3ENMA

The structure of the map2k mek6 reveals an autoinhibitory dimer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
279
Chain Sequence
FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the MAP2K MEK6 reveals an autoinhibitory dimer
pubmed doi rcsb
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
total genus 73
structure length 279
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3enmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3enmA01
5ANEA 2VX1A 2R3NA 2ZV9A 4JAIA 2ITYA 4V0GA 3BHYA 4HJOA 4UZDA 5B7VA 4F9BA 2W1DA 5HG5A 4DFBA 4I4EA 1OZ1A 1ZMUA 3FYJX 3ZRKA 2PVRA 3ORNA 3CGOA 5CY3A 4ZIMA 3OF0A 5ETCA 2R3MA 5FM3A 2XJ0A 1ZY4A 3BYMA 5DN3A 5LMAA 3R1SA 2C0IA 4KB8A 1H1WA 4QOXA 5FDXA 3BGQA 2H34A 3QD3A 2C1BA 3KN6A 4D4YA 4DC2A 1Q3WA 4NM0A 5C4LA 3IO7A 3Q04A 5E1SA 5FTQA 1W8CA 3P7BA 4XG4A 4EHZA 5JSMA 3AXWA 3ZDUA 1JSTA 2R3KA 3R0TA 4II5A 5JZNA 5I9YA 4ZY6A 4EORA 3PLAE 2WOUA 4NM5A 3K54A 4A9RA 2QG7A 3MV5A 3O71A 4JIAA 4GMYA 4QMOA 4QP7A 5DT3A 2ZVAA 2WPAA 2C6MA 3I5NA 1U5RA 3MY0A 1PXJA 4DEIA 4YU2A 1URWA 4DEEA 2JBPA 4RQVA 5EI2A 3IGOA 3C4CA 2XB7A 1P2AA 2DYLA 2YDJA 2BZHB 3G6GA 2P2HA 2QU5A 2YDKA 1JPAA 1LPUA 3VBWA 5BVDA 4IZ5A 5CQUA 2J0IA 3Q53A 3NUAA 4BFMA 5BYYA 3H30A 1JWHA 4G3CA 4ASEA 4IM3A 5IF1A 4FKVA 4I41A 4BCIA 4BGQA 4QMUA 3EQCA 4A7CA 5AV4A 3LXPA 2GQGA 3ZBXA 4KIKB 2YCRA 5AUVA 3IKAA 4YZMA 2PVMA 5AX3A 2W1HA 4FT5A 5HG7A 5KHWA 3BZ3A 3W33A 5CXZA 2GSFA 2YIRA 3KA0A 2OFVA 3MI9A 5AV2A 3MH1A 4CCUA 2G2HA 3N4TA 4CLJA 2Z7RA 3BBTB 2BRMA 1WVWA 2BRHA 3BLHA 4QP4A 4CD0A 3VF8A 4O2ZA 4RJ6A 4NJ3A 4OR5A 1SM2A 3KULA 3R7YA 1Y6BA 4W4YA 3VUTA 1PRYA 4JRNA 4U44A 3PVUA 4YLJA 5BNJA 2W4KA 3CXWA 1T45A 3GQLA 4AW5A 3Q9YA 4BIBA 2X81A 5E91A 2HWOA 3TT0A 2JIUA 3UGCA 4YC3A 4WUNA 4Y95A 4QMZA 2BKKA 4RVMA 2B9FA 1S9IA 2W1GA 1ZYLA 2QU6A 4E7WA 2C0TA 3CY2A 4IJPA 5FEEA 4DEBA 5HVJA 2XH5A 2UZDA 4LL0A 4P7EA 4RBLA 4WNOA 5CF4A 2BDFA 4DGNA 4EOSA 2Z7LA 4BKZA 3NUXA 4IX5A 3LZBA 3R7EA 2YZAA 1XBBA 3OS3A 3OWPA 4LRMA 3F2AA 4HPTE 4BY9E 3KVWA 3PXFA 4CRSA 5CSXA 1V1KA 4O96A 4E93A 1W82A 2YACA 3GC9A 2XEZA 3RPYA 4L8MA 5AIKA 1OI9A 4OT5A 3P79A 4G3EA 2PSQA 4AA4A 1QPCA 5H8GA 4CVAA 1TQIA 1E9HA 3FI4A 3BU6A 4O6LA 2BAJA 3HDMA 1M7NA 5JRSA 4DT8A 1FOTA 4EI4A 3MJ2A 2GNGA 3P86A 1CTPE 4GT4A 3UE4A 4NZWB 4FK3A 4EHVA 2G2FA 3LCSA 2B9IA 4FKIA 3DPKA 4PPBA 2WHBA 5DPVA 4C3PA 3AGMA 2FSLX 4FOCA 4BI0A 4ZMFA 1ZLTA 4J71A 3TWJA 1KOAA 5E8SA 1CKJA 3VQHA 1PYEA 2PZIA 4IAKA 5L2QA 4O7LA 3OY3A 5HVYA 5HORA 4O0WA 2YWVA 3PA3A 1MRVA 2XM8A 1CM8A 5HE3A 4JNWA 4C4HA 4KBCA 4RIWA 4YC6A 4Z3VA 2VWVA 3H0YA 3QRJA 5CZHA 3SXFA 1M7QA 3VQUA 3QCQA 4F6WA 5A4QA 3ODYX 1R3CA 3AC8A 1KOBA 1R78A 1WZYA 1YDRE 2FYSA 2NRUA 2PL0A 2RSVA 2XNNA 3MIYA 3QZGA 4MXXA 4J96A 2OJFE 4PMTA 4Q2AA 2WOTA 4DLIA 3QYWA 2DUVA 4XP0A 4DEGA 1PXIA 2QODA 4I4FA 1JSUA 2YCSA 3DJ7A 5DE2A 1U46A 5CAOA 3P23A 3A7GA 3GVUA 4YMJA 5I9ZA 4FSTA 1NW1A 4ACDA 3MFSA 4KAOA 3ZO2A 4DAWA 3PIZA 2ZMDA 3ZZWA 5GINE 2QOQA 4IM0A 2V55A 1WBSA 3D94A 4H3PA 4DLJA 2C6DA 4FIGA 4CV8A 3KB7A 2YLEA 2BVAA 4GU9A 5E1EA 3C0GA 3VNTA 4RJ4A 5AEPA 3EH9A 2Y0AA 5EG3A 4MBJA 2ITWA 1OBGA 2FSTX 2OSCA 2XP2A 3FLQA 3G33A 4LUEA 4OBOA 5H3QA 3KMUA 3NNXA 3W2QA 4DYMA 3QL8A 4ANSA 4IDTA 3FL4A 4QO9A 4GK3A 3CSVA 2J7TA 3DXQA 2UZTA 4GEOA 2BFXA 3KCFA 4NIFA 3PXZA 2ZV2A 3F3VA 1M2QA 2CDZA 3R1NA 5FLFA 3VS6A 5LWMA 3A60A 3QKMA 3QLFA 4L43A 1W7HA 4K33A 5G1XA 3NR9A 3E92A 5LCJA 3L9LA 5AR2A 2XA4A 3AC5A 3HLLA 3QBNA 5CU0A 3LQ3A 2PUIA 3DBEA 1FVTA 2QOCA 4QRCA 5C01A 4AT3A 3UYSA 4HOKA 4WRSA 4S33A 1IR3A 2Z60A 4O0XA 2JDRA 2XIZA 3MTLA 4O0RA 4QP8A 2YN8A 3CPCA 4J52A 2XK3A 3ULIA 4KUJA 5DMZA 4QPSA 4X0MA 3U9NA 5J1VA 5CT7A 3ZDIA 4JJRA 3U4WA 4DH1A 4HCTA 3HA8A 1OKYA 3DNEA 3WBLA 4F7NA 4V0GB 4U42A 1IA9A 3TNHA 4FYNA 3REPA 2WMSA 4L6QA 4ZZOA 5A6OA 5KMJA 5EHLA 4FNZA 4C58A 2QC6A 2X2KA 5GZ8A 4CGAA 5BMSA 3LOKA 4ZTNA 4IMYA 4WNKA 4BBFA 4NKSA 3BHUA 3N9XA 1AD5A 3SV0A 2VWUA 4YZDA 3ZOSA 4D2TA 2WO6A 4UMQA 3OT8A 4B9DA 4O84A 1H26A 2BMCA 3MB6A 3ANQA 2Q0BA 4FV5A 4RZVA 4A4OA 2OJIA 4O2PA 3TUBA 4HYSA 2PMNX 1XH5A 5EYCA 2EXMA 5H9BA 4BTMA 3PJ8A 3RJCA 3OROA 1R39A 5JFVA 4WO5A 1XH4A 1M2PA 2HY81 4FEVA 3FI3A 2J5EA 4IWOA 4EOKA 5CYIA 1DI8A 5IU2A 4BHNA 4UWYA 3EFWA 1Z5MA 4FMQA 4QMXA 5AUZA 2HIWA 3U6JA 2O64A 4Y72A 3RNYA 1YXVA 1YOMA 2OZAA 3E5AA 3PLSA 5D11A 4EHGA 5IA0A 5AV1A 2P33A 5M55A 4B8LA 2BZKB 2OZAB 1IAJA 5K0XA 3ZFXA 2J6MA 2BCJA 4H36A 4XG2A 4BDAA 1OKWA 4PPCA 3SQQA 5GJDA 4ALWA 2A4LA 5TT7A 5LXMA 2EU9A 4GYIA 4BGHA 2OF4A 4TWPA 4X3FC 4R7HA 