4OBPA

Map4k4 in complex with inhibitor (compound 29), 6-(2-fluoropyridin-4-yl)pyrido[3,2-d]pyrimidin-4-amine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
298
structure length
285
Chain Sequence
IDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Discovery of Selective 4-Amino-pyridopyrimidine Inhibitors of MAP4K4 Using Fragment-Based Lead Identification and Optimization.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 285
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4obpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4obpA01
3TNPC 3G9NA 4LOOA 1U4DA 5D7VA 4NL0A 4D4YA 3RPVA 4CFMA 4PMSA 2FSOX 3R7OA 3OY1A 3Q5ZA 2YLEA 4EHZA 1YHWA 3HNGA 4KIKA 4F08A 4FSQA 5IQDA 3ZTXA 4JOAA 3GGFA 1O9UA 2QU6A 2OKRA 3MESA 3MH3A 4O84A 1PKDA 3JUHA 3NNUA 3W10A 3IW5A 4QQJA 2EXMA 4TT7A 3I4BA 4DGMA 4J71A 4QMOA 4FIHA 5E4HA 4FUYA 2PUPA 4S30A 4DFUA 2W1IA 3LFDA 1YWVA 4JBPA 3TKUA 3UVPA 1NT2A 2HXLA 4U81A 4R1YA 2YISA 2B7AA 3OROA 4IVDA 5L8LA 3DCVA 1DM2A 4ASXA 1JSVA 1ZAOA 3FZPA 3RAWA 3MA6A 4JNWA 4AZVA 2QKRA 5EW9A 5EQEA 1YHVA 4IX4A 2O2UA 4R3CA 3D94A 3UO5A 3ALNA 4I5HA 4RIYB 2JDSA 3KULA 2PE1A 3REPA 4RC2A 4FV3A 2NPQA 4I5PA 4GVJA 1B38A 2OJFE 3I5ZA 3F5UA 4JBVA 5H2UA 4QQ5A 1WBSA 3UOLA 4IZAA 1XJDA 3A8XA 3F82A 4IC7A 3UG2A 4E26A 4EOIA 3O17A 3QTXA 3FL4A 3UZPA 5M4IA 4WBOA 5AUUA 4LM5A 4YZCA 3QU0A 5HE2A 1WBWA 2VO0A 4KKEA 2QOQA 3A7JA 3RKBA 3W2OA 1CKPA 4R8QA 1BYGA 4MNEB 5TO8A 4E93A 2XH5A 5HGIA 2YERA 3UZTA 4O0VA 5EYCA 3GC0A 4PTGA 4RVMA 4IAFA 3RPRA 5HEZA 4NIFB 3AXWA 1PXLA 3VO3A 4CEGA 5M08A 3ULZA 5EH0A 4EHVA 5LMBA 3DK7A 3F61A 3LCKA 3ORIA 3QTIA 5AR3A 5TE0A 3ZUUA 1Q8ZA 4AXAA 4C33A 4Q9ZA 3DJ7A 4QTBA 3VULA 4PMTA 4ZTSA 2R3NA 3VBTA 3PPJA 3ZXZA 5G1XA 4ZY5A 4RFMA 4IE9A 5CEIA 3DQXA 4G5JA 4X0MA 3U55A 2AC5A 3G2FA 4IVAA 2BRMA 3VS6A 2J4ZA 1OM1A 2E2BA 3TV6A 2O65A 3OWPA 4OTFA 4QTAA 1J3HA 3D2IA 2GFSA 2QONA 3SD0A 4ANNA 2UZBA 3GP0A 2W5HA 4GVAA 3DBQA 3GNIB 1RQQA 3T9IA 4HVSA 3DXPA 2XYNA 5HHWA 4H1MA 2OF4A 3U87A 3P86A 3B2TA 2WTJA 3BBWA 3R8MA 5JH6A 4AUAA 1Z5MA 5HVJA 4FV0A 2PL0A 4ACGA 4GJ2A 5CASA 2W0JA 3TKHA 3ZONA 5EDPA 4JXFA 2OLCA 2VUWA 2WU6A 4HW7A 2CNQA 2ZM3A 1LUFA 3RJCA 4ZMFA 4M8TA 5AP0A 1XO2B 2YCSA 4MBLA 2W1FA 2W9FB 3JY0A 3P08A 3KN5A 4EH6A 3H4JA 3MWUA 4FTIA 4GK3A 1ND4A 3E8DA 5FM3A 4ERWA 2OFUA 3FI8A 4O38A 1R0EA 2BILB 3MSSA 4Y5HA 5IUGA 5CU0A 1DI9A 3ODZX 4XV9A 3CGOA 3PYYA 3QQKA 4X6QC 3OTVA 5A4TA 1DAWA 4I94A 3NX8A 4CFNA 5HI2A 3GFWA 2CCIA 2YM3A 1OKZA 3QRTA 4OLIA 4ASZA 4C58A 3RAHA 2XNPA 4M7IA 4YJNA 4AN3A 3IO7A 3IGOA 5E8WA 3P9JA 3Q60A 4EZ7A 4AF3A 2OGVA 2QG5A 4QD6A 4QMLA 5E8SA 2YWVA 3V51A 4QQCA 3ERKA 4I20A 2ZV2A 2YEXA 4O2PA 5CU6A 2YIXA 4FEQA 3QTRA 1OKYA 4KSPA 2GS7A 3CY2A 3N4VA 5AV3A 2ACXA 1GNGA 2H34A 3PP1A 4CT2A 5BUEA 4YGAA 4DTKA 4OTDA 3GCQA 2J5FA 3MI9A 3R6XA 1PHKA 5ETAA 2WMVA 4QYGA 3E5AA 4IBMA 4LYNA 5FGKA 4EYJA 2EU9A 1H0VA 3NW6A 5BVNA 5C4LA 2BROA 4D2RA 3VUDA 3EN6A 3FI2A 4E8AA 2W06A 5B0XA 4DYMA 4B99A 1UV5A 5AFVA 3NUPA 4BRXA 3EB0A 2O5KA 5FEQA 3R30A 4Y8DA 4FTMA 2Z2WA 4KA3A 2XVDA 4EWHA 5IQHA 4RJ7A 3BHUA 5IQGA 2XNBA 2CGXA 2XK6A 3EL8A 4R7IA 4TNDA 2WTKB 2Y7JA 5B7VA 3O71A 3H10A 4F70A 4QQTA 3KKVA 4KB8A 1LP4A 4JIKA 2VTSA 2PMNX 3UVRA 4TNBA 4R1VA 3TJDA 4BDDA 5CLPA 2PYWA 4FTRA 4EK5A 4JT3A 5KMLA 1NXKA 3AD5A 2C6MA 4G3FA 4IB1A 3UNJA 3GQIA 4TRLA 5BPYA 2QOFA 3KCKA 2ZDTA 3R0TA 2WMUA 5EQYA 3HUCA 2CSNA 4O7TA 4ZTNA 4ZZMA 3FV8A 1S9IA 3F66A 3JXWA 3W2SA 2QKWB 2JD5A 3DK3A 3GCUA 4FKJA 1ZLTA 3GU5A 5T3QA 4FKTA 4M12A 4YJVA 5A14A 3W2PA 3I60A 3D14A 1UU3A 3IW4A 4TWNA 3D83A 4W8EA 2OIQA 3JVRA 3BEGA 1GIIA 4O1PA 4F9YA 4FTUA 3P7CA 2J5EA 3R8LA 2WMBA 3R7UA 3ZS5A 4AGDA 3KK8A 5LVOA 3FSFA 4OT5A 2YN8A 3HMIA 2O3PA 1WBOA 3LM5A 2ITWA 4WSYA 4I6FA 3FLYA 1OI9A 5JKGA 5H8BA 2NP8A 2BRHA 2V7AA 2WQMA 4LUDA 4DEAA 1YWNA 4DCEA 4NM7A 3S0OA 1XH4A 4EOSA 4PF4A 5HD4A 3HUBA 4EKLA 5L8KA 3NAXA 2C0IA 4JVGA 3RHXA 2UZUE 3BCEA 3MFSA 3DBDA 4TYHB 3L1SA 4HGLA 4ZSEA 4QMTA 4RJ3A 4C35A 3SG8A 4N6YA 2OWBA 5DIAA 3FZOA 3DZOA 4CG9A 3AC8A 3LVPA 2QO9A 4GKIA 5KHWA 2Z8CA 3C7QA 3D7ZA 3DS6A 3NVKI 3ALOA 2J0KA 1W7HA 2ONLA 5FG8A 5J5TA 4PL5A 5C4KA 4YC3A 3ET7A 3TJCA 4USFA 1Z57A 2R64A 4MXZA 3FC2A 4OBOA 2G1TA 5BVKA 2YFXA 4AZSA 4BZNA 2Y4PA 5L2SA 1UVRA 3AMBA 3FY2A 3NAYA 3Q9YA 3TUCA 1M2PA 3CP9A 5HE3A 2R0IA 1YXUA 4FIJA 4KAOA 4X3FB 3BU5A 3O50A 5EM8A 4D9TA 3BWJA 3QQLA 5BMSA 1H1RA 5FEEA 1YVJA 5JT2A 3QQHA 5I9UA 5DT0A 3UDBA 4B0GA 3LQ3A 4R7HA 4YC8A 4DEDA 4G9CA 4D2TA 2IVSA 1HCLA 2W5AA 1K9AA 3E7VA 3F5XA 4WRSA 4A4OA 1Q97A 4U97A 4CG8A 4CCBA 1RE8A 2WTIA 4DG3E 3DJ5A 1ZMVA 2ETKA 3TI1A 1OBGA 4F64A 2WQEA 2WIHA 3BPRA 3DNEA 2R2PA 3QYZA 3E3PA 1BI8A 3KK9A 5EOBA 4EHEA 4ENXA 3AC5A 3QC9A 4BWKA 5EYDA 3Q4UA 3UC3A 5HG5A 1H1WA 4DTBA 2Y0AA 3WIKA 5HQ0A 4BF2A 5DRDA 5JEBA 3AGLA 3RAIA 4UMUA 1CDKA 1REKA 1OL1A 3RNIA 5L2TA 3GI3A 3MGYA 3ATTA 5LMKC 2RFSA 3P7AA 3PIZA 4C0TA 3RMFA 4D2WA 3RWPA 3LFAA 2XB7A 3EQGA 3TDVA 2BR1A 3MFUA 5TT7A 3IGGA 4FIFA 4ZSAA 3NMUF 1L8TA 4A9YA 3CEKA 1S9JA 2A19B 3RZFA 3S1HA 5KZ0A 3RK5A 3SXSA 4ZLZA 4C2WA 5A4CA 3NR9A 3ACJA 3BWFA 4CTBA 3GEQA 1H00A 5LVPA 4MK0A 1Q3WA 4RVLA 2RFDA 4BGHA 3UO4A 3S4QA 