 4HCUA 4M14A 5CASA 1I44A 4XH6A 1UV5A 2J5EA 4F1MA 3FAAA 3DBQA 2CNVA 3AMYA 3KMUA 2YIYA 4RX8A 4E6CA 3UZRA 4UEUA 3WF5A 3QXOA 1XO2B 5AR2A 2PVJA 4YSMA 2BCJA 5KZIA 4ZMEA 4PL5A 4EOOA 2CGXA 5CEQA 4OTWA 5JGDA 4J52A 3RMFA 3E92A 3R8LA 1JAMA 3QHWA 4OTFA 4YJRA 4R3CA 5J9YA 1B6CB 2JD5A 5JZJA 5LMBA 5M06A 1CKPA 2B54A 4RMZA 3SDJA 3VBTA 2YWVA 2P4IA 4IX4A 2UUEA 3S2PA 4BHNA 5IQFA 3DJ5A 2H6DA 2QOOA 2UW5A 4N0SA 5B2MA 1EH4A 2Q0BA 4H3BA 3G9NA 4TYEA 4I5PA 3I1AA 1MQBA 3P79A 2YWPA 5FP5A 3FBVA 2ESMA 4RC2A 3V8SA 3S0OA 2IN6A 3DKCA 3D5XA 3FQEA 4YURA 1GJOA 4FNYA 2OH0E 2VWZA 5T68A 3LVPA 4F7LA 1K2PA 3MWUA 4OAVB 3FPMA 3RWPA 3UYSA 5IA5A 2ITYA 4Y8DA 1Z57A 3SHEA 4WKQA 3PRIA 2OJFE 1XH4A 4YLJA 5HCXA 1REKA 3PA5A 4WNKA 5EHOA 5AIKA 2ZV7A 3LCTA 3U4UA 4DT8A 2CNQA 5DI1A 3BLHA 3KFAA 2BUJA 5FEDA 3R6XA 4XEYA 4BF2A 4O2ZA 5JFSA 4JQ8A 4O2PA 4WUNA 3FZ1A 4N6ZA 4ZP5A 4EL9A 5IUIA 3GOPA 2DQ7X 2OIBA 4HGLA 3UQCA 3EMGA 1YOJA 3OEZA 4L7SA 2G2HA 3KQ7A 3RZFA 3ZDIA 4F1OA 4D5KA 4ZY5A 2XB7A 3VUIA 2WU6A 3PYYA 3QRUA 1U5RA 4XG7A 2PZ5A 2NP8A 2VWBA 3MPAA 3OWJA 4BZNA 2YIQA 2B0QA 2WIHA 4UWYA 4U0IA 4D58A 1WMKA 3Q9WA 3OCBA 5BYZA 5LVPA 1T46A 3QZIA 2YEXA 4X6QC 3MS9A 4YNEA 3NUUA 4YO4A 3FMMA 4JI9A 4D2WA 4EK8A 3GU5A 5ANDA 4ANQA 2UW9A 2BDJA 4FK3A 4KBAA 3BEAA 4TYGA 3IW5A 4V01A 5TT7A 4GIHA 2Q0NA 3NX8A 5EYDA 4YZ9A 3NNXA 3HEGA 3ZLYA 5C4LA 3R02A 4RSSA 2W1ZA 1FMOE 2JDSA 4LOPA 3VUTA 1M2RA 5BUIA 4FSRA 3QQGA 3AC2A 3NDMA 4IAFA 3W8LA 2EB2A 4EJ7A 4EZ3A 2BAKA 2VO0A 4C02A 5JQ8A 4N70A 3BX5A 4UB7A 4BRXA 2UVZA 4TYHB 4XHKB 3DBCA 4EHEA 4L42A 5HD4A 3GQLA 3OTUA 1HCLA 4H39A 2BALA 4O7VA 3D2IA 3OVVA 4FOBA 4GW8A 5EDRA 4LQMA 1YOMA 3BI6A 3UOKA 1JQHA 5CF5A 2EU9A 3SD0A 4YBKA 5IA2A 3FE3A 4NK9A 5EOLA 1GZNA 3RHKA 1WBOA 4XBUA 2ERZE 4BCJA 5BYYA 4HGEA 1Q61A 2BIKB 4V05A 1YXTA 3GQIA 1JOWB 3QAME 1UU9A 4FGBA 5CAPA 3K5UA 2ERKA 5C8MA 3BLRA 4AGDA 3SX9A 4GRBA 3WIKA 3PVUA 3MIYA 5AX9A 3WE4A 3TUDA 4TWOA 4IBMA 3KULB 3K3IA 3PA4A 3SKCA 3F2AA 4XP0A 4YZCA 3FLYA 3R1YA 4EH6A 3HAVA 2G2FA 2VO7A 3RAHA 4IZAA 2OGVA 2OO8X 5FGKA 3V5QA 2IVUA 1TQPA 1SNXA 3EN6A 2RG6A 2OF4A 2YA9A 2J7TA 4EEVA 4KINA 3LPBA 4UZHA 3PXRA 4X7QA 4QNAA 4FKSA 2PU8A 5BMMA 3I7BA 4V0GA 3O0GA 4F63A 4FR4A 4F6WA 5HNIX 3LMGA 2YCSA 4HYUA 4D1XA 5AEPA 4BIEA 3OT3A 3HMOA 3KK8A 3I60A 5I4NA 1YI3A 3FMEA 2GHLA 3WZKA 1YQJA 4KBKA 3CIKA 2RKUA 2HY0A 2PL0A 2R3KA 3QRJA 3QU0A 3F3UA 4FV9A 3MN3A 1URWA 3BLQA 4U80A 3R83A 3HZTA 3LFEA 2E9UA 4M66A 3CJGA 4R3PA 4EH5A 4WG5A 3I7CA 5I9WA 5TOZA 3TCPA 1Q99A 4BTFA 1SVGA 4FYNA 4G6NA 3DS6A 4TW9A 1TQMA 4HGSA 5M56A 2BKZA 2X1NA 3C4WA 4ZMFA 5DR9A 3G33A 1L3RE 4KBCA 3TIZA 3JYAA 3OG7A 5A4EA 3UP7A 3IDPA 1ZARA 3FZTA 3HMIA 4YTHA 3E8CA 3UBDA 4O0WA 2JDOA 3P7BA 4FYOA 5AR3A 4G3FA 5D9HA 4LL0A 5CT0A 1VEBA 3EQCA 5IQCA 3UDBA 4I5MA 3ZZEA 2XA4A 3KN5A 2CCIA 4QTDA 4ALVA 4ITHA 1U54A 2R9SA 2UZTA 1IA9A 4JBQA 5LWMA 4AS0A 2JLDA 4WG4A 4D4VA 4D55A 1AGWA 1Q3DA 2BZHB 3VC4A 3FMDA 5HCZA 5LVOA 4AUAA 4CG8A 3O71A 3UG1A 5DOSA 3EQIA 5HG5A 2VX0A 4U5JA 4R7IA 4TWCA 4QMYA 4O84A 1G5SA 4YU2A 4BI1A 5KMKA 3PY0A 4C59A 4RWJA 3F61A 5HU3A 3UYTA 5HO7A 5HTBA 3EN4A 3MY0A 2VTPA 3B8RA 3F3ZA 3PY1A 3E5AA 4IM3A 5CQWA 5L8JA 1ZWSA 5DT0A 4FVRA 3O8UA 1G8SA 4AZVA 1ZRZA 3OY1A 3JS2A 2WMAA 3BGZA 3Q4UA 4TL0A 4PDPA 2HZNA 3SC1A 4YUQA 2RG5A 1H25A 2O5KA 4AW5A 3PJ3A 4CNHA 3HECA 4W8DA 3ZEWA 4KIKB 4S33A 4W9XA 2VTMA 3A4OX 5L2TA 2QODA 1PXIA 3O51A 5LVLA 5HICA 4X0MA 3M42A 1SM2A 5ANKA 4XYFA 2ITNA 2W1EA 4BDCA 2IWIA 2VAGA 4Y95A 3TM0A 1SMHA 2ZM4A 5E8YA 4EQCA 2QCSA 4BN1A 4D5HA 4NW6A 5CF6A 4FE2A 3VRYA 2VTTA 3DAKA 2YCRA 4KSQA 3OXZA 4IW0A 2XK7A 4FEUA 3BWFA 2JAMA 3IW8A 3HV6A 4CKJA 4NM0A 3QTWA 4O83A 3IS5A 4PNIA 4JNWA 2W1CA 3IK3A 5L3AA 1OL7A 3QTQA 3QUDA 2XBAA 4ZTRA 4U79A 4FSNA 3ZRLA 1OPLA 5E1SA 3O7LD 1NT2A 2OJIA 3C5UA 5DGZA 3H30A 4I4EA 1IAJA 4CCUA 2PMOX 2XK8A 1PXKA 2BPMA 3BBWA 2R3HA 4QTAA 4EUUA 1H01A 2F49A 3DPKA 4FEQA 5EOBA 4MEDA 2J0MB 3D5VA 5IEYA 1ZYCA 3QQFA 4FVQA 2R5TA 2PY3A 2C1BA 4XG3A 4NTSA 4FSUA 5BVOA 4BDKA 4YTCA 3POZA 2UVXA 3F2NA 5EYCA 3C13A 3R8MA 1JNKA 4O27B 3PP0A 3V6RA 2UVYA 3H0ZA 4C4EA 4G31A 4L3PA 4BDHA 2HXQA 4KIQA 1IA8A 2VNYA 2W7XA 1H28A 4MBIA 4Z7HA 3UTOA 5F94A 5AP4A 1H08A 2VTJA 3Q9ZA 4I22A 3ATTA 