3VQUA

Crystal structure of human mps1 catalytic domain in complex with 4-[(4-amino-5-cyano-6-ethoxypyridin-2- yl)amino]benzamide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Diaminopyridine-Based Potent and Selective Mps1 Kinase Inhibitors Binding to an Unusual Flipped-Peptide Conformation
doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 258
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vquA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vquA01
3TJCA 3DA6A 3W2SA 2PVRA 2P3GX 3SV0A 3C4ZA 3GCPA 3QC4A 4RJ7A 4XV2A 1GIIA 4QMZA 5B2MA 3PDTA 3HMOA 3VUIA 5JGDA 2BRBA 2C47A 5EW8A 3GU4A 3OT8A 2GHMA 1GY3A 2Z7RA 3ORNA 3QTQA 2CN5A 3QZIA 2XK4A 1G3NA 3LOKA 4EOOA 2W5HA 3VUGA 4PPBA 2W9ZB 4NJDA 4RBLA 3TV7A 5D7AA 2UUEA 3LFDA 5KMKA 3K5UA 4QMNA 4FGRA 5CU3A 4FT9A 4P4CA 4IWPA 4K18A 4YJVA 3LXLA 1IAJA 2XK3A 2PSQA 4G5PA 4O0WA 2QOHA 3QHRA 4PL5A 3EOCA 4RZVA 4WBBB 3D83A 2OH4A 5FEQA 1OIQA 2OW3A 3PJ1A 5IA4A 1M7QA 1XKKA 4I4FA 1BX6A 1RW8A 4EH3A 2VGOA 3PSCA 4RC3A 4LMNA 5I5ZA 2C4GA 3QLGA 4KSQA 2R0IA 3RVGA 3QZHA 2H9VA 4B7TA 5LVPA 2FO0A 5EQEA 3LXNA 1H1RA 5I9UA 4B6LA 3ZBXA 5KBQA 1M2RA 3OTUA 3BX5A 4CSVA 2QHNA 3T8OA 1OITA 3MI9A 4WG5A 5BVKA 5IQEA 4EC9A 2W1EA 4UMRA 1DAWA 4J71A 4MTAA 2BKZA 1M2PA 3PXQA 3OOMA 2VNYA 5I9XA 2XA4A 3I7BA 5IEVA 2A19B 5HO6A 1B6CB 1Q8ZA 3FXZA 3TL8A 4EHGA 4NW6A 2BZKB 3GCQA 3IONA 2J90A 5C1QB 3OBGA 3FMEA 4O0SA 4OT5A 4BZDA 4HOKA 4UMUA 2E9VA 5HTCA 3HMIA 4APCA 3NNXA 3W10A 4BVUA 3EMGA 4IWOA 5E8XA 2Z02A 3FC1X 3PJ2A 3BYOA 4BDDA 1UU7A 4G3FA 4JX3A 3QUPA 5HTIA 2A4LA 3EQBA 4E5BA 4IX3A 2W4JA 5F94A 3NYOA 1JBPE 3QUEA 2QURA 5JN2A 2J2IB 3UGCA 3GI3A 4BI2A 5K3YA 5CEKA 3QZGA 4XJ0A 5M06A 5KHWA 3QQLA 3DFAA 2X6EA 4U43A 3WZEA 5HEZA 4Y46A 1Y57A 3NUPA 4C2WA 3SOCA 4KKGA 3UO5A 5CEIA 5JFXA 4U5JA 4RSSA 3LXPA 2EUFB 5D11A 2F57A 2F7XE 3UYTA 4YURA 5AUXA 1SYKA 4LQMA 4UWYA 3U54A 2X39A 4YZNA 4D0XA 3JVRA 4Y73A 2EXMA 4I93A 4GFMA 3PLSA 1Q24A 4W4VA 5EM8A 4WUNA 5CT7A 4XRJA 4DGOA 3LMIA 3TUBA 2CLQA 3BI6A 4IM3A 4QMLA 5EK7A 5CEQA 3UTOA 3D94A 2X4FA 3SKCA 3IW5A 3TZ8A 2R3GA 4Z55A 2IZSA 3QBNA 1GZ8A 4NCTC 2G2FA 2VX0A 2JDRA 2J9MA 1PF8A 4FKQA 4QMXA 4RVMA 4U3YA 5HG8A 4M84A 5BVWA 4EJNA 2ZMDA 3HV7A 2YM4A 4FF8A 3KXHA 5CSHA 4CFMA 2JKMA 3MVMA 4P7EA 4K11A 1IA8A 3FI8A 2R3PA 2J0MB 3DBFA 3PSBA 4D2RA 3EQPA 1VYZA 3B8RA 3CD8A 3OFMA 4RVKA 4BICA 4JOAA 1YI6A 4C59A 1LPUA 3OCSA 3DK3A 4QYGA 4J52A 5ETCA 2WNTA 1PXMA 3UQCA 4ALVA 4BDEA 3CEKA 4KKEA 4MAOA 5J5TA 4RX9A 3EFWA 5IG1A 4IX4A 3AT3A 4DH8A 2QOLA 4JDHA 3LPBA 3PG3A 4NM0A 3V01A 3RP9A 2QQ7A 2CLXA 4RWKA 2GPHA 2FSMX 4YZDA 2ITVA 4U79A 3NS9A 3WF8A 2BRMA 4C4IA 3Q2JA 1G5SA 1OL1A 2C3IB 2YHVA 3VJOA 4EK4A 4EL9A 1L3RE 4A4XA 3PVUA 2QONA 4DH1A 1WBSA 4YP8A 3SVVA 2IVTA 4FT0A 4PNKA 2CCIA 4OTHA 4E93A 4WRGA 3MIYA 3LHJA 3OC1A 3AT2A 1Z5MA 2ETRA 5FG8A 5T6KA 2UZTA 4D4YA 1UKHA 2WQMA 5FEEA 4NU1A 1R0EA 4K6ZA 3FEGA 3SGCA 4V05A 3PJCA 4FTAA 1LEWA 5CYIA 5JH6A 3FQSA 3MY1A 4DG0E 3P0MA 5FEDA 2XEYA 5HBEA 2C3LA 3NCGA 4YJUA 4QMSA 3SHEA 3B8QA 2YA9A 3IDBA 1J7UA 1REKA 3AC1A 5CSVA 3R7IA 3EYHA 2ZV8A 4EC8A 4BIEA 4UYNA 3NLBA 4I41A 5I3OA 3DCVA 4LRJA 4PMSA 5DEYA 4CVAA 4L42A 4YJRA 2C5XA 2XP2A 2QOCA 3K54A 4BIBA 4WHZA 5DI1A 2HW7A 2YAAA 5E8UA 3VWAA 3R02A 5M55A 2OXXA 4YHTA 5IA5A 4C35A 2XBJA 3ZUTA 3HAVA 4DN5A 4BDKA 4FV4A 2YLEA 4UEUA 3R28A 2VWUA 4O7WA 2X2LA 3CTJA 1H4LA 4J53A 4JL9A 5AUYA 1A48A 3EZRA 1JKKA 3O96A 4W9WA 2XJ1A 2OXYA 4WKQA 2WQEA 3GU6A 4MQ1A 4PX6A 5EHOA 2VWWA 3EN9A 5CF5A 4X3JA 1OPKA 5DPVA 4PP9A 3O50A 2R3MA 3U6HA 2UW6A 3SW7A 3WIKA 3IOKA 4X2JA 2C0TA 3HDMA 4G1WA 5AP1A 4OLIA 1Z9XA 3DJ6A 1OL5A 2J0LA 5LWMA 5BYYA 2YLFA 4GK4A 3RHKA 3BGPA 2XIKA 3LJ0A 4XNEA 3UC4A 2X8DA 3MS9A 4GJ3A 2A2AA 2XRWA 1S9JA 3EFLA 3W2QA 4RIWB 2IVSA 2OK1A 4OGRA 3KK8A 2I7QA 3WZUA 2Y6MA 2WU6A 4YZBA 3ZC5A 3Q6WA 3H9OA 5TF9A 5HKMA 2VTSA 4A9RA 3R8ZA 4EOKA 2GQRA 1U46A 4E5AX 4BCMA 3GC7A 3PE2A 4QP6A 5IQCA 3NUYA 4EOLA 3R7OA 2VTLA 4UZDA 4GIIA 3PRFA 3W2OA 4YTIA 2QU5A 5AUZA 4CEGA 4YR8A 4QPMA 3FMKA 2W0JA 3BYUA 2ZV2A 5CAQA 1OUKA 4FTQA 3KEXA 3P5KA 4I24A 4M3QA 4CV8A 4FK6A 4X21A 1O9UA 3UO4A 1ZYDA 1PYXA 2PU8A 2UZNA 3FMHA 3HNGA 2BDJA 1QPCA 3F7WA 3R1SA 4PPCA 4ACCA 4AS0A 2I0YA 4BGQA 4JDIA 3DBCA 1AQ1A 3QGYA 2J50A 2WQBA 5AIRA 4FZ6A 4UALA 2PVFA 5DT3A 5LARA 3EQDA 4C02A 2YJSA 4ASXA 1OI9A 4FEQA 2BRHA 4PV0A 5DT0A 2HOGA 3NMUF 4OTQA 4BBMA 4LL0A 4A06A 3OEFX 5HLWA 4TY1A 3ID6C 2EU9A 4QMUA 4GRBA 5ETIA 2OF2A 2VWVA 3N9XA 5AUVA 4CCUA 1PKDA 2B9FA 4CLJA 3CKXA 5J9ZA 2P2HA 2OBJA 4WNPA 2IZTA 4E3CA 4CMUA 3F61A 5K5NA 3DAEA 3R00A 1IG1A 3F3TA 3L1SA 3JXWA 5HHWA 5CF8A 3ZXZA 4U41A 2C6TA 4RX5A 1WVYA 2F7ZE 2PZYA 2VAGA 3LQ5A 2VTHA 3R04A 2WMBA 2C1BA 2QKRA 4F09A 2J4ZA 3I6WA 1O6LA 4E4NA 2YJRA 4BGGA 3W8QA 4KRDA 3VIDA 3H30A 4XS2A 5GNKA 2VTRA 5AR3A 4EK5A 5KZIA 3DBEA 2XS0A 3OY1A 4YTFA 1SVGA 4PL3A 4I5HA 4O91A 3IS5A 2G2IA 2YIWA 2HZIA 2WTWA 3BHVA 3V8WA 3GXLA 2R3NA 3FAAA 3LFCA 4V0GB 4XUFA 5DEWA 3G6GA 4G2FA 4AOTA 2PMNX 3UPZA 4OUCA 4LG4A 3PXYA 3P1AA 5I9VA 4RG0A 3CY2A 5IDPA 4ANLA 4AW2A 2OLCA 4ITHA 4A9UA 5IEXA 1NVQA 1W83A 4NFMA 4R78A 3RALA 4JBPA 4MCVA 2XKFA 4CKIA 2IZUA 1RDQE 3DBQA 3MB6A 4PY1A 