3IW4A 4FTLA 3O96A 5IEYA 3SW4A 3VW6A 4GIIA 4H3QA 2H96A 4C4IA 4EWHA 1OPJA 1G8AA 2QHMA 3QD0A 1LEZA 3H9OA 1GZNA 1APME 2C5VA 4NKAA 4IX3A 5C03A 2WTJA 3W10A 2UZWE 3EQIA 2DS1A 2QO2A 2WMBA 2O5KA 4NIFB 1P4OA 2XJ1A 4HPUE 3RGFA 3NS9A 3UMXA 4EUUA 3DGKA 5I9XA 4YJPA 4UMPA 5JFWA 4LOOA 2ITUA 4YLKA 3WYYA 2ZDUA 2EB3A 5EDPA 3AGLA 2O0UA 2R9SA 5HBJA 4MAOA 3MFTA 4AWIA 4O0VA 5I5ZA 4X2NA 1FPUA 2CGXA 2Y4PA 4EH9A 4NK9A 4F4PA 2I0YA 1H24A 2FUMA 4BZNA 4O7YA 4RT7A 5IQAA 2QOOA 4R8QA 3E8EA 4KNBA 3F5PA 4UBAA 2CKQA 5AFVA 5EI6A 3FQHA 2VWIA 3M11A 4RJ8A 4BBMA 4UALA 5KE0A 4YO6A 4BC6A 3QWKA 4I3ZA 5M06A 4YSMA 5CTPA 4LUDA 1BLXA 3FPMA 3ORPA 4ZMEA 3DV3A 4YSJA 3MYGA 4DGGA 4CEGA 4LI5A 2IG7A 4ITIA 3D2KA 4FTUA 3MY1A 2XYNA 4ZS0A 1WBNA 2PZPA 4L42A 2WU7A 3PZEA 3QKLA 3QXOA 3Q9WA 5HBHA 1YWNA 3EKNA 5BVKA 5AA8A 4TPTA 2UW0A 3OCSA 4TYHB 5JRQA 3NIZA 2UZUE 2QKWB 4GL9A 4IADA 4XV2A 3UNKA 4UX9A 3DQXA 4TYHA 4U6RA 4JLCA 2RG5A 2OBJA 2JBOA 3EN7A 2WIPA 4G31A 5DR2A 3WIGA 4BDEA 1NY3A 5HZNA 3BIZA 4IAIA 1Q8WA 2OJJA 3QAME 5A3XA 3KMWA 4G3FA 1JKTA 1WVXA 4O0SA 4HGTA 5AM7A 2C69A 4FTNA 3NW5A 4FSZA 4FSQA 4ZJIA 4C61A 1F3MC 5JGAA 5JT2A 3Q96A 2OJ9A 2CCHA 3B8QA 4ZTHA 2QOHA 4TNDA 2B1PA 3QX2A 3TUDA 5HNBA 3DZOA 1ZY5A 4U45A 4UMTA 5IPJA 2REIA 4D1ZA 5E7RA 4YJSA 3Q3BA 3E3BX 4ERKA 2YCQA 4FG7A 4AGUA 3R04A 3DXPA 5DNRA 2KULA 2FA2A 5HO8A 3NVMB 2BDJA 3QUPA 3GOKA 1A48A 1GZKA 4FEUA 2V22A 2GS2A 2WMXA 1YXSA 3QUDA 4ALUA 3MVMA 2XNPA 3VAPA 4BIEA 5KMKA 3CIKA 2WB8A 4IWQA 1FVVA 2E9VA 4BDGA 3RNIA 4E4NA 3FZTA 2PVKA 2W4OA 2BFYA 4KS8A 4BDHA 3AC4A 2WKMA 3VUMA 1JSVA 2YA9A 3WIKA 1YVJA 2I0VA 3EL8A 5E8ZA 1QPJA 4E5AX 3EQRA 4B8MA 2HAKA 2PZYA 3QWJA 1U59A 4WOVA 4LOPA 3FUPA 2PMOX 5B2LA 5E92A 5IA2A 4M84A 2C6TA 2PVHA 2ESMA 3ZM4A 4ACCA 4E8AA 3UIUA 3GU4A 3BE2A 5BYLA 4DITA 2GMXA 1REKA 2BZJA 5AR8A 3E3PA 3LFEA 3C4ZA 4OTRA 3NUYA 2OIBA 4BYJA 1UWHA 3MW1A 4X6RA 1HCLA 3UOJA 2G1TA 5EW8A 3A8WA 3FL5A 3IDCA 2XIYA 4GT3A 3MH3A 3IECA 3ENHA 4TYGA 3LCDA 1BKXA 2YM6A 4CFNA 4ZTSA 2J9MA 5ANDA 4FV9A 2VTAA 4AGWA 5CNNA 3NLBA 4FKOA 4ENXA 3WE4A 1TQMA 2A2AA 2VX3A 3AT3A 4FKGA 5EDRA 5BUJA 4E3CA 4C38A 2XUUA 3MH2A 4PDPA 4R7BA 2RFDA 5A6NA 4AW1A 4CTBA 5E8TA 1U54B 5KMNA 2QQ7A 3MDYA 4CG8A 4KIQA 2V62A 3C51A 3MH0A 2C47A 3K5VA 1PF8A 3FJQE 4USDA 3GENA 4O86A 1GIJA 2ZM4A 3D9VA 3GCVA 3QCYA 5M4IA 3MPAA 2CLQA 3QD2B 1PKGA 2BRNA 2P55A 3EJ1A 4CFFA 4DBXA 3F9NA 3GU8A 1OVEA 4F99A 1PXNA 2VO6A 4E20A 5IUHA 3MSSA 3JYAA 2G01A 2IWIA 3Q6WA 3TNWA 3BPRA 5CI6A 3S3IA 3ZUVA 4ZJVA 3RVGA 4DA5A 2GNFA 4EYJA 1OPKA 4FV2A 5AAGA 4M7IA 2IW9A 3PG3A 2XKDA 4MF0A 4RJ7A 4D4SA 3QHWA 3UYTA 4X6QC 3GOPA 2I0EA 5FRIA 4HNFA 5I9UA 3ZTXA 3OY1A 1Q61A 3UTOA 5H8BA 2YCFA 3V04A 4OTWA 3NCZA 5FGKA 1H28A 4BDIA 4MXOA 4F0IA 5JZJA 4UY9A 5K3YA 4DH3A 2XK7A 3ORZA 1NVSA 4G34A 5G6VA 2VAGA 5TKDA 3OBJA 3I79A 4YHTA 4CRLA 3FBVA 5DT4A 4FTKA 2X7FA 3PXYA 4FT3A 4GFMA 5IA1A 2GFSA 1S9JA 1UKIA 3IDBA 3KQ7A 4O22A 4EOPA 4MQ2A 5CSHA 1GOLA 1OL7A 2XNBA 3DTWA 3G5DA 3O23A 5EFQA 4BBEA 3COIA 4FODA 4IAFA 4D55A 3PP1A 3O8PA 3HV5A 2O63A 4HYHA 4ANNA 3DFAA 1REJA 5DRBA 4U9AA 4BF2A 4N70A 4CKIA 3LFDA 4FZ6A 4Q9ZA 4R77A 2F7XE 3O17A 3R8UA 3LM5A 1W83A 2X8IA 4ZSAA 4I20A 4EH5A 3SHEA 3H9RA 5EDQA 3HAVA 3Q4UA 4OLIA 3V5WA 3C4EA 3LFSA 1CKPA 1CMKE 4HVGA 4FV3A 2XNMA 3V5TA 5K9IA 4O1OA 2UW9A 2B53A 2B9JA 4IXPA 3NNWA 4IB3A 5ICPA 2C6IA 4B0GA 3EL7A 4H05A 2C6LA 2JKQA 4CFVA 3UIMA 4J98A 2PMLX 3BHTA 5GJFA 3ZC6A 5CU4A 4NM3A 4YJOA 2VGPA 3UVPA 4TY1A 4F7LA 2CN8A 3WZKA 2PZ5A 3HRFA 4L44A 4D9UA 4IJ9A 4IAAA 4XLIA 1ZWSA 4AGCA 4AW2A 4FL2A 1OECA 3BU5A 3MVLA 5DI1A 4O7RA 3II5A 4WSQA 3PRIA 4I22A 3H10A 3R71A 2EUFB 4BCKA 3IDPA 2HYYA 3I6UA 4YHFA 2CLXA 4PDSA 5HEZA 4UN0C 3GC7A 4OUCA 3LJ2A 4O27B 4MF1A 2QD9A 2CNQA 2C30A 2GTNA 2R64A 3ZH8A 2UZNA 3OC1A 3ZC5A 4BB4A 4L7SA 5CT0A 3R83A 1OITA 4MEDA 2G15A 2F4JA 4RQKA 1DAWA 1YI4A 3DQWA 4IM2A 3RINA 4KINA 2ERKA 1H1PA 3CD3A 4C2WA 2ZMCA 2QR7A 3GQIA 1UA2A 4BDBA 3TL8A 3CCNA 4FKPA 2V7OA 3PVWA 1ZOGA 4TYIA 4FICA 3TIZA 3DBCA 3FYKX 3QRTA 4GIHA 4IACA 2C1AA 4F6SA 3Q60A 2V0DA 4QNYA 4RC3A 2JITA 4R3CA 4I0SA 3U6IA 4AZWA 3A2CA 5KO1A 5HD4A 4TNBA 4MNEA 5J79A 4AN3A 5JH6A 1CKIA 3FLZA 3BHVA 3R2YA 5HNGA 3QTIA 4R5YA 3V8SA 5DG5A 3FI2A 3V5PA 3CTHA 3WF8A 1L3RE 4XG7A 1Q8TA 3LM0A 2BAQA 3PSCA 5CASA 3HGKA 4HGEA 4ZEGA 3VN9A 2C3IB 4WSYA 4X7QA 3R21A 3UZRA 4QTCA 1M17A 3SDJA 4A9SA 3HVCA 4BWXA 2BUJA 4D2VA 2CKEA 1Q99A 3DY7A 4I6FA 4AT5A 1GAGA 4FKTA 4ANBA 1SNXA 3O2MA 5E8YA 3TV4A 1M52A 2QO7A 3ZONA 4M68A 4BR3A 4APCA 2VZ6A 4BCHA 5JFXA 5AR4A 2OXDA 