3CTHA 1YWRA 4DE4A 2FSLX 3ELJA 4MHAA 4ZTNA 3CKWA 3DXNA 3UC3A 4BKJA 2W96B 5HO8A 2XBJA 4W4VA 4G3GA 4JDKA 4TNBA 3TN8A 1DM2A 5JGBA 5L2WA 2GFSA 5B2KA 2JGZA 4DGGA 4G1WA 5K0KA 4FK6A 4WBOA 3OUKA 2WIPA 3KMWA 4XV2A 4Z55A 3PIYA 2ZDUA 4PDSA 3DZOA 4HGTA 3TZ8A 4L45A 3CQEA 3EH9A 1A48A 3ZHPC 3WYYA 3SW4A 1WBPA 5M55A 4FNZA 3MFRA 3OCGA 3TDWA 2G9XA 3PRFA 2ZMDA 2VTOA 3S4QA 1ZYSA 5FQDC 4DLIA 2QNJA 2HIWA 2B9HA 3FLQA 4QP6A 3ACKA 3OUNB 4JLCA 2GS7A 1CMKE 4F64A 3O96A 3ZM4A 3BYUA 4JIKA 4UMPA 4EK6A 4QRCA 3EZVA 4IXPA 2C5OA 3HX4A 4FUYA 4O0VA 4AGCA 2VO6A 5DHJA 4QQTA 4A7CA 1RQQA 1Q5KA 4C2WA 1XKKA 4A9YA 4DEIA 5JK3A 1JKTA 3EQHA 5EM5A 5CLPA 2PZIA 3UNZA 2Q83A 4FEWA 3VN9A 3RPVA 4QQJA 1UVRA 3G0EA 3SOCA 3GEQA 2W4JA 4EYMA 4DFYA 2EWAA 2GNFA 3KVWA 3NAYA 5AV1A 5F9EA 3EFWA 5K4IA 2PVNA 4A07A 3VHKA 2XVDA 2ZVAA 4F7JA 1S9IA 4FICA 5JMSA 4Y46A 2OH4A 4A4LA 1H1QA 1AQ1A 3C50A 5DVRA 4U43A 5B7VA 3FXXA 3LFDA 3RINA 3QWJA 1XBAA 4IZ5A 4Z9LA 1KSWA 1YHSA 4EOSA 2NRYA 3FWQA 5JGAA 2EB3A 4BDDA 2F7XE 3EN5A 4IWOA 1SNUA 4R5SA 2PVFA 4YNOA 3TV6A 5FDPA 5ANIA 3LQ5A 3HRFA 3PE2A 4M8TA 1LEWA 3CXWA 3KF7A 4L53A 3UO5A 3OY3A 5CI6A 3LFQA 4GJ2A 3SAYA 4O86A 3NW5A 1OKVA 3LM5A 3NUNA 4JRNA 5CEMA 4M15A 2CSNA 1PXNA 1ZYJA 4IB5A 4DEBA 3QC9A 4FT9A 1Q4LA 4O21A 1ZMUA 3NNVA 3EFKA 1Q8YA 4RQVA 4KABA 3DK6A 1YDSE 2QLUA 3F9NA 4HVIA 4YHJA 3R71A 4XRJA 4RFYA 3D7ZA 3BGQA 5FWKK 2XZSA 5CVGA 4R78A 2QOIA 3PTGA 3KVXA 3D9VA 2YM4A 2ZV8A 1OL6A 1ZOEA 4XOYA 3HMNA 1H0WA 4RIXA 1YVJA 3BV2A 3QTXA 4QTEA 3T9IA 5AV3A 4TXCA 2H96A 1XJDA 4Q2AA 5GZ9A 5CVHA 2W4OA 2YHVA 3R30A 4UX9A 3TJCA 4MXAA 5FM3A 3WZJA 4KSPA 2PUNA 4D2SA 3MESA 4ZSJA 2JDRA 1GAGA 1P14A 2JFMA 3COIA 2PZPA 3LJ0A 4FA2A 2J0KA 4FKLA 1Y8GA 4HNIA 4PP9A 1UU8A 4EHVA 5HLPA 3D0EA 3W8QA 3RK9A 1FMKA 3IW6A 1GY3A 2FSTX 5FD2A 1V0PA 3KXNA 4PPCA 4XNEA 3ZTXA 2Z02A 2OZAB 5EQEA 1Y6AA 2QOQA 4EWQA 3V5LA 2X7FA 2P33A 1O6LA 3QRKA 4H1MA 4N6YA 3NVKI 3ZSHA 2HW7A 3WF9A 3NW7A 2W0JA 1Y91A 2X4ZA 4CFNA 4YJQA 2BILB 3HYHA 2PE2A 5HBJA 4QYGA 3LFNA 5AP1A 2BDWA 3I4BA 4B9DA 3UVRA 4ITJA 5A6OA 4MNFA 4FIEA 4BGHA 4CZUA 2GQRA 2ITOA 3MFTA 3GC8A 3UP2A 4CYJA 5LMKC 2CN5A 5JSMA 4FKVA 4ZLYA 2J6MA 3KRLA 3PPZA 3FUPA 5KMLA 5CNNA 1QPDA 2W99B 3PVBA 3UZTA 4JXFA 3JY9A 2IVVA 3LE6A 5HE2A 3DLSA 4PPBA 3F66A 3W2QA 3FI3A 4NCTA 3EN7A 2BRHA 5EYKA 4RX5A 3GC9A 3R2YA 2C30A 3VWAA 3FYJX 5E8SA 3ET7A 3QD4A 4X3JA 4GJ3A 3D14A 3ZH8A 3C51A 3OBJA 5CU2A 4CFMA 4GG5A 5A14A 3A7IA 2PULA 3VS1A 3A61A 4G6LA 4L44A 4WIHA 3TKIA 3VS7A 1XBBA 4I4FA 3HRCA 4KIPA 5B0XA 4CMOA 3LJ1A 2GDOA 4FV3A 2HW6A 3DGKA 3HVCA 5HESA 4BKYA 3Q4ZA 5E92A 3L8PA 5KUPA 4MTAA 3SQQA 3E88A 3TT0A 2AYPA 3VBWA 4ALUA 2Y4IC 3UODA 4PX6A 1O9UA 1SZMA 3NYOA 4JG6A 2UZEA 3NZ0A 3Q2MA 4FTOA 4FX3A 5IF1A 2BKKA 5CSHA 1KE6A 4MWHA 3EQFA 4H3QA 3P78A 5HD7A 3RBWA 3FI4A 5AADA 2JKKA 1DI8A 3E87A 1P2AA 3KF4A 5IH6A 4C4FA 3DOGA 2W17A 3VBYA 4F9AA 2BMCA 2XIZA 4RJ6A 1V1KA 2YM3A 3R8PA 5CAQA 3ROCA 4FEXA 2CKEA 1IAHA 4QYEA 1CKIA 1Y8YA 1IRKA 4PL4A 3MGYA 3GI3A 3COMA 4ZS0A 4NW5A 3KB7A 3QA8A 5M09A 3UIMA 4F0GA 2ITZA 3S1HA 3W10A 4OTGA 3OZ6A 4C62A 3F3TA 4NTTA 2YACA 3NW6A 1YDRE 4G34A 3RPRA 4UY9A 1FQ1B 4B7TA 3BYOA 2C6TA 5HO6A 2KTYA 4KWPA 1F3MC 3FKLA 3ZRMA 3PJ1A 2QD9A 1OIUA 4ACMA 3PJCA 1ZZLA 5AAFA 3EN9A 4C37A 4O7TA 5HVKA 3O8TA 2OLCA 2YLFA 3FZPA 4F7SA 4JG8A 2XIYA 4XG6A 3DFCB 4BWKA 3FLZA 3W32A 5M44A 3ZO4A 4D0WA 3QX4A 5AA9A 2UZUE 4PQNA 3R8ZA 4R1VA 4CCBA 3HDNA 5TO8A 4EOIA 1F5QA 4XRLA 5JFWA 4D9TA 4E20A 5E8XA 1JPAA 4JIAA 5E8TA 3KULA 5AUZA 4Z3VA 4HVSA 3R9RA 4BB4A 4RIYB 1WCCA 2R7IA 1F0QA 3JY0A 1DI9A 2P2HA 3EQRA 3EWHA 2GHGA 3M11A 5J7BA 1VR2A 4YJUA 4D4SA 4LV5A 1UU7A 4LOQA 2GPHA 3DJ7A 3AGMA 2VTRA 4Y5HA 4AZTA 4XX9A 2CLXA 5DRBA 4F7NA 5DE2A 4HW7A 1OVEA 2PYWA 3COHA 2VWWA 4HZRA 5FBNC 3AD4A 3U51A 3RPSA 3FKNA 5IQIA 1ZZ2A 4BDGA 3NLBA 4CEGA 3RI1A 4E5AX 5JT2A 4AN2A 3E3PA 3D5UA 3NYXA 4Q5HA 4BTJA 4RBLA 3OP5A 1Q3WA 2PK9A 1U46A 4P5QA 4YBJA 2X8DA 2Y4IB 2ZYBA 4E6AA 4UYNA 3ZO2A 1R39A 4UXQA 5ETAA 5KMJA 3TDVA 4AX8A 5H9BA 3PJ2A 3QRTA 3DT1A 5EW3A 4EK5A 3Q60A 4AT4A 3G6GA 1WBNA 1E1VA 4UMTA 4MX9A 2WQMA 3MPMA 4S30A 3F3WA 4GT3A 4FZ6A 3DTCA 2V7AA 5I9ZA 3SLSA 4LGGA 4K6ZA 4DC2A 2XNOA 4FKUA 4QP9A 3OWPA 2OJJA 4CFFA 