2C0IA 5BUEA 2R7IA 1E1VA 3DAKA 1U4DA 3IKAA 3LW0A 3S4QA 3FMDA 4GG5A 4BCOA 2YCFA 3ZLSA 2C6EA 3C0GA 3NW5A 4TYHA 3UG2A 3RI1A 3R1NA 5C4LA 5EI2A 4DAWA 2IW9A 1ZMVA 2XK6A 2ZJWA 4FTLA 4UY9A 1XH7A 1JNKA 1T45A 4M68A 4PTCA 5AR5A 5ACKA 3OCGA 4QTCA 2FSOX 2VWYA 4HVDA 4F9CA 1W7HA 5BVFA 5HOAA 3ORZA 3PIYA 1URCA 4TWPA 4MHAA 1YOJA 4LMUA 3FKNA 1Q8WA 2A0CX 4J7BA 5E9EA 3EYGA 4RC2A 4C58A 3DT1A 4CFUA 1YWVA 4TWNA 5M57A 3RNYA 4K9YA 3FZOA 3NAYA 4NJ3A 4FSWA 5DRBA 4CQEA 4X2NA 4ZZNA 2BZJA 5M4IA 4LI5A 1F3MC 1YDRE 3E5AA 4NYEA 1QL6A 2PZRA 3DXQA 2GFSA 4CG8A 3F3WA 4D55A 5JZNA 2LAVA 2QD9A 4BFMA 2X6DA 1YHSA 4DH7A 4O84A 3BLHA 3E8NA 4QYEA 4ANQA 3R9DA 2OJFE 5L4QA 2OIBA 4F63A 3ELJA 3MPAA 4AGWA 1FVRA 2W1IA 5IQDA 5CQUA 3R7GA 4WG4A 4C0TA 1URWA 4D0WA 3KMMA 2J51A 1GOLA 4JX7A 2JIUA 1VJYA 3TKUA 5FTOA 1CMKE 3BU5A 5H3QA 3SX9A 1UU8A 5M51A 4B8MA 4F9BA 3FQHA 2QG7A 1JAMA 2F2UA 2YZAA 2WIPA 4FKGA 1WFCA 5LVNA 5EM5A 5A46A 3R0TA 4G3DA 2JBOA 5C27A 2GS7A 3PPJA 4G31A 3LFAA 4IHPA 5AP6A 3VW8A 4F9AA 3R8LA 4AQCA 3FI2A 5CZIA 3WF5A 4PF4A 2YERA 3ENMA 3U55A 1WBNA 5CTPA 1H1PA 2I40A 3HL7A 3MESA 3A8XA 4HNIA 1OBDA 3S0OA 3GB2A 4MYGA 5E8YA 1H1WA 1QPEA 4DEDA 4F9YA 4KA3A 2IG7A 3OTVA 2Z2WA 3C7QA 4QP7A 4QOXA 4XX9A 4QP3A 4ZEGA 2IZRA 3K2LA 3QALE 4ASZA 1T46A 4M67A 4MXXA 4IVBA 3QLFA 4AA5A 2UW7A 3LFEA 3HA6A 2XIYA 2WTDA 4HYHA 1PMEA 2WXVA 3GBZA 4MXCA 4FV9A 4X3FB 4FEWA 3OWKA 2ZV9A 3BBTB 4F7NA 4F70A 5D10A 5EM7A 3Q96A 5AAFA 5T68A 5KX8A 3PUPA 4KIPA 3C1XA 3VRZA 1NA7A 4BZNA 2ONLC 3MVLA 1OGUA 4FKRA 3ZM9A 3QXPA 3OCTA 1JSVA 1WBOA 5ETAA 4IAYA 3TKHA 5DR6A 5C9CA 2BRGA 2PVKA 1V0PA 4CFNA 4EQMA 2PHKA 5HORA 1PMVA 3LMHA 4D58A 5E1EA 1DM2A 1UWHA 1YQJA 1Y6AA 4LFIA 4ZTHA 3CQEA 4JDKA 4L3LA 3NNUA 3OW3A 2UW4A 4QQJA 5DR2A 5K5XA 3GOPA 2CCHA 1J7IA 4DH5A 2AC5A 2OU7A 3E7OA 2ZM4A 3R8PA 3ZZEA 2JKKA 2QOKA 3BV2A 5BX0A 4ASEA 2YZLA 1Y6BA 4ZJVA 2VN9A 5BMMA 4BB4A 1SVEA 2XNPA 2YCRA 3I5ZA 3QRJA 4BI1A 2BAKA 3IPHA 3LVPA 4FR4A 3VUTA 3DDQA 3EQRA 5L2WA 4P2KA 5EHLA 2B4SB 3KA0A 2CDZA 4HCUA 4IB0A 4ARKA 4DH3A 4KUJA 5M08A 2OXDA 2I0EA 3V5LA 2PE0A 4FNWA 1W0XC 3PJ8A 2VTNA 4RJ8A 4ZS0A 1YOMA 4D4RA 3KVXA 4ONAA 5FDPA 3FHRA 2PVHA 4FV0A 4XRLA 3KU2A 3RAIA 3QD3A 4J1RA 1U54B 1UV5A 4FKIA 2OZOA 4NIFB 3OXIA 4MF0A 3S2PA 4S32A 4IB1A 1CSNA 2W9FB 5ANGA 3FQEA 2HZNA 3CXWA 4FKOA 1M7NA 2V7AA 4RGJA 4O7RA 5CU2A 2FH9A 4C4FA 4EBWA 3IGOA 2KTYA 4GIHA 5HQ0A 4RFMA 5JZJA 3TZ9A 4AFJA 3O8UA 4ANNA 3KMWA 4FV1A 4XP0A 3V5QA 2XRUA 1Q62A 4P90A 4GK3A 4IAFA 3OG7A 4FOBA 4C61A 3D9VA 1J3HA 3POZA 3VBVA 1ZMUA 2OJGA 5H8BA 1H1SA 3TUDA 3C50A 4YMJA 4FE2A 4ZMFA 5M07A 3HV5A 2ZMCA 3ENHA 2J5EA 3IW6A 4EH9A 5TR6A 4E73A 3HV6A 3V5JA 2ITPA 2G1TA 1Q8YA 5F95A 4W4YA 3V5TA 2BALA 4C3RA 1BI8A 2XCHA 3CKWA 4IJPA 1PXKA 4H3PA 3BQCA 3V6SA 1H28A 2B52A 5AP4A 2PYWA 1WCCA 2NPQA 3RPVA 2PUPA 4IVAA 5EKOA 1PXIA 2GNFA 3R2YA 4FSNA 4RMZA 3G9LX 5AP3A 3TNPC 2PZ5A 2J5FA 4BDJA 4BCJA 4DFBA 3GFWA 3EN4A 5E8SA 4PMMA 2BDFA 4X3FA 4D5KA 2Z8CA 4IAZA 3FI4A 2F9GA 4OTGA 3F66A 4O0YA 4C4JA 1XWSA 3LCDA 4KD1A 3LXKA 2V7OA 1Q3WA 3QD2B 1DI9A 4YBKA 4YBJA 4R5YA 5DT4A 3C4WA 5CASA 1KWPA 1ZWSA 3I6UA 3NIEA 3MWUA 5CT0A 4QP8A 2XB7A 4WOVA 4ZJIA 2I1MA 4RPVA 4GG7A 1ZYSA 1K9AA 3QTUA 4M12A 2CNUA 3HRFA 3DXPA 4DEIA 3NPCA 3DQXA 5DYJA 3F3UA 4EYJA 3VUKA 5EHYA 4YTCA 4RJ3A 4X6RA 5JQ5A 1ZRZA 4CZUA 3VULA 3D5UA 3BQRA 4QNYA 3C4CA 3KY2A 1W98A 2C69A 3HP5A 2C30A 3BHHA 3FKLA 4NW5A 1Q61A 4F1TA 4ANSA 4O27B 4JQ7A 2GS6A 5EDRA 2HIWA 3R9HA 3R8UA 4QT1A 2ITQA 3A8WA 1XO2B 1PXJA 2WTKB 2X9FA 3D14A 4IWDA 3P08A 1QCFA 2G15A 3A7FA 3FLYA 4RT7A 3R7YA 3JR1A 4YJNA 3LCOA 3FMMA 3R71A 4QRCA 3AXWA 4AN9A 4FIGA 3Q52A 4TT7A 3BBWA 3V8TA 2CGXA 3RMFA 3VBQA 4FOCA 3ZEWA 3BIZA 4AAAA 4AA0A 3NYVA 5KO1A 4NIFA 1U54A 5IQHA 3MV5A 4NK9A 4CMTA 4WT6A 4HW7A 1H27A 4FIFA 3Q4UA 3QTIA 3DOGA 3F2NA 4Z7HA 5HU3A 3L8VA 1MQ4A 4FL1A 4HGLA 4JBQA 3MH0A 3FLWA 2WEVA 3UZTA 4A9YA 1IASA 4U9AA 4BRXA 2P0CA 1NW1A 3UP7A 3M42A 1Q8TA 4RJ6A 2WPAA 1PHKA 3LE6A 3PLAE 1Q4LA 2IJMA 3LKMA 2XMYA 4L45A 4Q5HA 4QTAA 4EZ7A 3LJ1A 2C6DA 2JKOA 3QQJA 4L9IA 4RLLA 5DVRA 4B9DA 3GGFA 2GU8A 4PP7A 3KKVA 3LFQA 4R7IA 4FKLA 3PFQA 3U6JA 3SC1A 4CKRA 2C6KA 3BGZA 2VO0A 4S2ZA 3ROYA 3FHIA 5IQFA 4BYIA 3EKKA 4WD5A 5AA8A 3GT8A 3COIA 3GCVA 4QP9A 4KWPA 3LMGA 4O7SA 5CY3A 4RIXB 3OHTA 4LUDA 3HV3A 3R6XA 4FZAB 4QMQA 4O7TA 4EH6A 4I94A 3QKLA 2YDJA 2C5NA 3F3ZA 4FV7A 4YZCA 5FM3A 5AWMA 4EH5A 5L2SA 3V5WA 4L52A 4EOQA 2V5QA 4FTIA 1WBVA 2X8EA 3GCUA 3KRJA 3NNWA 3A4OX 5GIPE 4FEUA 5HO8A 3CE3A 4G16A 3VF8A 2PVJA 2W1ZA 2PZPA 2YM6A 1OPLA 3AG9A 4NWMA 4D9UA 1UU3A 5AR2A 3VS4A 5LJJA 5HE3A 5CF4A 3DZQA 4H05A 4M14A 2BMCA 5F4NA 3FYKX 5JGAA 3TTJA 2YISA 2BUJA 3COMA 3ZSGA 3RPRA 4F64A 1JQHA 1W8CA 4A9SA 5CLPA 2WOUA 3PJ3A 4AW1A 4BCNA 1PXNA 3RZBA 2UZOA 2JLDA 3KF4A 4X2KA 1UU9A 4H3QA 4BZOA 3A61A 3QL8A 4FZDB 3DZOA 4TWOA 5EYKA 4FIIA 4AA4A 4DTBA 3ETAA 3BE9A 3VS0A 1WBWA 3O17A 2W1GA 3R1YA 3RAHA 3DS6A 3FXWA 4IFGA 1HCLA 4YTHA 5AV0A 3DQWA 3GC9A 4IADA 4IC7A 2XBAA 2XUUA 3R9OA 3UO6A 5DFPA 2E9PA 2JEDA 2UW3A 3QTRA 4QYYA 4M0YA 3TZ7A 1Q99A 2YCQA 4W4XA 5KBRA 3LFNA 1BL6A 4YHJA 3U8WA 5AAEA 3ODZX 4OBPA 4CT2A 5DMZA 4XG2A 4J8MA 2R3HA 1BMKA 3OVVA 4FTJA 