4C3FA 3QBNA 2W1DA 3R9OA 2YM6A 4BCHA 4BCMA 3D5XA 4I92A 4H58A 4PP9A 4LV5A 5L2IA 4RVTA 1ZY5A 4O2ZA 4LGDA 1FVRA 4J52A 2QHNA 1H24A 3ORLA 4LL5A 3RM7A 3SRVA 5AUTA 5EQPA 4U5JA 4KBKA 3DGKA 3LCDA 4C4EA 4U8ZA 2X2KA 3R1YA 4GUBA 3D0EA 3E64A 4WSQA 5HKMA 4TW9A 3UC4A 2G9XA 3IKAA 4V05A 2GNJA 1J7UA 5IQAA 3F6XA 2XCKA 4NM5A 4RZWA 4EK3A 3IDPA 3MPTA 3VS1A 3R7EA 1XBCA 4C2VA 1U54B 4D2PA 1MRVA 2QC6A 4KINA 4PDSA 3NYOA 4U43A 4EBVA 3U54A 2HCKA 2XEZA 4I6QA 3RALA 3F5PA 3R02A 2ITVA 4MKCA 3SQQA 4MBJA 1V0BA 4U9AA 4D2SA 4DITA 5IZFA 2PZ5A 3QWKA 1OBDA 3LJ2A 3FMMA 4EWQA 3F2AA 3VUIA 4FEUA 4JS8A 3PPZA 4U3YA 2PVLA 3CJGA 3OFMA 4XV2A 4ANQA 3PA3A 3Q4ZA 2ZV7A 4XCUA 4A4XA 4XEYA 3KU2A 4DN5A 4D4VA 2Q0NA 4XOYA 3UO6A 5HNIX 3A8WA 2YIWA 3CPCA 4FODA 3NZ0A 1CTPE 3KMUA 4FK3A 3B8QA 3W55A 4GK2A 2X2MA 2XBJA 4Y83A 3UTOA 4APCA 2BRGA 4C4GA 2O63A 3UIUA 4J96A 4O7ZA 3DU8A 4IMYA 4L9IA 4FNYA 3DBFA 1CSNA 3QUEA 2UW3A 4V04A 4U7ZA 3EH9A 4ENYA 2UW7A 4ZS4A 5LOHA 1LR4A 5CY3A 4AZFA 1PRYA 4WKQA 5I9ZA 1YW2A 3HP5A 2GQGA 1ZY4A 2PK9A 3E63A 1AD5A 4G6OA 3PWYA 4QMWA 5KBRA 4UMTA 5AUWA 2XJ0A 4QNYA 5HNGA 4BZDA 4E4XA 3R21A 4XV1A 4KSQA 3ACKA 3ZO4A 3U9NA 3AT2A 4XH6A 2IVVA 3ZC5A 1UNHA 5IA2A 2QOKA 4YZ9A 5HBHA 2PULA 5GINE 3OP5A 2HY0A 4CLIA 4IWPA 4QP4A 1MP8A 3DFCB 5L6PA 3CE3A 4FL3A 2OIDA 1XH5A 4MNFA 3KY2A 5CEQA 3DDQA 3QLGA 3N4TA 4AZEA 5J7HA 1PY5A 3TCPA 4YJOA 5HCZA 1FPUA 5GZ8A 5JSMA 3PDTA 4WBBB 4GG5A 3UMWA 4BBFA 5CZIA 2VNYA 3R63A 4RIXB 1BX6A 2B4SB 2VTNA 2EB3A 3WZDA 4USEA 4ZOGA 4BCFA 2C0OA 4YHTA 2LAVA 1W83A 4CZYB 4FIIA 4F6WA 2XJ2A 4CQGA 3U4UA 2R3OA 2CNVA 4XBUA 2VTHA 3DXNA 4BCKA 4CVAA 4IWQA 1KSWA 2JIIA 2R3LA 4RPVA 1R0PA 3EQDA 3GFEA 3QD0A 2QLQA 5EYKA 5CQWA 3ZDUA 4FYOA 4MEDA 2YM5A 5AP7A 3FE3A 4F4PA 4E20A 3LPBA 4KIKB 4XNEA 5CVGA 4C4JA 1XKKA 3HDNA 2PVJA 2UW4A 4FG7A 2JFLA 1P14A 2PUUA 4K33A 1OL7A 4MQ1A 3QRUA 5DRBA 3W2CA 2IPXA 1Q4LA 4X21A 5CT7A 1KE9A 4BTJA 4HGEA 4JBOA 3GXLA 3CPBA 3TN8A 2EVAA 3R01A 4EUTA 2JDVA 2FA2A 4RT7A 2XEYA 3O8PA 5LARA 2JFMA 3DKGA 5DLSA 3SOAA 3WE8A 5HLWA 4DH7A 2XIYA 3DFAA 2XNNA 2OJIA 2VTOA 3HV7A 4RX9A 4DGLC 4DEBA 4UZDA 5BUIA 4IFCA 1RDQE 1Y8GA 3UIMA 5CX9A 5DVRA 4QMNA 2UZDA 4WRGA 3BHTA 3TNWA 4YTHA 3WF7A 4FE2A 4G3CA 4CFVA 3L8XA 2W17A 1Y6AA 3G15A 4PDYA 3D5WA 4BKJA 3F5GA 5KMKA 1H26A 3ETAA 2RL5A 2Y4IC 4BDKA 2IW6A 3OEZA 4J97A 3HLLA 3KULB 2VD5A 3OC1A 4JBQA 3ORTA 4QO9A 5C26A 5IPJA 1OKWA 3GOPA 4G16A 3QZGA 4FX3A 4YNOA 3QD2B 4MCVA 1IA9A 5CEMA 4IFGA 4PNKA 4F7NA 1IR3A 1A9UA 4J7BA 4TWOA 5AM6A 3T3UA 3K3IA 1XBAA 1NW1A 4BZOA 3T9TA 3WE4A 3RVGA 2WOTA 1V1KA 5I9WA 3K54A 4TN6A 1QPJA 4A07A 4HVIA 4DCAA 2LGCA 4RSSA 4D1XA 4GK4A 4W4YA 3VW6A 3GENA 3HA6A 3WIGA 2FSLX 1FINA 2VWWA 4G6LA 4KBAA 3ZSHA 4O7LA 4X2NA 3V01A 4BIDA 5CSVA 1P4FA 4M67A 4DLJA 3BYVA 3H0YA 2YA9A 5T68A 2W4JA 2P2HA 3WZEA 3CD3A 2WO6A 5HBJA 3CQUA 4MBIA 5HX8A 3PFQA 3R8UA 1H8FA 3FQSA 2C1BA 4Y73A 3VBYA 1H27A 3E3BX 5A6OA 5E1SA 3S2PA 3DDPA 3OCSA 5F4NA 5IF1A 3MJ2A 2JKMA 2YZAA 1DS5A 3EQPA 3DV3A 2VTMA 4RIOA 5KUPA 1OVEA 1GZ8A 1H28A 4FUXA 4S33A 3NRMA 4QP3A 1H01A 2J0JA 2W4OA 1I09A 4FSTA 2BAJA 3ANQA 5CQUA 4EJNA 3RK7A 4S31A 4RC4A 4L43A 5CVHA 4EHGA 4LMUA 3BZ3A 4HNIA 3VQUA 3G5DA 2V5QA 4FKRA 4FSMA 1YXTA 3LFQA 2UW0A 3PE1A 3QALE 5BNJA 3VUTA 1BLXA 4JJRA 1KE6A 3U51A 4IDTA 5AIRA 2BAQA 1P5EA 4O96A 2C6IA 2HK5A 1SVEA 5AV1A 3RZBA 2UVZA 1K2PA 3BU6A 4K0YA 4W9XA 2J6MA 5E91A 3T8OA 4YSJA 3FAAA 3F3TA 4QP9A 4PPCA 4Z9LA 2XKDA 3VN9A 3K5UA 3LFFA 4BVUA 3ZFYA 4OTRA 5FUTA 1VYWA 1ZXEA 2A4LA 2GTNA 4MAOA 4EUUA 5HORA 4FSZA 3MIYA 2YDJA 5DFPA 2JC6A 3UG1A 3WZKA 2GNGA 3OMVA 3QC4A 4DHFA 4NW5A 3PUPA 3ATSA 3G6HA 1BI7A 1PXIA 5CI6A 4FOBA 3MDYA 2X39A 5KKRC 1F0QA 4O27B 1VEBA 3C0GA 2GNFA 4G9RA 3MTFA 5K0XA 1OMWA 4W9WA 2C68A 3OT3A 5IH6A 3R1NA 3D15A 2Q83A 3BGZA 3L9LA 4WHZA 4FKUA 4PTCA 4O7RA 3PA5A 3H9FA 3NYNA 2VNWA 4FYNA 5CU3A 4YHFA 3UBDA 4EOPA 5KMIA 2W5BA 4DGOA 1A48A 3WBLA 4J8MA 4FGRA 4YP8A 5C8MA 4LMNA 2ZV9A 3QTSA 2OI4X 3E92A 4XG2A 1TKIA 2DUVA 5AMNA 2QR8A 3EKKA 3W8LA 4FICA 1NVQA 5DGZA 5BVOA 2CDZA 4M84A 2R3KA 5AAGA 3OUKA 2X7OA 3EQIA 5M06A 4FV6A 2QOIA 3EFLA 2X7FA 3V5QA 4E4NA 3EN7A 3ZRMA 3CKXA 4XP0A 5FBOA 4GIIA 1SVGA 3C4CA 3IQ7A 4Q2AA 4LQMA 5DN3A 1J7IA 5DHJA 3RCJA 3CQEA 3OWLA 1YI4A 2PVYA 2VX3A 3K2LA 3KXMA 4YBKA 3MVMA 5CALA 2JDRA 5E90A 5AA8A 4UBAA 3OCTA 2YCFA 4E5AX 5F9EA 5FDXA 4TYJA 4TYGA 4UZHA 4BIEA 3F3VA 2DWBA 5C03A 1ZYSA 4AW1A 4BDIA 3FBVA 4IX5A 2PU8A 3FLWA 2XZSA 3BGPA 4GT5A 4GT3A 2RKUA 3KN6A 4IHPA 4AU8A 3HECA 3PSBA 1XR1A 3DA6A 4MD8E 3OTUA 4I4FA 4EJ7A 5GHVA 4I5MA 3EYHA 3B2WA 2ITTA 4EOMA 3DNDA 5BUJA 4UB7A 4ZAUA 2GPHA 3PXQA 5KBQA 3LFSA 3ZZWA 2ERKA 1B39A 4JDHA 3V8SA 3FMNA 1R1WA 3C0IA 1M17A 2CKEA 2IZTA 1B6CB 2CLQA 4YO6A 2Y9QA 3H30A 4G1WA 3Q5IA 4V0GA 5DR9A 5D7AA 3LM0A 3OEFX 5I3RA 3KVXA 3SXRA 4JG8A 3GT8A 5ETFA 4K6ZA 3UP2A 4O0SA 2YAAA 4RX8A 1SNUA 4S34A 5HVYA 2WGJA 5HESA 1QMZA 3DTWA 4M97A 1H0WA 3RM6A 4UEUA 1UKIA 3Q9WA 3EYGA 2OICA 3W18A 4YMJA 1Z9XA 2QU5A 3QCXA 5IU2A 2EXEA 4O0RA 2GFCA 3WZUA 2BDWA 4HVDA 4O83A 4GCJA 3G51A 4YPDA 3GCPA 5HCYA 5C01A 4FV7A 4DA5A 1IEPA 3TZ9A 4IXPA 3UQFA 2JITA 2WQOA 3FKOA 4RJ6A 3WF8A 4FL1A 4HPTE 4KS8A 2V55A 1KE8A 