4Q9SA 5CSWA 3Q9YA 4FKGA 3RPOA 1GZKA 4CLIA 1JSVA 1TQIA 3ENMA 3LCDA 2C6KA 3TTIA 3BRBA 2B53A 3I0OA 3R7IA 1R0PA 4ANBA 3R7VA 3MVMA 4DEEA 5IPJA 3UGCA 2QOLA 2HOGA 4L3LA 5AP6A 3SW7A 3KREA 4DEGA 5JH6A 3PSCA 4R7BA 3OT8A 2C5XA 2ITWA 2J50A 3PG1A 2XRWA 4J95A 4C58A 5HGIA 2VTQA 4JR3A 5E8WA 4KA3A 3MB7A 3V51A 3ZYAA 2VWVA 4DEAA 1J1BA 5KKRC 2C6MA 4FIGA 4FSWA 4B0GA 3VW6A 4RIWB 5AUVA 3UIUA 1FGKA 3BV3A 5FXSA 4IWPA 2WTDA 2XEYA 3AGLA 4ZAUA 5LCJA 4I24A 1OL2A 3TKHA 1KUTA 3ORPA 4M3QA 5AIRA 5TF9A 4B99A 3BHHA 4JDIA 5AP0A 1K9AA 5EFQA 5BVKA 2YDJA 5HNGA 3M2WA 2X7OA 4IADA 4FIFA 3EHAA 5JN2A 5LWNA 3ZLSA 4RA4A 2GQGA 4PNKA 4NYEA 4C38A 2EVAA 1IR3A 4C2VA 3RGFA 4D2PA 4RJ5A 3QC4A 4GVJA 3QL8A 3R7UA 3UOLA 4ZK5A 1ZXEA 2GNHA 3A60A 2JBOA 4PMMA 1UU3A 5C01A 2PVHA 3C4ZA 4PF4A 5EM8A 5GHVA 4QT1A 2WMQA 1PXLA 4M68A 3ZFMA 3ZFXA 5KNJA 2PVRA 5AR7A 4O1PA 4WO5A 2O2UA 5G6VA 4O0SA 4QMPA 3E3BX 2R3LA 1P5EA 5H3QA 1YDTE 2C68A 2CKPA 2G1TA 3BPRA 4FKTA 4AZSA 5JRSA 2XEZA 4JJRA 4JS8A 5C26A 3G15A 3Q5ZA 4FG8A 2I40A 5E4HA 3R9OA 4EQUA 2J4ZA 2BDFA 3N51A 5L2SA 1YKRA 2YISA 3MJ1A 4KRCA 4ZTHA 5BPYA 4BY9E 4TWNA 1R1WA 3K2LA 5D10A 4FKIA 1ZMWA 2XH5A 4QP3A 5IISA 4F6SA 4GIIA 4K9YA 5IU2A 4X6RA 3F5UA 4I5HA 2XKDA 1JKLA 4ZJJA 3D94A 5CZIA 4JDHA 3VBXA 2VO3A 4LGDA 4C8BA 4CQGA 3FL5A 3R2BA 5J9LA 3NIEA 3SA0A 3RM7A 1B39A 2PVYA 2HZ0A 4YO6A 1E1XA 3PSDA 3VUKA 3L9PA 4LI5A 4DLJA 1VYWA 4O7WA 1A9UA 3OXIA 5J7HA 5DEWA 4UV0A 4HOKA 3ZLWA 5KHXA 4FT7A 1IASA 4AOJA 4O7NA 4RC4A 3ODYX 3VHEA 3MH2A 5AP3A 5CANA 3G0FA 1ERKA 1MRVA 1IG1A 1WFCA 3R22A 3HMPA 4NFNA 2I6LA 1UKIA 4WD5A 5KKRB 4CVAA 4AA5A 4MK0A 2UZBA 2GHMA 1Y6BA 4NU1A 3ZCLA 4F65A 3PXQA 2R3JA 3A8XA 3V5JA 1XBCA 3FSKA 3NEWA 1M52A 4KS8A 2WTWA 4YC6A 3AC5A 5F95A 4F9WA 3E8EA 4TY1A 3FI2A 4FNXA 2J0JA 2R3NA 4YGAA 4BBMA 2RSVA 2ZM3A 4L68A 4LRKA 3VULA 2PUIA 4BZDA 5JFXA 2CCHA 4CG9A 4L6QA 5AR5A 3FXZA 3UNJA 4O82A 5HLNA 3MVJA 1LR4A 1OPJA 3EL8A 3C5IA 3KC3A 3T8OA 2QU6A 2C47A 3VS3A 2O65A 2QO9A 5IDPA 3ZONA 1BUHA 1CKJA 2B1PA 5AR4A 5HG8A 3AT2A 5AUWA 3TIYA 3VF8A 3E7OA 4CSVA 5LCKA 3LKMA 3L9MA 3Q4CA 4CTBA 3TWJA 2A1AB 2WELA 2QKRA 2BZKB 4YLKA 3BU3A 3TJDA 4O7ZA 4C3PA 2WTJA 4Z7GA 4EH7A 3LXPA 4DYMA 2A0CX 2BIYA 4MVFA 3TXOA 3W1FA 5IDNA 3E8NA 4X2JA 3VBVA 4QQCA 2P3GX 3PIXA 4EOQA 2W5BA 3ATSA 5HEZA 2BRMA 2R3FA 3G6HA 4OUCA 2R3MA 3H9FA 3LLAA 4E4MA 4JG7A 3HUCA 1M7NA 3CD3A 4H58A 5LXMA 3AT4A 4DGNA 2OJ9A 1RE8A 3SXSA 1HOWA 5L4QA 1J7LA 3DA6A 3GUBA 5CSXA 3Q4TA 1FVRA 5TKDA 3FY2A 3LFSA 4DFBA 5EKOA 2QI8A 4FSMA 2Z7LA 4NL0A 4IVDA 4H1JA 2VWIA 3H10A 3W2RA 4RQKA 2GS6A 2C5YA 2YM6A 3WILA 4BCQA 2X8EA 3V3VA 1H4LA 2JDVA 1OIRA 4MBLA 3CLYA 3ANQA 4BI2A 2WQBA 3TV7A 4FVPA 4FG7A 4YJTA 5JFVA 4A9RA 3R7GA 4P5ZA 3QTRA 3EZRA 2QU5A 4I5CA 4CFUA 5J9ZA 1OITA 3QQLA 4RZVA 3NNWA 2QO7A 2WKMA 2PMLX 4AFJA 4D2RA 4AZWA 1ZYLA 4YZMA 5I3OA 4DGOA 4FV7A 2OI4X 1GZ8A 4WOVA 2OW3A 4QTCA 3II5A 4U3YA 4EYJA 4TN6A 4CT2A 1WVWA 5C9CA 4F9YA 5A4QA 4ASZA 2Z60A 4F9BA 5HLWA 3LCOA 2V7OA 3W2SA 4LYNA 3MDYA 3DXPA 3B2TA 5C8NA 5HNBA 3CTQA 2YJRA 5J1WA 5ITAA 1DAYA 2W1IA 5IQAA 3OC1A 4CFWA 3PY3A 4FSZA 4XLVA 2R0IA 2OFUA 4QP2A 5DLSA 5E8ZA 4OTDA 1LP4A 1KE7A 4YC3A 2QKWB 3W55A 2C0IA 4YTFA 2FSOX 4L46A 2R3OA 4K77A 2BVAA 2GCDA 3FLWA 4YJSA 5CAOA 3IW7A 2WOTA 4FL1A 4RGJA 3GT8A 4PL3A 2JAVA 2HY81 2QR8A 4G3DA 4AA0A 5IA3A 2BFXA 4O91A 5IMEA 3ERKA 3IDBA 1H1SA 3KKVA 5L2QA 1V0BA 3DB8A 2XNGA 5C1QB 3RP9A 4XG9A 2XK6A 4RRVA 4C0TA 4M0YA 2XYNA 4XG8A 4E6DA 1OB3A 1Q8TA 2PVLA 4K11A 2B9FA 3LMHA 3H0YA 2BRGA 1YWNA 3NYVA 2OZAA 3KXMA 2GMXA 4OTHA 1BL6A 4KD1A 2G01A 2V22A 4EKLA 3MTLA 3R04A 3JVSA 5BUEA 2RF9A 3MVLA 2XNEA 1PY5A 4IWQA 2I0VA 2YM7A 4EJNA 5AUYA 3R9HA 3DCVA 2FSMX 2PVMA 5DBXA 3MSSA 2X2MA 4Y83A 3WF7A 3Q6WA 1VJYA 1XH7A 2C3IB 5AFVA 1I09A 4K1BA 2CGWA 4M69A 1TKIA 3PFQA 4HVGA 3VS6A 3L9NA 5FEQA 1JBPE 4FL3A 3UNKA 5HU9A 3LXKA 4I6QA 3ORNA 4IFGA 4NZWB 5ACKA 4Q9ZA 1S9JA 4L52A 4RPVA 3JUHA 3R1QA 2GFCA 4Y85A 3AD5A 2QURA 4GU6A 4AE6A 3R0TA 1BX6A 2B52A 4M12A 4DH8A 3PSBA 5IQBA 1JKSA 2BTRA 2XM9A 3MTFA 2IZRA 3QBNA 3QQUA 1B38A 2IVTA 3QLFA 5M4FA 4FKJA 1UNGA 5A4CA 4XJ0A 4W4XA 3DK3A 3OTVA 4A9UA 1QPEA 2VTNA 4I94A 5C03A 5DH3A 3QCSA 2XRUA 4CXAA 2ITVA 3RKBA 2X0GA 4RJ3A 4ZEGA 2DWBA 