4TNBA 3EJ1A 2CMWA 4F99A 1Y8GA 1KE6A 3QA8A 2BIYA 4UMTA 2XIXA 5AIKA 3UE4A 4MWHA 2GTNA 2UW5A 4CRLA 5C4KA 4WNKA 4EH2A 3KXZA 4DF3A 1TKIA 1YXSA 2WO6A 3FPMA 1UKIA 1KE7A 3NEWA 5LOHA 2CKEA 1ZZ2A 4BDFA 2CGUA 3UP2A 4XG6A 5AA9A 4IDVA 5LVMA 3PYYA 2QODA 3MN3A 4EKLA 5AUTA 2GQGA 5IU2A 4KIQA 5L6WL 3PP1A 5J1WA 2UW9A 2UZBA 4O7NA 4O7LA 1TQMA 2YIRA 4QMMA 3R9RA 3BU6A 3TCPA 2WKMA 3QWKA 4DE4A 4MD8E 4OTWA 4BDBA 2X0GA 3GFEA 3ORPA 3Q9ZA 4DFZE 4V01A 3KC3A 1YW2A 1YXTA 5BVOA 5M56A 4IE9A 4PQNA 2BPMA 3VS3A 4I5PA 2HK5A 2XIRA 1R39A 4ZLYA 3QYZA 4JR3A 2ERKA 1STCE 4N6YA 5FD2A 4YJPA 4C57A 4D2VA 5AM7A 5E1SA 4E6AA 5ETFA 1LEZA 5IISA 3G0EA 1RE8A 3BE2A 4GL9A 4I22A 4KBKA 4RIXA 1XH9A 3OROA 4HPTE 5IKWA 2XVDA 4ZK5A 3RK5A 2VWIA 3RKBA 4MX9A 4CRSA 3DKCA 5IQBA 2QOOA 2JKQA 3MH1A 3PA3A 3GP0A 4RFZA 2W4KA 4BWPA 2YCSA 4Z3VA 5CZHA 5HNIX 3ULIA 4GT3A 5DGZA 4ACMA 3EN7A 3ZLYA 1OIRA 3N4VA 2AYPA 3QRUA 3HMNA 5I9ZA 1XBAA 4DITA 4DFLA 3CGOA 2B55A 2E9NA 2UV2A 5ANJA 3CJGA 3GU7A 2QLQA 2PVNA 2R2PA 4BCIA 1H25A 3IW7A 1TQIA 5FXRA 3TNHA 4IFCA 2HW6A 3V6RA 3CJFA 3LCKA 5DRDA 3ZDUA 2E2BA 5HIDA 3KVWA 4FVPA 4GVJA 2YM8A 3EQGA 4DGLC 5LMKC 5I0BA 1CDKA 2BTRA 4I6FA 3KFAA 3ANQA 5BMSA 3TM0A 3C4EA 3V5PA 4O7ZA 3I1AA 2E9UA 3MFSA 4XLVA 3V51A 2BFYA 4ANMA 3ZO2A 3MSSA 3VBTA 3MFUA 1VEBA 1O6KA 2X9EA 2HAKA 4IVDA 3T3UA 4EHVA 3E92A 1WAKA 4EONA 2HYYA 1XBCA 3QD0A 4OTPA 4XBRA 1GZOA 3TTIA 4JXFA 3ZUUA 2CPKE 1JKSA 4H36A 2JDOA 3KMUA 3KB7A 4XG3A 2VU3A 1ZYCA 4YC8A 4FKWA 5JRSA 2OIDA 2HZ0A 2ZM3A 3MTFA 1FPUA 4AT3A 4DLJA 1GIJA 4O7VA 1BL7A 3GC8A 1JOWB 1U5QA 2XK8A 3UG1A 4BN1A 2CKOA 5A54A 1YI3A 3LJ2A 3IW8A 4O82A 3PA4A 3QKMA 5FWKK 4GFGA 4X0MA 1Q8UA 1ZOEA 2XIZA 5J7HA 3EQIA 5DBXA 5EG3A 4IVCA 4LGGA 3ULZA 5CANA 3EIDA 3ZU7A 4U40A 2O65A 3ORKA 1AGWA 3Q3BA 5L3AA 4GEOA 4JDJA 2ESMA 3FXXA 2RL5A 4X2FA 5KE0A 4U3ZA 5J79A 2VV9A 5IUGA 3GNIB 4GYIA 4I1ZA 4MD9E 5HICA 4BL1A 2DS1A 4W8EA 3VUHA 3U4WA 5M4FA 2ZV7A 3FE3A 2B54A 3BRBA 3G0FA 3P7AA 4PDOA 3UODA 3UZPA 3ZO3A 3THBA 1NY3A 1CTPE 5F1ZA 1OKZA 4JG6A 3MGYA 5BUJA 3F2AA 2W96B 4TKSA 5HCXA 2ZDUA 4AZEA 2O3PA 2BHHA 4Y95A 3UOJA 2UZEA 1H24A 4XMOA 4K1BA 3QD4A 3UVRA 3FSKA 4F7JA 3BZ3A 3ZMMA 4FG7A 3L9MA 5ACBC 1MP8A 3O7LD 4DCAA 3QQGA 1SZMA 2JDSA 2XNBA 1W82A 3AC2A 3CD3A 5CU6A 3BYSA 1VYWA 3ZRLA 1H26A 2W99B 4D28A 5AV3A 1JVPP 2QR8A 4TPTA 2ZDTA 3C9WA 4LV5A 4FMQA 5E92A 2Y4IB 2PK9A 2OF4A 3LFSA 4JVGA 4YSMA 2BVAA 4ACDA 4NL0A 4ZTLA 3WF9A 2W1FA 3VQHA 3MH2A 4DBXA 2PZIA 3WF7A 3ZM4A 3N4TA 3ZCLA 2J7TA 3E62A 4QO9A 3F88A 4RWIA 5H8GA 4NKSA 4XYFA 2X7OA 5E90A 4FKSA 4EOMA 4F6UA 2JBPA 5E8TA 1MQBA 5FP6A 3DKOA 4Y83A 2OSCA 2VD5A 3FMLA 4I6BA 4RFYA 4E6DA 3OUKA 3C51A 4DC2A 3MYGA 3TIYA 3DKGA 2YWVA 1V1KA 2OWBA 5K0XA 4NTSA 2P55A 5CENA 3KK9A 2QOFA 4JIAA 4EZ3A 1MRYA 4FSRA 1FVVA 4MEDA 4DEBA 1GNGA 3F5GA 2FVDA 4BDCA 4JNWA 3R83A 3HECA 3EN6A 2H34A 5IF1A 4NEUA 2Q83A 1UNHA 2OJJA 3RNIA 4C34A 5HI2A 2WTJA 4UN0C 5CU0A 1P2AA 4B0GA 2P2IA 4BCGA 4ZXTA 2QOIA 5L2QA 3DB6A 4U45A 5H8EA 2XNGA 3E63A 4NM3A 5DN3A 1TVOA 5KKRC 3FV8A 4IANA 4MXYA 4TRLA 4M15A 5L2TA 5TT7A 3W2RA 5BQ0A 2QO9A 4IH8A 4IDTA 4E4LA 3MW1A 1Q97A 3KXMA 1ZY5A 3WOWA 3HAMA 4YO6A 1R1WA 4W9XA 5A4CA 4L01A 5CNOA 2JFLA 2P33A 3LCSA 3D5VA 3DY7A 4IAIA 3RPYA 2PVLA 4IX6A 1H01A 5HVYA 4BDAA 1U59A 3ZFXA 3Q2MA 2WU7A 2YWPA 2YIXA 4EOSA 5CEPA 4I21A 5M44A 3E93A 2WZJA 2I0VA 2GNLA 4ZS4A 2WFYA 4CD0A 3ZSHA 4AGDA 2PPQA 5IUHA 4C36A 5IMXA 3RZFA 1MRVA 2R5TA 2OFUA 4ID7A 4BHZA 3NVMB 4EZ5A 3NW6A 2JAMA 1KV1A 3ORIA 4GCJA 1YXVA 2C6IA 5C26A 1FINA 5IDNA 4XBUA 2GDOA 5HG5A 2XM8A 3WIGA 3VBYA 4FSMA 3LCTA 3R73A 3TWJA 3ZSIA 3Q60A 3PP0A 3KGAA 5BPYA 2Y9QA 3EQFA 2LGCA 4W8DA 5DNRA 4D1SA 3DJ5A 5IQGA 4AWIA 3E8EA 4RC4A 3MIAA 2PMOX 4GUBA 1IR3A 5AV4A 3E7VA 5GIOE 5JK3A 1XBBA 2FA2A 4U7ZA 4DBNA 1GZNA 3JPVA 4OTFA 4FL2A 1OIUA 4FSTA 2XJ0A 3IW4A 3VO3A 2YM5A 3PVWA 3ZONA 4MBJA 5JRQA 4ZSGA 4R77A 2GS2A 3ZZWA 4AXAA 2ZVAA 3OP5A 2DYLA 3PXRA 4JR7A 3LAUA 4OT6A 4RIWA 5FQDC 3RCDA 5I9YA 3KF7A 2ZYBA 5AUUA 1FBNA 3FMNA 4PRJA 3UOHA 3H9RA 3MA3A 1XJDA 2GCDA 4BY9E 4K2RA 2OZAB 4USDA 3MH3A 4TW9A 4FYNA 4AW5A 4GH2A 1RJBA 3EH9A 4UXLA 2ZB0A 2REIA 2HWPA 4PTGA 1XH5A 5EW9A 5J87A 4OAUC 1H1QA 4D1XA 3BEAA 3G9NA 4QMPA 3KRWA 5ITAA 4F0FA 2P4IA 2WMVA 3HZTA 4TTHB 3Q5IA 2ITXA 4M13A 4QP1A 4QP4A 2PTKA 3RM7A 3G5DA 3ZC6A 4UZHA 2WTVA 4ANOA 1ERKA 3MJ1A 3C13A 1QPDA 4QMVA 5GJGA 3ZS5A 5M09A 4QMTA 5D41A 5JFSA 4N4SA 4U80A 3FBVA 1I09A 2GNHA 3BPRA 1JSUA 4TYJA 4EYMA 2PE2A 4FK3A 4AZWA 3FL4A 5AV2A 1NVRA 3DKFA 1W84A 3PXFA 2BKKA 5L8KA 4LUEA 3KN6A 3ORXA 4FT3A 3ORMA 5CXHA 2XYUA 4ZTMA 4H3BA 4Y8DA 5J5SA 2DQ7X 4XOYA 2VUWA 4L7FA 4FKPA 3POOA 5GJFA 1Y8YA 1ZAOA 1PXPA 1GIHA 2NP8A 3FZSA 4FC0A 4FBXA 4FZ7A 3TNQB 5IEYA 3NWWA 4MNFA 2QOBA 5FTQA 3VVHA 3W32A 5HVKA 3QRTA 4BBFA 3PRIA 5A3XA 1P5EA 3VNTA 1UA2A 2PUIA 4RZWA 4FZFB 3C4XA 3KCKA 5KMLA 4FL3A 5EDPA 2CJMA 2YM7A 4I4EA 4L3PA 4YZ9A 3O8PA 4J8NA 5IZFA 4IB3A 2EXCX 4TYGA 5IUIA 2W1DA 3HVCA 4HVGA 4E4MA 4Z9LA 2VRXA 4ACHA 4XG4A 3S1HA 3OXTA 2O2UA 1H8FA 3R2BA 1OKYA 3PTGA 3W33A 5K4IA 3F2RA 4JRNA 4IZ5A 5H2UA 4EQUA 3LIJA 3R22A 1V0BA 4IMYA 4ZY6A 4ZSEA 2CNVA 1J91A 4AX8A 1XH4A 2UVZA 5FTGA 4FICA 1PXOA 4GW8A 