4F63A 4K9YA 5HZNA 2JKQA 2RFNA 3MY1A 5LMKA 2ZDUA 4JX3A 4CT1A 2H6DA 2QO7A 3R9DA 2UVXA 3OCGA 4FZDB 4OAUC 4XRLA 1KE7A 3L8SA 4FKLA 3FXZA 5HE0A 3I81A 3DKFA 3LMHA 4DEEA 2R3GA 2ZOQA 1FMOE 4LRJA 2BFYA 3H9OA 1SNXA 3AC2A 3LMGA 5IH4A 2QODA 3PWDA 3O8UA 3W2QA 3ORXA 4KBCA 4DG2E 1R3CA 3D4QA 4EOQA 5ANEA 3H0ZA 4EK4A 3A2CA 1GIJA 3QCSA 4Z3VA 1UWHA 3A60A 2YACA 3O96A 5DNRA 4E7WA 2QG7A 5KMNA 4ITJA 4K1BA 5DA3A 4ERKA 1NA7A 2OG8A 1P4OA 2X6DA 4AGWA 2CCHA 4ZIMA 5K3YA 2E9OA 3F3UA 4BI2A 3EQBA 1FOTA 4RWLA 2C5XA 4ZXTA 4DTAA 4AA0A 5FD2A 4FK6A 3AT3A 3UZRA 1MQBA 2ZV8A 3LHJA 1IG1A 5HO7A 1SVHA 2CLXA 3GOKA 3PSDA 4A9TA 2WAJA 3JPVA 4IZYA 5IG1A 3KXHA 3FKNA 3ZC6A 5IDPA 3V8WA 3Q2JA 3KFAA 3OW3A 1R39A 3ZFXA 3H3CA 3PVWA 3I6UA 3AMYA 3I0OA 5FXRA 5HICA 4RWIA 2ZVAA 3FMHA 3KQ7A 3PY3A 5D9HA 2R3JA 2J0LA 3PZEA 1RJBA 4YLLA 4QRCA 3KXZA 2VV9A 3S95A 4DEHA 4Y46A 1OB3A 5AP1A 3BV3A 3E62A 3Q96A 1PXNA 4FEWA 5D11A 3TKIA 3S3IA 4DH5A 3C51A 4AW0A 4YR8A 4DLIA 3D7TA 4A9SA 4FEXA 4DT8A 4PV0A 2XK4A 4K11A 4ZSLA 2VTJA 2XM9A 3ORPA 4C36A 2BFXA 2C0TA 5CWZA 3GU6A 3GBZA 5BVEA 3VJNA 4F99A 2B9HA 2B52A 2C69A 1I44A 3PTGA 2J50A 4L46A 2G2IA 2OH0E 3LZBA 1YDRE 3D5UA 3Q4TA 4XG7A 3W32A 2E9PA 2Y8OA 3SRVB 5ANIA 5CAUA 1TQIA 3TZ8A 2F4JA 4I21A 2IVUA 1Q8YA 2C6KA 3NS9A 3COKA 3MH2A 4L7FA 3FMLA 3VF9A 3VC4A 3SA0A 1KE5A 1QPCA 3EQCA 3LJ0A 3QD3A 3D2KA 3PJ1A 3MVJA 4I6BA 5H9BA 4BCJA 3ZO3A 3C4WA 4BWPA 3LFBA 5CI7A 5J8IA 2V62A 4LOQA 2UZTA 1Y57A 1IAJA 4CXAA 3DOGA 4F7SA 1U59A 2QOOA 2W4KA 3FMDA 2C6OA 4YZDA 2BALA 5HIBA 3TNIA 3BYUA 2G2HA 5LCKA 4JR3A 2PMLX 2WTDA 2WQNA 4FKOA 3HAVA 3VRZA 2F7ZE 1H1QA 4XLVA 5BYLA 3KGAA 3QKKA 5JMSA 2GCDA 3CGFA 3ENMA 3UYSA 3OS3A 3R22A 3A7HA 4U42A 3VS7A 4NSTA 3G9LX 3N9XA 4DG0E 4WNMA 4JAIA 4GH2A 5AR4A 1JOWB 3FDNA 3EMGA 4FTJA 4NKSA 3V5JA 1YQJA 4QYYA 4CFFA 3FI4A 3RGFA 5JFWA 3PG3A 3VUKA 1VJYA 5EM7A 3KCFA 3WF9A 3TTIA 1Q8TA 2ITOA 2C3JA 3C50A 5M07A 4UXLA 2X7GA 1IA8A 1OL5A 3I7BA 4JAJA 3CTHA 3DKCA 3ZLXA 1AGWA 2GNIA 2JAMA 3RWQA 4E4MA 3EN4A 3EZRA 3V3VA 2HELA 1YXVA 4XBRA 2YJSA 3KXXA 4EZ5A 4E3CA 4O7WA 2J9MA 2BZKB 4CZTA 3UNZA 2CJMA 3E7OA 1GZNA 4IADA 4IW0A 5DPVA 5B2MA 1PXPA 2A1AB 1WMKA 5I5ZA 2Y6OA 4Z7GA 4U0IA 4QOXA 3UPXA 2XNMA 4YJRA 4NFNA 1WVYA 4GW8A 3O23A 1JVPP 4UV0A 3PY0A 4O0TA 4IANA 4FTAA 4IEBA 4I22A 5E8YA 1GZKA 5B2KA 4IACA 1PMVA 3DT1A 4IAAA 4M13A 2UV2A 3U8WA 4N4SA 4BDHA 4CYJA 2CKOA 3QYWA 4I3ZA 4BR3A 2SRCA 5L6OA 5E9EA 5CT0A 4E5WA 3UIBA 4PRJA 4YHJA 4I23A 2C5VA 2IO6A 3THBA 1NVRA 4BDGA 2VN9A 1PXOA 1GOLA 4H3QA 4AT4A 3DQWA 1NVSA 5GJGA 3HA8A 3LFCA 3ENHA 3UYTA 4EH7A 3Q4CA 5L6WL 5GIPE 4F7JA 4IM0A 3PZHA 5EI2A 2OBJA 4HVHA 4L8MA 3QX4A 1PMNA 4EH3A 1LEZA 1W8CA 4OGRA 3ZYAA 2GDOA 4BDBA 1KOAA 3F7WA 4EOLA 2UW6A 4FZ7A 5C9CA 1SMHA 5CXHA 4JQEA 3NVMB 3NUSA 4QMQA 5CSWA 5JQ8A 5EFQA 1BL6A 1XH7A 3Q6WA 3R04A 4P5QA 3VAPA 4DE4A 4FSYA 4KIPA 4LFIA 5TF9A 2R4BA 1VZOA 1XQZA 3GB2A 1M14A 4IJ9A 3BKBA 4K8AA 4TTHB 3PRFA 4Y72A 5FBNC 2JIUA 4F6UA 4FGBA 1TQMA 5FP5A 2JBPA 5CU2A 4AE6A 5BVFA 4RRVA 3LQ8A 1KOBA 3CTQA 3QLFA 3LIJA 4AOTA 1WBVA 2YLFA 4L6QA 4WUAA 4BDJA 4TWCA 3SXFA 4F0IA 4ID7A 5GJFA 5ANJA 4AGUA 5M56A 1ZOGA 4RIYA 4RG0A 5ICPA 4TY1A 2BHEA 5CANA 3PG1A 2OZAA 4L01A 3NCGA 5E1EA 3TACA 3PP0A 4N70A 5KMMA 5HG7A 3OBJA 4C4FA 3IOPA 3L9PA 2OFVA 1MQ4A 2GSFA 4BGQA 1FGKA 5K9IA 4G3GA 5LWNA 4UY9A 2X4ZA 2BKKA 3P23A 4QYHA 3DAJA 3CY3A 3NNVA 4D0WA 4QTDA 1JKTA 2FSMX 2VWUA 3ZLWA 4PMPA 3WF5A 3R28A 2UUEA 3PXYA 2CKQA 3EL7A 5M57A 3LXPA 1CKIA 4NM0A 4EQCA 2XA4A 3O7LB 4NIFA 3DB6A 4QP7A 3FYJX 2VX1A 4YU2A 3QZHA 3QF9A 4HJOA 3PJ3A 4P90A 2B1PA 1Q5KA 2J0IA 4DFZE 5BYYA 5LCJA 4BKZA 4F9WA 4M0YA 2IZSA 4M14A 5EW3A 2ZJWA 4AW2A 2I6LA 2OO8X 1W0XC 1Y6BA 3OXZA 5HTBA 1YOMA 3OZ6A 4E6CA 5IQCA 5CEPA 2B54A 4KUJA 2R0UA 5HLPA 2BMCA 4OBPA 4NCTC 4YZNA 4XP3A 4CKRA 3VW8A 3EFKA 2XK9A 3HKOA 4X3JA 2PY3A 3L8VA 3SVVA 4HCTA 3K3JA 2YABA 5DEWA 4RJ8A 3M11A 4OTHA 4FKSA 4GS6A 4HYUA 4JRNA 4X2FA 1YDTE 3KB7A 4UN0C 3N51A 3NUYA 3UOKA 2PE2A 5DMZA 3MIAA 5JFVA 4UMPA 3ORZA 5HO8A 5LVLA 2VTRA 4HYIA 4LUEA 4BB4A 3I7CA 3Q52A 3MPAA 4O7YA 3E8CA 4FSRA 4GUEA 3BRBA 2UW9A 4W4WA 4CTCA 5GZAA 4QMSA 1ZMUA 4RA4A 4IWOA 3CS9A 4MF0A 5GNKA 5B2LA 3MTLA 3EQHA 2NRYA 4S32A 2IW8A 2YHVA 1JNKA 2NRUA 3GU8A 2QNJA 4O21A 4GSBA 3ITZA 5ACBC 4BCNA 4Z16A 4WG3A 3FYKX 1STCE 4FKQA 1ZOEA 4BCQA 4R5YA 4IC8A 3I1AA 3QHWA 3HRCA 5CAPA 3KRJA 2R3FA 2QR7A 2XKCA 4WOVA 4ZMEA 3NGAA 5FXQA 4H1JA 1Q24A 2CKPA 4HGSA 2V7OA 2WMTA 1SZMA 4AQCA 1YOLA 2FYSA 1DI8A 2VTLA 2IG7A 4CFWA 1JKSA 1CM8A 3OUNB 2ZM1A 4QTCA 4DFYA 2CGWA 2YCQA 3G33A 4O6LA 2P4IA 4YJSA 4BTMA 4NZWB 2X1NA 3I6WA 3MA3A 4X2KA 3SHEA 3O0GA 2X8DA 4MXCA 1Q41A 5DBXA 4Q5HA 4P4CA 3QA0A 2PVHA 2XP2A 3FLSA 3M1SA 2H8HA 5CXZA 2RF9A 4FTNA 3VHKA 4FZ6A 3MW1A 4IM2A 4L68A 5AR8A 4C34A 3QQFA 3QZIA 5IEYA 3KEXA 5AP3A 1OL2A 4MTAA 3HL7A 4FIEA 3G0FA 2J51A 1URWA 3COMA 3A7FA 1RW8A 2YIQA 4RIWA 3CSVA 3UJGA 2UVYA 5AV2A 4JG7A 3OD6X 4I93A 4AFJA 4EYMA 4F1MA 4CNHA 2YM4A 2C5NA 4E4LA 1PYXA 3DK6A 1IAHA 4FIGA 2GQSA 2VWYA 2Y6MA 4IZ7A 2WTCA 5JFSA 4L45A 3CJFA 3R1QA 3ROYA 4E5BA 4F9CA 4FTCA 3FZRA 3FZSA 4RZVA 2I7QA 4FTQA 3TTJA 5KMJA 2FB8A 4MXXA 1OGUA 4NJ3A 2ZM4A 2C30A 4BIBA 2P0CA 