1XO2B 1XBCA 1IEPA 5EM6A 1GNGA 2XJ2A 1Q8ZA 3PY1A 4IVBA 3V5LA 4P4CA 3UQGA 1J7LA 5HGIA 3SKCA 2FO0A 2QI8A 3RK5A 4PMMA 4R7IA 2JKMA 4FEQA 5HI2A 2C3KA 5J5SA 3D15A 4F7SA 4JBOA 4MXYA 5GJGA 4Y85A 3ZLWA 3G9NA 4X3JA 1FGKA 4CSVA 3FDNA 3VHKA 3P1AA 1UU9A 2OG8A 1KSWA 1YXXA 2P4IA 4PP9A 1SNUA 5CVFA 3HP5A 4QYHA 4QQCA 3I0QA 3BYSA 5I9WA 5JMSA 3OWLA 1B39A 3QRIA 4AAAA 2ONLC 2HW6A 2GQRA 3U87A 2IJMA 4J95A 3I81A 2WQMA 3UC3A 4EZ5A 5CSWA 4NTTA 4HGSA 4O0UA 3R2BA 3HMIA 4IEBA 3SA0A 5IDNA 5L6WL 1VYWA 3KXNA 4GFGA 3VS1A 2Z7QA 4RA5A 1XWSA 2Y4IC 4U80A 4DG2E 4IX4A 2GQSA 3BQRA 3OWKA 3Q4TA 2WTKC 2Y6MA 3E8DA 4RGJA 4D2RA 4IDVA 4DFYA 2PUUA 4FZ7A 1E1VA 3R9OA 2CKOA 3R7OA 3ZMMA 2GNLA 4PTEA 4WIHA 3OXIA 2ETKA 3N4VA 1J1CA 3P5KA 2CPKE 4RRVA 3QHRA 3MGYA 1FGIA 3HV4A 2RKUA 3OD6X 4FEWA 4YZBA 4UMRA 4IVCA 4O38A 1OM1A 2VTNA 3E93A 1OIQA 3CKXA 4GG5A 4M15A 3HNGA 4FT0A 2R3PA 2X6EA 3D5WA 3DZQA 3KRRA 2QLUA 1Q8YA 1FQ1B 1PXMA 3L9MA 4TYJA 3KRJA 4PQNA 4GW8A 3TM0A 4F08A 2GHGA 3MN3A 4RWIA 1PXKA 4L46A 3WOWA 1LP4A 2W05A 4RC4A 3ZS5A 4EEVA 3AC2A 3V3VA 1OL6A 2BKZA 3RM6A 3T8OA 5GIPE 5HE0A 2GPHA 4FEXA 5EQEA 5ANJA 1WBVA 3RAHA 2G9XA 2DQ7X 5FUTA 4ZZMA 4YZCA 4O82A 3CGFA 5KMIA 1RJBA 4IZYA 3ZO4A 4BCQA 3N4UA 4IZ7A 3FZPA 3QTRA 2J0MB 2R2PA 4QQTA 4WKQA 4W4XA 4OT6A 2VTPA 4BICA 5IISA 3LCKA 3DB8A 1GZ8A 3AOXA 4IWPA 4Q5EA 4BGGA 4H3BA 4Z16A 4R6VA 4EK6A 4QMNA 5CF5A 4E6QA 3SG8A 4XV3A 4DFNA 5F1ZA 2BILB 3TJCA 4WUAA 1OGUA 1VZOA 2RF9A 3HV7A 4EONA 2X9FA 5TR6A 3MFUA 2B4SB 3BU3A 5HOAA 5JQ5A 1KWPA 4M0YA 2YERA 4LFIA 3R22A 4QP2A 2OF2A 5L8KA 3EN9A 5D10A 3UDBA 3D0EA 5DEYA 2WTDA 3F5XA 1ZMVA 5CSVA 2JLDA 3BE9A 2ITPA 3LFCA 5ACBC 3NWWA 2BRBA 5EKOA 3NAXA 3ID6C 4QPMA 1Y6AA 4W4WA 4ANQA 1W98A 4H1JA 4L3JA 4WT6A 4AT4A 4C4FA 4PMSA 3NYNA 4FV4A 1IRKA 2PE1A 2XMYA 5IUIA 5HVKA 4P5QA 5EW9A 5K5NA 4XHKB 4XP3A 3F61A 2QCSA 4YZNA 2VN9A 2YJRA 3RCDA 3ZLYA 3DKCA 3OTUA 2F7ZE 5CVHA 5LARA 2FB8A 3KF7A 3VW8A 3BKBA 4FV1A 4L3LA 4LRJA 5HHWA 2RFSA 4S2ZA 3I5ZA 3VRZA 3CLYA 3DK3A 1I09A 2VUWA 4AF3A 4L7FA 5J1WA 3GC0A 4AU8A 1H27A 3WF7A 1OKVA 4I24A 4QTEA 3SOAA 5AR3A 4ZY4A 5HIDA 5IQIA 1KV1A 3FLYA 4APPA 2UZVA 4YC8A 5TO8A 3OW3A 3E8CA 2QO9A 2YM7A 4TRLA 1UU7A 5CU2A 4N57A 2F49A 4FTTA 2ZYBA 4BCJA 4U3YA 3D7TA 4YBKA 4C33A 5CVGA 2WMRA 3OHTA 4BHZA 5HX8A 4XBRA 3ZO3A 4AXAA 3ORIA 5C27A 3LMHA 4FV7A 3DDQA 4L67A 4QP6A 3IG7A 3Q6UA 2YAKA 2WD1A 1H0VA 2ERZE 2IZTA 3NUNA 4BCNA 4C57A 2WGJA 3E62A 3QGYA 3AG9A 4RX7A 2YDIA 3C5IA 2R3FA 5LOHA 3IPHA 2AUHA 2YM8A 4RLLA 3AC1A 2X39A 3NAYA 4S30A 4Y5HA 4JR3A 5LVOA 5M4FA 2WTWA 4KS7A 2WIHA 5JN2A 1YHWA 5T68A 4AE6A 3EFKA 2VNYA 4I5HA 2IPXA 3QZIA 2ZDTA 1UU8A 5DGZA 3LFNA 5KBQA 2VTIA 3CPBA 2WMUA 3QKKA 3F2NA 4KIOA 4OTGA 4P5ZA 1U54A 5AP1A 3RK7A 4BTJA 5CAUA 4YTFA 5KBRA 5LWNA 3BCEA 4IQ6A 4IWDA 4RJ3A 1QL6A 1EH4A 5J7BA 2X1NA 4NL0A 1FINA 3FMNA 4W8EA 1RW8A 2FH9A 4G6NA 5DBXA 1J3HA 4GRBA 4J99A 4ACGA 3TUCA 3QZHA 2XCKA 5BVWA 3FC2A 4EOJA 5GNKA 4YTIA 4EKKA 4IC7A 2YHVA 3ANRA 2E9PA 2RFEA 4KIPA 4EK3A 4DH8A 3VBVA 3F7WA 2I1MA 4UXLA 3RHKA 5KMMA 4MTAA 2J0JA 2QNJA 2JDTA 4M14A 5D9HA 4DH7A 2EWAA 2J51A 3HMNA 4IB1A 4DBNA 4GJ3A 4K6ZA 5JQ8A 2SRCA 2YIYA 1ZYCA 4U40A 4IC8A 4OGRA 3QZFA 4BZOA 5JFSA 3QUEA 1JKSA 5T6KA 3SAYA 4RX9A 3OUKA 3S00A 3D2IA 4LL5A 2VWYA 4C7TA 4FZFB 4EZ3A 3GC8A 4MWIA 4CNHA 4QYEA 3RM7A 3A61A 1NT2A 4W9WA 1ZRZA 1MQBA 4ZSEA 4OBQA 3TTJA 1YRPA 1YI6A 2XZSA 3UZTA 3A99A 5B0XA 4WNPA 4I5PA 1YDSE 4WD5A 2WEIA 3DBFA 5HNIX 4EK5A 4BCGA 5H8EA 2BROA 3CJFA 4JDIA 1YWRA 3QTQA 1XR1A 2BRGA 4JBVA 3RPVA 5ETFA 5GHVA 3E87A 4AOTA 5JGBA 4U3ZA 2Z02A 2R3LA 3EKKA 4HVIA 2OWBA 2QLQA 3LFBA 2ZB0A 4OW8A 1GIHA 3ORTA 4C3FA 1AGWA 4I23A 4X3FB 3UPXA 2C5NA 2X7GA 4Y83A 4AACA 4DEDA 5HIBA 2VO3A 3JS2A 3E7OA 5CANA 2X4FA 2JIIA 2Y7JA 1PMEA 3R7GA 3LPBA 4ZTLA 3VC4A 3ORLA 4Z9LA 4U97A 5HG8A 4A9TA 4PDYA 2DWBA 4D1SA 3PSBA 5EYKA 4EBVA 3ET7A 3QTSA 1STCE 3UNZA 3LFQA 5CEPA 4XOZA 4DGMA 2ZB1A 4KSPA 2Y6OA 5HLWA 3R28A 4A4LA 1ERKA 4EH6A 5AAEA 5BVEA 4MHAA 3F69A 2NPQA 3NUUA 3OCTA 5BQ0A 3UPZA 4RWJA 3LMIA 2B54A 3CJGA 4E6AA 3CR0A 4FI1A 3RPRA 3M42A 4FL3A 4L45A 3CC6A 2J0KA 2WQBA 3SRVB 3OTVA 4NT4A 2B55A 4TN6A 4EQMA 1QCFA 1SYKA 1YHVA 2H6DA 3JXWA 4YTHA 5IQHA 3GBZA 3ORXA 4EH8A 2E9UA 1UVRA 4JS8A 3VBQA 5L6OA 3VS7A 2VTOA 3FSKA 3QQJA 4C62A 4I6HA 5HCYA 3NUPA 3OBGA 3W8QA 1Q4LA 3GU6A 4M66A 1G5SA 5AMNA 4C36A 5L8LA 5AP3A 3TDVA 4EK8A 3F5GA 4CMOA 1X8BA 2P0CA 1XKKA 3LMGA 4D4VA 2XRUA 2ZAZA 3HRCA 2XYUA 4FTRA 2OH0E 2XK4A 3UZPA 3TG1A 3CQEA 3KVXA 3BEGA 1PYXA 3U9CA 2PVJA 4JXFA 2B9HA 4RWLA 4BKJA 