4WBOA 2OJIA 3FKOA 4LV8A 2UVYA 1OPJA 3RINA 4FGBA 4V0GA 4ENXA 3DAJA 3RWPA 4BTKA 2IVVA 5EOBA 4GKHA 4R3CA 2Q0NA 5ANKA 4X6QC 2BAQA 2R3JA 5AM6A 4I92A 3ALOA 3F7ZA 3KCFA 4QMYA 4CQGA 2W1HA 4U8ZA 1J1BA 3Q6UA 4IC8A 3RTPA 4CFVA 2X81A 3LFBA 5CU4A 3NUNA 5FDXA 5FXSA 1WBPA 2WGJA 4U81A 4CV9A 4F0IA 3DXNA 3RK9A 4CT1A 2SRCA 2OZAA 3GOKA 2Z7QA 3K5VA 4FUYA 5IQIA 4HZSA 2O63A 2WMXA 4UXQA 2C3KA 2ITZA 3V04A 2CGVA 3I0OA 1BKXA 1MRUA 3NUXA 4YU2A 2R64A 3D2KA 2R9SA 4KB8A 4L8MA 3VHEA 4XCUA 4MD7E 2YITA 1OIYA 2BFXA 2W4OA 4G6LA 4A7CA 5CEOA 4YGAA 2YFXA 4II5A 3M1SA 3NX8A 3WI6A 3C4FA 3BEGA 5HG7A 1YKRA 3HUCA 3BELA 3GC0A 4J96A 5EI6A 4O6EA 2OICA 3NCZA 3QRIA 4LM5A 5JGBA 3F5PA 4JAJA 5E8WA 3A60A 4XG8A 3DLZA 5EM6A 4FTRA 4I6HA 4K8AA 4APPA 4ZAUA 3JUHA 3HKOA 2W06A 4AFEA 3MJ2A 4QQTA 2NO3A 3NRMA 1RQQA 2WMQA 4AG8A 5L6PA 4D4SA 1EH4A 4M69B 4BKJA 4WNMA 3Q4CA 3QC9A 5LCKA 3DTCA 2R3QA 4AGCA 1UNGA 1BLXA 4EWHA 4O1OA 3F5XA 2X7FA 2O8YA 3O0GA 3PVBA 1ZYJA 4JRVA 4BDIA 2XZSA 2CHLA 5EYCA 3TN8A 4JBOA 3D2IA 3W8LA 3LM0A 4JQ8A 4MVFA 3QTWA 3JY0A 5JMSA 4J95A 3TG1A 2ZAZA 3NGAA 1KUTA 3OWJA 5FM2A 3V8SA 4ANBA 4IM0A 4XV9A 2BZHB 3FLQA 2OFVA 3MY0A 4G6NA 4C2VA 4TNDA 5M4CA 5T3QA 3TUCA 2FGIA 4C62A 4QPAA 4KS7A 4FSYA 3F5UA 4O22A 4A07A 3HP2A 3QKKA 4GMYA 2XM9A 3R63A 4GUEA 4LL5A 2IW8A 4FUXA 5CNNA 1E1XA 1SNUA 3KRRA 3OMVA 4FVRA 4EK6A 3R7VA 4HVHA 2CNQA 3ET7A 3COKA 5CS6A 3SXFA 3EB0A 2CSNA 5DR9A 2E9OA 4D4VA 1FOTA 4OW8A 5LVOA 3QWJA 2GHLA 5GZ8A 3ZH8A 3GENA 5CEMA 4NCTA 3DB8A 4O0TA 4ITIA 5CQWA 4DGMA 4BTMA 2O64A 1GJOA 4RQVA 3EFKA 2JDVA 5A4EA 2X2MA 3IECA 4IW0A 3TNWA 3TT0A 2QHMA 4EK3A 5HTBA 4EQCA 4FIHA 2AC3A 3IDPA 3R7UA 3OY3A 2WB8A 4AF3A 3VS6A 4C4EA 2QNJA 4GS6A 3CP9A 4DEAA 2QO2A 3QU0A 2XNMA 3WZDA 4C8BA 4KIOA 3CC6A 3P4KA 3R9NA 4BKZA 1JKTA 5AP2A 5HX8A 3QCXA 1OKVA 4E26A 4BF2A 3O7LB 4FG9A 1PW2A 2WMRA 3ZLXA 5B7VA 5KMMA 2OG8A 4JS8A 5HE2A 3Q5ZA 1R3CA 2YN8A 3MTLA 4EUTA 4C4GA 5BVEA 5EQPA 4G17A 4EI4A 4YO4A 4QQ5A 3MB7A 4L68A 4LRMA 3VW6A 4ERWA 4DLIA 3SA0A 2QKWB 2EB3A 3OW4A 4NFNA 2Z7LA 4N0SA 3VS5A 4G34A 5EFQA 1SMHA 3OT3A 3Q04A 5JT2A 3QFVA 4AZVA 5CF6A 2VX3A 3PVGA 3UVQA 5FUTA 3PPKA 1QMZA 1DS5A 4BTFA 4EH7A 1OL7A 2J0JA 3OS3A 2RFSA 4K77A 1Z57A 3QRKA 5E7RA 2F49A 4G3GA 2XH5A 2GFCA 4NT4A 5DH3A 3TJDA 3FWQA 5HBJA 5KZ0A 4RQKA 2W7XA 2JGZA 3VBWA 5B2LA 3WE8A 3CQUA 4HGEA 2JDTA 4WNOA 4D2SA 4QD6A 1IEPA 4GV1A 3VAPA 2RIOA 3FL5A 3QZFA 3OOGA 5HNBA 3MFRA 4YLJA 3DFCB 5E91A 3UIUA 3RAKA 3I81A 5FXQA 4O1PA 2GQSA 3F6XA 2X4ZA 2GNGA 2C5OA 3L8PA 3ACJA 3EWHA 3RK7A 4FV8A 5CSWA 3S95A 4WSQA 2XKDA 3H4JA 2WHBA 3RPSA 4O81A 1BUHA 4IM2A 4HYSA 3PWYA 4ACGA 5CI6A 3A99A 4HYIA 5FRIA 2XKEA 3C0HA 4UB7A 3SXRA 4ZTRA 1XHAA 5BVNA 4D2TA 2R3OA 4IZAA 2ITTA 5EYMA 5IA1A 3PA5A 1YWRA 4FKUA 4TZRA 2VTQA 4ZY5A 2V0DA 2VTTA 3ZDIA 5EQYA 2ACXA 3NW7A 1V0OA 5BUIA 4ERKA 5IMEA 2PVMA 3IOPA 5CALA 5IA0A 5L2IA 4NTTA 3FSFA 5EDQA 2Q0BA 3BHUA 3RHXA 4O0XA 3IK3A 2C0OA 4ORKA 1SM2A 1J7LA 2VWBA 3HGKA 2YIYA 4P5ZA 4ZP5A 4GJ2A 4WUAA 5FP5A 3BGQA 1GZKA 5AJQA 4UBAA 4KRCA 1REJA 2J6MA 5L8LA 2DWBA 5FGKA 2GSFA 2Z60A 4BR3A 3QGWA 2VTJA 1PMUA 1BI7A 3OEZA 3P7BA 4XV3A 1YWNA 3QXOA 4ITJA 3GUBA 5DWRA 2C6OA 3O71A 1IRKA 2EB2A 2VWZA 1VR2A 4O2PA 5G1XA 4HGSA 4CTCA 4B99A 2GTMA 2VNWA 3BCEA 5D9HA 3VS1A 3TV6A 5EYDA 3ZYAA 5J7BA 5GINE 2QCSA 4FSZA 1R0PA 5LWNA 5A14A 3UBDA 4ZTNA 2J0IA 3SDJA 3G51A 5TE0A 1UWJA 3ORLA 3E87A 1XH6A 2VWXA 5HE1A 3U6IA 3R30A 3ACKA 3HDNA 4KBAA 5JKGA 4J98A 3NUAA 4O6LA 3L8SA 4EUUA 2BR1A 2UZLA 4AE6A 2G01A 2W5BA 4RIYB 4HNFA 4DEGA 4RLKA 1Q41A 5HD7A 3D7ZA 3E8DA 4L67A 4E6CA 3AD4A 3O23A 3R1QA 2O0UA 2VTMA 3DPKA 4FT5A 4ZTSA 3G15A 4Q5EA 3QAME 5HCYA 3AMAA 1B38A 2XNNA 5AUWA 1XH8A 1QPJA 4FVQA 4RVLA 1P14A 1ZXEA 4ZIMA 4ZSAA 4S30A 3AT4A 4P5QA 3TI1A 5J1VA 3NVKI 4O86A 4KKHA 2WD1A 3F69A 1TQPA 3NDMA 2FSTX 3QTSA 4FYOA 3HRBA 4JBVA 2JITA 4JLCA 4N70A 4BCFA 4DG3E 4BBEA 3DTWA 3TIZA 5GZAA 5AMNA 3ZRMA 3ZTXA 4FKTA 4WSYA 4PDSA 2WMTA 3FZRA 1MUOA 2WEIA 4LRKA 2WMAA 3UPXA 4A9TA 2QI8A 3E64A 4AZFA 3OD6X 5J8IA 5HIBA 4YSJA 5KCVA 3EHAA 4BDHA 3KXXA 3EQCA 5EI8A 2WMUA 3AMBA 2YAKA 5JFWA 3QQFA 3QQUA 1KSWA 2UVXA 1YI4A 3T9IA 5A6OA 5HZNA 4GKIA 3SRVB 2V22A 3COHA 3IGGA 5DIAA 4ZLOA 5AEPA 4C4HA 1GAGA 2ETMA 2VX1A 4XH6A 3DGKA 5HNGA 3RM6A 4RWJA 3CPCA 4XG7A 5AX3A 4F1OA 4N6ZA 4BCPA 4WIHA 5F9EA 4GT5A 3CSVA 3BLRA 3NNVA 1OBGA 4DGGA 4NM5A 4X2GA 1FVTA 5CXZA 4EOPA 3KULB 2JD5A 4G9CA 3FLNC 4U6RA 5AFVA 3Q9WA 4WRSA 5ANIA 2WQNA 1PKGA 4EEVA 3FY0A 4ZSLA 1JSTA 1OL2A 3DU8A 1OZ1A 3SQQA 4EHEA 1YOLA 3FYJX 5LQFA 2ZB1A 1FMOE 3EZVA 4DA5A 2BZIB 4L43A 3H9FA 4C33A 4RX7A 3HRCA 4YPSA 3MVHA 4WG3A 3G6HA 4YNOA 2HXQA 1F5QA 4L44A 2OGVA 5ICPA 4GYGA 4UMPA 3QQKA 4FIJA 4GFOA 2R3IA 3MPMA 2IPXA 3DLSA 2HXLA 4X3FC 2RFNA 3CS9A 4USFA 1FGKA 1XR1A 4TYEA 3SG9A 4M7IA 4TL0A 3WILA 5K0KA 1F0QA 3FC2A 2Y0AA 4O0VA 5LXMA 4EORA 1OUYA 5KMNA 4FSQA 3BLQA 3VF9A 2W05A 4CCBA 3TDVA 1H0WA 2RFDA 3F9NA 4FT7A 4L00A 4NUSA 4FTOA 5BVDA 4IEBA 4FV6A 4ZLZA 1FMKA 4IB5A 2BDWA 3ALNA 2C3JA 4K33A 4AOIA 4I23A 2ZOQA 4DTAA 4O2ZA 1ZARA 2GHGA 4I0RA 3BV3A 5D1JA 3ITZA 4RIOA 4LGDA 3D5XA 3TNIA 2FYSA 1YDTE 5CVFA 3FLSA 2XF0A 4L6QA 4RIYA 2CKQA 4I0SA 3TACA 4D1ZA 5AP0A 