4QP2A 2XYUA 3RHKA 3ZOSA 3DLSA 5AADA 3NDMA 2BDFA 4OTQA 4JRVA 3IW7A 4KD1A 3ORKA 4QMUA 5E7RA 2HAKA 4UWBA 4IM3A 4KKHA 2PWLA 5E8XA 3EFJA 4GFMA 2HZ0A 2WOUA 4MYGA 2JKKA 4O6EA 3CIKA 3TEIA 5EKOA 3OHTA 4BBMA 3MVLA 4I24A 3BLHA 3C4XA 4GEOA 4P7EA 3C1XA 3W8QA 4PTEA 1JSUA 4GMYA 4W4XA 3ZRKA 4BC6A 2VTQA 2J7TA 4FT5A 4JR7A 4DEIA 1MRUA 3TIZA 4C8BA 4EQUA 5FQDC 1CKJA 5BX0A 2RSVA 5C8NA 3P1AA 3BELA 3UMXA 4TYHA 3UP7A 2UW8A 4YJQA 4A06A 2DS1A 4YSMA 2Z02A 2WQBA 3VHEA 5CYIA 3RP9A 5HBEA 2BRNA 4C61A 4YBJA 2RFEA 3FHRA 4CQEA 1OL6A 2HY81 5K5NA 2WMSA 3TM0A 2XNEA 5D10A 5A6NA 4EONA 2I40A 4JQ7A 4UYAA 3A7IA 3VS5A 4RWKA 3F2RA 3BEAA 2QOLA 5ANGA 2ESMA 4P2KA 2OF2A 2PZIA 4J98A 2XK7A 5IEXA 1FBNA 2QOHA 2VTAA 4K18A 1GZOA 2BZHB 3HZTA 3PJCA 3VUHA 3OWKA 3QX2A 3GC8A 2HZ4A 5L8JA 2GHMA 4MF1A 4X3FA 1OECA 5JGBA 3LXKA 4ONAA 2QQ7A 3LMIA 1TQPA 2RGPA 2E9VA 5BYZA 4DH8A 4FT0A 4G2FA 1APME 5HU3A 5FDPA 4JDKA 3Q3BA 3GCSA 2CPKE 5I3OA 1KWPA 5IKWA 2REIA 5CNOA 2FH9A 4A9UA 2R3MA 4OTWA 3NW5A 5AEPA 1H07A 3GC7A 2EB2A 3AT4A 2C5OA 2GU8A 4NYEA 4XYFA 3PIYA 3ZXTA 1TVOA 4BDCA 3TZMA 3R8ZA 3V5WA 4HPUE 4YO4A 4IZ5A 2WNTA 1XH8A 3VS0A 4Z55A 3CBLA 4XV3A 4O0UA 4MXAA 4ZJVA 3U9CA 4O0WA 2GS6A 2XK8A 2XBAA 3R00A 1O6KA 4AE9A 1M2QA 2BCJA 5C27A 3F3WA 4BCGA 4AT3A 4CMUA 1PMEA 3NSZA 4ITHA 5IA0A 4KS7A 1M7QA 3OXTA 3RBWA 3RCDA 3V8TA 2X81A 4M15A 4ZSGA 4I0RA 4ZSJA 3OT8A 4GYIA 4ZK5A 5HU9A 3NWWA 3TL8A 3ELJA 5LVMA 4P5ZA 3DLZA 4R7BA 2O0UA 5C8KA 3BBTB 3P4KA 4CCUA 1FVTA 2CGVA 2W1ZA 4R5SA 3VBQA 2BZIB 3A99A 4CD0A 3WILA 5CZHA 3QCYA 5FLFA 5CTPA 3QTQA 2ETMA 2BVAA 4E6AA 3NEWA 4XJ0A 4F0FA 3FL5A 4RJ4A 4YPSA 2JKOA 4IB5A 4YJUA 4MHAA 2W99B 1G5SA 1QPDA 2HW6A 4ACMA 2WIPA 3HMNA 4L67A 4WG4A 4NU1A 2ZYBA 3AD4A 5CVFA 3QTZA 2W9ZB 5K4IA 3ZO2A 2HOGA 4U40A 4CZUA 5DT3A 2G15A 5H8EA 3BGQA 4AGCA 4AS0A 4OTGA 3O51A 5BVWA 2WMWA 3DAKA 3FI3A 4B7TA 4I5CA 3SAYA 2C6DA 2FGIA 5J9YA 2YAKA 3ZZEA 2P3GX 4FC0A 5HOAA 4QP6A 4G3DA 4D4RA 4ANBA 2KULA 4U3ZA 3EOCA 5F94A 4HZSA 1H08A 3CKWA 3E87A 1Q3DA 3R2BA 4GYGA 4HGTA 5FXSA 2ITZA 1EH4A 4CYIA 5CEOA 5CSHA 2XJ1A 3FMKA 2HENA 2UW5A 1U54A 4O1OA 3MBLA 2QHMA 1H1SA 4QMPA 3HV4A 4FBXA 2FSTX 4ZS0A 3MB7A 4RQVA 4C37A 3DBEA 3R8VA 3IECA 5DOSA 1W98A 5FRIA 4B6LA 5LJJA 3LOKA 3GUBA 1YWRA 3UNKA 5IQBA 1PJKA 3C4ZA 2PE0A 2IZUA 2XUUA 3RPOA 4WNKA 4E73A 2R3QA 4EEVA 2I0VA 5DI1A 1PF8A 2XCHA 4FV2A 2QCSA 1SM2A 4PL3A 2VWZA 3UOJA 5CNNA 1JBPE 4XS2A 3EZVA 4C3RA 3V5PA 4AZWA 5EHOA 3JYAA 4ANOA 3GC9A 3TV4A 5EW8A 1OIQA 5AUYA 3C5IA 3KL8A 5EYMA 5CSXA 4L00A 2VAGA 2R7BA 2PZPA 3KF4A 3BYSA 3UE4A 4FNZA 3EJ1A 4DFXE 2I0HA 2ITXA 4ZZNA 3Q53A 5J7BA 2W1GA 3ZDIA 1IASA 2QOCA 4NJDA 4XRJA 4FVRA 4D58A 5C1QB 2X9FA 5DG5A 4B8LA 3BI6A 2C6EA 1UWJA 2OJGA 1G8AA 2CNUA 5F95A 3O7LD 4M68A 4U79A 5IISA 4KKGA 4D5KA 2OJJA 4F9BA 2WKMA 1OPJA 1UU7A 3M42A 3NW7A 3FXXA 4YLJA 4XHKB 4L3PA 1YRPA 2WTKC 4CRLA 2IVTA 3QTWA 4GU6A 5LWMA 5EDRA 2I0EA 4D1ZA 5KMOA 3QXOA 4L3JA 4FKGA 4DT9A 4C62A 3RINA 4QMZA 4AOJA 3HMPA 2V22A 3E8NA 3VUMA 1WBPA 2E9NA 3LXNA 4YLKA 4K77A 4PWNA 5AUZA 4GFGA 5FWKK 5HG8A 3F69A 2ITYA 4BI0A 3QKLA 5E8TA 3KRLA 3FLZA 5HO6A 2VWVA 3FEGA 4C3PA 1X8BA 4HCUA 3LXLA 2JDTA 4H3PA 1VYZA 3HV3A 2VTIA 3QXPA 4LV8A 4MWHA 3IDCA 2J90A 4BICA 5E92A 3ZEWA 3I79A 3TNQB 5DR6A 3FMEA 3F3ZA 4ZTMA 5HTCA 3AC1A 3JS2A 4LRMA 4L3LA 4E6QA 1YI6A 4J1RA 2KTYA 4F6SA 4BHNA 3VIDA 2YCRA 3C4EA 3NUXA 3QA8A 3QUPA 1YOJA 4C38A 4IAYA 4EH8A 4FI1A 3QQJA 4FR4A 5L3AA 1WFCA 4F1TA 3KMWA 3MH0A 4JDJA 5ANOA 2YDIA 3R9HA 5J1VA 4O82A 5EOLA 4GFOA 4ITIA 2WMRA 2R3RA 4RFYA 4MD9E 4GL9A 2R3HA 4GKHA 4AA5A 4BN1A 2FUMA 5L4QA 3S00A 5JN2A 5G6VA 3ULIA 4MD7E 5M44A 4PX6A 1OKVA 1PXJA 2W96B 2GMXA 3KXGA 4FVQA 2BHHA 4FV1A 3NYXA 4FSUA 4Q5EA 1W84A 4HVGA 1E9HA 3BHHA 4ACHA 4R78A 4ZJJA 3LFEA 5DT4A 4KIQA 2JAVA 2GNLA 3LW0A 4F1OA 4AG8A 5EI6A 2JBOA 1YI3A 4G31A 4D4SA 4RLKA 3ORNA 3NIEA 3NCZA 3R7GA 4IX3A 2VWXA 2X4FA 3QRJA 2CN5A 2ITPA 2WFYA 5CENA 1OUKA 4H3BA 4X3FC 3ZEPA 3Q9ZA 4EK6A 5A54A 4U6RA 4XLIA 3VRYA 1T45A 3CXWA 4LL0A 2BUJA 2PZRA 2Y4IB 4QMVA 2B9FA 2QLUA 4FSNA 4AP7A 4A9RA 2XIZA 3FY0A 2WU7A 4X6RA 3QTUA 1UU8A 4FG9A 4L7SA 4EK8A 2Z7LA 2OZAB 5I9XA 4OBQA 4YTFA 4CFUA 3IPHA 1ZZ2A 2PZYA 3FSKA 3FC1X 3VQHA 4QP8A 4EL9A 2PUNA 2XIXA 4XG4A 4XG3A 2IZRA 5EG3A 5EM6A 4CRSA 4QP1A 2VX0A 5AIKA 3L9NA 3QZFA 5EHYA 3C4FA 4MX9A 5FTQA 4EKKA 5CAOA 2R7IA 4NCTA 3PJ2A 3CD8A 1URCA 3F2NA 5D12A 4EBWA 3UQCA 3HAMA 2OW3A 1OIYA 3FZTA 3WZJA 3KXNA 2YIRA 4KRCA 4WD5A 5AM7A 1ZYLA 4IB0A 1PXMA 2UZNA 5EHLA 3ZSIA 2ITQA 3KA0A 4ACDA 5I4NA 4MH7A 2IN6A 1Q99A 1OIUA 4YTCA 3E88A 2RG6A 2R3IA 4F0GA 2C1AA 3LFNA 2PMOX 2DQ7X 5GJDA 3VS2A 1J1BA 4QYEA 4NKAA 4O7NA 3QL8A 4EZ3A 5L2WA 5DYJA 3EN9A 2PMIA 3FKLA 4EI4A 4EH9A 4RQKA 3UQGA 4U44A 3PXFA 3MY5A 4PDOA 4R6VA 3BX5A 2ZMCA 2OK1A 3A61A 3DAEA 4RFZA 3W1FA 2HYYA 4YJPA 1HOWA 4FL2A 5FEDA 5IA5A 3ZHPC 2YM8A 3OY3A 5AP6A 4DINA 2ZB0A 1YDSE 4QMYA 4AOIA 1DAYA 5H8GA 4ACCA 2BDJA 1WVXA 4RMZA 3CLYA 4XG9A 2WXVA 5D1JA 1OITA 3DB8A 3IS5A 3R8PA 3LLTA 3JVSA 4Q9SA 3A4PA 2XK3A 3EQRA 4IJPA 3JY9A 3VS4A 2ETRA 4QPAA 4UMQA 2VTTA 1E1VA 4IDVA 3SOCA 4AN2A 4OAVB 2AYPA 3LCSA 4ZTQA 2BRBA 1ZRZA 2A2AA 3AD6A 1FVVA 1LEWA 1J91A 4EOKA 5LVNA 