2QKRA 4CT1A 3GFWA 3VS2A 3ACKA 3BLQA 3ORKA 3G2FA 3BV3A 3VUIA 3GP0A 4D1XA 2ITQA 4R3RA 3RMFA 3ACJA 4O7SA 3ZXZA 4Z7HA 2VRXA 3GUBA 4HYIA 3T3UA 3JY0A 4AS0A 3ITZA 4YJTA 3FEGA 4E1ZA 3TZ7A 1UWJA 3EQFA 4TTHB 5FP5A 3R8MA 4HNIA 4RIXB 3LQ8A 4A06A 4G5PA 2WXVA 2PUNA 3LW0A 4EH3A 5KUPA 3ORMA 4BTFA 4RIXA 5CQWA 2PVFA 3NYXA 2W5BA 4AG8A 5CLPA 3MVHA 1U4DA 4TYEA 5DH3A 3ATSA 2X7OA 4GUEA 4O81A 3OWJA 3UO4A 2W1IA 4D2SA 5L4QA 2VO7A 4FSUA 5IMXA 5AWMA 2WQOA 1YWVA 3K5UA 3VO3A 4XG3A 1JLUE 5ANOA 5FDPA 2I40A 2J50A 3W8LA 4EOIA 2WMAA 1OIUA 3IW5A 4TL0A 3QQGA 3QTXA 3LFAA 3NEWA 3Q5ZA 4Q9SA 4XV1A 1LUFA 5I4NA 4OAVB 5KMOA 4DTBA 5HX6A 4FIHA 2YABA 3O51A 4FBXA 1OL1A 1Y8YA 2GCDA 1GZOA 2V5QA 3O50A 4FSWA 4JQEA 1ND4A 2GTMA 4AX8A 5F20A 2F9GA 4MXZA 5ITAA 4FSYA 1VYZA 4XG9A 2R5TA 1VEBA 4I0TA 1JOWB 3KU2A 4K8AA 3KC3A 3V8WA 4CZTA 4D2PA 5HO7A 1SZMA 1OUKA 2UW3A 5HQ0A 4PDOA 4ORKA 2GU8A 5HTCA 3V6RA 4XOYA 2PPQA 2CGVA 3SRVA 1R0PA 2BR1A 3GB2A 4IH8A 2J90A 3WZDA 5B2MA 2C6EA 4PX6A 3N51A 4C34A 4ZLZA 2ZV7A 4FKJA 5AIRA 3D7ZA 2OJGA 4MXAA 3RPOA 3FMMA 3IOPA 3KFAA 1OIYA 1DS5A 4OTPA 4QP9A 2XKEA 5AP2A 3HP2A 4L68A 3ULZA 3VVHA 4FYOA 4EZ7A 4O83A 3ZLXA 3R8LA 3C13A 3KREA 4QMYA 4QYYA 2JDOA 3KK8A 2IN6A 4G16A 3RAKA 1W0XC 4USFA 2NP8A 3F3UA 3IS5A 3FHIA 2PVNA 2YEXA 2XS0A 3EMGA 4RIOA 3QQLA 4AN9A 2E9NA 4CXAA 5EKNA 4K11A 2HZIA 4Y73A 3LCOA 5EOBA 5KHXA 3C50A 4I94A 2C6KA 2YITA 4XNEA 2YIXA 3LE6A 2QG5A 4FIIA 3VUHA 3FI8A 4PWNA 3D4QA 4EYMA 2QONA 3WF5A 4G6LA 3PSDA 4K0YA 2R3QA 2JDVA 2EVAA 4LMUA 5ACKA 2VTJA 4YZ9A 2R3JA 3IW8A 4FUXA 4KIKA 3JY9A 3QQHA 3CQUA 3D7TB 2IVSA 2YAAA 2ZOQA 3QX4A 3A7FA 5DEWA 3EQPA 4JG7A 5D41A 4MNFA 3P08A 3FKOA 4FVPA 2ITNA 4FV6A 4G2FA 3UVQA 4MD8E 3WI6A 2HOGA 2XIRA 2V7AA 5IUGA 4BCMA 3UO5A 4GV1A 4F65A 1CSNA 1Y91A 4UEUA 3RK9A 2WTVA 5C1QB 4ARKA 1UKHA 2BPMA 1OL2A 3TV6A 4U81A 4PP7A 3NNUA 4CG9A 2OK1A 2PK9A 2HZNA 1Q5KA 2X4ZA 3FWQA 3KULB 3MA6A 3MJ1A 2O3PA 3UJGA 4KKHA 2Y8OA 4RIYB 3PY3A 4USEA 5IH4A 3HMMA 4F64A 2WELA 5AP5A 3GT8A 3QXPA 4Z7GA 4I6QA 3PRFA 3DAEA 4U8ZA 4Z55A 5CX9A 5DHJA 3GFEA 2VTMA 3UBDA 4FE2A 1Q24A 2VD5A 1BL7A 1BYGA 3ELJA 3O0GA 4EC8A 3K3IA 3DLSA 4FZDB 3WZJA 5GIOE 4EOQA 1K9AA 1PKDA 5FG8A 3ZO1A 2Z7SA 2UW6A 4M3QA 2JC6A 4XRLA 4F0FA 4TWNA 4YGAA 4GT5A 2H9VA 3QQFA 4DTKA 3SX9A 3FLNC 3OFMA 4IAZA 4CKRA 3R63A 1O6YA 2YM5A 3V01A 5HTBA 3R73A 1V0OA 5AUWA 5FM2A 5EM8A 4AZFA 3IW6A 4BKYA 4MBLA 5C26A 2WZJA 4ZTRA 3ZFYA 4AZVA 2JEDA 3CY3A 4YR8A 2OLCA 4BDJA 4FTIA 3FMEA 4I5CA 3FXZA 5IQEA 3PYYA 4F9AA 4O7ZA 3COMA 2R3GA 2WTCA 1P14A 4MD7E 4NUSA 2OIDA 4E4MA 5E8VA 3UQFA 3NIEA 5DWRA 4WG3A 3EZRA 4DFXE 5AUUA 3FKNA 5CF6A 2QHNA 5LQFA 2GDOA 4JG6A 2VTRA 3ERKA 3Q4CA 4RA4A 5KMLA 4XMOA 4RIWB 4OAUC 3FQEA 1VJYA 3ZXTA 4F1OA 3PWYA 3LKMA 4PL4A 4HGLA 2QOFA 4LOQA 4KWPA 3W1FA 2PE2A 4EWQA 2W1ZA 5BPYA 3HECA 4HVSA 2I7QA 3AC3A 2GHMA 3I60A 3JUHA 3PTGA 3QFVA 4MWHA 3VHEA 2UV2A 2W9FB 3W18A 1BL6A 5D7VA 5BUIA 2B52A 2AC5A 1J7IA 4O7WA 1H8FA 3RPSA 1O6KA 3G15A 4FSRA 4G17A 1YQJA 4TWOA 3EQHA 3LXNA 5J5TA 4R1YA 2CNVA 3FKLA 4RIYA 4O1PA 3ODZX 2JKKA 3EQDA 4O0YA 3VBXA 1MP8A 4V01A 5I3OA 1FMOE 3U4UA 3COHA 4BDFA 4DEAA 4K2RA 4BDCA 5F94A 3Q5IA 4RX8A 3R1YA 4ITJA 2WNTA 3Q9XA 5K5XA 2R7IA 5CEOA 2W9ZB 4ZLYA 3GU7A 5ANGA 3GCPA 4JQ8A 3RALA 1G8SA 4N0SA 4YJUA 5E8UA 4IANA 3OP5A 4F70A 3DA6A 4XG8A 2HZ4A 4CV9A 3CP9A 1KE8A 3OOMA 3PP0A 5D12A 5D1JA 4U41A 2XKCA 3TZ9A 4CCBA 4ZLOA 4UYNA 3CD8A 4D58A 4GG7A 3VWAA 3R7VA 3FZOA 3NPCA 5EYDA 1BI8A 4RZWA 4K1BA 4XJ0A 3S2PA 4C4GA 5JGDA 2CGUA 4R3PA 4MCVA 3OT3A 5J9ZA 4ERWA 4ASZA 4NTSA 2HY0A 2WEVA 5CU3A 4PRJA 3WF6A 4D9TA 3PZHA 5IH5A 5FXSA 3U54A 5EQPA 3QU0A 4GCJA 4BI1A 1KE6A 5HLNA 1NVQA 2I0HA 4FSMA 5E8XA 3E88A 3CTQA 3B8RA 2UVZA 3D5XA 3TKIA 3W2RA 3F7ZA 5CALA 4BL1A 3RZFA 4FX3A 1PMVA 1ZAOA 4FT7A 5M08A 3PUPA 4GVJA 5AUYA 1YKRA 4AZTA 1H01A 2GNHA 4QD6A 2WMVA 5FP6A 1YOLA 3VBTA 5AADA 5KKRC 5M09A 4YPSA 2C4GA 1BI7A 4IB0A 3QTWA 4DEHA 4JL9A 3C5UA 4FIFA 2X6DA 4QT1A 5DLSA 2ITZA 2OXXA 4ACHA 2R3IA 1K2PA 3FLWA 3FY0A 5E90A 2JDSA 2AYPA 5IQGA 5CI7A 3KY2A 3V8TA 1M14A 4BZDA 2ETMA 2F57A 3L8VA 2RIOA 1IAHA 2UW7A 4I6BA 4NWMA 3IQ7A 3SG9A 1UNGA 3BEAA 2W5HA 3KXGA 3OCGA 3LHJA 2ZV8A 3FMLA 3PVGA 4JX7A 4U0IA 1UNLA 4FTJA 2HELA 3ZFMA 2GFCA 2A19B 1JBPE 4TWCA 5DFPA 3RWQA 3UIBA 4I93A 4X2GA 3GGFA 4RJ5A 4EC9A 3HUCA 3HV3A 3CTJA 1PMUA 2OH4A 2X2LA 3UO6A 3MTFA 5CNOA 1JQHA 5IEVA 3G9LX 5AP4A 5C8NA 4WG5A 1GIIA 4PF4A 4D0XA 4J8MA 4RC2A 1YOJA 2FGIA 3LQ5A 4XH6A 3WZEA 3PDTA 3R7IA 4FTOA 1NA7A 3DS6A 4PV0A 3PXQA 1UV5A 2WAJA 4MD9E 2ITOA 2NO3A 