2HY0A 2WAJA 2WIHA 4FSUA 3T9TA 3WYYA 1ZMWA 5DA3A 4AACA 4AU8A 2YABA 4BGHA 5H9BA 4DFXE 2A1AB 4IIRA 3QUDA 4MQ2A 4FKJA 3ORTA 3P78A 1Y91A 3QCSA 1CKPA 2IVUA 5IQAA 1E9HA 4K0YA 5A4LA 1KV2A 1HOWA 1A06A 3A62A 2IWIA 3BYMA 3AQVA 4S33A 4I20A 3HMMA 3M2WA 3P9JA 4F1MA 4YZMA 1KE8A 2A27A 2JFMA 3CY3A 5E8VA 3QX4A 4WO5A 4FKVA 2Y7JA 5C01A 4R7BA 4KSPA 5AV1A 4EOJA 5FBNC 3DBDA 4ZZOA 3NUUA 3CTHA 4DCEA 4EKKA 1G8SA 4J99A 5AR8A 4MH7A 3SD0A 2HZ4A 2NRYA 4QMOA 3AD5A 3CIKA 2JC6A 2BROA 3K3JA 3JY9A 3RAWA 5K9IA 4DG2E 3MBLA 3W2CA 3RCJA 1K2PA 2Y8OA 1PY5A 5AP7A 3SRVA 4D2WA 5TOZA 2IN6A 5HO7A 4DFUA 5AP5A 1H00A 2QC6A 1BYGA 4YJSA 1DAYA 2UW0A 4XEYA 3D15A 4PDPA 5CAPA 3MFTA 4MXOA 1ZOGA 3KULA 4IJ9A 3UIXA 4R3PA 5TKDA 4B8LA 4PTEA 2B9HA 4R3RA 1LR4A 3KXGA 2FUMA 3LQ8A 4LOQA 4MNEB 3RWQA 1S9IA 5AADA 5I3RA 5KMJA 3CQWA 3PWDA 3R8MA 4PDYA 1Q3DA 3ZBFA 3ZRKA 1O6YA 3NYNA 4FTTA 5ANEA 1A9UA 3ATSA 5C8KA 2ONLA 4FODA 3VRYA 2XCKA 5L8JA 1M14A 2YDKA 3IG7A 4C7TA 2PMIA 5C8NA 3K3IA 4OTRA 4YJTA 2R3KA 5CSXA 4OR5A 3PY1A 4RRVA 4X7QA 3SG8A 4I3ZA 4EJ7A 2HWOA 2EWAA 4FNZA 4IBMA 4NM7A 4QQCA 3UNJA 3UYSA 3W18A 4GK2A 2KULA 3HLLA 3I5NA 3QCYA 4QP2A 4AE9A 1WVWA 3L9LA 3PXKA 4CMOA 1M52A 2PUUA 4WA9A 3MY5A 2JAVA 4TXCA 4RX8A 4GU6A 3I4BA 3D5WA 4TN6A 3NZ0A 2NRUA 2OI4X 4JT3A 4PL4A 2C1AA 4AP7A 4BHNA 4TYHB 3N4UA 3ANRA 2R3LA 3OBJA 5F20A 4FTCA 1OMWA 5KNJA 3A2CA 4QTBA 4OAVB 4L53A 1OECA 3FZTA 3DK6A 4CLIA 4NSTA 3GU8A 3PY0A 4FG8A 4O96A 5AR4A 3ZXTA 2ZM1A 3U4UA 4IZ7A 1J1CA 3JVSA 3R01A 2B7AA 3SAYA 2R0UA 3E3BX 2PMLX 3EKNA 3ZO1A 3Q4TA 5ANOA 4XLIA 4N57A 4AZSA 4V04A 3O8TA 2WTKC 1XQZA 4XOZA 3CGFA 5DOSA 3CR0A 4AN2A 5KHXA 3FPQA 5BYLA 3FDNA 5A6NA 3ZUVA 3PIZA 4RJ5A 5CI7A 4Q9SA 4BCHA 3PY3A 5A4QA 4E6QA 4CTBA 2V55A 3H0ZA 4OTIA 5HVJA 1Q5KA 2H96A 5CWZA 4G5JA 2R4BA 3QTZA 2WOTA 4F4PA 3EL7A 3NAXA 5DHJA 3EQHA 2ITYA 1KE9A 5HCZA 2HCKA 2BIKB 2XK9A 2YM3A 4HZRA 3AOXA 4R1YA 4ZZMA 2RGPA 3MDYA 5IH5A 2BILB 1M2QA 1R78A 4QTEA 3B2WA 1M17A 3AMYA 4PNIA 4GU9A 2YIQA 4RA4A 3VUMA 4HCVA 2VO3A 4HVSA 4CXAA 5IH4A 3QA0A 4YLLA 4DYMA 5A9UA 4CYJA 5HE0A 3TEIA 3OXZA 5B0XA 2ITNA 2QO7A 3RPOA 4ASDA 3GCSA 4H39A 4CGAA 5ANDA 1JWHA 2ETKA 4IAKA 4LOOA 1OB3A 5IA2A 3HYHA 4USEA 4BTJA 2H6DA 3NYXA 4DHFA 3TKIA 3AC5A 4MNEA 4XP3A 3MPTA 4OTDA 1WZYA 3SLSA 4F6WA 1IA9A 4ZMEA 1YXUA 3ODYX 2YACA 1DI8A 1VZOA 4FTNA 3W1FA 4ZY4A 2HELA 3FJQE 2VZ6A 4U44A 3SXSA 1G8AA 5J9YA 2RG5A 1I44A 4FI1A 3FZ1A 4R6VA 3R8VA 2YDIA 3UMWA 5JSMA 3GQIA 2QLUA 3MVJA 4QTDA 3P79A 1SNXA 3D4QA 4Y5HA 3JYAA 5GJDA 4EBVA 4FX3A 4Q9ZA 4ENYA 4AW0A 4BCQA 4U97A 4UYAA 3ZO4A 4DEHA 5A4TA 3AC4A 3DJ7A 3F82A 4MXAA 4AN3A 2OJ9A 5CVHA 3A4PA 3RBWA 5BNJA 5HLNA 4ZOGA 3HX4A 4FIEA 4RJ4A 5CX9A 3IO7A 1H0VA 4F7LA 4B4LA 2B1PA 4M97A 3DNEA 5M53A 2WMSA 2J0KA 4L7SA 5CAOA 4YC3A 2B9IA 4JQEA 3OUNB 2IW6A 2WTIA 3KL8A 1ZZLA 3E8CA 2X8IA 1K3AA 1YDSE 4UWCA 5EOLA 3VJNA 4EK8A 2ITWA 4MK0A 5M4UA 3C5IA 4JIKA 3H0YA 5FLFA 4D2PA 5I9WA 4O83A 4Y5QA 5J95A 4NKAA 2RSVA 4OBOA 1JKLA 4L3JA 4EOIA 4YC6A 2XKCA 3BWFA 3U9NA 4DFNA 2XJ2A 3UQGA 3VS7A 4UMQA 4YUQA 4U42A 3FY2A 4F6SA 2RKUA 4QMWA 3UDBA 2FSLX 4FTKA 3UMXA 1OVEA 3VQUA 2EVAA 3GU5A 5KUPA 2I0HA 3D7TB 4RVTA 1WMKA 2UW8A 2HENA 2VTPA 5DLSA 2I6LA 1OL6A 2XYNA 4ZSJA 3F3VA 2PULA 4JG8A 4A4OA 3UJGA 4BI0A 2IO6A 4EH8A 1APME 4F65A 4I5CA 4E5WA 3MA6A 1WBTA 2OIQA 3FUPA 1ZLTA 2VTOA 4KAOA 4U0IA 1KOAA 4YLKA 2BRNA 4AOJA 1PYEA 4M66A 2B0QA 3UOKA 4QYHA 3TZMA 4QPSA 5HG9A 2AUHA 3BU3A 3VS2A 1P4OA 3LLAA 4AT4A 4GSBA 3BHYA 3LLTA 5HGIA 4YHFA 3ZFMA 3U51A 2O5KA 5LMBA 1OKWA 4BIDA 3HEGA 3B2TA 1HCKA 2QU6A 4J97A 4BWKA 4O0UA 5HBHA 3DK7A 2W17A 4C3FA 3LFFA 3V3VA 5LCJA 5KMIA 2R3RA 4PMTA 4R1VA 1NT2A 3W55A 3FLZA 3I0QA 4KBCA 3U87A 3LZBA 2R7BA 4R5SA 3VHKA 3GEQA 3Q32A 3I60A 2VGPA 3VC4A 5HX6A 4E20A 5IA3A 3EN5A 3WF6A 3KRXA 4DTKA 3FI3A 4CZTA 4IXPA 3O2MA 4OBQA 3VN9A 2OKRA 4CFFA 4IACA 3S3IA 3H3CA 4F08A 3HV4A 3ZEPA 4G3EA 1L8TA 2VO7A 5CSPA 4PWNA 3BWJA 3E3PA 3P23A 4FTUA 1YVJA 3AC3A 3NUSA 3ZLWA 4AT5A 3KXNA 4DFYA 4XHKB 1U5RA 2F2CB 5DE2A 4ZJJA 2PUNA 4G3CA 3LQ3A 1PJKA 3PSDA 1NVSA 3OZ6A 1YRPA 4XG9A 4BYJA 4AGUA 2B9JA 4JG7A 3SOAA 4MF1A 2BAJA 4C37A 4CG9A 4H1JA 2QG5A 3PZHA 4L46A 3UIBA 1ATPE 4BCKA 5HU9A 3W16A 2JIVA 3ZOSA 2UZWE 4XP2A 4CFXA 3QF9A 2BHEA 3WARA 2Z7SA 2PVYA 3PXZA 2JIIA 4G6OA 4A4LA 3QTXA 4ALUA 2C5YA 3OWPA 2PY3A 4KABA 4F7SA 3L9PA 4HPUE 4EHZA 1LP4A 2G2HA 3HA8A 2C68A 4YNEA 3D0EA 3G90X 3ZFYA 3ATTA 4FV3A 4GVAA 5FBOA 5D7VA 2YEXA 4LGHA 3HUBA 2OO8X 3BHTA 4M8TA 1PXLA 3GVUA 4LYNA 4CKJA 2EXEA 4HGTA 3D7TA 3NR9A 4M0ZA 4Q2AA 4TYIA 5J9LA 4IX5A 1CM8A 1UNLA 3WZJA 5HD4A 1UVRA 5DG5A 3NIZA 4O38A 4YJQA 3R7EA 3DDPA 4KIKB 5AX9A 3SW4A 4E4XA 4C3PA 3UZRA 3IQ7A 4TWCA 1B39A 4FV5A 5AR7A 4AZTA 3I79A 2DUVA 4PMPA 4JJRA 1YXXA 4BC6A 2WMWA 1ZYLA 5HLPA 2GMXA 4G9RA 3AGLA 2F4JA 3EFJA 5B2KA 4BKYA 4YJOA 3TDWA 1PMNA 1ZY4A 3OF0A 4H1MA 3PG1A 5CVGA 3CCNA 4FNXA 2BTSA 4HVIA 3L8XA 3FZPA 4IZYA 2XK7A 4D5HA 4UX9A 1IAHA 4DT8A 4H58A 4DGNA 2CKPA 4O7YA 2H8HA 4C38A 3N51A 3UNZA 2XNEA 2UZVA 3AD6A 3H10A 5GHVA 3QX2A 4IWQA 3E88A 2C6LA 2XEZA 4LOPA 4DINA 3UQFA 2C6MA 1OM1A 4S31A 5JEBA 4S34A 5KMOA 3LM5A 5JQ8A 4O0RA 3VBXA 5E4HA 2ITOA 3I7CA 3P7CA 3PZEA 3CTQA 