2PUIA 3II5A 2O64A 3HMOA 1W82A 2X8IA 3SG9A 4YJTA 3VS3A 4DFBA 4FG8A 3R9NA 2H96A 3G0EA 4PPBA 2JLDA 5M4UA 5HVKA 2YDKA 3RPSA 2F2CB 2AUHA 2OJ9A 3AC4A 2PTKA 2F2UA 4JIAA 2J0MB 2JEDA 5KKRB 3EWHA 2BIYA 2P2IA 4O91A 3FLNC 4ZY4A 5KO1A 5BVDA 4C4IA 5AV0A 3R2YA 4RC3A 2R5TA 2EXCX 2XKEA 3FJQE 4H39A 4XMOA 5M51A 5FTGA 4MWIA 5J1WA 5KNJA 5K5XA 2XMYA 4DGGA 5CF4A 5DEYA 4MXYA 3W33A 4M66A 4M69A 4GT4A 2BIKB 1L3RE 3NIZA 2C3LA 3FPMA 4NTTA 2UZVA 5TOZA 4B4LA 2ERZE 2VO6A 2XF0A 4FNXA 5ETCA 3HRFA 3V6SA 3M2WA 4BFMA 2B53A 3D5VA 4L52A 4R77A 4ZLOA 4AX8A 1WBTA 5HTIA 3SDJA 4ASEA 3DTCA 2OXYA 3SW4A 4LOPA 4F65A 2BAKA 5M53A 1U5RA 1G8SA 4ALVA 4IX6A 3C5UA 4RIWB 5IA1A 1XHAA 1ZZLA 4PPAA 2PSQA 2VO3A 1GIHA 4YZMA 4DAWA 3NNWA 4FTOA 5ETIA 1HCKA 4EOOA 2VWBA 3ZBFA 4M0ZA 3QHRA 2OH4A 3EKNA 5LXMA 4EH5A 2PHKA 2R9SA 4D55A 4CKIA 4UX9A 2GQRA 2CGUA 2O8YA 4XUFA 3SGCA 1ATPE 5AR5A 1LPUA 3SX9A 1U5QA 4IWDA 3ZCLA 1ZMWA 3COHA 2F57A 1H1PA 4TYIA 3Q6UA 5CU4A 3LJ1A 5DH3A 4PMMA 4WA9A 4RBLA 4RX7A 2PVNA 3F9NA 5HNBA 2WMAA 2XRWA 4XOZA 4OUCA 3C13A 4FZFB 3B8RA 4LG4A 4B9DA 4EQMA 5CSPA 1JAMA 3KVWA 1Q8UA 2ZB1A 3SLSA 4CKJA 4IVCA 1T46A 3IW6A 4WUNA 2X0GA 2VWIA 5DE2A 4CMTA 3U6HA 3P7BA 3G90X 4LRKA 2BKZA 4WNPA 4RLLA 3P5KA 3LCOA 3A4OX 2WTWA 2GHLA 4RWJA 3U4WA 3UGCA 1V0PA 4CMOA 2HXQA 2QD9A 2QI8A 1KV1A 5IMEA 2ITNA 3SC1A 4XX9A 3ZH8A 1JSTA 3BYOA 4FT7A 4MXOA 5A3XA 3A62A 4D5HA 4IH8A 4GRBA 4O7SA 3PLSA 2P55A 3PPKA 3PXZA 2VTPA 4B8MA 4DH3A 1H4LA 3DZQA 1JPAA 4EC9A 5IH5A 4I6HA 2QOBA 5AP2A 5TKDA 5EKNA 4BI1A 5ACKA 2WEVA 1BMKA 2X6EA 3R7YA 5ANDA 4YURA 2W1EA 3BLRA 3QRKA 5KE0A 3AG9A 1CMKE 3POOA 1PMUA 5ANKA 2PVFA 4TZRA 4IIRA 4OT6A 1M2RA 2Z60A 3AGMA 5AWMA 2OXDA 5CF8A 4NUSA 1XWSA 4FKVA 3VVHA 2HWPA 3ROCA 3LCTA 3TG1A 2WZJA 4OR5A 3LQ5A 3PRIA 4DGNA 3SW7A 5J79A 4EOJA 4MNEA 2C3KA 5KX8A 5IQFA 1YHSA 4NK9A 3PXRA 4KIOA 4I1ZA 3KMMA 1AQ1A 3D9VA 5J95A 4YZBA 4AZTA 5DR2A 3BHYA 1JKKA 2B9IA 2UZOA 3VJOA 1UA2A 5BMMA 4C57A 1WBNA 3TUDA 5TR6A 4WNOA 1MRYA 4C7TA 3NUNA 4XG6A 5HIEA 4ZTLA 4U80A 1OPLA 3VF8A 1JKLA 5JQ5A 1REJA 3DKOA 5M4CA 4J95A 1WVWA 3IONA 4OTPA 4LGGA 4EH4A 5HCXA 5IA3A 4ARKA 1VR2A 2C5YA 4AAAA 2AC3A 2J2IB 3WOWA 2IW9A 4FV8A 4AT5A 3LLAA 4NT4A 4ANMA 4J53A 4ALWA 2X8EA 2NNWB 1XH6A 4FV4A 2YWPA 1PYEA 5JRQA 4MQ2A 3BIZA 4TYEA 1WAKA 4WT6A 3P78A 5I9VA 5KHXA 1FGIA 5J5SA 1GY3A 1M52A 3P79A 4D1SA 3QD4A 3EFWA 4FNWA 5HD7A 3NYVA 3QGYA 4U41A 3DY7A 5K0KA 2Z7QA 5AR2A 4GG7A 4TKSA 4UWYA 1H25A 2W1CA 3L8PA 4XG8A 3WYYA 1WZYA 1ZYJA 3E8EA 5JK3A 3P0MA 1UNGA 5IMXA 4JG6A 4RGJA 1GAGA 5AJQA 4CFXA 2B55A 3T3VA 4E1ZA 5ITAA 5AAEA 4DF3A 1OIRA 2RG5A 1KUTA 4QYFA 3Q9XA 3ANRA 4D9UA 4X2GA 4FMQA 4RX5A 4AA4A 4FZAB 4G17A 1OUYA 4KRDA 3IG7A 3IOKA 3KRWA 4WIHA 4KNBA 2HW7A 2C6TA 4O0XA 2NO3A 4FKIA 3RK9A 3FUPA 3VBWA 4HOKA 3L9MA 4QT1A 4NH1A 3ZUTA 5A4QA 5JGDA 4O81A 2FO0A 3V04A 4ALUA 3TXOA 3OOMA 2GTMA 2ITUA 3IW8A 5H3QA 3ZLSA 4UXQA 4PDPA 5FP6A 4BCOA 5E8VA 3H9RA 4I4EA 5LMAA 3HP2A 3OVVA 4GU9A 4PY1A 3PVBA 4FT9A 5K4JA 4A4LA 3ZSGA 2UZEA 3BYMA 2XNOA 4Y95A 4DH1A 4QMXA 2VO7A 4N57A 4APPA 4F7LA 4QPMA 3BE9A 3FQHA 3HX4A 3ID6C 4FV5A 2VGOA 3VUGA 4G5PA 3AQVA 3PSCA 4IQ6A 3RNYA 3UPZA 2IWIA 4YTIA 2YZLA 3R73A 4CSVA 4I0TA 2F7EE 2YM7A 4EORA 5T6KA 1SYKA 4ZTHA 4IVBA 5AV4A 2CMWA 4BYJA 4H36A 4NW6A 4HCVA 4TL0A 3OG7A 1ZYDA 1YKRA 2WTVA 4AW5A 3I5NA 1Q8WA 3CTJA 3POZA 3BQRA 4GJ3A 2QURA 4PQNA 4JQ8A 3QQGA 4ZTRA 4EC8A 5EDQA 3HV5A 3FWQA 3MPMA 5HIDA 1WCCA 3R83A 2W7XA 3BHVA 2UZLA 3OBGA 4FVPA 3OOGA 2OU7A 1ZYCA 3FLQA 4CV9A 4N6ZA 3N4UA 1Q61A 1UU9A 1Y91A 5AR7A 2VGPA 3O8TA 3VBXA 5DWRA 4YUQA 1ZOHA 3TZ7A 2WD1A 3ZUVA 3PXKA 3PIXA 3WARA 2JIVA 4IB3A 5E8ZA 4BHZA 4O0YA 2XNGA 4LI5A 3ZMMA 4BL1A 2W05A 5AP4A 3AOXA 2WB8A 3SV0A 5FTOA 4ZEGA 2FVDA 2BTSA 2XKFA 4NFMA 2JGZA 2C4GA 5F20A 5I0BA 2RIOA 5AX9A 2XIKA 5EK7A 4Z7HA 4R3RA 3R7VA 4MVFA 1A06A 3TV7A 2OSCA 3TT0A 2OXXA 3CQWA 3FMJA 1P2AA 5CF6A 5J9ZA 5EI8A 1JWHA 3CCNA 2PVKA 3OW4A 3OXIA 1XH9A 3ODYX 1IRKA 2V0DA 4FKPA 3ZRLA 3OF0A 2G2FA 3TWJA 3RAKA 2BPMA 4U45A 2GHGA 3WI6A 1BKXA 3DJ6A 1JQHA 3E93A 3EHAA 2GNHA 3MYGA 4JX7A 4V0GB 4ZJIA 3ZO1A 2C6LA 1QCFA 4BKYA 5IDNA 3HEGA 4D0XA 5HX6A 2C47A 3R7IA 5J87A 4C59A 4YNEA 2XS0A 4WG5A 1O6LA 4D2VA 3FPQA 5JFXA 3I0QA 1GJOA 3ZLYA 5M4FA 1KV2A 4E6DA 4L42A 3NUUA 3KC3A 4Y85A 1UKHA 2A0CX 1ZARA 5I9YA 3CC6A 1G3NA 2XIRA 4II5A 4PP7A 5AAFA 2YJRA 2ONLC 2Q0BA 3EQFA 1OZ1A 3C9WA 3FQEA 3QQUA 3EIDA 3BV2A 4G34A 2PVMA 4K2RA 4DBNA 5IQEA 2Z7SA 4OW8A 2CN8A 3QCQA 4J99A 3KF7A 4A7CA 3HDMA 3TUBA 2C3IB 2QO2A 3IDBA 4NEUA 1FQ1B 2BZJA 3COIA 4S2ZA 5KZIA 4C02A 3R9RA 4PUZA 1FMKA 4I0SA 4IAZA 4ZLYA 2ZMDA 1OPKA 4FOCA 5CEKA 5CAVA 4BBEA 1E1XA 3F7ZA 3GVUA 4L44A 3QUDA 1Y8YA 1J1CA 4JDIA 1QPEA 5IA4A 3MV5A 5A46A 3PVGA 3PY1A 2JDOA 4HYHA 4TXCA 2P33A 4ZP5A 3ZM9A 3QGWA 3K5VA 1YXXA 1O6YA 2ZAZA 5AUXA 1ERKA 4TPTA 4F09A 4FEVA 4H05A 4DFLA 4EH2A 4BWXA 4PL4A 3QFVA 3BU3A 3MJ1A 3V5TA 1BL7A 3GU4A 4HYSA 4BDAA 1M7NA 3NUAA 2B9JA 4D28A 3UODA 5J9LA 3MY0A 2I1MA 3JR1A 4BTFA 4ANSA 3DBCA 4HZRA 4NTSA 5AA9A 1R78A 4FTKA 4IAIA 3LKMA 3ZU7A 2HIWA 2W1HA 2IJMA 3LE6A 3O2MA 5JZNA 5CAQA 4JI9A 3QKMA 5KCVA 2OIBA 5JZJA 4BY9E 1K3AA 1YXSA 5CS6A 3V6RA 4ANLA 2X2LA 3KREA 3FZ1A 