2Y7JA 3DNEA 4OBOA 4NIFB 4QPMA 3NNUA 4RFZA 4GH2A 4E73A 3DBFA 4G17A 3WZDA 3EKKA 5ANOA 4GKIA 3BE2A 2WMTA 3K54A 3UIXA 3I6WA 4O0TA 4USDA 4G5PA 5J79A 1OMWA 2RFNA 2ZMCA 3U6HA 3RTPA 3LXNA 4IAAA 3DQWA 2QHNA 5IG1A 4GVAA 3AXWA 1M14A 1LPUA 1P4OA 4S31A 3RZBA 3PJ8A 1FVVA 4BWXA 1ZY5A 5M51A 3LIJA 4QMSA 4J98A 3D2KA 3C9WA 3DY7A 4GV1A 4NKSA 4ANSA 1OUKA 1UNLA 4GFMA 5JZNA 5IA1A 4EOPA 2A4LA 4RVLA 3TI1A 3EQBA 3BEGA 4X3FC 3F5PA 1HCKA 1YXSA 2YAKA 1XQZA 1KV2A 2J0LA 3LXLA 2XF0A 4G5JA 2YDKA 3BU5A 2CLQA 5C4KA 3SRVB 4C61A 1M2PA 3CR0A 3O23A 4O7RA 5IQGA 3HAMA 4MNEB 2HXLA 3FZSA 2WXVA 2PHKA 3F3VA 4GMYA 3HP2A 3ITZA 4O0YA 5EQPA 3FZRA 3VS4A 4ZOGA 2CHLA 5ANEA 3EKNA 5CAVA 1SVHA 2UZVA 1FOTA 3HA6A 4IFCA 4LRMA 4K33A 2XM8A 1Q62A 3H4JA 4QMLA 4QYHA 4MAOA 4RLLA 4D4RA 3ZSGA 1YHVA 3R28A 3VVHA 4DBNA 4RVKA 5CSPA 2C0OA 2OZOA 4DCEA 2B55A 5KBQA 2J9MA 3RJCA 1OPKA 5E8VA 4CRSA 2VUWA 3BZ3A 3W16A 1QMZA 5E90A 1H0VA 2CMWA 4O0XA 5LOHA 4RFMA 4RIYA 3NUPA 2UW4A 2Z2WA 4EQMA 1BMKA 3CPBA 4FMQA 4IAZA 3EB0A 2VZ6A 4G3EA 4FKOA 4RZWA 4XG4A 2WTKC 4GKHA 4MCVA 5D41A 1E9HA 2AC5A 4W4YA 3PXYA 2WQNA 2ITQA 2UW7A 3DLZA 4YP8A 2QO2A 3D83A 3PXFA 4UMRA 3ZO1A 4QPAA 5A46A 5CXZA 1GNGA 3NVMB 4M13A 4IVBA 5KE0A 2ETKA 4TYJA 4UN0C 1WBWA 3DB6A 4O22A 3QCQA 4DT9A 1H26A 4MWIA 4QOXA 2GS2A 2WAJA 4KKEA 4I6FA 1YI4A 4TTHB 4IJPA 5A9UA 4KRDA 1OIQA 5IMXA 4GSBA 5HX6A 1WBVA 4MQ1A 5FM2A 4BYIA 2PZRA 4NJ3A 4FTQA 4JBPA 4EK4A 3QXPA 5CI7A 5E8UA 3PVGA 1Q8UA 4D1ZA 4DFNA 4ORKA 1KOBA 4R77A 4DFUA 4AG8A 3ORLA 4AN3A 1BI8A 4O38A 5EK7A 3EJ1A 2ZAZA 3QYWA 4RWIA 1WBTA 2XYUA 4GFGA 4X3FB 1YHWA 3R8UA 3WZUA 4E4XA 3W18A 3Q04A 4C33A 3PVWA 5HTIA 4J96A 4ASEA 3ENHA 5L2IA 1CM8A 2OF2A 5HIDA 3E63A 3ALOA 4BYJA 5DYJA 2VTSA 4MD9E 4UBAA 5AR8A 3BHYA 3PE1A 4J8NA 3NUXA 3WI6A 4TNDA 3GB2A 2C1AA 3NYNA 3VQUA 5L6PA 2UZOA 1PW2A 4FTAA 5KMOA 3CY3A 3Q32A 2OICA 3MB6A 4C4IA 3GCUA 2O3PA 2OXYA 4FNWA 4CKRA 2JKQA 4FZ7A 2GNGA 5GIOE 2YDIA 4RIWA 4W8EA 4APPA 4AOTA 1ZOGA 3ULIA 4AU8A 1GZOA 3I79A 5CY3A 3ROYA 4KUJA 4E1ZA 3KMMA 5FTGA 5AA8A 3QLGA 2PE0A 3GVUA 3FKOA 3FDNA 2HZ4A 2W9ZB 2QC6A 5HORA 1NVSA 4Y73A 4PTGA 4BDAA 4JOAA 2E9PA 3OD6X 3VNTA 5F20A 4B6LA 5L8KA 4UMUA 4S32A 3FC1X 2IW9A 3GXLA 4CKIA 3DDPA 4PP7A 1M17A 2WU7A 4WRGA 1XH5A 4R1YA 3OCTA 4EOJA 3QQKA 5HTCA 3SG8A 5GINE 2ONLC 2UZNA 2A2AA 3F7ZA 3GP0A 4LV8A 4QP7A 2WMXA 4BDIA 2KULA 3RHXA 1XH9A 2EXCX 2WTKB 2VV9A 1YXXA 3C7QA 3L8XA 4LGHA 1OUYA 4J53A 4JDJA 4KAOA 4YMJA 4NWMA 5KMNA 4RJ8A 2W1GA 5CU3A 3RCJA 3E93A 3DQXA 3I5NA 3DNDA 5D7AA 4D4YA 4MXCA 4BCMA 2IW6A 3QKLA 3RM6A 2WTCA 2F9GA 4AW1A 3VUGA 3GCQA 3KXZA 3GU8A 1YXUA 3BYSA 3DBDA 3QTSA 3IECA 1APME 3CKXA 3V04A 4C4HA 2I1MA 2IZTA 2X8IA 2E9OA 3W2PA 2XK3A 3ANRA 3G2FA 4FT3A 4NJDA 4BCFA 3G5DA 4C35A 3NRMA 4HPTE 4JAIA 3WBLA 3AT3A 3HRBA 3QKKA 4PMPA 4FBXA 2CKQA 2QONA 4ZSEA 3LQ8A 2XCKA 3LCSA 3DZQA 3R63A 4M7IA 3FMJA 3NUSA 5AM6A 3RWQA 5LVNA 4OTPA 5IQDA 3CP9A 3MJ2A 2IW8A 2PZYA 5KZ0A 4GG7A 4F70A 4C36A 4FL2A 4FSQA 4ASDA 1NXKA 4XOZA 2C5NA 4XS2A 2C0TA 3HNGA 4WNMA 3KN6A 3UO6A 2YIWA 1DS5A 3VJNA 4IC7A 2W9FB 4QTBA 4ZSAA 1RDQE 3R01A 5DWRA 3MFUA 3VRZA 4IDVA 3PA3A 1WAKA 5DEYA 3ZSIA 2WGJA 2YM8A 5ANGA 3LFCA 3FXWA 2BRBA 3SVVA 4G2FA 3QCXA 4ENXA 3Q3BA 2FYSA 3QHRA 1PKDA 4A4XA 5K3YA 1P4FA 4XV9A 2CDZA 5L6WL 3JVRA 4J1RA 2XKFA 5HVJA 3QX2A 3P08A 2E2BA 5HE0A 3W2OA 5J5SA 3ZO3A 4TYHA 2WQOA 5C27A 3Q6UA 4G9CA 1X8BA 3DAJA 3OBGA 5HBHA 3UOJA 1FGIA 3T3VA 5AJQA 5LMAA 3E8DA 5BNJA 4CGAA 3CD8A 3ZUVA 3CSVA 2XK4A 2YN8A 3CGFA 5I9XA 4UWCA 3BELA 4APCA 1KE5A 4M97A 4EORA 5CYIA 1T45A 4IX5A 4O0RA 2X9FA 4PMTA 2F57A 4YHFA 4F0IA 3O7LB 3KCKA 4B8LA 4UWBA 3U6IA 2ZV2A 4AQCA 5E1EA 2I0YA 4DF3A 3CE3A 4FTIA 3C4CA 3LOKA 3QQHA 4FV0A 5FTOA 3OS3A 4PY1A 4C34A 3ZFYA 3QZGA 5GJGA 1FPUA 5EYMA 5L8LA 3V5PA 2HK5A 4P4CA 5BMSA 4N57A 4BICA 2G15A 3H3CA 4AACA 4Y72A 1RJBA 2C5VA 2J0IA 1L8TA 4D1SA 4L7FA 3DK7A 1Q8WA 3KRWA 2GSFA 1JWHA 2P55A 5E91A 3R73A 3UO4A 4BR3A 3CQWA 3A7JA 3G90X 4WBBB 3N9XA 4DFXE 1O6KA 3L9LA 3JXWA 4M0ZA 2C3JA 3M1SA 1XH6A 3DDQA 3HP5A 1KV1A 3L8VA 4IIRA 3QKMA 3N4VA 4FEVA 3U8WA 5BVWA 5HBEA 2WTIA 2YABA 4DFZE 4L3JA 2O8YA 2ITPA 3VS2A 4C3FA 2XNPA 3Q2JA 4BCNA 5BVEA 2R7BA 1U5QA 3MY1A 5ACBC 3R9DA 5M4UA 3LFBA 3FEGA 