3RGFA 3QQHA 5AAGA 5CAUA 4R8QA 3AC8A 2Y4IC 3C0IA 5EKNA 2X7GA 5LMKA 2RFEA 4KINA 4Z16A 4E8AA 1KE5A 4FV2A 3WBLA 5IH6A 2CN8A 3Q9XA 4CZYB 3BKBA 2C5VA 2R3FA 3PE1A 2PWLA 2W5AA 4NH1A 2X2KA 3A7IA 2QOQA 3Q53A 4I6QA 4RWLA 1PRYA 2RF9A 5BYZA 1X8BA 5I4NA 3NSZA 3C5UA 3REPA 1ND4A 1H08A 2FB8A 2ITUA 2V62A 3BYVA 5D12A 4Y72A 4PPAA 4FEVA 3R21A 4I5MA 3FMJA 3W2PA 3CPBA 3RJCA 4QYFA 3M11A 4JAIA 4NZWB 3KREA 3G2FA 4FNYA 2GNIA 3UNKA 1YHVA 2XNOA 4GT4A 2G9XA 3IDCA 1FQ1B 5C03A 3VUDA 4Z7GA 3KQ7A 4YPDA 4KS8A 5KKRB 4FEXA 2WQOA 3OWLA 3T3VA 4PUZA 1WVXA 5TO8A 1NXKA 4M69A 3ERKA 3TXOA 3UOLA 4FA2A 2ERZE 2X1NA 4QNAA 5LMAA 5K4JA 4Y85A 5L6OA 4FTMA 4MKCA 2UZUE 2VTAA 3KN5A 3S00A 3U9CA 5C8MA 3TV4A 2Y6OA 2QVSE 5JFVA 2VTIA 4UWBA 3PPZA 2WTCA 3Q4ZA 4EH4A 5CAVA 2Y4PA 4HYUA 3QYWA 4CFWA 4E7WA 4UV0A 3HMPA 4AUAA 1H07A 3WYXA 2B53A 3OCBA 4IAAA 3EL8A 4D9TA 3DNDA 3P86A 3UIMA 1SVHA 5EH0A 3WZKA 3A7JA 2BCJA 4HJOA 3O51A 2OH0E 5LVLA 4DT9A 4F9WA 4RA5A 2RG6A 4MWIA 4EWQA 3CBLA 4CYIA 1P4FA 4KIKA 3L9NA 4O21A 4XV1A 1JLUE 2PL0A 5EW3A 3A7GA 3QHWA 3UVPA 2W1CA 4MXZA 3JS2A 4ALWA 3AGMA 3KRLA 3Q9YA 5GZ9A 2PE1A 3DV3A 3ZHPC 3G33A 4F0GA 1YHWA 1ZOHA 5E8ZA 2WELA 4BDGA 4HCTA 3CLYA 4W4WA 4BWXA 1AD5A 3WE4A 4E1ZA 2HY81 4DEEA 2F7EE 4CNHA 4ZTQA 5HIEA 1JPAA 1KOBA 3GQLA 2VO6A 2CGWA 5G6VA 4JI9A 1LUFA 1FGIA 2UZDA 4I0TA 5HESA 3UC3A 2NNWB 5IPJA 4MBLA 1CKIA 3PIXA 3QCQA 2QR7A 4IQ6A 1CKJA 2GNJA 4MBIA 3A7HA 3II5A 4KNBA 3ROCA 4R7HA
chains in the Genus database with same CATH superfamily
3TJCA 3DA6A 3W2SA 2PVRA 2P3GX 3SV0A 3C4ZA 3GCPA 3QC4A 4RJ7A 4XV2A 1GIIA 4QMZA 5B2MA 3PDTA 3HMOA 3VUIA 5JGDA 2BRBA 2C47A 5EW8A 3GU4A 3OT8A 2GHMA 1GY3A 2Z7RA 3ORNA 3QTQA 2CN5A 3QZIA 2XK4A 1G3NA 3LOKA 4EOOA 2W5HA 3VUGA 4PPBA 2W9ZB 4NJDA 4RBLA 3TV7A 5D7AA 2UUEA 3LFDA 5KMKA 3K5UA 4QMNA 4FGRA 5CU3A 4FT9A 4P4CA 4IWPA 4K18A 4YJVA 3LXLA 1IAJA 2XK3A 2PSQA 4G5PA 4O0WA 2QOHA 3QHRA 4PL5A 3EOCA 4RZVA 4WBBB 3D83A 2OH4A 5FEQA 1OIQA 2OW3A 3PJ1A 4ALWA 5IA4A 1M7QA 1XKKA 4I4FA 1BX6A 1RW8A 4EH3A 2VGOA 3PSCA 4RC3A 4LMNA 5I5ZA 2C4GA 3QLGA 4KSQA 2R0IA 3RVGA 3QZHA 2H9VA 4B7TA 5LVPA 2FO0A 5EQEA 3LXNA 1H1RA 5I9UA 4B6LA 3ZBXA 5KBQA 1M2RA 2IF8A 3OTUA 3BX5A 4CSVA 2QHNA 3T8OA 1OITA 3MI9A 4WG5A 5BVKA 5IQEA 4EC9A 2W1EA 4UMRA 1DAWA 4J71A 4MTAA 2BKZA 1M2PA 3PXQA 3OOMA 2VNYA 5I9XA 2XA4A 3I7BA 5IEVA 2A19B 5HO6A 1B6CB 1Q8ZA 3FXZA 3TL8A 4EHGA 4NW6A 2BZKB 3GCQA 3IONA 2J90A 5C1QB 3OBGA 3FMEA 4O0SA 4OT5A 4BZDA 4HOKA 4UMUA 2E9VA 5HTCA 3HMIA 4APCA 3NNXA 3W10A 4BVUA 3EMGA 4IWOA 5E8XA 2Z02A 3FC1X 3PJ2A 3BYOA 4BDDA 1UU7A 4G3FA 4JX3A 3QUPA 5HTIA 2A4LA 3EQBA 4E5BA 4IX3A 2W4JA 5F94A 3NYOA 1JBPE 3QUEA 2QURA 5JN2A 2J2IB 3UGCA 3GI3A 4BI2A 5K3YA 5CEKA 3QZGA 4XJ0A 5M06A 5KHWA 3QQLA 3DFAA 2X6EA 4U43A 3WZEA 5HEZA 4Y46A 1Y57A 3NUPA 4C2WA 3SOCA 4KKGA 3UO5A 5CEIA 5JFXA 4U5JA 4RSSA 3LXPA 2EUFB 5D11A 2F57A 2F7XE 3UYTA 4YURA 5AUXA 1SYKA 4LQMA 4UWYA 3U54A 2X39A 4YZNA 4D0XA 3JVRA 4Y73A 2EXMA 4I93A 4GFMA 3PLSA 1Q24A 4W4VA 5EM8A 4WUNA 5CT7A 4XRJA 4DGOA 3LMIA 3TUBA 2CLQA 3BI6A 4IM3A 4QMLA 5EK7A 5CEQA 3UTOA 3D94A 2X4FA 3SKCA 3IW5A 3TZ8A 2R3GA 4Z55A 2IZSA 3QBNA 1GZ8A 4NCTC 2G2FA 2VX0A 2JDRA 2J9MA 1PF8A 4FKQA 4QMXA 4RVMA 4U3YA 5HG8A 4M84A 5BVWA 4EJNA 2ZMDA 3HV7A 2YM4A 4FF8A 3KXHA 5CSHA 4CFMA 2JKMA 3MVMA 4P7EA 4K11A 1IA8A 3FI8A 2R3PA 2J0MB 3DBFA 3PSBA 4D2RA 2ZFYA 3EQPA 1VYZA 3B8RA 3CD8A 3OFMA 4RVKA 4BICA 4JOAA 1YI6A 4C59A 1LPUA 3OCSA 3DK3A 4QYGA 4J52A 5ETCA 2WNTA 1PXMA 3UQCA 4ALVA 4BDEA 3CEKA 4KKEA 4MAOA 5J5TA 4RX9A 3EFWA 5IG1A 4IX4A 3AT3A 4DH8A 2QOLA 4JDHA 3LPBA 3PG3A 4NM0A 3V01A 3RP9A 2QQ7A 2CLXA 4RWKA 2GPHA 2FSMX 4YZDA 2ITVA 4U79A 3NS9A 3WF8A 2BRMA 4C4IA 3Q2JA 1G5SA 1OL1A 2C3IB 2YHVA 3VJOA 4EK4A 4EL9A 1L3RE 4A4XA 2A98A 3PVUA 2QONA 4DH1A 1WBSA 4YP8A 3SVVA 2IVTA 4FT0A 4PNKA 2CCIA 3AKJA 4OTHA 4E93A 4WRGA 3MIYA 3LHJA 3OC1A 3AT2A 1Z5MA 2ETRA 5FG8A 5T6KA 2UZTA 4D4YA 1UKHA 2WQMA 5FEEA 4NU1A 1R0EA 4K6ZA 3FEGA 3SGCA 4V05A 3PJCA 4FTAA 1LEWA 5CYIA 5JH6A 3FQSA 3MY1A 4DG0E 3P0MA 5FEDA 2XEYA 5HBEA 2C3LA 3NCGA 4YJUA 4QMSA 3SHEA 3B8QA 2YA9A 3IDBA 1J7UA 1REKA 3AC1A 5CSVA 3R7IA 3EYHA 2ZV8A 4EC8A 4BIEA 4UYNA 3NLBA 4I41A 5I3OA 3DCVA 4LRJA 4PMSA 5DEYA 4CVAA 4L42A 4YJRA 2C5XA 2XP2A 2QOCA 3K54A 4BIBA 4WHZA 5DI1A 2HW7A 2YAAA 5E8UA 3VWAA 3R02A 5M55A 2OXXA 4YHTA 5IA5A 4C35A 2XBJA 3ZUTA 3HAVA 4DN5A 4BDKA 4FV4A 5BV3A 2YLEA 4UEUA 3R28A 2VWUA 4O7WA 2X2LA 3CTJA 1H4LA 4J53A 4JL9A 5AUYA 1A48A 3EZRA 1JKKA 3O96A 4W9WA 2XJ1A 2OXYA 3TMOA 4WKQA 2WQEA 3GU6A 4MQ1A 4PX6A 5EHOA 2VWWA 3EN9A 5CF5A 4X3JA 1OPKA 5DPVA 2X0PA 4PP9A 3O50A 2R3MA 3U6HA 2UW6A 3SW7A 3WIKA 3IOKA 4X2JA 2C0TA 3HDMA 4G1WA 5AP1A 4OLIA 1Z9XA 3DJ6A 1OL5A 2J0LA 5LWMA 5BYYA 2YLFA 4GK4A 3RHKA 3BGPA 2XIKA 3LJ0A 4XNEA 3UC4A 2X8DA 3MS9A 4GJ3A 2A2AA 2XRWA 1S9JA 3EFLA 3W2QA 4RIWB 2IVSA 2OK1A 4OGRA 3KK8A 2I7QA 3WZUA 2Y6MA 2WU6A 4YZBA 3ZC5A 3Q6WA 3H9OA 5TF9A 5HKMA 2VTSA 4A9RA 3R8ZA 4EOKA 2GQRA 1U46A 4E5AX 4BCMA 3GC7A 3PE2A 4QP6A 5IQCA 3NUYA 4EOLA 3R7OA 2VTLA 4UZDA 4GIIA 3PRFA 3W2OA 3W0PA 4YTIA 2QU5A 5AUZA 4CEGA 4YR8A 4QPMA 3FMKA 2W0JA 3BYUA 2ZV2A 5CAQA 1OUKA 4FTQA 3KEXA 3P5KA 4I24A 4M3QA 4CV8A 4FK6A 