3QRIA 4V01A 3HYHA 3MVHA 3OWJA 1V0OA 4UWCA 4X7QA 4DEGA 3QWJA 3F88A 5JGAA 4QTEA 5JRSA 4XP2A 3TDWA 3PVUA 4NWMA 4CV8A 4BGGA 2WEIA 4L53A 4W8DA 1ZWSA 3KRRA 3VWAA 3PA4A 1NY3A 4USDA 3UIXA 3V5LA 4WO5A 5HG9A 4AFEA 3NPCA 2WMQA 3GQLA 3FHIA 4FKWA 4G3EA 4QMMA 4R3PA 3RTPA 4BCPA 3D7TB 2A27A 1PKGA 4QNAA 4W4VA 5E8UA 4GIHA 5AX3A 4AWIA 3DXQA 4FF8A 3AMAA 2YIYA 2HZIA 4I41A 4IAKA 5D41A 4LGHA 4RJ5A 3WF6A 3IK3A 4DFNA 2G01A 1Q62A 3HVCA 3VNTA 3ORMA 5M09A 2R3PA 3PLAE 3BE2A 3NLBA 4ZY6A 4JL9A 3G6GA 2WMXA 5BQ0A 2PPQA 1XBBA 1J7LA 3ZBXA 2XM8A 4BDFA 5EM5A 4AACA 3W2RA 3WYXA 4BTKA 4BCIA 2VRXA 4G6NA 4FT3A 3CR0A 4X2JA 5F1ZA 2EUFB 4DC2A 2HWOA 2B0QA 1JLUE 4CLJA 3GCVA 3VBVA 3W16A 5IQIA 5IEVA 3TIYA 3MB6A 3BLQA 3RPYA 4F9AA 1PW2A 5FM2A 4KWPA 5A4LA 4Y5QA 4FA2A 1U46A 4JLCA 4O86A 3MH1A 2OZOA 4BDEA 1QL6A 3C0HA 3Q2MA 3U6IA 5L2QA 1F3MC 2I0YA 3DPKA 2H9VA 1UNLA 2BTRA 3R1SA 3NNXA 3HRBA 4BYIA 4FSWA 3MFRA 1MUOA 5GZ9A 5HLNA 4UALA 2EWAA 2XRUA 2GS2A 3HV6A 3KRXA 4GV1A 2F49A 2WELA 3LAUA 4RA5A 1BUHA 5IUIA 3RI1A 3PE2A 4M69B 3ZFMA 4ASDA 1PXKA 2F7XE 4N0SA 2X9EA 3MN3A 4FV9A 3PJ8A 4C4HA 5A9UA 4UYNA 5HE1A 5GIOE 4RVKA 3SKCA 3UOHA 4AN9A 4M3QA 3TNHA 2QVSE 4HNFA 5M55A 2YITA 3UVQA 4FTTA 4PNIA 2UZWE 3BQCA 2HZNA 3A7GA 2Z7RA 3QAME 5AUVA 4UMRA 4KABA 5LQFA 2WHBA 3U6JA 4NM3A 5CF5A 4QPSA 3MFTA 4O22A 4TWPA 4OTIA 2E9UA 4ORKA 2VZ6A 3OCBA 4ZZOA 1F5QA 4J8NA 2WPAA 4RIXA 2CHLA 4YC6A 3GU7A 3ZM4A 3Q04A 2VU3A 3EN5A 3R71A 5A4EA 5AP5A 4O7VA 3AC3A 5IUHA 3FXWA 3HMMA 3Q32A 3MS9A 2F9GA 4DBXA 4FTLA 4CGAA 3HGKA 2PVRA 2DYLA
chains in the Genus database with same CATH superfamily
3TNPC 3G9NA 4LOOA 1U4DA 5D7VA 4NL0A 4D4YA 3RPVA 4CFMA 4PMSA 2FSOX 3R7OA 3OY1A 3Q5ZA 2YLEA 4EHZA 1YHWA 3HNGA 4KIKA 4F08A 4FSQA 5IQDA 3ZTXA 4JOAA 3GGFA 1O9UA 2QU6A 2OKRA 3MESA 3MH3A 4O84A 1PKDA 3JUHA 3NNUA 3W10A 3IW5A 4QQJA 2EXMA 4TT7A 3I4BA 4DGMA 4J71A 4QMOA 4FIHA 5E4HA 4FUYA 2PUPA 4S30A 4DFUA 2W1IA 3LFDA 1YWVA 4JBPA 3TKUA 3UVPA 1NT2A 3TMOA 2HXLA 4U81A 4R1YA 2YISA 2B7AA 3OROA 2X0PA 4IVDA 5L8LA 3DCVA 1DM2A 4ASXA 1JSVA 1ZAOA 3FZPA 3RAWA 3MA6A 4JNWA 4AZVA 2QKRA 5EW9A 5EQEA 1YHVA 4IX4A 2O2UA 4R3CA 3D94A 3UO5A 1W2FA 3ALNA 4I5HA 4RIYB 2JDSA 3KULA 2PE1A 3REPA 4RC2A 4FV3A 2NPQA 4I5PA 4GVJA 1B38A 2OJFE 3I5ZA 3F5UA 4JBVA 5H2UA 3W0SA 4QQ5A 1WBSA 3UOLA 4IZAA 1XJDA 3A8XA 3F82A 4IC7A 3UG2A 4E26A 4EOIA 3O17A 3QTXA 3FL4A 3UZPA 5M4IA 4WBOA 5AUUA 4LM5A 4YZCA 3QU0A 5HE2A 1WBWA 2VO0A 4KKEA 1XMMA 2QOQA 3A7JA 3RKBA 3W2OA 1CKPA 4R8QA 1BYGA 4MNEB 5TO8A 4E93A 2XH5A 5HGIA 2YERA 3UZTA 4O0VA 5EYCA 3GC0A 4PTGA 4RVMA 4IAFA 3RPRA 5HEZA 4NIFB 3AXWA 1PXLA 3VO3A 4CEGA 5M08A 3ULZA 5EH0A 4EHVA 5LMBA 3DK7A 3F61A 3LCKA 3ORIA 3QTIA 5AR3A 5TE0A 3ZUUA 1Q8ZA 4AXAA 4C33A 4Q9ZA 3DJ7A 4QTBA 3VULA 4PMTA 4ZTSA 2R3NA 3VBTA 3PPJA 3ZXZA 5G1XA 2IF8A 4ZY5A 4RFMA 4IE9A 5CEIA 3DQXA 4G5JA 4X0MA 3U55A 2AC5A 3G2FA 4IVAA 2BRMA 3VS6A 2J4ZA 1OM1A 2E2BA 3TV6A 2O65A 3OWPA 4OTFA 4QTAA 1J3HA 3D2IA 2GFSA 2QONA 3SD0A 4ANNA 2UZBA 3GP0A 2W5HA 4GVAA 3DBQA 3GNIB 1RQQA 3T9IA 4HVSA 3DXPA 2XYNA 5HHWA 4H1MA 2OF4A 3U87A 3P86A 3B2TA 2WTJA 3BBWA 3R8MA 5JH6A 4AUAA 1Z5MA 5HVJA 4FV0A 2PL0A 4ACGA 4GJ2A 5CASA 2W0JA 3TKHA 3ZONA 5EDPA 4JXFA 2OLCA 2VUWA 2WU6A 4HW7A 2CNQA 2ZM3A 1LUFA 3RJCA 4ZMFA 4M8TA 5AP0A 1XO2B 2YCSA 4MBLA 2W1FA 2W9FB 3JY0A 3P08A 3KN5A 4EH6A 3H4JA 3MWUA 4FTIA 4GK3A 1ND4A 3E8DA 5FM3A 4ERWA 2OFUA 3FI8A 4O38A 1R0EA 2BILB 3MSSA 4Y5HA 5IUGA 5CU0A 1DI9A 3ODZX 4XV9A 3CGOA 3PYYA 3QQKA 4X6QC 3OTVA 5A4TA 1DAWA 4I94A 3NX8A 4CFNA 5HI2A 3GFWA 2CCIA 2YM3A 1OKZA 3QRTA 4OLIA 4ASZA 4C58A 3RAHA 2XNPA 4M7IA 4YJNA 4AN3A 2NYAA 3IO7A 3IGOA 5E8WA 3P9JA 3Q60A 4EZ7A 4AF3A 2OGVA 2QG5A 4QD6A 4QMLA 5E8SA 2YWVA 3V51A 4QQCA 3ERKA 4I20A 2ZV2A 2YEXA 4O2PA 5CU6A 2YIXA 4FEQA 3QTRA 1OKYA 4KSPA 2GS7A 3CY2A 3N4VA 5AV3A 2ACXA 1GNGA 2H34A 3PP1A 4CT2A 5BUEA 4YGAA 4DTKA 4OTDA 3GCQA 2J5FA 3MI9A 3R6XA 1PHKA 5ETAA 2WMVA 4QYGA 3E5AA 4IBMA 4LYNA 5FGKA 4EYJA 2EU9A 1H0VA 3NW6A 5BVNA 5C4LA 2BROA 4D2RA 3VUDA 3EN6A 3FI2A 4E8AA 2W06A 5B0XA 4DYMA 4B99A 1UV5A 5AFVA 3NUPA 4BRXA 3EB0A 2O5KA 5FEQA 3R30A 4Y8DA 4FTMA 2Z2WA 4KA3A 3W0QA 4AQKA 2XVDA 4EWHA 4O4BB 5IQHA 4RJ7A 3BHUA 5IQGA 2XNBA 2CGXA 2XK6A 3EL8A 4R7IA 4TNDA 2WTKB 2Y7JA 5B7VA 3O71A 3H10A 4F70A 4QQTA 3KKVA 4KB8A 1LP4A 4JIKA 2VTSA 2PMNX 3UVRA 4TNBA 4R1VA 3TJDA 4BDDA 5CLPA 2PYWA 4FTRA 4EK5A 4JT3A 5KMLA 1NXKA 3AD5A 2C6MA 4G3FA 4IB1A 3UNJA 3GQIA 4TRLA 5BPYA 2QOFA 3KCKA 2ZDTA 3R0TA 2WMUA 5EQYA 3HUCA 2CSNA 4O7TA 4ZTNA 4ZZMA 3FV8A 1S9IA 3F66A 3JXWA 3W2SA 2QKWB 2JD5A 3DK3A 3GCUA 4FKJA 1ZLTA 3GU5A 5T3QA 4FKTA 4M12A 4YJVA 5A14A 3W2PA 3I60A 3D14A 1UU3A 3IW4A 4TWNA 3D83A 4W8EA 2OIQA 3JVRA 3BEGA 1GIIA 4O1PA 4F9YA 4FTUA 3P7CA 2J5EA 3R8LA 2WMBA 3R7UA 3ZS5A 4AGDA 3KK8A 5LVOA 3FSFA 4OT5A 2YN8A 3HMIA 2O3PA 1WBOA 3LM5A 2ITWA 4WSYA 4I6FA 3FLYA 1OI9A 5JKGA 5H8BA 2NP8A 2BRHA 2V7AA 2WQMA 4LUDA 4DEAA 1YWNA 4DCEA 4NM7A 3S0OA 1XH4A 4EOSA 4PF4A 5HD4A 3HUBA 4EKLA 5L8KA 4MUQA 3NAXA 2C0IA 4JVGA 3RHXA 2UZUE 3BCEA 3MFSA 3DBDA 4TYHB 3L1SA 4HGLA 4ZSEA 4QMTA 4RJ3A 4C35A 3SG8A 4N6YA 2OWBA 5DIAA 3FZOA 3DZOA 4CG9A 3AC8A 3LVPA 2QO9A 4GKIA 5KHWA 2Z8CA 