5CU4A 3Q96A 4ANMA 2A19B 4QYYA 4XG2A 5J5TA 3B2WA 4FTRA 2HELA 4TPTA 4PV0A 1Q8ZA 3K3JA 3G51A 4LMNA 3PDTA 5CXHA 5LQFA 5A4TA 4F1TA 2WMSA 4ZJIA 4MXOA 1H1PA 3BCEA 5IKWA 3UPZA 4JQEA 4XV1A 3MY5A 4FKRA 4G9RA 4M67A 4QO9A 4QPSA 3UC4A 4ZZNA 4KB8A 4QP4A 1Z9XA 1YWVA 3UQGA 4USEA 1SYKA 5H8BA 3DBEA 4ERWA 4ID7A 1M2QA 1M7QA 4MXXA 4QMVA 3U6JA 4ACHA 4EBWA 5A4LA 2XJ0A 1PJKA 2HZIA 2UZWE 4UMQA 5AP2A 3P23A 3ZUTA 2ZJWA 3DV3A 4HNFA 1JSUA 1NVRA 4QMUA 3TNQB 4YHTA 2LAVA 2JIVA 1R78A 4HCTA 4I6BA 3GFEA 2ACXA 3KRXA 3OWKA 3F2RA 4C4GA 1W83A 3BYMA 3KXXA 3UE4A 4DGMA 1J91A 3QALE 4OTIA 4QMXA 3MH3A 5IA0A 5M53A 3PIZA 5KX8A 3NIZA 3VIDA 4RG0A 4ERKA 5IUHA 4LUEA 5A54A 2VTAA 3Q9XA 4RT7A 3F5XA 1JLUE 4L01A 3IW4A 4TYIA 4YZDA 5CZHA 4NFMA 2F2UA 4L8MA 2W5HA 4IX3A 3T3UA 3AD6A 3JR1A 4J97A 3PXKA 5BYLA 2JBPA 1XWSA 2X2KA 3GCVA 4U97A 3ZC6A 4BC6A 3CC6A 2H34A 3LM0A 2R3RA 3MI9A 3OOMA 4RIOA 4RLKA 3PG3A 4Q5EA 4FZFB 3D15A 3BHTA 3KCFA 4CD0A 4D9UA 2XJ1A 4EI4A 3WOWA 1NW1A 3Q52A 2WTVA 4U7ZA 2WHBA 4BGQA 5GJDA 3WYXA 5DRDA 2GNIA 4UZDA 1OKYA 4JBVA 3TG1A 3SXRA 3GU7A 3ACJA 4BL1A 4DEDA 3LHJA 5DNRA 3C1XA 3TZMA 2JKOA 4BDFA 4EH4A 4BGGA 2FH9A 3P7CA 1J1CA 3CY2A 1H8FA 5GNKA 3NMUF 5AUXA 2BZJA 2GNLA 2HENA 4ITIA 4KIKA 1WVYA 3CS9A 3LQ3A 5DR6A 3VBQA 3GC0A 4FIHA 2B9IA 4XP2A 3KEXA 3R7OA 2Y8OA 4E4LA 1OECA 1PF8A 1R0EA 3Q5IA 5EI8A 4FV8A 2WMUA 4CV8A 2X2LA 2VTLA 5EH0A 1OKWA 2JIUA 2Z7RA 3ORZA 4LG4A 5M07A 1J3HA 3HV5A 4R8QA 5DN3A 2QR7A 4I6HA 5LVMA 3V5TA 4ZY4A 2FVDA 2BHEA 3MIAA 3L1SA 2NRUA 2O63A 3BKBA 4QD6A 1UKHA 4IM0A 4EH8A 3VW8A 3UVQA 4N4SA 4DTKA 1OIYA 2WMRA 3RK7A 5CEOA 5KCVA 1QPJA 3HL7A 4I1ZA 4IWDA 2Y9QA 2OFVA 2VWUA 2OBJA 2QOFA 2OU7A 3LLTA 4I93A 4IEBA 4ZTSA 5HE3A 5M4IA 4BBFA 2JDTA 4O7LA 5K9IA 2PWLA 4AW0A 4GU9A 2AUHA 3P9JA 4CV9A 4CZTA 5HZNA 4QYFA 3RNIA 3TNIA 4PDYA 5CVFA 3OHTA 2GTMA 3MA6A 1FINA 4IAIA 4QMOA 2B9JA 4RC3A 1K3AA 5BVDA 1JKKA 4YR8A 1UNHA 4OT5A 2R3QA 3W2CA 3QQJA 3HV4A 5AWMA 4RX7A 3FYKX 4NIFA 4BCPA 2X6EA 4QNYA 4USFA 5CT7A 2Z8CA 2ZV9A 3KGAA 3B8QA 3H9RA 3OF0A 5AUTA 5I0BA 5DA3A 2YZLA 2WMWA 3AMAA 3EYHA 1KWPA 3IO7A 4IX6A 3PPKA 4BIDA 3F7WA 4YJOA 1FVTA 4DH7A 3VO3A 4ACDA 4K18A 5D7VA 4QP8A 1OL1A 3GCPA 2QHMA 4LL5A 2C6IA 3F6XA 3RPYA 2X39A 3C4XA 3HKOA 4FG9A 5AAEA 3P4KA 5CU0A 3IGGA 3G9LX 2WOUA 3DAEA 4QQ5A 2JEDA 3W33A 3AG9A 4IVAA 4DGLC 2LGCA 3R1NA 4GK2A 5DG5A 1BKXA 3TTJA 5EM7A 1WVXA 4I20A 2XIRA 4E3CA 5I9UA 2XS0A 3OXTA 4OT6A 2QVSE 4PTEA 3UJGA 3UMXA 4J99A 4P90A 4X2FA 1PYXA 3RAKA 2EXEA 4NM3A 4MF0A 4CMUA 5J1VA 3ZM9A 4DITA 5HHWA 3FL4A 3O17A 2XP2A 2C3KA 4O1OA 1JVPP 4IQ6A 2W1FA 3AMBA 4GUBA 2BR1A 4GEOA 4IM2A 5E7RA 2XNBA 4FTLA 5EQYA 4OTRA 5GJFA 4H05A 4TKSA 3FMKA 3SRVA 4EOLA 2IZSA 3C0IA 5EKNA 2H9VA 1Q97A 2WEVA 4MNEA 4EHZA 2VX3A 3TZ7A 4AE9A 3DXQA 4ZIMA 3HV7A 3IQ7A 3A62A 4EKKA 4GK3A 4UYAA 5HG7A 5FEEA 1AD5A 4I0SA 2WZJA 3FMNA 3A7GA 3BQRA 4PRJA 2OXXA 4FTKA 5HE1A 2J5FA 3LAUA 4DBXA 3QD3A 4WA9A
chains in the Genus database with same CATH superfamily
4OAUC 3S95A 3V5WA 4DH3A 2O64A 4XV3A 5HG9A 1FBNA 2XNNA 3KXGA 4F09A 1YXVA 2XJ2A 3A99A 3Q53A 4FF8A 4ZZOA 4MKCA 5LJJA 3QZFA 4DINA 5L6OA 1Q41A 3MFSA 4NUSA 1KOAA 5DR2A 3QD0A 4ACCA 4C7TA 4GS6A 2OG8A 5IEXA 1MQ4A 5H2UA 2NPQA 4AFEA 1ZAOA 4IMYA 5EI6A 4RVTA 5CF4A 5CTPA 1ZYDA 2DUVA 4ZSGA 4IAKA 5HX8A 4R6VA 4WHZA 5AMNA 4NT4A 3D7TB 5D11A 5BUJA 2YZAA 4W4WA 3QTIA 4O4CA 1XR1A 4F6UA 4W9WA 4FKPA 1QPCA 4BIBA 3PFYA 4U45A 4EC9A 5IA4A 5F1ZA 1WZYA 3U9CA 3UG2A 5IZFA 1XMLA 3BHVA 3OW3A 2DYLA 4O6EA 4YC8A 1MRUA 3CCNA 3EIDA 4AF3A 2XARA 3EQGA 4MQ2A 3CQUA 2JKMA 2YERA 2CKOA 3DU8A 4DHIB 2R2PA 1GIJA 2PVKA 2ITTA 4F9CA 4PTCA 4U8ZA 5HQ0A 2UW3A 3BBTB 2HCKA 3C4FA 3UOHA 2REIA 2RFEA 2GU8A 4OW8A 3ORKA 4LM5A 4E7WA 4EK3A 1PXPA 4I3ZA 3TV4A 5ETCA 3U4WA 4AGWA 3NUAA 4FI1A 5CSVA 4AA4A 4QP1A 5BVNA 3NGAA 4NM7A 4BTMA 5F4NA 4EUTA 5BVFA 4F4PA 4QEBA 3GNIB 3QUEA 5FG8A 3ZUUA 4TZRA 2ETMA 4MXZA 4IZ7A 3TL8A 2IVSA 4CQEA 1GOLA 4IB0A 2P0CA 1W8CA 5HKMA 4X3FA 3TEIA 1W82A 1H27A 4FTUA 5CAUA 3E64A 3QTUA 5K0XA 3PWDA 3TACA 4LMUA 1BLXA 1DAWA 5HCYA 4GUEA 3V8WA 1LEZA 4G6OA 3IONA 4J71A 4P2KA 2X0QA 1OZ1A 5KMIA 5M57A 1REJA 2QOCA 4GT5A 4BBEA 4BCHA 3P86A 3LJ2A 3FZOA 4FTTA 3AC3A 5GZ8A 2VNWA 4L00A 3BHUA 4EH2A 