4X21A 1O9UA 3UO4A 1ZYDA 3W0OA 1PYXA 2X0OA 2PU8A 2UZNA 3FMHA 3HNGA 2BDJA 1QPCA 3F7WA 3R1SA 4PPCA 4ACCA 4AS0A 2I0YA 4BGQA 4JDIA 3DBCA 1AQ1A 3QGYA 2J50A 2WQBA 5AIRA 4FZ6A 4UALA 2PVFA 5DT3A 5LARA 3EQDA 4C02A 2YJSA 4ASXA 1OI9A 4FEQA 2BRHA 4PV0A 5DT0A 2HOGA 3NMUF 4OTQA 4BBMA 4LL0A 4A06A 3OEFX 5HLWA 4TY1A 3ID6C 2EU9A 4QMUA 4GRBA 5ETIA 2OF2A 2VWVA 3N9XA 5AUVA 4CCUA 1PKDA 2B9FA 4CLJA 3CKXA 5J9ZA 2P2HA 2OBJA 4WNPA 2IZTA 4QDEA 4E3CA 4CMUA 3F61A 5K5NA 3DAEA 3R00A 1IG1A 3F3TA 3L1SA 3JXWA 5HHWA 5CF8A 3ZXZA 4JMQA 4U41A 2C6TA 4RX5A 1WVYA 2F7ZE 2PZYA 2VAGA 3LQ5A 2VTHA 3R04A 2WMBA 2C1BA 2QKRA 4F09A 2J4ZA 3I6WA 1O6LA 4E4NA 2YJRA 4BGGA 3W8QA 4KRDA 3VIDA 3H30A 4XS2A 5GNKA 2VTRA 5AR3A 4EK5A 5KZIA 3DBEA 2XS0A 3OY1A 4YTFA 1SVGA 4PL3A 4I5HA 4O91A 3IS5A 2G2IA 2YIWA 2HZIA 2WTWA 3BHVA 3V8WA 3GXLA 2R3NA 3FAAA 3LFCA 4V0GB 4XUFA 5DEWA 3G6GA 4G2FA 4AOTA 2PMNX 3UPZA 4OUCA 4LG4A 3PXYA 3P1AA 5I9VA 4RG0A 3CY2A 5IDPA 4ANLA 4AW2A 2OLCA 4ITHA 4A9UA 5IEXA 1NVQA 1W83A 4NFMA 4R78A 3RALA 4JBPA 4MCVA 2XKFA 4CKIA 2IZUA 1RDQE 3DBQA 3MB6A 4PY1A 2C0IA 5BUEA 2R7IA 1E1VA 3DAKA 1U4DA 3IKAA 3LW0A 3S4QA 4QEBA 3FMDA 4GG5A 4BCOA 2YCFA 3ZLSA 2C6EA 3C0GA 3NW5A 4TYHA 3UG2A 3RI1A 3R1NA 5C4LA 5EI2A 4DAWA 2IW9A 1ZMVA 2XK6A 2ZJWA 4FTLA 4UY9A 1XH7A 1JNKA 1T45A 4M68A 4PTCA 5AR5A 5ACKA 3OCGA 4QTCA 2FSOX 2VWYA 4HVDA 4F9CA 1W7HA 5BVFA 5HOAA 3ORZA 3PIYA 1URCA 4TWPA 4MHAA 1YOJA 4LMUA 3FKNA 1Q8WA 2A0CX 4J7BA 5E9EA 3EYGA 4RC2A 4C58A 3DT1A 4CFUA 1YWVA 4TWNA 5M57A 3RNYA 4K9YA 3FZOA 3NAYA 4NJ3A 4FSWA 5DRBA 4CQEA 4X2NA 4ZZNA 2BZJA 5M4IA 4LI5A 1F3MC 1YDRE 3E5AA 4NYEA 1QL6A 2PZRA 3DXQA 2GFSA 4CG8A 3F3WA 4D55A 5JZNA 2LAVA 2QD9A 4BFMA 1G8JA 2X6DA 1YHSA 4DH7A 4O84A 3BLHA 3E8NA 4QYEA 4ANQA 3R9DA 2OJFE 5L4QA 2OIBA 4F63A 3ELJA 3MPAA 4AGWA 1FVRA 2W1IA 5IQDA 5CQUA 3R7GA 4WG4A 4C0TA 1URWA 4BJJB 4D0WA 3KMMA 2J51A 1GOLA 4JX7A 2JIUA 1VJYA 3TKUA 5FTOA 1CMKE 3BU5A 5H3QA 3SX9A 1UU8A 5M51A 4B8MA 4F9BA 1OGYA 3FQHA 2QG7A 1JAMA 2F2UA 2YZAA 2WIPA 4FKGA 1WFCA 5LVNA 5EM5A 5A46A 3R0TA 4G3DA 2JBOA 5C27A 2GS7A 3PPJA 4G31A 3LFAA 4IHPA 5AP6A 3VW8A 4F9AA 3R8LA 4AQCA 3FI2A 5CZIA 3WF5A 4PF4A 2YERA 3ENMA 3U55A 1WBNA 5CTPA 1H1PA 2I40A 3HL7A 3MESA 3A8XA 4HNIA 1OBDA 3S0OA 3GB2A 4MYGA 5E8YA 1H1WA 1QPEA 4DEDA 4F9YA 4KA3A 2IG7A 3OTVA 2Z2WA 3C7QA 4QP7A 4QOXA 4XX9A 4QP3A 4ZEGA 2IZRA 3K2LA 3QALE 4ASZA 1T46A 4M67A 4MXXA 4IVBA 3QLFA 4AA5A 2UW7A 3LFEA 4FRFA 3HA6A 2XIYA 2WTDA 4HYHA 1PMEA 2WXVA 3GBZA 4MXCA 4FV9A 4X3FB 4FEWA 3OWKA 2ZV9A 3BBTB 4F7NA 4F70A 5D10A 5EM7A 3Q96A 5AAFA 5T68A 5KX8A 3PUPA 4KIPA 3C1XA 3VRZA 1NA7A 4BZNA 2ONLC 4AXFA 3MVLA 1OGUA 4FKRA 3ZM9A 3QXPA 3OCTA 1JSVA 1WBOA 5ETAA 4IAYA 3TKHA 5DR6A 5C9CA 2BRGA 2PVKA 1V0PA 4CFNA 4EQMA 2PHKA 5HORA 1PMVA 3LMHA 4D58A 5E1EA 1DM2A 1UWHA 1YQJA 1Y6AA 4LFIA 4ZTHA 3CQEA 4JDKA 4L3LA 3ML1A 3NNUA 3OW3A 2UW4A 4QQJA 5DR2A 5K5XA 3GOPA 2CCHA 1J7IA 4I6LA 4DH5A 2AC5A 2OU7A 3E7OA 2ZM4A 3R8PA 3ZZEA 2JKKA 2QOKA 3BV2A 5BX0A 4ASEA 2YZLA 1Y6BA 4ZJVA 2VN9A 5BMMA 4BB4A 1SVEA 2XNPA 2YCRA 3I5ZA 3QRJA 4BI1A 2BAKA 3IPHA 3LVPA 4FR4A 3VUTA 3DDQA 3EQRA 5L2WA 4P2KA 5EHLA 2B4SB 3KA0A 2CDZA 4HCUA 4IB0A 4ARKA 4DH3A 4KUJA 5M08A 2OXDA 2I0EA 3V5LA 2PE0A 4FNWA 1W0XC 3PJ8A 2VTNA 4RJ8A 4ZS0A 1YOMA 4D4RA 3KVXA 4ONAA 5FDPA 3FHRA 2PVHA 4FV0A 4XRLA 3KU2A 3RAIA 3QD3A 4J1RA 1U54B 1UV5A 4FKIA 2OZOA 4NIFB 3OXIA 4MF0A 3S2PA 4S32A 4IB1A 1CSNA 2W9FB 5ANGA 3FQEA 2HZNA 3CXWA 4FKOA 1M7NA 2V7AA 4RGJA 4O7RA 4BJJA 5CU2A 2FH9A 4C4FA 4EBWA 3IGOA 2KTYA 4GIHA 5HQ0A 4RFMA 5JZJA 3TZ9A 4AFJA 3O8UA 4ANNA 3KMWA 4FV1A 4XP0A 3V5QA 2XRUA 1Q62A 4P90A 4GK3A 4IAFA 3OG7A 4FOBA 4C61A 3D9VA 1J3HA 3POZA 3VBVA 1ZMUA 2OJGA 5H8BA 1H1SA 3TUDA 3C50A 4YMJA 4FE2A 4ZMFA 5M07A 3HV5A 2ZMCA 3ENHA 2J5EA 3IW6A 4EH9A 5TR6A 4E73A 3HV6A 3V5JA 2ITPA 2G1TA 1Q8YA 4O4BB 5F95A 4W4YA 3V5TA 2BALA 4C3RA 1BI8A 2XCHA 3CKWA 4IJPA 1PXKA 4H3PA 3BQCA 3V6SA 1H28A 2B52A 5AP4A 2PYWA 1WCCA 2NPQA 3RPVA 2PUPA 4IVAA 5EKOA 1PXIA 2GNFA 3R2YA 4FSNA 4RMZA 3G9LX 5AP3A 3TNPC 2PZ5A 2J5FA 4BDJA 4BCJA 4DFBA 3GFWA 3EN4A 5E8SA 4PMMA 2BDFA 4X3FA 4D5KA 2Z8CA 4IAZA 3FI4A 2F9GA 4OTGA 3F66A 4O0YA 4C4JA 1XWSA 3LCDA 4KD1A 3LXKA 2V7OA 1Q3WA 3QD2B 1DI9A 4YBKA 4YBJA 4R5YA 5DT4A 3C4WA 5CASA 1KWPA 1ZWSA 3I6UA 3NIEA 3MWUA 5CT0A 4QP8A 2XB7A 4WOVA 4ZJIA 2I1MA 4RPVA 4GG7A 1ZYSA 1K9AA 3QTUA 4M12A 2CNUA 3HRFA 3DXPA 4DEIA 3NPCA 3DQXA 5DYJA 3F3UA 4EYJA 3VUKA 5EHYA 4YTCA 2AQXA 4RJ3A 4X6RA 5JQ5A 1ZRZA 4CZUA 3VULA 3D5UA 3BQRA 4QNYA 3C4CA 3KY2A 1W98A 2C69A 3HP5A 2C30A 3BHHA 3FKLA 2XANA 4NW5A 1Q61A 4F1TA 4ANSA 4O27B 4JQ7A 2GS6A 5EDRA 2HIWA 3R9HA 3R8UA 4QT1A 2ITQA 3A8WA 1XO2B 1PXJA 2WTKB 2X9FA 3D14A 4IWDA 3P08A 1QCFA 2G15A 3A7FA 3FLYA 4RT7A 3R7YA 3JR1A 4YJNA 3LCOA 3FMMA 3R71A 4QRCA 3AXWA 4AAYA 4AN9A 4FIGA 3Q52A 4TT7A 3BBWA 3V8TA 2CGXA 3RMFA 3VBQA 4FOCA 3ZEWA 3BIZA 4AAAA 4AA0A 3NYVA 5KO1A 4NIFA 1U54A 5IQHA 3MV5A 4NK9A 4CMTA 4WT6A 4HW7A 1H27A 4FIFA 3Q4UA 3QTIA 3DOGA 3F2NA 4Z7HA 5HU3A 3L8VA 1MQ4A 4FL1A 4HGLA 4JBQA 3MH0A 3FLWA 2WEVA 3UZTA 4A9YA 1IASA 4U9AA 4BRXA 2P0CA 1NW1A 3UP7A 3M42A 1Q8TA 4RJ6A 2WPAA 1PHKA 3LE6A 3PLAE 1Q4LA 2IJMA 3LKMA 2XMYA 