5A46A 4DINA 5AX9A 2W1FA 5J87A 5J8IA 4EQUA 5L8JA 5EW3A 3UC4A 1MUOA 4ZSLA 4CFMA 4E4XA 4FKLA 3SW7A 4HCUA 4G3DA 2R7BA 3KL8A 5EM7A 4B4LA 5E9EA 4LM5A 1WCCA 3G90X 1L8TA 3KXXA 4KRDA 1W84A 2WQEA 5BX0A 2C68A 3P7CA 3QYZA 4G6OA 3TKHA 4EKLA 3NZ0A 4PUZA 3FV8A 2VU3A 2B0QA 3ZUTA 4AN2A 4NH1A 4QMTA 3PY0A 4HYUA 5AJQA 4DT9A 3JVSA 5BVNA 2RGPA 2PE0A 3MY5A 3DAKA 4UWBA 3L8SA 4EJ7A 2VO0A 3QLGA 3HYHA 4CT2A 3B2TA 3AMAA 4CFWA 2PVYA 2BTSA 3BI6A 5L2IA 3SOCA 2CMWA 3RAIA 2EXCX 1WAKA 3EFJA 4YJVA 3P78A 3AMBA 4LV8A 4L53A 5F95A 4EBWA 2NRYA 2YWPA 1O9UA 2CN5A 2VTHA 4MVFA 4QTDA 4BCPA 2ITXA 4LGDA 3SD0A 5AP0A 1H00A 3H3CA 4X2KA 2P3GX 4LMNA 3RTPA 4NM7A 4KRCA 5BMMA 3BHHA 3HV6A 3S95A 5CAVA 3EN5A 4KBAA 5AR5A 3TI1A 1IA8A 4QMVA 3WARA 4CZUA 3F5UA 2UZEA 4DN5A 3F82A 3DDPA 3SXRA 2PTKA 4C3RA 4BDDA 5A4CA 4O7NA 4FT9A 4L9IA 4LV5A 3DKGA 3TIYA 2XK8A 4CMUA 3FSFA 3HMOA 3VUGA 3EN6A 5HE1A 1JAMA 2VTLA 5GZAA 2C5XA 3HMPA 4XCUA 4J7BA 2IVVA 2OKRA 4LRKA 4RG0A 3H9FA 3S1HA 2A1AB 3OOGA 4YHJA 5HKMA 1PXOA 3HAMA 3H4JA 2PMIA 3NNVA 3F3ZA 3AMYA 4ANOA 4IAYA 2PU8A 3AD5A 3Q2JA 2ZJWA 4GK4A 2UZLA 3UP2A 1PHKA 4M13A 4E6CA 3PJ3A 3BWFA 3MB7A 3TV7A 3A7JA 4CTCA 5A9UA 3BBWA 4XX9A 2OICA 1J7UA 5K0KA 3LFFA 2XNOA 3PFQA 3F6XA 4I5MA 5ANIA 3CE3A 3WE8A 4TKSA 2WMQA 3M1SA 5HBEA 3O8UA 4ZZNA 4J97A 3IK3A 2GS7A 5CXHA 4WBBB 4ANLA 2XBJA 3EYHA 1WBPA 4S32A 3SC1A 4CKJA 3ROYA 5IA3A 4ZS4A 3ALNA 4BWPA 3CKWA 1PJKA 3QA0A 3VF9A 3VJOA 1YXUA 3W2CA 3ATTA 4X2JA 2YIQA 3BLRA 5J7HA 3EWHA 1OUYA 3P0MA 3GNIB 3FY2A 4Y5QA 1ATPE 1VR2A 4BIDA 3HX4A 2IVUA 3CQWA 4LG4A 4H58A 3L8PA 4KABA 4XG6A 3DKOA 4DTAA 5CEKA 5LVPA 4FKQA 4M8TA 1OKZA 4OTHA 3NCGA 5IDPA 4W9XA 5C8MA 3QD4A 4FKUA 3I4BA 4I0RA 2JGZA 5IQBA 4DH5A 2X0GA 4C0TA 4E4LA 3OG7A 3D14A 3TKUA 2C0OA 3LJ1A 3R8PA 2QOKA 4W8DA 4WNMA 4E26A 4C8BA 4BCOA 1B6CB 4NYEA 3EOCA 1JKKA 1XH8A 5M56A 4JG8A 1R1WA 3AT2A 4LYNA 2J0LA 3EHAA 4DGLC 1DM2A 3G0EA 2KTYA 4BI2A 4UMUA 4O21A 3MS9A 4RX5A 4FGRA 1H1SA 4O0TA 2F2UA 2XVDA 3I1AA 4NJDA 4IBMA 4TXCA 5M4CA 3A62A 4RPVA 5AUXA 4HCVA 4TT7A 1TQPA 3VRYA 4JOAA 4QNAA 3ZRLA 4QMPA 4UWCA 3DCVA 1YI3A 1RE8A 2C3LA 3M2WA 4QMSA 5HCXA 4A07A 3KXHA 5M44A 3FAAA 3LXKA 1ZOHA 2W17A 1B38A 3MA3A 4M97A 3ALOA 3VS3A 4AA0A 5HICA 4OTIA 3BV2A 4ZOGA 4QPAA 3TCPA 5EOLA 5KCVA 2QVSE 5FWKK 2Z2WA 4CQEA 5BVOA 2OU7A 3C4WA 5M53A 5AAFA 4XYFA 4FG8A 3RZBA 5T3QA 2OI4X 3VUDA 4CLIA 2VX0A 5EH0A 5L6PA 2PVLA 4NCTA 4XEYA 3P9JA 3UG1A 4ZAUA 3UOKA 3QC9A 3TNQB 1J91A 5AP7A 1LR4A 2OO8X 5AA9A 2BZIB 4YJRA 4EH4A 3LLAA 4UXQA 1Q8UA 3DFCB 4C35A 5CSPA 4FA2A 2VWWA 4NW5A 3A7IA 3QTZA 3EYGA 2J2IB 5DR6A 3RI1A 3TNIA 4PMPA 3OW4A 3FMDA 2CCIA 3BELA 3C9WA 5FBOA 5M51A 3ZSHA 5FD2A 3BGZA 3NX8A 3S4QA 4UB7A 3P4KA 4QMLA 5IZFA 4BRXA 4AGDA 4O7VA 1Q62A 5K4JA 3AT4A 1Y8GA 3RWPA 4J8NA 3UMWA 1OB3A 3VS0A 5CF8A 3NYOA 1LEWA 3LXLA 4P2KA 4BCFA 3DTCA 2QOLA 2CHLA 1H0WA 4M69B 3OXTA 3NSZA 4MQ1A 4BDKA 3LVPA 4LQMA 5HTIA 1YDTE 1UNHA 3R1QA 4C37A 4RFMA 1OMWA 4QP1A 3AQVA 2QURA 2VWXA 4AFEA 2IZRA 5LVMA 3ZEPA 1JNKA 2W5AA 5I9VA 4D28A 2W99B 2IW6A 2XK6A 3E64A 5AV3A 3SVVA 1XHAA 1DAYA 3KEXA 5ETIA 3LIJA 1HCKA 2E9OA 4FZAB 2XBAA 4AFJA 1BMKA 1JVPP 4NCTC 3BYOA 3CS9A 3QGWA 2W06A 4FTAA 1OL5A 1WBWA 4R5SA 2VTSA 3FQSA 3UVRA 4PL5A 3VIDA 2YM4A 2RFNA 2GS6A 2BIKB 3UQCA 3DK6A 1ZOEA 5AM6A 5DT0A 3PXKA 4W4VA 4Y46A 2BALA 1OBDA 1PW2A 3A4OX 3GU5A 4JBPA 3WYXA 5CZIA 1A06A 2O65A 3KK9A 3DU8A 3AD6A 2HCKA 3C4XA 3DLZA 3HRBA 2PYWA 3GEQA 1URCA 4QTAA 5BYZA 3RKBA 4RLKA 3ZM9A 3KGAA 2XEYA 4YJNA 3TJDA 3VUKA 4E73A 4ZTQA 1GJOA 2JIVA 5CAPA 3MPTA 3ETAA 4H39A 3LJ0A 1ZARA 5HD7A 4ONAA 3PXRA 1IG1A 1H25A 3C1XA 3V5JA 3ZSIA 5I0BA 3BWJA 4GJ2A 3I6WA 2UUEA 4IB5A 3R8VA 5IA5A 1ZYSA 2VNWA 4ENYA 3NMUF 1XJDA 4YJQA 4O6EA 2C3JA 3L8XA 2HXLA 4WA9A 4OBPA 2NNWB 4DFLA 3R8ZA 5IEXA 2WTKB 4AA5A 4AUAA 4YNOA 3QF9A 2IZSA 4U79A 2HZ0A 3OCBA 5DRDA 4NW6A 5IH6A 5J9YA 3OVVA 5HESA 4WBOA 3C0HA 2UW8A 2XK9A 3NUSA 4E6DA 4EOOA 4DE4A 4J1RA 2QOIA 4C4JA 3NW7A 4IE9A 4PNKA 2HXQA 2C6OA 1ZXEA 5J95A 3P7AA 3HZTA 4Q5HA 3UG2A 4B7TA 1R0EA 4DFUA 5DA3A 3EQBA 4CFUA 2WTIA 4GFOA 4RMZA 1M2RA 4NU1A 4QQ5A 3EFLA 3MFRA 2CKPA 1YHSA 2OGVA 2O2UA 4FV0A 3W55A 3PWDA 4XBUA 5CAQA 5EM5A 4B99A 4C59A 4AZEA 2PHKA 4HVDA 3K3JA 3R01A 4FSNA 5EHOA 3QRKA 4OTQA 4BVUA 4HW7A 3VBYA 1P5EA 2EXEA 2IZUA 5KX8A 1H1QA 3I7CA 4K77A 2F2CB 3R7UA 4AQCA 2CJMA 3DKFA 3HL7A 3PIXA 4XV9A 1QPEA 3MIAA 1KUTA 2B7AA 4ASDA 3KXMA 5E4HA 2R3OA 2YFXA 1WBTA 4YP8A 4A9YA 4EH7A 2W1CA 4FKSA 4AZSA 5LMKC 3QTUA 3R02A 3DBQA 4FKWA 1SVEA 5LMKA 3H0ZA 4F09A 4AE9A 4GVAA 3R9RA 3KMMA 