3C7QA 3D7ZA 3DS6A 3NVKI 3ALOA 2J0KA 1W7HA 2ONLA 5FG8A 5J5TA 4PL5A 5C4KA 4YC3A 3ET7A 3TJCA 4USFA 1Z57A 2R64A 4MXZA 3FC2A 4OBOA 2G1TA 5BVKA 2YFXA 4AZSA 4BZNA 2Y4PA 5L2SA 1UVRA 3AMBA 3FY2A 3NAYA 3Q9YA 3TUCA 1M2PA 3CP9A 5HE3A 2R0IA 1YXUA 4FIJA 4KAOA 4X3FB 3BU5A 3O50A 5EM8A 4D9TA 3BWJA 3QQLA 5BMSA 1H1RA 5FEEA 1YVJA 5JT2A 3QQHA 5I9UA 5DT0A 3UDBA 4B0GA 3LQ3A 4R7HA 4YC8A 4DEDA 4G9CA 4D2TA 2IVSA 1HCLA 2W5AA 1K9AA 3E7VA 3F5XA 4WRSA 4A4OA 1Q97A 4U97A 4CG8A 4CCBA 1RE8A 2WTIA 4DG3E 3DJ5A 1ZMVA 2ETKA 3TI1A 1OBGA 4F64A 2WQEA 2WIHA 3BPRA 3DNEA 2R2PA 3QYZA 3E3PA 1BI8A 3KK9A 5EOBA 4EHEA 4ENXA 3AC5A 3QC9A 4BWKA 5EYDA 3Q4UA 3UC3A 5HG5A 1H1WA 4DTBA 2Y0AA 3WIKA 5HQ0A 4BF2A 5DRDA 5JEBA 3AGLA 3RAIA 4UMUA 1CDKA 1REKA 1OL1A 3RNIA 5L2TA 3GI3A 3MGYA 3ATTA 5LMKC 2RFSA 3P7AA 3PIZA 4C0TA 3RMFA 4D2WA 3RWPA 3LFAA 2XB7A 3EQGA 3TDVA 2BR1A 3MFUA 5TT7A 3IGGA 4FIFA 4ZSAA 3NMUF 1L8TA 4A9YA 3CEKA 1S9JA 2A19B 3RZFA 3S1HA 5KZ0A 3RK5A 3SXSA 4ZLZA 4C2WA 5A4CA 3NR9A 3ACJA 3BWFA 4CTBA 3GEQA 1H00A 5LVPA 4MK0A 1Q3WA 4RVLA 2RFDA 4BGHA 3UO4A 3S4QA 4C3FA 3QBNA 2W1DA 3R9OA 2YM6A 4BCHA 4BCMA 3D5XA 4I92A 4H58A 4PP9A 4LV5A 5L2IA 4RVTA 1ZY5A 4O2ZA 4LGDA 2A98A 1FVRA 4J52A 2QHNA 1H24A 3ORLA 4LL5A 3RM7A 3SRVA 5AUTA 5EQPA 4U5JA 4KBKA 3DGKA 3LCDA 4C4EA 4U8ZA 2X2KA 3R1YA 4GUBA 3D0EA 3E64A 4WSQA 5HKMA 4TW9A 3UC4A 2G9XA 3IKAA 4V05A 2GNJA 1J7UA 5IQAA 3F6XA 2XCKA 4NM5A 4RZWA 4EK3A 3IDPA 3MPTA 3VS1A 3R7EA 1XBCA 4C2VA 1U54B 4D2PA 1MRVA 2QC6A 4KINA 4PDSA 3NYOA 4U43A 4EBVA 1ST4A 2HCKA 2XEZA 3U54A 4I6QA 3RALA 3F5PA 3R02A 2ITVA 4MKCA 3SQQA 4MBJA 1V0BA 4U9AA 4D2SA 4DITA 5IZFA 2PZ5A 3QWKA 1OBDA 3LJ2A 3FMMA 4EWQA 3F2AA 3VUIA 4FEUA 4JS8A 3PPZA 4U3YA 2PVLA 3CJGA 3OFMA 4XV2A 4ANQA 3PA3A 3Q4ZA 2ZV7A 4XCUA 4A4XA 4XEYA 3KU2A 4DN5A 4D4VA 2Q0NA 4XOYA 3UO6A 5HNIX 3A8WA 2YIWA 3CPCA 4FODA 3NZ0A 1CTPE 3KMUA 4FK3A 3B8QA 3W55A 4GK2A 2X2MA 2XBJA 4Y83A 3UTOA 4APCA 2BRGA 4C4GA 2O63A 3UIUA 4J96A 4O7ZA 3DU8A 4IMYA 4L9IA 4FNYA 3DBFA 1CSNA 3QUEA 2UW3A 4V04A 4U7ZA 3EH9A 4ENYA 2UW7A 4ZS4A 5LOHA 1LR4A 5CY3A 4AZFA 1PRYA 4WKQA 5I9ZA 1YW2A 3HP5A 2GQGA 1ZY4A 2PK9A 3E63A 1AD5A 4G6OA 3PWYA 4QMWA 5KBRA 4UMTA 5AUWA 2XJ0A 4QNYA 5HNGA 4BZDA 4E4XA 3R21A 4XV1A 4KSQA 3ACKA 3ZO4A 3U9NA 3AT2A 4XH6A 2IVVA 3ZC5A 1UNHA 5IA2A 2QOKA 4YZ9A 5HBHA 2PULA 5GINE 3OP5A 2HY0A 4CLIA 4IWPA 4QP4A 1MP8A 3DFCB 5L6PA 3CE3A 4FL3A 2OIDA 1XH5A 4MNFA 3KY2A 5CEQA 3DDQA 3QLGA 3N4TA 4AZEA 5J7HA 1PY5A 3TCPA 4YJOA 5HCZA 1FPUA 5GZ8A 5JSMA 3PDTA 4WBBB 4GG5A 3UMWA 4BBFA 5CZIA 3UDSA 2VNYA 3R63A 4RIXB 1BX6A 2B4SB 2VTNA 2EB3A 3WZDA 4USEA 4ZOGA 4BCFA 2C0OA 4YHTA 2LAVA 1W83A 4CZYB 4FIIA 4F6WA 2XJ2A 4CQGA 3U4UA 2R3OA 2CNVA 4XBUA 2VTHA 3DXNA 4BCKA 4CVAA 4AXEA 4IWQA 1KSWA 2JIIA 2R3LA 4RPVA 1R0PA 3EQDA 3GFEA 3QD0A 2QLQA 5EYKA 5CQWA 3ZDUA 4FYOA 4MEDA 2YM5A 5AP7A 3FE3A 4F4PA 4E20A 3LPBA 3W0PA 4KIKB 4XNEA 5CVGA 4C4JA 1XKKA 3HDNA 2PVJA 2UW4A 4FG7A 2JFLA 1P14A 2PUUA 4K33A 1OL7A 4MQ1A 3QRUA 5DRBA 3W2CA 2IPXA 1Q4LA 4X21A 5CT7A 1KE9A 4BTJA 4HGEA 4JBOA 3GXLA 3CPBA 3TN8A 2EVAA 3R01A 4EUTA 2JDVA 2FA2A 4RT7A 2XEYA 3O8PA 5LARA 2JFMA 3DKGA 5DLSA 3SOAA 3WE8A 5HLWA 4DH7A 2XIYA 3DFAA 2XNNA 2OJIA 2VTOA 3HV7A 4RX9A 4DGLC 4DEBA 4UZDA 5BUIA 4IFCA 1RDQE 1Y8GA 3UIMA 5CX9A 5DVRA 4QMNA 2UZDA 4WRGA 3BHTA 3TNWA 4YTHA 3WF7A 4FE2A 4G3CA 4CFVA 3L8XA 4DDGA 2W17A 1Y6AA 3G15A 4PDYA 3D5WA 4BKJA 3F5GA 5KMKA 1H26A 3ETAA 2RL5A 2Y4IC 4BDKA 2IW6A 3OEZA 4J97A 3HLLA 3KULB 2VD5A 3OC1A 4JBQA 3ORTA 4QO9A 5C26A 5IPJA 1OKWA 3GOPA 4G16A 3QZGA 4FX3A 4YNOA 3QD2B 4MCVA 1IA9A 5CEMA 4IFGA 4PNKA 4F7NA 1IR3A 1A9UA 4J7BA 4TWOA 5AM6A 3T3UA 3K3IA 1XBAA 1NW1A 4BZOA 3T9TA 3WE4A 3RVGA 2WOTA 1V1KA 5I9WA 3K54A 4TN6A 1QPJA 4A07A 4HVIA 4DCAA 2LGCA 4RSSA 4D1XA 4GK4A 4W4YA 3VW6A 3GENA 3HA6A 3WIGA 2FSLX 1FINA 2VWWA 4G6LA 4KBAA 3ZSHA 4O7LA 4X2NA 3V01A 4BIDA 5CSVA 1P4FA 4M67A 4DLJA 3BYVA 3H0YA 2YA9A 5T68A 2W4JA 2P2HA 3WZEA 3CD3A 2WO6A 5HBJA 3CQUA 4MBIA 5HX8A 3PFQA 3R8UA 1H8FA 3FQSA 2C1BA 4Y73A 3VBYA 1H27A 3E3BX 5A6OA 5E1SA 3S2PA 3DDPA 3OCSA 5F4NA 5IF1A 3MJ2A 2JKMA 2YZAA 1DS5A 3EQPA 4DHJA 3DV3A 2VTMA 4RIOA 5KUPA 1OVEA 1GZ8A 1H28A 4FUXA 4AAYA 4S33A 3NRMA 4QP3A 1H01A 2J0JA 2W4OA 1I09A 4FSTA 2BAJA 3ANQA 5CQUA 4EJNA 3RK7A 4S31A 4RC4A 4L43A 5CVHA 4EHGA 4LMUA 3BZ3A 4HNIA 3VQUA 3G5DA 2V5QA 4FKRA 4FSMA 1YXTA 3LFQA 2UW0A 3PE1A 3QALE 5BNJA 3VUTA 1BLXA 4JJRA 1KE6A 3U51A 4IDTA 5AIRA 2BAQA 1P5EA 4O96A 2C6IA 2HK5A 1SVEA 5AV1A 3RZBA 2UVZA 1K2PA 3BU6A 4K0YA 4W9XA 2J6MA 1W2CA 5E91A 3T8OA 3FAAA 4YSJA 3F3TA 4QP9A 4PPCA 4Z9LA 2XKDA 3VN9A 3K5UA 3LFFA 4BVUA 3ZFYA 4OTRA 5FUTA 1VYWA 1ZXEA 2A4LA 2GTNA 4MAOA 4EUUA 5HORA 4FSZA 3MIYA 2YDJA 5DFPA 2JC6A 3UG1A 3WZKA 2GNGA 3OMVA 3QC4A 4DHFA 4NW5A 3PUPA 3ATSA 3G6HA 1BI7A 1PXIA 5CI6A 4FOBA 4BJJA 3MDYA 2X39A 5KKRC 1F0QA 4O27B 1VEBA 3C0GA 2GNFA 4G9RA 3MTFA 5K0XA 1OMWA 4W9WA 2C68A 3OT3A 5IH6A 3R1NA 3D15A 2Q83A 3BGZA 3L9LA 4WHZA 4FKUA 4PTCA 4O7RA 3PA5A 3H9FA 3NYNA 2VNWA 4FYNA 5CU3A 4YHFA 3UBDA 4EOPA 5KMIA 2W5BA 4DGOA 1A48A 3WBLA 4J8MA 3PUFC 4FGRA 4YP8A 5C8MA 4LMNA 2ZV9A 3QTSA 2OI4X 3E92A 4XG2A 1TKIA 2DUVA 5AMNA 2QR8A 3EKKA 3W8LA 