4L45A 4Q5HA 4QTAA 4EZ7A 3LJ1A 2C6DA 2JKOA 3QQJA 4L9IA 4RLLA 5DVRA 4B9DA 3GGFA 2GU8A 4PP7A 3KKVA 3LFQA 4R7IA 4FKLA 3PFQA 3U6JA 3SC1A 4CKRA 2C6KA 3BGZA 2VO0A 4S2ZA 3ROYA 3FHIA 5IQFA 4BYIA 3EKKA 4WD5A 5AA8A 3GT8A 3COIA 3GCVA 4QP9A 4KWPA 3LMGA 4O7SA 5CY3A 4RIXB 3OHTA 4LUDA 3HV3A 3R6XA 4FZAB 4QMQA 4O7TA 4EH6A 4I94A 3QKLA 2YDJA 2C5NA 3F3ZA 4FV7A 4YZCA 5FM3A 5AWMA 4EH5A 5L2SA 3V5WA 1XMMA 4L52A 4EOQA 2V5QA 4FTIA 1WBVA 2X8EA 3GCUA 3KRJA 3NNWA 3NFGB 3A4OX 5GIPE 4FEUA 5HO8A 3CE3A 4G16A 3VF8A 2PVJA 2W1ZA 2PZPA 2YM6A 1OPLA 3AG9A 4NWMA 4D9UA 1UU3A 5AR2A 3VS4A 5LJJA 5HE3A 5CF4A 3DZQA 4H05A 4M14A 2BMCA 5F4NA 3W0QA 3FYKX 5JGAA 3TTJA 2YISA 2BUJA 3COMA 3ZSGA 3RPRA 4F64A 1JQHA 1W8CA 4A9SA 5CLPA 2WOUA 3PJ3A 4AW1A 4BCNA 4AXDA 1PXNA 3RZBA 2UZOA 2JLDA 3KF4A 4X2KA 1UU9A 4H3QA 4BZOA 3A61A 3QL8A 4FZDB 3DZOA 4TWOA 5EYKA 4FIIA 4AA4A 4DTBA 3ETAA 3BE9A 3VS0A 1WBWA 3O17A 2W1GA 3R1YA 3RAHA 3DS6A 3FXWA 4IFGA 1HCLA 4YTHA 5AV0A 3DQWA 3GC9A 4IADA 4IC7A 2XBAA 2XUUA 3R9OA 3UO6A 5DFPA 2E9PA 2JEDA 2UW3A 3QTRA 4QYYA 4M0YA 3TZ7A 1Q99A 2YCQA 4W4XA 5KBRA 3BL7A 4QDVA 3LFNA 1BL6A 4YHJA 3U8WA 5AAEA 3ODZX 4OBPA 4CT2A 5DMZA 4XG2A 4J8MA 2R3HA 1BMKA 3OVVA 4FTJA 4TNBA 3NFFB 3EJ1A 2CMWA 4F99A 1Y8GA 1KE6A 3QA8A 2BIYA 4UMTA 2XIXA 5AIKA 3UDSA 3UE4A 4MWHA 2GTNA 2UW5A 4CRLA 5C4KA 4WNKA 4EH2A 3KXZA 4DF3A 1TKIA 1YXSA 2WO6A 3FPMA 1UKIA 1KE7A 3NEWA 5LOHA 3AKKA 2CKEA 1ZZ2A 4BDFA 2CGUA 3UP2A 4XG6A 5AA9A 4IDVA 5LVMA 3PYYA 2QODA 3MN3A 4EKLA 5AUTA 2GQGA 5IU2A 4KIQA 5L6WL 3PP1A 5J1WA 2UW9A 2UZBA 4O7NA 4O7LA 1TQMA 2YIRA 4QMMA 3R9RA 3BU6A 3TCPA 2WKMA 3QWKA 4DE4A 4MD8E 4OTWA 4BDBA 2X0GA 3GFEA 3ORPA 3Q9ZA 4DFZE 4V01A 3KC3A 1YW2A 1YXTA 5BVOA 5M56A 4IE9A 4PQNA 2BPMA 3VS3A 4I5PA 2HK5A 2XIRA 1R39A 4ZLYA 3QYZA 4JR3A 2ERKA 1STCE 4N6YA 5FD2A 4YJPA 4C57A 4D2VA 5AM7A 5E1SA 4E6AA 5ETFA 1LEZA 5IISA 3G0EA 1RE8A 3BE2A 4GL9A 4I22A 4KBKA 4RIXA 1XH9A 3OROA 4HPTE 5IKWA 2XVDA 4ZK5A 3RK5A 2VWIA 5EW3A 3RKBA 4MX9A 4CRSA 3DKCA 5IQBA 2QOOA 2JKQA 3MH1A 3PA3A 3GP0A 4RFZA 2W4KA 4BWPA 2YCSA 4Z3VA 4DDGA 5CZHA 5HNIX 3ULIA 4GT3A 5DGZA 4ACMA 3EN7A 3ZLYA 1OIRA 3N4VA 2AYPA 3QRUA 3HMNA 5I9ZA 1XBAA 4DITA 4DFLA 3CGOA 2B55A 2E9NA 2UV2A 5ANJA 3CJGA 3GU7A 2QLQA 2PVNA 2R2PA 4BCIA 1H25A 3IW7A 1TQIA 5FXRA 3TNHA 4IFCA 2HW6A 3V6RA 3CJFA 3LCKA 5DRDA 3ZDUA 2E2BA 5HIDA 3KVWA 4FVPA 4GVJA 2YM8A 3EQGA 4DGLC 5LMKC 5I0BA 1CDKA 2BTRA 4I6FA 3KFAA 3ANQA 5BMSA 3TM0A 3C4EA 3V5PA 4O7ZA 3I1AA 2E9UA 3MFSA 4XLVA 3V51A 2BFYA 4ANMA 3ZO2A 3MSSA 3VBTA 3MFUA 1VEBA 1O6KA 2XAMA 2X9EA 2HAKA 4IVDA 3T3UA 4EHVA 3E92A 1WAKA 4EONA 2HYYA 1XBCA 3QD0A 4OTPA 4XBRA 1GZOA 3TTIA 4JXFA 3ZUUA 2CPKE 4DHIB 1JKSA 4H36A 2JDOA 3KMUA 3KB7A 4XG3A 2VU3A 1ZYCA 4YC8A 4FKWA 5JRSA 2OIDA 2HZ0A 2ZM3A 3MTFA 1FPUA 4AT3A 4DLJA 1GIJA 4O7VA 1BL7A 3GC8A 1JOWB 1U5QA 2XK8A 3UG1A 4BN1A 2CKOA 5A54A 1YI3A 3LJ2A 3IW8A 4O82A 3PA4A 3QKMA 5FWKK 4GFGA 4X0MA 1Q8UA 1ZOEA 2XIZA 5J7HA 3EQIA 5DBXA 5EG3A 4IVCA 4LGGA 3ULZA 5CANA 3EIDA 3ZU7A 4U40A 2O65A 3ORKA 1AGWA 3Q3BA 5L3AA 4GEOA 4JDJA 2ESMA 3FXXA 2RL5A 4X2FA 5KE0A 4U3ZA 5J79A 2VV9A 5IUGA 3GNIB 4GYIA 4I1ZA 4MD9E 5HICA 4BL1A 2DS1A 4W8EA 3VUHA 3U4WA 5M4FA 2ZV7A 3FE3A 2B54A 3BRBA 3G0FA 3P7AA 4PDOA 3UODA 3UZPA 3ZO3A 3THBA 1NY3A 1CTPE 5F1ZA 1OKZA 4JG6A 3MGYA 5BUJA 3F2AA 2W96B 4TKSA 5HCXA 2ZDUA 4AZEA 2O3PA 2BHHA 4Y95A 3UOJA 2UZEA 1H24A 4XMOA 4K1BA 3QD4A 3UVRA 3FSKA 4F7JA 3BZ3A 3ZMMA 4FG7A 3L9MA 5ACBC 1MP8A 3O7LD 4DCAA 3QQGA 1SZMA 2JDSA 2XNBA 1W82A 3AC2A 3CD3A 5CU6A 3BYSA 1VYWA 4AQKA 3ZRLA 1H26A 2W99B 4D28A 5AV3A 1JVPP 2QR8A 4TPTA 2ZDTA 3C9WA 4LV5A 4FMQA 5E92A 2Y4IB 2PK9A 2OF4A 3LFSA 4JVGA 4YSMA 2BVAA 4ACDA 4NL0A 4ZTLA 3WF9A 2W1FA 3VQHA 3MH2A 4DBXA 2PZIA 3WF7A 3ZM4A 3N4TA 3ZCLA 2J7TA 3E62A 4QO9A 3F88A 2X0QA 4RWIA 5H8GA 4NKSA 4XYFA 2X7OA 5E90A 4FKSA 4EOMA 4F6UA 2JBPA 5E8TA 1MQBA 5FP6A 3DKOA 4Y83A 2OSCA 2VD5A 3FMLA 4I6BA 4RFYA 4E6DA 3OUKA 3C51A 4DC2A 3MYGA 3TIYA 3DKGA 2YWVA 1V1KA 2OWBA 5K0XA 4NTSA 2P55A 5CENA 3KK9A 2QOFA 4JIAA 4EZ3A 1MRYA 4FSRA 1FVVA 4MEDA 4DEBA 1GNGA 3F5GA 2FVDA 4BDCA 4JNWA 3R83A 3HECA 3EN6A 2H34A 5IF1A 4NEUA 2Q83A 1UNHA 2OJJA 3RNIA 4C34A 5HI2A 2WTJA 4UN0C 5CU0A 1P2AA 4B0GA 2P2IA 4BCGA 4ZXTA 2QOIA 5L2QA 3DB6A 4U45A 5H8EA 2XNGA 3E63A 4NM3A 5DN3A 1TVOA 5KKRC 3FV8A 4IANA 4MXYA 4TRLA 2AEGA 4M15A 5L2TA 5TT7A 3W2RA 5BQ0A 2QO9A 4IH8A 4IDTA 4E4LA 3MW1A 1Q97A 3KXMA 1ZY5A 3WOWA 3HAMA 4YO6A 1R1WA 4W9XA 5A4CA 4L01A 5CNOA 2JFLA 2P33A 3LCSA 3D5VA 3DY7A 4IAIA 3RPYA 2PVLA 4IX6A 1H01A 5HVYA 4BDAA 1U59A 3ZFXA 3Q2MA 3KIOC 2WU7A 2YWPA 2YIXA 4EOSA 5CEPA 4I21A 5M44A 3E93A 2WZJA 2I0VA 2GNLA 4ZS4A 2WFYA 3W0SA 4CD0A 3ZSHA 4AGDA 2PPQA 5IUHA 4C36A 5IMXA 3RZFA 1MRVA 2R5TA 2OFUA 4ID7A 4BHZA 3NVMB 4EZ5A 3NW6A 2JAMA 1KV1A 3ORIA 4GCJA 1YXVA 2C6IA 5C26A 1FINA 5IDNA 4XBUA 2GDOA 5HG5A 2XM8A 3WIGA 3VBYA 4FSMA 3LCTA 3R73A 3TWJA 3ZSIA 3Q60A 3PP0A 3KGAA 5BPYA 2Y9QA 3EQFA 2LGCA 4W8DA 5DNRA 4D1SA 3DJ5A 5IQGA 4AWIA 3E8EA 4RC4A 3MIAA 2PMOX 4GUBA 1IR3A 5AV4A 3E7VA 5GIOE 5JK3A 1XBBA 2FA2A 4U7ZA 4DBNA 1GZNA 3JPVA 4OTFA 4FL2A 1OIUA 4FSTA 2XJ0A 3IW4A 3VO3A 2YM5A 3PVWA 3ZONA 4MBJA 5JRQA 4ZSGA 4R77A 2GS2A