2C5YA 2P2IA 3RAWA 4FR4A 3NYVA 2VGOA 5A4TA 2JFLA 2Q0NA 2VV9A 4XUFA 3LCTA 3T9IA 3FC1X 3OZ6A 3COKA 1MQ4A 5A4LA 1Q41A 2CGWA 2YJSA 3KRXA 5F4NA 3OXZA 4O91A 4EK4A 1UU3A 4FF8A 4GSBA 4MK0A 4P90A 1Y57A 5TE0A 3TNPC 5M07A 3C0IA 1MRUA 5L3AA 3ZRMA 4OTDA 3G0FA 5H2UA 2IW8A 2FVDA 3HEGA 3W2PA 2QOBA 4I92A 4QMQA 3DJ5A 3RP9A 2PULA 3BGPA 4DGOA 5A14A 2EB2A 4GS6A 3TACA 2ZM1A 4WG4A 3O7LD 2XIXA 3G6HA 1SVGA 3EQGA 2BHEA 1TVOA 2IVTA 4MNEB 1O6LA 3PPKA 4JT3A 3Q52A 3E63A 3ZZEA 4L3PA 4EUTA 3DB6A 2ACXA 3FHRA 3W2OA 4YO4A 5B2KA 3D5UA 3R9DA 4JQ7A 4ALVA 5HIEA 5CWZA 4C4EA 1Z57A 3TTIA 3W16A 1H07A 3WILA 1V0BA 4IZAA 5HU9A 2LAVA 3SGCA 4D4RA 4OTFA 1PMNA 4JDJA 4EOLA 4RVLA 2GNIA 3PG1A 3PJ1A 5D7AA 3TZMA 5EK7A 2G2IA 3DXNA 5LJJA 1PXLA 3QA8A 2C5OA 3F2RA 4BTKA 3I0OA 4PY1A 4YBJA 4D5KA 4JRVA 4QTBA 4U43A 3PA4A 2VTQA 3EIDA 4GUBA 2HW7A 4ZK5A 1CDKA 3Q4ZA 4JI9A 4S34A 1Z9XA 2JAVA 4ZXTA 4AP7A 3L9PA 2HENA 1H4LA 4JDHA 5FBNC 2ITTA 3ZBFA 4EJNA 5HE2A 3ZYAA 2O8YA 3DOGA 3U51A 3RHXA 1V0PA 4JDKA 3VS4A 3PJCA 3C7QA 5LVNA 4GH2A 3NVKI 4WHZA 3JR1A 3A8XA 4YUQA 2XNEA 3GI3A 4D2WA 2UW4A 5EQYA 2F7EE 1J1BA 2FSMX 3KF4A 1FVRA 1TKIA 4FTQA 4NSTA 2RG6A 5M4UA 3FPQA 5E8WA 4A4XA 4DF3A 4ZSJA 1JKLA 5DIAA 4ITHA 4AW0A 2WFYA 2WQNA 3TDWA 3E7VA 4GK2A 3U6HA 1P4FA 4HZRA 4CMTA 3GCQA 4PL3A 5F9EA 3ZSGA 5LVLA 5A54A 4D0WA 3W32A 5IA4A 2H8HA 2ITVA 3T3VA 2UVXA 3BX5A 2Y4IB 1T46A 3EN4A 3FLSA 3L1SA 1XH6A 1U5QA 3TZ8A 3C4FA 3UNJA 5CEQA 3MVJA 2R0IA 4DG0E 1OPLA 1ZYDA 4FVQA 4G1WA 3SXSA 4F7JA 3QCXA 2BDWA 4FTMA 3TN8A 2Y9QA 4QQJA 4KKGA 3UP7A 5JEBA 4K9YA 1PY5A 2X8DA 2Z8CA 4TW9A 5HG9A 4A9UA 3HKOA 3R30A 4PTCA 4LGGA 1AQ1A 4E5BA 5BVFA 4O7TA 4IIRA 5FQDC 1ZZ2A 5GZ9A 5TF9A 4G9RA 2FSOX 3FXXA 3UOLA 3UIXA 3ENMA 3D5VA 3EZVA 3FZSA 1ZMWA 4RFZA 5FXQA 4UZHA 4FTCA 2Q83A 1HOWA 2HK5A 2UZBA 4F1MA 2W1EA 4L52A 5AR7A 4RSSA 2JAMA 3L9NA 2PWLA 5EI8A 1BUHA 1KV2A 1K3AA 1YW2A 4J53A 4JVGA 4HZSA 4XRJA 3O8TA 4FUYA 5IMEA 2XRWA 4L00A 3IGGA 2PY3A 3G51A 5DR9A 2OXYA 4FNXA 4U7ZA 4PTGA 4WRGA 3TXOA 1Q3DA 4XS2A 2PUPA 4V05A 2J4ZA 5IQCA 3JVRA 3Q32A 4F9CA 3PE1A 4QYFA 4GYGA 4QP3A 5A4EA 4L01A 4JAJA 2R3RA 3PJ2A 3QQUA 4X2FA 3FXWA 5LMBA 1OIRA 4MBIA 4CFXA 1GY3A 4CQGA 2XM9A 3MWUA 1ZZLA 3D83A 2R0UA 5DOSA 4FIEA 5DVRA 3V6SA 3FZRA 3THBA 4IFGA 1KE7A 3F88A 4F9WA 3DK7A 4ANMA 4FNYA 3IW7A 2GNJA 3VJNA 4EQCA 2BIYA 3O7LB 4UV0A 3E8NA 4B6LA 4IFCA 5HCZA 3OUNB 3NW6A 2OZOA 2R4BA 2UVYA 4DCEA 4G5JA 2YIWA 4IX6A 4D5HA 4PPAA 5K4IA 3KN5A 3T9TA 3KXZA 5EHYA 4BN1A 2WMTA 2J5FA 4MH7A 5CENA 4XP2A 2PZRA 5C9CA 4KBKA 3A7HA 4S31A 1ZYJA 3FMJA 3POZA 4IW0A 3KRLA 4BYIA 3DJ6A 3EB0A 5FTOA 3ROCA 4NFMA 2LGCA 4KD1A 4XLVA 3U55A 2VTTA 3BYVA 3MBLA 3IOKA 3DBDA 5AP6A 3FMKA 3GXLA 3W2SA 4ZY5A 3MESA 3GCSA 1YXTA 1KE5A 4DFZE 1G3NA 4DG3E 2YM3A 3B2WA 4CYJA 1RQQA 4U5JA 4F6UA 2X8EA 3KKVA 4YLLA 3KRWA 3MPMA 5KZ0A 2WMWA 1IASA 4FIJA 3S0OA 3KCKA 2YISA 2OW3A 3PPZA 2X9EA 4G9CA 3PVBA 4M0ZA 4C02A 4F9YA 2W0JA 2AC3A 2VWZA 1BX6A 4DHFA 2XCHA 2VWBA 3FZ1A 4FKRA 5DYJA 4MX9A 4KKEA 4JBQA 2JD5A 5ANKA 5LCKA 2ONLA 4EH2A 4JIKA 4N4SA 4FV8A 5TOZA 1SMHA 4QYGA 3PIYA 3JPVA 4M69A 3LLTA 5L2SA 4I1ZA 4IHPA 1XH9A 3F66A 2OFUA 1KE9A 2BAKA 5IKWA 4NFNA 3NRMA 1I44A 4CYIA 1F0QA 4H1MA 3ZCLA 4EHEA 3PE2A 3HUBA 3POOA 5KZIA 4EOMA 4YPDA 3R6XA 3UOHA 4QMMA 5I3RA 5HO6A 4ZP5A 2IO6A 4N6YA 3OEZA 4C2VA 5HU3A 4FVRA 3PA5A 4ZSGA 2OIQA 4KSQA 3V51A 2CSNA 2UW5A 4FG9A 3R9HA 2W96B 1WMKA 1QPDA 3QRUA 5IG1A 3Q2MA 4IVAA 3BQCA 4KA3A 4QMWA 3RBWA 5KKRB 2XF0A 3I7BA 2UZOA 5CS6A 1NVRA 3BRBA 3ZLSA 3VS5A 3VULA 1XH7A 4AOJA 2I6LA 3CBLA 3A4PA 3ZEWA 3AD4A 1MRYA 3HDNA 4GKIA 2XKFA 2X2MA 4ACMA 4YTCA 4GKHA 5IQFA 5FEQA 1Q97A 4MKCA 3BYUA 4ASXA 4ID7A 4BWKA 5C4KA 2WU6A 2XNGA 4FL1A 3ZU7A 5CEMA 3OEFX 3NDMA 1H1RA 3DT1A 5ETAA 4LGHA 3IONA 4K18A 2RL5A 3F3TA 4F1TA 3QQKA 4NEUA 2W4JA 5AV0A 3FE3A 4TZRA 3HA6A 3K2LA 4RVTA 5L2WA 4ZTMA 2JKOA 4AOIA 5M57A 3DAJA 3WZUA 1NXKA 5CEIA 3F3WA 4E5WA 4R78A 2E2BA 1WBOA 4F0GA 3QCSA 3LAUA 4YURA 4RWKA 4FNWA 4JX3A 5J9LA 3R9NA 1RDQE 1FBNA 4Y8DA 4HVHA 2W7XA 2JFMA 4PNIA 1XQZA 3WF9A 2A27A 4MXCA 4CZYB 3NGAA 5AUTA 5FXRA 5KNJA 4YNEA 1XBAA 3PPJA 5BUEA 3Q9ZA 3R00A 4FC0A 3ZUUA 3CEKA 4GU6A 2BTRA 4R1VA 5IQDA 1FMKA 2QR8A 4I21A 4JR7A 3V5QA 5FEDA 3FMHA 5CU6A 3RCJA 3GCUA 1WVYA 3TEIA 2YLFA 3QALE 4FGBA 4X3FA 5C8KA 5JKGA 4MYGA 2ZM3A 3ZHPC 1F5QA 5JK3A 1A9UA 4X21A 3DNDA 4M12A 4UYAA 2XIKA 2GHLA 4ZJJA 4FK6A 4N6ZA 5L2TA 4G3GA 4V04A 3SLSA 1SVHA 1QMZA 5FTGA 5EYMA 5HLPA 2CNUA 2ETRA 2A0CX 3UODA 3OMVA 4EL9A 4F63A 4RFYA 3QC4A 3U8WA 2R3HA 2YZLA 4M67A 4RVKA 4DCAA 1H08A 4IVDA 1DI9A 1E1XA 2BHHA 1PXPA 1WFCA 4FOBA 2HWPA