4FICA 1NVQA 5DGZA 5BVOA 2CDZA 4M84A 2R3KA 5AAGA 3OUKA 2X7OA 3EQIA 5M06A 4FV6A 2QOIA 3EFLA 2X7FA 3V5QA 4E4NA 3EN7A 3ZRMA 3CKXA 4XP0A 5FBOA 4GIIA 1SVGA 3C4CA 3IQ7A 4Q2AA 4LQMA 5DN3A 1J7IA 5DHJA 3RCJA 3CQEA 3OWLA 1YI4A 2PVYA 2VX3A 3K2LA 3KXMA 4YBKA 3MVMA 5CALA 2JDRA 5E90A 5AA8A 4UBAA 3OCTA 3W0MA 2YCFA 4E5AX 5F9EA 5FDXA 4TYJA 4TYGA 4UZHA 4BIEA 3F3VA 2DWBA 5C03A 1ZYSA 4AW1A 4BDIA 3FBVA 4IX5A 2PU8A 3FLWA 2XZSA 3BGPA 4GT5A 4GT3A 2RKUA 3KN6A 4IHPA 4AU8A 3HECA 3PSBA 1XR1A 3DA6A 4MD8E 3OTUA 4I4FA 4EJ7A 5GHVA 4I5MA 3EYHA 3B2WA 2ITTA 4EOMA 3DNDA 5BUJA 4UB7A 4ZAUA 2GPHA 3PXQA 5KBQA 3LFSA 3ZZWA 2ERKA 1B39A 4JDHA 3V8SA 3FMNA 1R1WA 3C0IA 1M17A 2CKEA 2IZTA 1B6CB 2CLQA 4YO6A 2Y9QA 3H30A 4G1WA 3Q5IA 4V0GA 5DR9A 5D7AA 3LM0A 3OEFX 5I3RA 3KVXA 3SXRA 4JG8A 3GT8A 5ETFA 4K6ZA 3O5AA 3UP2A 4O0SA 2YAAA 4RX8A 1SNUA 4S34A 5HVYA 2WGJA 5HESA 1QMZA 3DTWA 4M97A 1H0WA 3RM6A 4UEUA 1UKIA 3Q9WA 3EYGA 2OICA 3W18A 4YMJA 1Z9XA 2QU5A 3QCXA 5IU2A 2EXEA 4O0RA 2GFCA 3WZUA 2BDWA 4HVDA 4O83A 4GCJA 3G51A 4YPDA 3GCPA 5HCYA 5C01A 4FV7A 4DA5A 1IEPA 3TZ9A 4IXPA 3UQFA 2JITA 2WQOA 3FKOA 4RJ6A 3WF8A 4FL1A 4HPTE 4KS8A 2V55A 1KE8A 4F63A 4K9YA 5HZNA 2JKQA 2RFNA 3MY1A 5LMKA 2ZDUA 4JX3A 4CT1A 2H6DA 2QO7A 3R9DA 2UVXA 3OCGA 4FZDB 4OAUC 4XRLA 1KE7A 3L8SA 4FKLA 3FXZA 5HE0A 3I81A 3DKFA 3LMHA 4DEEA 2R3GA 2ZOQA 1FMOE 4LRJA 2BFYA 3H9OA 1SNXA 3AC2A 3LMGA 5IH4A 2QODA 3PWDA 3O8UA 3W2QA 3ORXA 4KBCA 4DG2E 1R3CA 3D4QA 4EOQA 5ANEA 3H0ZA 4EK4A 3A2CA 1GIJA 3QCSA 4Z3VA 1UWHA 3A60A 2YACA 3O96A 5DNRA 4E7WA 2QG7A 5KMNA 4ITJA 4K1BA 5DA3A 4ERKA 1NA7A 2OG8A 1P4OA 2X6DA 4AGWA 2CCHA 4ZIMA 5K3YA 2E9OA 3F3UA 4BI2A 3EQBA 1FOTA 4RWLA 2C5XA 4ZXTA 4DTAA 4AA0A 5FD2A 4FK6A 3AT3A 3UZRA 1MQBA 2ZV8A 3LHJA 1IG1A 5HO7A 1SVHA 2CLXA 3GOKA 3PSDA 4A9TA 2WAJA 3JPVA 4IZYA 5IG1A 3KXHA 3FKNA 3ZC6A 5IDPA 3V8WA 3Q2JA 3KFAA 3OW3A 1R39A 3ZFXA 3H3CA 3PVWA 3I6UA 3AMYA 3I0OA 5FXRA 5HICA 4RWIA 2ZVAA 3FMHA 3KQ7A 3PY3A 5D9HA 2R3JA 2J0LA 3PZEA 1RJBA 4YLLA 4QRCA 3KXZA 2VV9A 3S95A 4DEHA 4Y46A 1OB3A 5AP1A 3BV3A 3E62A 3Q96A 1PXNA 4FEWA 5D11A 3TKIA 3S3IA 4DH5A 3C51A 3AKLA 4AW0A 4YR8A 4DLIA 3D7TA 4A9SA 4FEXA 4DT8A 4PV0A 2XK4A 4K11A 4ZSLA 2VTJA 2XM9A 3ORPA 4C36A 2BFXA 2C0TA 5CWZA 3GU6A 3GBZA 5BVEA 3VJNA 4F99A 2B9HA 2B52A 2C69A 1I44A 3PTGA 2J50A 4L46A 2G2IA 2OH0E 3LZBA 1YDRE 3D5UA 3Q4TA 4XG7A 3W32A 2E9PA 2Y8OA 3SRVB 5ANIA 5CAUA 1TQIA 3TZ8A 2F4JA 4I21A 2IVUA 1Q8YA 2C6KA 3NS9A 2AQXA 3COKA 3MH2A 4L7FA 1TZDA 3FMLA 3VF9A 3VC4A 3SA0A 1KE5A 1QPCA 3EQCA 3LJ0A 3QD3A 3D2KA 3PJ1A 3MVJA 4I6BA 5H9BA 4BCJA 4LV7A 3ZO3A 3C4WA 4BWPA 3LFBA 5CI7A 5J8IA 2V62A 4LOQA 2UZTA 1Y57A 1IAJA 4CXAA 3NFFB 3DOGA 4F7SA 1U59A 2QOOA 2W4KA 3FMDA 2C6OA 4YZDA 2BALA 2X0QA 5HIBA 3TNIA 3BYUA 2G2HA 5LCKA 4JR3A 2PMLX 2WTDA 2WQNA 4FKOA 3HAVA 3VRZA 2F7ZE 1H1QA 4XLVA 5BYLA 3KGAA 3QKKA 5JMSA 2GCDA 3CGFA 3ENMA 3UYSA 3OS3A 3R22A 3A7HA 4U42A 3VS7A 4NSTA 3G9LX 3N9XA 4DG0E 4WNMA 4JAIA 4GH2A 5AR4A 1JOWB 3FDNA 3EMGA 4FTJA 4NKSA 3V5JA 1YQJA 4QYYA 4CFFA 3FI4A 3RGFA 5JFWA 3PG3A 3VUKA 1VJYA 5EM7A 3KCFA 3WF9A 3TTIA 1Q8TA 2ITOA 2C3JA 3C50A 5M07A 4UXLA 2X7GA 1IA8A 1OL5A 3I7BA 4JAJA 3CTHA 3DKCA 3ZLXA 1AGWA 2GNIA 2JAMA 3RWQA 4E4MA 3EN4A 3EZRA 3V3VA 2HELA 1YXVA 4XBRA 2YJSA 3KXXA 4EZ5A 4E3CA 4O7WA 2J9MA 2BZKB 4CZTA 3UNZA 2CJMA 3E7OA 1GZNA 4IADA 4IW0A 5DPVA 5B2MA 1PXPA 2A1AB 1WMKA 5I5ZA 2Y6OA 4Z7GA 4U0IA 4QOXA 3UPXA 2XNMA 4YJRA 4NFNA 1WVYA 4GW8A 3O23A 1JVPP 4UV0A 3PY0A 4O0TA 4IANA 4FTAA 4IEBA 4I22A 5E8YA 1GZKA 5B2KA 4IACA 1PMVA 3DT1A 4IAAA 4M13A 2UV2A 3U8WA 4N4SA 4BDHA 4CYJA 2CKOA 3QYWA 4I3ZA 4BR3A 2SRCA 5L6OA 5E9EA 5CT0A 4E5WA 3UIBA 4PRJA 5BV3A 4YHJA 4I23A 2C5VA 2IO6A 3THBA 1NVRA 4BDGA 2VN9A 1PXOA 1GOLA 4H3QA 4AT4A 3DQWA 1NVSA 5GJGA 3HA8A 3LFCA 3ENHA 3UYTA 4EH7A 3Q4CA 5L6WL 5GIPE 4F7JA 4IM0A 3PZHA 5EI2A 2OBJA 4HVHA 4L8MA 3QX4A 1PMNA 4EH3A 1LEZA 1W8CA 4OGRA 3ZYAA 2GDOA 4BDBA 1KOAA 3F7WA 4EOLA 2UW6A 4DDIA 4FZ7A 5C9CA 1SMHA 5CXHA 4JQEA 1G8JA 3NUSA 4QMQA 5CSWA 5JQ8A 3NVMB 5EFQA 1BL6A 1XH7A 3Q6WA 3R04A 4P5QA 3VAPA 4DE4A 4FSYA 4KIPA 4LFIA 5TF9A 2R4BA 1VZOA 1XQZA 3GB2A 1M14A 4IJ9A 3BKBA 4K8AA 4TTHB 3PRFA 4Y72A 5FBNC 2JIUA 4F6UA 4FGBA 1TQMA 5FP5A 2JBPA 5CU2A 4AE6A 5BVFA 4RRVA 3LQ8A 1KOBA 3CTQA 3QLFA 3LIJA 4AOTA 1WBVA 2YLFA 4L6QA 4WUAA 4BDJA 4TWCA 3SXFA 4F0IA 4ID7A 5GJFA 5ANJA 4AGUA 5M56A 1ZOGA 4RIYA 4RG0A 5ICPA 4TY1A 2BHEA 5CANA 3PG1A 2OZAA 4L01A 3NCGA 5E1EA 3TACA 3PP0A 4N70A 5KMMA 5HG7A 3OBJA 4C4FA 3IOPA 3L9PA 2OFVA 1MQ4A 2GSFA 4BGQA 1FGKA 5K9IA 4G3GA 5LWNA 4UY9A 2X4ZA 2BKKA 3P23A 4QYHA 3DAJA 3CY3A 3NNVA 4D0WA 4QTDA 1JKTA 2FSMX 2VWUA 3ZLWA 4PMPA 3WF5A 3R28A 2UUEA 3PXYA 1TFFA 2CKQA 3EL7A 5M57A 3LXPA 1CKIA 4NM0A 4EQCA 2XA4A 3O7LB 4NIFA 3DB6A 4QP7A 3FYJX 2VX1A 4YU2A 3QZHA 3QF9A 4HJOA 3PJ3A 4P90A 2B1PA 4O4FA 1Q5KA 2J0IA 4DFZE 3AKJA 5BYYA 5LCJA 4BKZA 4F9WA 4M0YA 2IZSA 4M14A 5EW3A 2ZJWA 4AW2A 2I6LA 2OO8X 1W0XC 1Y6BA 3OXZA 5HTBA 1YOMA 3OZ6A 4E6CA 4AXFA 5CEPA 2B54A 4KUJA 2R0UA 5HLPA 2BMCA 4OBPA 4NCTC 4YZNA 4XP3A 4CKRA 3VW8A 3EFKA 2XK9A 3HKOA 4X3JA 2PY3A 3L8VA 3SVVA 4HCTA 3K3JA 2YABA 5DEWA 4RJ8A 3M11A 4OTHA 4FKSA 4GS6A 4HYUA 4JRNA