4ENYA 1OM1A 4WT6A 4FOCA 5HI2A 4E8AA 3POOA 3BQCA 2UZLA 1O6YA 3DKOA 4FKQA 1G3NA 4GYGA 5FDXA 4CTCA 4EOKA 4DA5A 4MD7E 4FTCA 4JX3A 4PDOA 2IG7A 4O7YA 3U55A 2R64A 3SXFA 1OGUA 2W5AA 3LW0A 3FLNC 3RALA 2WD1A 4ONAA 1PXJA 4FJVA 3HUBA 4CFXA 1PXMA 5GZAA 1SVEA 3COKA 3QCYA 2JITA 3MV5A 2IJMA 3O8PA 4ZZMA 4R3RA 5CEPA 3THBA 4FGRA 3HLLA 4IVCA 1QL6A 4FZAB 4B8MA 5HVYA 2E9VA 1PXOA 5HIBA 3CEKA 2OK1A 4RWLA 5AV2A 3I5ZA 3AQVA 3CJFA 3BYVA 2WFYA 2HAKA 3KRRA 2C6DA 4U6RA 2RL5A 2UV2A 2WQEA 4D2TA 3EFJA 4U41A 2IPXA 3OMVA 4LRJA 1ZMVA 4WSYA 5H8GA 4ZSLA 3FV8A 4IDTA 5K5NA 4XBRA 2VGPA 3OWLA 3A2CA 3E62A 4IE9A 5FBOA 4GFOA 3QFVA 2E9NA 3EFLA 2YLEA 1UA2A 2J51A 4FIJA 3MBLA 3SGCA 2YCQA 1PMVA 4IHPA 3V01A 2CPKE 2C69A 4S2ZA 1NVQA 4HYIA 3D4QA 5K5XA 1PRYA 4X2GA 1R3CA 1PKGA 2F7ZE 2PUUA 5CS6A 3UVPA 5ICPA 2C3LA 2CGUA 3C0GA 2BAQA 1BL7A 5J8IA 3R7YA 3MH0A 4CMTA 1MUOA 1OI9A 3GU6A 3PP1A 3VUHA 3OFMA 4E4NA 5CNOA 3OW4A 3BIZA 2BRNA 1OBDA 2YM5A 2X7GA 2C6OA 4IB1A 3WF8A 3OCSA 3SG9A 5CQUA 4FSTA 4EC8A 4ZTLA 3ZEPA 5CU6A 4ZXTA 4K2RA 3NCGA 3FPQA 5TE0A 5KBRA 4ALWA 4BDEA 3AC1A 4WUAA 4FV5A 2VWYA 4C57A 3LZBA 4PUZA 4FV6A 3WE8A 4L9IA 2Y6MA 4DFLA 5I9YA 2Z7QA 1CDKA 2ZOQA 3NUYA 4MH7A 3PUFC 4EH9A 3NCZA 3KU2A 3MH1A 1OL5A 4RJ7A 3E7VA 2X9EA 5AP7A 2QG7A 4HYSA 2V55A 1CTPE 3IOPA 4AWIA 2W06A 2WMBA 3EOCA 3V8TA 3ZBFA 4ZLOA 1GIHA 2BFYA 2FO0A 3QYZA 4CRLA 1H00A 1NA7A 1U4DA 3ORIA 3VQHA 2UW0A 3GCSA 4G3CA 4R5YA 5FXRA 3IG7A 3R8VA 4R7HA 1YRPA 4NKAA 2B4SB 4Y5QA 4TT7A 2ITXA 3QRIA 3KY2A 5AAGA 3P0MA 4DG2E 5LMKA 3TNHA 3R9NA 2ONLA 5ETFA 3U87A 1MRYA 4AW2A 4MYGA 5AV4A 5FUTA 2WNTA 1VYZA 2I0EA 3FLSA 3ZXZA 4AP7A 5M4CA 3FHIA 2J90A 3U54A 4ZS4A 3ZOSA 2XIKA 1ZLTA 4D28A 4MXYA 3A4PA 3TYKA 2ZDTA 1ATPE 4EBVA 4PPAA 2I7QA 3ZRKA 4FTNA 3T9TA 3NFGB 4WRSA 4AZFA 2BZIB 3PLAE 4I23A 4V0GB 4WG3A 5E9EA 1URCA 2X0PA 2W05A 3EL7A 4OBQA 3FJQE 4AT3A 2PMNX 2C6LA 4YPSA 3BWJA 1J7IA 2UZDA 4HCVA 4TRLA 2RGPA 3S3IA 4BWPA 4EH3A 2FUMA 1UWHA 4OLIA 2PTKA 3KL8A 4D0XA 1GIIA 3LMIA 3NR9A 2GQSA 3KA0A 3PZEA 3DFAA 3OEFX 3HDMA 3PLSA 1BYGA 3QTZA 3VJOA 2BROA 3GFWA 1JSTA 4RX9A 3O50A 4CT1A 3QWKA 2BTSA 3RCDA 4IC8A 3FY0A 1BI7A 4FT0A 5D1JA 1G8KA 2QQ7A 1W0XC 3I6UA 1CSNA 4EOMA 1OKZA 2OKRA 3R21A 4CFVA 4QMNA 3FC2A 5FLFA 3CPCA 5AX3A 3UQFA 3QGWA 1Q24A 4IZYA 2V0DA 4XCUA 4UXLA 4HPUE 2AC3A 3RK5A 4EZ5A 5CENA 2BHHA 5EHLA 2VWXA 5A3XA 4XLIA 5D12A 4KNBA 4JL9A 4U81A 5T6KA 4DG3E 4RJ4A 2A27A 4DN5A 1MP8A 4ZLZA 1Y57A 3N4TA 4DAWA 4AOIA 2XIXA 3BU6A 3WARA 4O0UA 1LUFA 2YIRA 4BZOA 3NSZA 2WPAA 4S34A 4EWHA 3LCKA 3VUDA 4BKZA 1XH8A 5CWZA 2NNWB 2F2CB 3HGKA 3ALNA 2QG5A 3UIBA 1U54B 4D2VA 4ANLA 2ZB0A 4L67A 4BCIA 4FV4A 2YFXA 4FIIA 2OSCA 2ZM1A 2WMVA 1OBGA 5GIPE 4ZY6A 4I0TA 1IEPA 2GTNA 4MD8E 3ZLXA 1H1RA 2PSQA 1XHAA 5IH5A 4IANA 1W84A 2OIDA 2R0UA 4GT4A 5DPVA 4ACGA 4V04A 4I92A 4I21A 3QGYA 5J95A 5EI2A 2GNJA 2Z7SA 5IUGA 3IKAA 5EW9A 4ZTQA 2X81A 3ID6C 5AP5A 2VRXA 4MBJA 2P2IA 5I9VA 4WSQA 4FZDB 3VS0A 3ZDUA 4AN9A 4KS7A 4JVGA 3KXHA 4AZEA 3BGPA 2R3PA 5CEIA 1V0OA 4DTAA 5JEBA 2J2IB 2HWOA 3BE9A 5LARA 2VTHA 4LDTA 3DTWA 5DFPA 3WZEA 2RFSA 3ZZWA 4YSJA 4IJ9A 3SV0A 4RVMA 1KE9A 5AV0A 1YW2A 3GENA 2CN8A 3ZMMA 5IH4A 4II5A 5CF8A 3ORMA 3PUPA 3NAXA 4E26A 4QMTA 4M84A 2IZUA 2R3GA 4DHFA 2VGOA 2WB8A 4FUXA 4K8AA 3GBZA 3NPCA 4P7EA 3OOGA 4A9SA 2C4GA 3V6SA 3GGFA 3MPTA 2SRCA 4YJVA 4YLLA 5BX0A 5J87A 4U9AA 3TZ9A 3I81A 4OR5A 3TUBA 4NH1A 4F99A 1ND4A 4E5BA 2F7EE 3R7EA 5FRIA 4ANNA 3ZS5A 3KK9A 4M69B 3NWWA 3AOXA 3F88A 2YAAA 3H9OA 4I41A 4JT3A 2W1DA 3SOAA 4LFIA 4QMWA 4XP3A 3UZPA 4O4FA 3VAPA 2VTIA 5KO1A 3MYGA 3FQSA 1PMEA 2V62A 3CGOA 3O2MA 1H1WA 4YJPA 2WEIA 4BVUA 4BDJA 2CGVA 4IACA 4HJOA 3MA3A 4ARKA 1PHKA 5FTQA 3ETAA 3F82A 3ODZX 3CBLA 3P1AA 4U42A 2QOHA 5ETIA 4H3PA 5DT4A 3N4UA 3CTJA 3IGOA 4HZSA 3NFFB 5KMMA 3QZHA 4Z16A 3PWYA 2WO6A 4QMZA 4A4OA 2YIXA 4YJNA 2YJSA 3A7FA 4QMMA 1H24A 4AXAA 2XKCA 1G8AA 5M08A 5DT3A 5I3RA 2X6DA 2FB8A 2XCHA 4CZYB 2PPQA 3EQDA 3IPHA 4F08A 2YITA 4FKWA 4NEUA 2VD5A 4BDBA 4JR7A 3A7HA 2XKEA 3REPA 5AM7A 3VUMA 4LUDA 4U44A 4X2KA 3DKFA 5DIAA 5EDQA 4FODA 5IQEA 4BTKA 3ORTA 5I5ZA 4ASXA 4BJJB 1KE8A 4BCKA 3QUPA 3F69A 3OROA 5CEKA 2VU3A 4K0YA 2O0UA 3IDCA 3FI8A 3HA8A 5EW8A 2X4FA 4UALA 3AKLA 4ZTMA 