chains in the Genus database with same CATH superfamily
5ANEA 2VX1A 2R3NA 2ZV9A 4JAIA 2ITYA 4V0GA 3BHYA 4HJOA 4UZDA 5B7VA 4F9BA 2W1DA 5HG5A 4DFBA 4I4EA 1OZ1A 1ZMUA 3FYJX 3ZRKA 2PVRA 3ORNA 3CGOA 5CY3A 4ZIMA 3OF0A 5ETCA 2R3MA 5FM3A 2XJ0A 1ZY4A 3BYMA 5DN3A 5LMAA 3R1SA 2C0IA 4KB8A 1H1WA 4QOXA 5FDXA 3BGQA 2H34A 3QD3A 2C1BA 3KN6A 4D4YA 4DC2A 1Q3WA 4NM0A 5C4LA 3IO7A 3Q04A 5E1SA 5FTQA 1W8CA 3P7BA 4O4BB 4XG4A 4EHZA 5JSMA 3AXWA 3ZDUA 1JSTA 2R3KA 3R0TA 4II5A 5JZNA 5I9YA 4ZY6A 4EORA 3PLAE 2WOUA 4NM5A 3K54A 4A9RA 2QG7A 3MV5A 3O71A 4JIAA 4GMYA 4QMOA 4QP7A 5DT3A 2ZVAA 2WPAA 2C6MA 3I5NA 1U5RA 3MY0A 1PXJA 4DEIA 4YU2A 3W0QA 1URWA 4DEEA 2JBPA 4RQVA 5EI2A 3IGOA 3C4CA 2XB7A 1P2AA 2DYLA 2YDJA 2BZHB 3G6GA 2P2HA 2QU5A 2YDKA 1JPAA 1LPUA 3VBWA 5BVDA 4IZ5A 5CQUA 2J0IA 3Q53A 3NUAA 4BFMA 5BYYA 3H30A 1JWHA 4G3CA 4ASEA 4IM3A 5IF1A 4FKVA 4I41A 4BCIA 4BGQA 4QMUA 3EQCA 4A7CA 5AV4A 3LXPA 2GQGA 3ZBXA 4KIKB 2YCRA 5AUVA 3IKAA 4YZMA 2PVMA 5AX3A 2W1HA 4FT5A 5HG7A 5KHWA 3BZ3A 3W33A 5CXZA 2GSFA 2YIRA 3KA0A 2OFVA 3MI9A 5AV2A 3MH1A 4CCUA 2G2HA 3N4TA 4CLJA 4AXCA 2Z7RA 3BBTB 2BRMA 1WVWA 2BRHA 3BLHA 4QP4A 4CD0A 3VF8A 4O2ZA 4RJ6A 4NJ3A 4OR5A 1SM2A 3KULA 3R7YA 1Y6BA 4W4YA 3VUTA 1PRYA 4JRNA 4U44A 3PVUA 4YLJA 5BNJA 2W4KA 3CXWA 1T45A 3GQLA 4AW5A 3Q9YA 4BIBA 2X81A 5E91A 2HWOA 3TT0A 2JIUA 3UGCA 4YC3A 4WUNA 4Y95A 4QMZA 2BKKA 4RVMA 2B9FA 1S9IA 2W1GA 1ZYLA 2QU6A 4E7WA 2C0TA 3CY2A 4IJPA 5FEEA 4DEBA 5HVJA 2XH5A 2UZDA 4LL0A 4P7EA 4RBLA 4WNOA 5CF4A 2BDFA 4DGNA 4EOSA 2Z7LA 4BKZA 3NUXA 4IX5A 3LZBA 3R7EA 2YZAA 1XBBA 3OS3A 3OWPA 4LRMA 3F2AA 4HPTE 4BY9E 3KVWA 3PXFA 4CRSA 5CSXA 1V1KA 4O96A 4E93A 1W82A 2YACA 3GC9A 2XEZA 3RPYA 4L8MA 5AIKA 1OI9A 4OT5A 3P79A 4G3EA 2PSQA 4AA4A 1QPCA 5H8GA 4CVAA 1TQIA 1E9HA 3FI4A 3AKKA 3BU6A 4O6LA 2BAJA 3HDMA 1M7NA 5JRSA 4DT8A 1FOTA 4EI4A 3W0OA 3MJ2A 2GNGA 3P86A 1CTPE 4GT4A 3UE4A 4NZWB 4FK3A 4EHVA 2G2FA 3LCSA 2B9IA 4FKIA 3DPKA 4PPBA 2WHBA 5DPVA 4C3PA 3AGMA 2FSLX 4FOCA 4BI0A 4ZMFA 1ZLTA 4J71A 3TWJA 1KOAA 5E8SA 1CKJA 3VQHA 1PYEA 2PZIA 4IAKA 5L2QA 4O7LA 3OY3A 5HVYA 5HORA 4O0WA 2YWVA 3PA3A 1MRVA 2XM8A 3W0MA 1CM8A 5HE3A 4JNWA 4C4HA 4KBCA 4RIWA 4YC6A 4Z3VA 2VWVA 3H0YA 3QRJA 5CZHA 3SXFA 1M7QA 3VQUA 3QCQA 4F6WA 5A4QA 3ODYX 1R3CA 3AC8A 1KOBA 1R78A 1WZYA 1YDRE 2FYSA 2NRUA 2PL0A 2RSVA 2XNNA 3MIYA 3QZGA 4MXXA 4J96A 2OJFE 4PMTA 4Q2AA 2WOTA 4DLIA 3QYWA 2DUVA 4XP0A 4DEGA 1PXIA 2QODA 4I4FA 1JSUA 2YCSA 3DJ7A 5DE2A 1U46A 5CAOA 3P23A 3A7GA 3GVUA 4YMJA 5I9ZA 4FSTA 1NW1A 4ACDA 3MFSA 4KAOA 3ZO2A 4DAWA 3PIZA 2ZMDA 3ZZWA 5GINE 2QOQA 4IM0A 2V55A 1WBSA 3D94A 4H3PA 4DLJA 2C6DA 4FIGA 4CV8A 3KB7A 2YLEA 2BVAA 4GU9A 5E1EA 3C0GA 3VNTA 4RJ4A 5AEPA 3EH9A 2Y0AA 5EG3A 4MBJA 2ITWA 1OBGA 4O4FA 2FSTX 2OSCA 2XP2A 3FLQA 3G33A 4LUEA 4OBOA 5H3QA 3KMUA 3NNXA 3W2QA 4DYMA 3QL8A 4ANSA 4IDTA 3FL4A 1VLRA 4QO9A 4GK3A 3CSVA 2J7TA 3DXQA 2UZTA 4GEOA 2BFXA 3KCFA 4NIFA 3PXZA 2ZV2A 3F3VA 1M2QA 2CDZA 3R1NA 5FLFA 3VS6A 5LWMA 3A60A 3QKMA 3QLFA 4L43A 1W7HA 4K33A 5G1XA 3NR9A 3E92A 2XALA 5LCJA 3L9LA 5AR2A 2XA4A 3AC5A 3HLLA 3QBNA 5CU0A 3LQ3A 2PUIA 3DBEA 1FVTA 2QOCA 4QRCA 5C01A 4AT3A 3UYSA 4HOKA 4WRSA 4S33A 1IR3A 2Z60A 4O0XA 2JDRA 2XIZA 3MTLA 4O0RA 4QP8A 2YN8A 3CPCA 4J52A 2XK3A 3ULIA 4KUJA 5DMZA 4QPSA 4X0MA 3U9NA 5J1VA 5CT7A 3ZDIA 4JJRA 3U4WA 4DH1A 4HCTA 3HA8A 1OKYA 3DNEA 3WBLA 4F7NA 2XAOA 4V0GB 4U42A 1IA9A 3TNHA 4FYNA 3REPA 2WMSA 4L6QA 4ZZOA 5A6OA 5KMJA 5EHLA 4FNZA 4C58A 2QC6A 2X2KA 5GZ8A 4CGAA 5BMSA 3LOKA 4ZTNA 4IMYA 4WNKA 4BBFA 4NKSA 3BHUA 3N9XA 1AD5A 3SV0A 2VWUA 4YZDA 3ZOSA 4D2TA 2WO6A 4UMQA 3OT8A 4B9DA 4O84A 1H26A 2BMCA 3MB6A 3ANQA 2Q0BA 4FV5A 4RZVA 4A4OA 2OJIA 4O2PA 3TUBA 4HYSA 2PMNX 1XH5A 5EYCA 2EXMA 5H9BA 4BTMA 3PJ8A 3RJCA 3OROA 1R39A 5JFVA 4WO5A 1XH4A 1M2PA 2HY81 4FEVA 3FI3A 2J5EA 4IWOA 4EOKA 5CYIA 1DI8A 5IU2A 4BHNA 4UWYA 3EFWA 1Z5MA 4FMQA 4QMXA 5AUZA 2HIWA 3U6JA 2O64A 4Y72A 3RNYA 1YXVA 1YOMA 2OZAA 3E5AA 3PLSA 5D11A 4EHGA 5IA0A 5AV1A 2P33A 5M55A 4B8LA 2BZKB 2OZAB 2X0QA 1IAJA 5K0XA 4MUQA 3ZFXA 2J6MA 2BCJA 4H36A 4XG2A 4BDAA 1OKWA 4PPCA 3SQQA 5GJDA 4ALWA 2A4LA 5TT7A 5LXMA 2EU9A 4GYIA 4BGHA 2OF4A 4TWPA 4X3FC 4R7HA 3IW4A 4FTLA 3O96A 5IEYA 3SW4A 3VW6A 4GIIA 4H3QA 2H96A 4C4IA 4EWHA 1OPJA 1G8AA 2QHMA 3QD0A 1LEZA 3H9OA 1GZNA 1APME 2C5VA 4NKAA 4IX3A 5C03A 2WTJA 3W10A 2UZWE 3EQIA 2DS1A 2QO2A 2WMBA 2O5KA 4NIFB 1P4OA 2XJ1A 4HPUE 3RGFA 3NS9A 3UMXA 3BL7A 4EUUA 3DGKA 5I9XA 4YJPA 4UMPA 5JFWA 4LOOA 2ITUA 