5IEVA 3TNPC 4XUFA 1NY3A 2QOBA 2ZB1A 3ML1A 5CX9A 4AT5A 2B7AA 3FMLA 4JQ7A 4C4JA 4JRVA 3TKUA 4OGRA 5CALA 2XNMA 2XMYA 2PE1A 2CJMA 5G1XA 3ZBXA 4HYHA 4F0FA 5FXQA 3FMHA 2ETRA 2OXDA 4PWNA 1QCFA 2PUPA 4GK4A 4FT5A 4BHZA 2QLQA 3C0HA 1RW8A 4U40A 4QMQA 5DMZA 5JQ5A 4O6LA 2R3IA 3AC8A 1W7HA 2A98A 2PMIA 4GCJA 4G16A 3U9NA 3UPXA 4BI0A 4ZJVA 2QOKA 4YTIA 4PMSA 5FP6A 3WIGA 3W0QA 3L8SA 3AC4A 3VS5A 3RAWA 1PMUA 4RWKA 4EONA 1J7UA 1Z5MA 2ITUA 3P5KA 3ZXTA 4A9TA 1ZY4A 4CYIA 3HMMA 3K5VA 3MVHA 1YOLA 4YPDA 1W98A 3EQPA 4JBOA 2UW6A 4FSYA 5TR6A 4HVDA 3HV3A 1PYEA 2OIQA 2BAJA 4BCGA 2H8HA 3R1SA 3GU4A 4WNOA 2YCFA 1TVOA 4FC0A 3ULZA 5ANJA 1VZOA 2Y0AA 3A8WA 1YI6A 3DKGA 4OBPA 4C3RA 5BQ0A 4DH1A 2NO3A 4E5WA 4ANOA 2W1HA 3LFAA 2IO6A 2XUUA 3JPVA 4JAJA 3QA0A 4EZ7A 3NS9A 4O7SA 4HVHA 4GL9A 4L43A 1H07A 1U59A 4XMOA 2V5QA 2RFDA 4B4LA 2UW8A 2I0HA 3WF6A 4YZBA 4DTBA 2VN9A 3D7TA 4DEHA 4H36A 1A06A 5K4JA 4KIOA 4NCTC 4FV1A 5B2LA 4CLJA 3PZHA 3IOKA 3RVGA 4O81A 3FHRA 4J7BA 4WNPA 3QF9A 4E93A 2DS1A 4FV2A 5KHWA 2XK9A 3LFFA 3QD2B 4TWPA 4RA5A 3ORXA 5A6NA 1ZOHA 2F4JA 5EG3A 5HOAA 3PXZA 4KKGA 4AGUA 3ZU7A 3TNWA 5JRQA 5HIEA 2JIIA 3D5WA 2XANA 5IQHA 2RIOA 4O96A 2HWPA 4LOOA 3RNYA 4BFMA 2JFLA 2FGIA 2FA2A 3C4EA 5JKGA 4DCAA 3DJ6A 3I0QA 3FQHA 4YZNA 2CNUA 4MF1A 4FTMA 5H8EA 3FSFA 3UMWA 3RAIA 4AAAA 4DH5A 3VONA 2EUFB 4DG0E 4JX7A 2OWBA 3P7AA 4OTQA 2HYYA 1PMNA 2G2IA 3S00A 1WBSA 3R00A 3F5GA 5C8KA 2R4BA 3GC7A 2OJGA 2VX1A 5EDPA 1STCE 2JC6A 4I0RA 2Y4PA 2Y6OA 4NM5A 4U3ZA 4RIXB 5EHYA 3EYGA 4E6QA 2W4KA 3ZC5A 3KRJA 4IB3A 4X2NA 5EM6A 2EXMA 4BCOA 4EHGA 1UWJA 4A06A 5AUUA 3TUCA 4X21A 4IAYA 5T3QA 3GOKA 4FTJA 4GYIA 3PPJA 4IH8A 3MW1A 4KKHA 4NSTA 3VF9A 2C6EA 4J8MA 4HCUA 4M14A 5CASA 1I44A 4XH6A 1UV5A 2J5EA 4F1MA 3FAAA 3DBQA 2CNVA 3AMYA 3KMUA 2YIYA 4RX8A 4E6CA 3UZRA 4UEUA 3WF5A 3QXOA 1XO2B 5AR2A 2PVJA 4YSMA 2BCJA 5KZIA 4ZMEA 4PL5A 4EOOA 2CGXA 5CEQA 4OTWA 5JGDA 4J52A 3RMFA 3E92A 3R8LA 1JAMA 3QHWA 4OTFA 4YJRA 4R3CA 5J9YA 1B6CB 2JD5A 5JZJA 5LMBA 5M06A 1CKPA 2B54A 4RMZA 3SDJA 3VBTA 2YWVA 3P5JC 2P4IA 4IX4A 2UUEA 3S2PA 4BHNA 5IQFA 3DJ5A 2H6DA 2QOOA 2UW5A 4N0SA 5B2MA 1EH4A 2Q0BA 4H3BA 3G9NA 4TYEA 4I5PA 3I1AA 1MQBA 3P79A 2YWPA 5FP5A 3FBVA 2ESMA 4RC2A 3V8SA 3S0OA 2IN6A 3DKCA 3D5XA 3FQEA 4YURA 1GJOA 4FNYA 2OH0E 2VWZA 5T68A 3LVPA 4F7LA 1K2PA 3MWUA 4OAVB 3FPMA 3RWPA 3UYSA 5IA5A 2ITYA 4Y8DA 1Z57A 3SHEA 4WKQA 3PRIA 2OJFE 1XH4A 4YLJA 5HCXA 1REKA 3PA5A 4WNKA 5EHOA 5AIKA 2ZV7A 3LCTA 3U4UA 4DT8A 2CNQA 5DI1A 3BLHA 3KFAA 2BUJA 5FEDA 3R6XA 4XEYA 4BF2A 4O2ZA 5JFSA 4JQ8A 4O2PA 4WUNA 3FZ1A 4N6ZA 4ZP5A 4EL9A 5IUIA 3GOPA 2DQ7X 2OIBA 4HGLA 3UQCA 5BV3A 3EMGA 1YOJA 3OEZA 4L7SA 2G2HA 3KQ7A 3RZFA 3ZDIA 4F1OA 4D5KA 4ZY5A 2XB7A 3VUIA 2WU6A 3PYYA 3QRUA 1U5RA 4XG7A 2PZ5A 2NP8A 2VWBA 3MPAA 3OWJA 4BZNA 2YIQA 2B0QA 2WIHA 4UWYA 4U0IA 4D58A 1WMKA 3Q9WA 3OCBA 5BYZA 5LVPA 1T46A 3QZIA 2YEXA 4X6QC 3MS9A 4YNEA 3NUUA 4YO4A 3FMMA 4JI9A 4D2WA 4EK8A 3GU5A 5ANDA 4ANQA 2UW9A 2IEWA 2BDJA 4FK3A 4KBAA 1W2DA 3BEAA 4TYGA 3IW5A 4V01A 5TT7A 4GIHA 2Q0NA 3NX8A 5EYDA 4YZ9A 3NNXA 3HEGA 3ZLYA 3BL7A 5C4LA 3R02A 4RSSA 2W1ZA 1FMOE 2JDSA 4LOPA 3VUTA 1M2RA 5BUIA 4FSRA 3QQGA 3AC2A 3NDMA 4IAFA 3W8LA 2EB2A 4EJ7A 4EZ3A 2BAKA 2VO0A 4C02A 5JQ8A 4N70A 3BX5A 4UB7A 4BRXA 2UVZA 4TYHB 4XHKB 3DBCA 4EHEA 4L42A 5HD4A 3GQLA 3OTUA 1HCLA 4H39A 2BALA 4O7VA 3D2IA 3OVVA 4FOBA 4GW8A 5EDRA 4LQMA 1YOMA 3BI6A 3UOKA 3AKJA 1JQHA 5CF5A 2EU9A 3SD0A 4YBKA 5IA2A 3FE3A 4NK9A 5EOLA 1GZNA 3RHKA 1WBOA 4XBUA 2ERZE 4BCJA 5BYYA 4DHJA 4HGEA 1Q61A 2BIKB 4V05A 1YXTA 3GQIA 1JOWB 3QAME 1UU9A 4FGBA 5CAPA 3K5UA 2ERKA 5C8MA 3BLRA 4AGDA 3SX9A 4GRBA 3WIKA 3PVUA 3MIYA 5AX9A 3WE4A 3TUDA 4TWOA 4IBMA 3KULB 3K3IA 3PA4A 3SKCA 3F2AA 4XP0A 4YZCA 3FLYA 3R1YA 4EH6A 3HAVA 2G2FA 2VO7A 3RAHA 4IZAA 2OGVA 2OO8X 5FGKA 3V5QA 2IVUA 1TQPA 1SNXA 3EN6A 2RG6A 2OF4A 2YA9A 2J7TA 4EEVA 4KINA 3LPBA 4UZHA 3PXRA 4X7QA 4QNAA 4FKSA 2PU8A 5BMMA 3I7BA 4V0GA 3O0GA 4F63A 4FR4A 4F6WA 5HNIX 3LMGA 2YCSA 4HYUA 4D1XA 5AEPA 2NYAA 4BIEA 3OT3A 3HMOA 3KK8A 3I60A 5I4NA 1YI3A 3FMEA 2GHLA 3WZKA 1YQJA 4KBKA 3CIKA 2RKUA 2HY0A 2PL0A 2R3KA 3QRJA 3QU0A 3F3UA 4FV9A 3MN3A 1URWA 3BLQA 4U80A 3R83A 3HZTA 3LFEA 2E9UA 4M66A 3CJGA 4R3PA 4EH5A 4WG5A 3I7CA 5I9WA 5TOZA 3TCPA 1Q99A 4BTFA 1SVGA 4FYNA 4G6NA 3DS6A 4TW9A 1TQMA 4HGSA 5M56A 2BKZA 2X1NA 3C4WA 4ZMFA 5DR9A 3G33A 1L3RE 4KBCA 3TIZA 3JYAA 3OG7A 5A4EA 4O4BB 3UP7A 3IDPA 1W2FA 1ZARA 3FZTA 3HMIA 4YTHA 3E8CA 4AXEA 3UBDA 4O0WA 2JDOA 3P7BA 4FYOA 5AR3A 4G3FA 5D9HA 4LL0A 5CT0A 1VEBA 3EQCA 3BLAA 5IQCA 3UDBA 4I5MA 3ZZEA 2XA4A 4I6LA 3KN5A 4F78A 2CCIA 4QTDA 4ALVA 4ITHA 1U54A 2R9SA 2UZTA 1IA9A 4JBQA 5LWMA 4AS0A 2JLDA 4WG4A 4D4VA 4D55A 1AGWA 1Q3DA 2BZHB 3VC4A 4AXDA 3FMDA 5HCZA 5LVOA 4AUAA 4CG8A 3O71A 3UG1A 5DOSA 3EQIA 5HG5A 2VX0A 4U5JA 4R7IA 4TWCA 4MUQA 4QMYA 4O84A 1G5SA 4YU2A 4BI1A 5KMKA 3PY0A 4C59A 4RWJA 3F61A 5HU3A 3UYTA 5HO7A 5HTBA 3EN4A 3MY0A 2VTPA 3B8RA 3F3ZA 3PY1A 3E5AA 4IM3A 5CQWA 5L8JA 1ZWSA 5DT0A 4FVRA 3O8UA 1G8SA 4AZVA 1ZRZA 3OY1A 3JS2A 4O4DA 2WMAA 3BGZA 3Q4UA 4TL0A 4PDPA 2HZNA 3SC1A 4YUQA 2RG5A 1H25A 2O5KA 4AW5A 3PJ3A 4CNHA 3HECA 4W8DA 3ZEWA 4KIKB 4S33A 4W9XA 2ZFYA 2VTMA 3A4OX 5L2TA 4QDVA 2QODA 1PXIA 3O51A 5LVLA 5HICA 4X0MA 3M42A 1SM2A 5ANKA 4XYFA 2ITNA 2W1EA 4BDCA 2IWIA 2VAGA 4Y95A 3TM0A 1SMHA 2ZM4A 5E8YA 4EQCA 2QCSA 4BN1A 4D5HA 4NW6A 5CF6A 4FE2A 3VRYA 2VTTA 3DAKA 2YCRA 4KSQA 3OXZA 4IW0A 2XK7A 4FEUA 3BWFA 2JAMA 3IW8A 3HV6A 4CKJA 4NM0A 3QTWA 4O83A 3IS5A 4PNIA 4JNWA 2W1CA 3IK3A 5L3AA 1OL7A 3QTQA 3QUDA 2XBAA 1ST0A 4ZTRA 4U79A 4FSNA 3ZRLA 1OPLA 5E1SA 3O7LD 1NT2A 2OJIA 3C5UA 5DGZA 3H30A 4I4EA 1IAJA 3UDZA 4CCUA 2PMOX 2XK8A 1PXKA 2BPMA 3BBWA 2R3HA 4QTAA 4EUUA 1H01A 2F49A 3DPKA 4FEQA 5EOBA 4MEDA 2J0MB 3D5VA 5IEYA 1ZYCA 3QQFA 4FVQA 2R5TA 2PY3A 2C1BA 4XG3A 4NTSA 4FSUA 5BVOA 4BDKA 4YTCA 3POZA 2UVXA 3F2NA 5EYCA 3C13A 3R8MA 1JNKA 4O27B 3PP0A 3V6RA 2UVYA 3H0ZA 4C4EA 4G31A 4L3PA 4BDHA 2HXQA 4KIQA 1IA8A 2VNYA 2W7XA 1H28A 4MBIA 4Z7HA 3UTOA 5F94A 5AP4A 4BJJA 1H08A 2VTJA 3Q9ZA 4I22A 3ATTA 3CTHA 1YWRA 4DE4A 2FSLX 3ELJA 4MHAA 4ZTNA 3CKWA 3DXNA 3UC3A 4BKJA 2W96B 5HO8A 2XBJA 4W4VA 4G3GA 4JDKA 4TNBA 3TN8A 1DM2A 5JGBA 5L2WA 2GFSA 5B2KA 2JGZA 4DGGA 4G1WA 5K0KA 4FK6A 4WBOA 3OUKA 2WIPA 3KMWA 4XV2A 4Z55A 3PIYA 2ZDUA 4PDSA 3DZOA 4HGTA 3TZ8A 4L45A 3CQEA 3EH9A 1A48A 3ZHPC 3WYYA 3SW4A 1WBPA 5M55A 4FNZA 3MFRA 3OCGA 3TDWA 2G9XA 3PRFA 2ZMDA 2VTOA 3S4QA 1ZYSA 5FQDC 4DLIA 2QNJA 2HIWA 2B9HA 3FLQA 4QP6A 3ACKA 3OUNB 4JLCA 2GS7A 1CMKE 4F64A 3O96A 3ZM4A 3BYUA 4JIKA 4UMPA 4EK6A 4QRCA 3EZVA 4IXPA 2C5OA 3HX4A 4FUYA 4O0VA 4AGCA 2VO6A 5DHJA 4QQTA 4A7CA 1RQQA 1Q5KA 4C2WA 1XKKA 4A9YA 4DEIA 5JK3A 1JKTA 3EQHA 5EM5A 5CLPA 2PZIA 3UNZA 2Q83A 4FEWA 3VN9A 3RPVA 4QQJA 1UVRA 3G0EA 3SOCA 3GEQA 2W4JA 4EYMA 4DFYA 2EWAA 2GNFA 3KVWA 3NAYA 5AV1A 5F9EA 3EFWA 5K4IA 1W2CA 2PVNA 4A07A 3VHKA 2XVDA 2ZVAA 4F7JA 1S9IA 4FICA 5JMSA 4Y46A 2OH4A 4A4LA 4AXFA 1H1QA 1AQ1A 3C50A 5DVRA 4U43A 5B7VA 3FXXA 3W0RA 3LFDA 3RINA 3QWJA 1XBAA 4IZ5A 4Z9LA 1KSWA 1YHSA 4EOSA 2NRYA 3FWQA 5JGAA 2EB3A 4BDDA 2F7XE 3EN5A 4IWOA 1SNUA 4R5SA 2PVFA 4YNOA 3TV6A 5FDPA 5ANIA 3LQ5A 3HRFA 3PE2A 4M8TA 1LEWA 3CXWA 3KF7A 4L53A 3UO5A 3OY3A 5CI6A 3LFQA 4GJ2A 3SAYA 4O86A 3NW5A 1OKVA 3LM5A 3NUNA 4JRNA 5CEMA 4M15A 2CSNA 1PXNA 1ZYJA 4IB5A 4DEBA 3QC9A 4FT9A 1Q4LA 4O21A 1ZMUA 3NNVA 3EFKA 1Q8YA 4RQVA 4KABA 3DK6A 1YDSE 2QLUA 3F9NA 4HVIA 4YHJA 3R71A 4XRJA 4RFYA 3D7ZA 3BGQA 5FWKK 2XZSA 5CVGA 4R78A 2QOIA 3PTGA 3KVXA 3D9VA 2YM4A 2ZV8A 1OL6A 1ZOEA 4XOYA 3HMNA 1H0WA 4RIXA 1YVJA 3BV2A 3QTXA 4QTEA 3T9IA 5AV3A 4TXCA 2H96A 1XJDA 4Q2AA 5GZ9A 5CVHA 2W4OA 2YHVA 3R30A 4UX9A 3TJCA 4MXAA 5FM3A 3WZJA 4KSPA 2PUNA 4D2SA 3MESA 4ZSJA 2JDRA 1GAGA 1P14A 2JFMA 3COIA 2PZPA 3LJ0A 4FA2A 2J0KA 4FKLA 1Y8GA 4HNIA 4PP9A 1UU8A 4EHVA 5HLPA 3D0EA 3W8QA 3RK9A 1FMKA 3IW6A 1GY3A 2FSTX 5FD2A 1V0PA 3KXNA 4PPCA 4XNEA 3ZTXA 2Z02A 2OZAB 5EQEA 1Y6AA 2QOQA 4EWQA 3V5LA 2X7FA 2P33A 1O6LA 3QRKA 4H1MA 4N6YA 3NVKI 3ZSHA 2HW7A 3WF9A 3NW7A 2W0JA 1Y91A 2X4ZA 4CFNA 4YJQA 2BILB 3HYHA 2PE2A 5HBJA 4QYGA 3LFNA 5AP1A 2BDWA 3I4BA 4B9DA 3UVRA 4ITJA 5A6OA 4MNFA 4FIEA 4BGHA 4CZUA 2GQRA 2ITOA 3MFTA 3GC8A 3UP2A 4CYJA 5LMKC 2CN5A 5JSMA 4FKVA 4ZLYA 2J6MA 3KRLA 3PPZA 3FUPA 5KMLA 5CNNA 1QPDA 2W99B 3PVBA 3UZTA 4JXFA 4LV7A 3JY9A 2IVVA 3LE6A 5HE2A 3DLSA 4PPBA 3F66A 3W2QA 3FI3A 4NCTA 3EN7A 2BRHA 5EYKA 4RX5A 3GC9A 3R2YA 2C30A