4YLKA 3WYYA 2ZDUA 2EB3A 5EDPA 3AGLA 2O0UA 2R9SA 5HBJA 3UDTA 4MAOA 3MFTA 4AWIA 4O0VA 5I5ZA 4X2NA 1FPUA 2CGXA 2Y4PA 4EH9A 4NK9A 4F4PA 2I0YA 1H24A 2FUMA 4BZNA 4O7YA 4RT7A 5IQAA 2QOOA 4R8QA 3E8EA 4KNBA 3F5PA 4UBAA 2CKQA 3BL9A 5AFVA 5EI6A 3FQHA 2VWIA 3M11A 4RJ8A 4BBMA 4UALA 5KE0A 4YO6A 4BC6A 3QWKA 4I3ZA 5M06A 4YSMA 5CTPA 4LUDA 1BLXA 3FPMA 3ORPA 4ZMEA 3DV3A 4YSJA 3MYGA 4DGGA 4CEGA 4LI5A 2IG7A 4ITIA 3D2KA 4FTUA 3MY1A 2XYNA 4ZS0A 1WBNA 2PZPA 4L42A 2WU7A 3PZEA 3QKLA 3QXOA 3Q9WA 5HBHA 1YWNA 3EKNA 5BVKA 5AA8A 4TPTA 2UW0A 3OCSA 4TYHB 5JRQA 3NIZA 2UZUE 2QKWB 4GL9A 4IADA 4XV2A 3UNKA 4UX9A 3DQXA 4TYHA 4U6RA 4JLCA 2RG5A 2OBJA 2JBOA 3EN7A 2WIPA 4G31A 5DR2A 3WIGA 4BDEA 1NY3A 5HZNA 3BIZA 4IAIA 1Q8WA 2OJJA 3QAME 5A3XA 4LDTA 3KMWA 4G3FA 1JKTA 1WVXA 4O0SA 4HGTA 5AM7A 2C69A 4FTNA 3NW5A 4FSZA 4FSQA 4ZJIA 4C61A 1F3MC 5JGAA 5JT2A 3Q96A 2OJ9A 2CCHA 3B8QA 4ZTHA 2QOHA 4TNDA 2B1PA 3QX2A 3TUDA 5HNBA 3DZOA 1ZY5A 4U45A 4UMTA 5IPJA 2ZFYA 2REIA 4D1ZA 4AXFA 5E7RA 4YJSA 3Q3BA 3E3BX 4ERKA 2YCQA 4FG7A 4AGUA 3R04A 3DXPA 5DNRA 2KULA 2FA2A 5HO8A 3NVMB 2BDJA 3QUPA 3GOKA 1A48A 1GZKA 4FEUA 2V22A 2GS2A 2WMXA 1YXSA 3QUDA 4ALUA 3MVMA 2XNPA 3VAPA 4BIEA 5KMKA 3CIKA 2WB8A 4IWQA 1FVVA 2E9VA 4BDGA 3RNIA 4E4NA 3FZTA 2PVKA 2W4OA 2BFYA 4KS8A 4BDHA 3AC4A 2WKMA 3VUMA 1JSVA 2YA9A 3WIKA 1YVJA 2I0VA 3EL8A 5E8ZA 1QPJA 4E5AX 3EQRA 4B8MA 2HAKA 2PZYA 3QWJA 1U59A 4WOVA 4LOPA 3FUPA 2PMOX 5B2LA 5E92A 5IA2A 4M84A 2C6TA 2PVHA 2ESMA 3ZM4A 4ACCA 4E8AA 3UIUA 3GU4A 3BE2A 5BYLA 4DITA 2GMXA 1REKA 2BZJA 5AR8A 1W2CA 3E3PA 3LFEA 3C4ZA 4OTRA 3NUYA 2OIBA 4BYJA 1UWHA 3MW1A 4X6RA 1HCLA 3UOJA 2G1TA 5EW8A 3A8WA 3FL5A 3IDCA 2XIYA 4GT3A 3MH3A 3IECA 3ENHA 4TYGA 3LCDA 1BKXA 2YM6A 4CFNA 4ZTSA 2J9MA 5ANDA 4FV9A 2VTAA 4AGWA 5CNNA 3NLBA 4FKOA 4ENXA 3WE4A 1TQMA 2A2AA 2VX3A 3AT3A 4FKGA 5EDRA 5BUJA 4E3CA 4C38A 2XUUA 3MH2A 4PDPA 4R7BA 2RFDA 5A6NA 4AW1A 4CTBA 5E8TA 1U54B 5KMNA 2QQ7A 3MDYA 4CG8A 4KIQA 2V62A 3C51A 3MH0A 2C47A 3K5VA 1PF8A 3FJQE 4USDA 3GENA 4O86A 1GIJA 2ZM4A 3D9VA 3GCVA 3QCYA 5M4IA 3MPAA 2CLQA 3QD2B 1PKGA 2BRNA 2P55A 3EJ1A 4CFFA 4DBXA 3F9NA 3GU8A 1OVEA 4F99A 1PXNA 2VO6A 4E20A 5IUHA 3MSSA 3JYAA 2G01A 2IWIA 3Q6WA 3TNWA 3BPRA 5CI6A 3S3IA 3ZUVA 4ZJVA 3RVGA 4DA5A 2GNFA 4EYJA 1OPKA 4FV2A 5AAGA 4M7IA 2IW9A 3PG3A 2XKDA 4MF0A 4RJ7A 4D4SA 3QHWA 3W0RA 3UYTA 4X6QC 3GOPA 2I0EA 5FRIA 4HNFA 5I9UA 3ZTXA 3OY1A 1Q61A 3UTOA 5H8BA 2YCFA 3V04A 4OTWA 3NFGB 3NCZA 2X0PA 1H28A 5FGKA 4BDIA 4MXOA 4F0IA 5JZJA 4UY9A 5K3YA 4DH3A 2XK7A 3ORZA 1NVSA 4G34A 5G6VA 2VAGA 5TKDA 3OBJA 3I79A 4YHTA 4CRLA 3FBVA 5DT4A 4FTKA 2X7FA 3PXYA 4FT3A 4GFMA 5IA1A 2GFSA 1S9JA 1UKIA 3IDBA 3KQ7A 4O22A 4EOPA 4MQ2A 5CSHA 1GOLA 1OL7A 2XNBA 3DTWA 3G5DA 3O23A 5EFQA 4BBEA 3COIA 4FODA 4IAFA 4D55A 3PP1A 3O8PA 3HV5A 2O63A 4HYHA 4ANNA 3DFAA 1REJA 5DRBA 4U9AA 4BF2A 4N70A 4CKIA 3LFDA 4FZ6A 4Q9ZA 4R77A 2F7XE 3O17A 3R8UA 3LM5A 1W83A 2X8IA 4ZSAA 4I20A 4EH5A 3SHEA 3H9RA 5EDQA 3HAVA 3Q4UA 4OLIA 3V5WA 3C4EA 3LFSA 1CKPA 1CMKE 4HVGA 4FV3A 2XNMA 3V5TA 5K9IA 4O1OA 2UW9A 2B53A 2B9JA 4IXPA 4DDGA 3NNWA 4IB3A 5ICPA 2C6IA 4B0GA 3EL7A 4H05A 2C6LA 2JKQA 4CFVA 3UIMA 4LV7A 4J98A 2PMLX 3BHTA 5GJFA 3ZC6A 5CU4A 4NM3A 4YJOA 2VGPA 3UVPA 4TY1A 4F7LA 2CN8A 3WZKA 2PZ5A 3HRFA 4L44A 4D9UA 4IJ9A 4IAAA 4XLIA 1ZWSA 4AGCA 4AW2A 4FL2A 1OECA 3BU5A 3MVLA 5DI1A 4O7RA 3II5A 4WSQA 3PRIA 4I22A 3H10A 3R71A 2EUFB 4BCKA 3IDPA 2HYYA 3I6UA 4YHFA 2CLXA 4PDSA 5HEZA 4UN0C 3GC7A 4OUCA 3LJ2A 4O27B 4MF1A 3BLAA 2QD9A 2CNQA 2C30A 2GTNA 2R64A 3ZH8A 2UZNA 3OC1A 3ZC5A 4BB4A 4L7SA 5CT0A 3R83A 1OITA 4MEDA 2G15A 2F4JA 4RQKA 1DAWA 1YI4A 3DQWA 4IM2A 3RINA 4KINA 2ERKA 1H1PA 3CD3A 4C2WA 2ZMCA 2QR7A 3GQIA 1UA2A 4BDBA 3TL8A 3CCNA 4FKPA 2V7OA 3PVWA 1ZOGA 4TYIA 4FICA 3TIZA 3DBCA 3FYKX 3QRTA 4GIHA 4IACA 2C1AA 4F6SA 3Q60A 2V0DA 4QNYA 4RC3A 2JITA 4R3CA 4I0SA 3U6IA 4AZWA 3A2CA 5KO1A 5HD4A 4TNBA 4MNEA 5J79A 4AN3A 5JH6A 1CKIA 3FLZA 3BHVA 3R2YA 5HNGA 3QTIA 4R5YA 3V8SA 5DG5A 3FI2A 3V5PA 3CTHA 3WF8A 1L3RE 4XG7A 1Q8TA 3LM0A 2BAQA 3PSCA 5CASA 3HGKA 4HGEA 4ZEGA 3VN9A 2C3IB 4WSYA 4X7QA 3R21A 3UZRA 4QTCA 1M17A 3SDJA 4A9SA 3HVCA 4BWXA 4AXEA 2BUJA 4D2VA 2CKEA 1Q99A 3DY7A 4I6FA 4AT5A 1GAGA 4FKTA 4ANBA 1SNXA 3O2MA 5E8YA 3TV4A 1M52A 2QO7A 3ZONA 4M68A 4BR3A 4APCA 2VZ6A 4BCHA 5JFXA 5AR4A 2OXDA 1XO2B 1XBCA 1IEPA 5EM6A 1GNGA 2XJ2A 1Q8ZA 3PY1A 4IVBA 3V5LA 4P4CA 3UQGA 1J7LA 5HGIA 3SKCA 2FO0A 2QI8A 3RK5A 4PMMA 4R7IA 2JKMA 4FEQA 5HI2A 2C3KA 5J5SA 3D15A 4F7SA 4JBOA 4MXYA 5GJGA 4Y85A 3ZLWA 3G9NA 4X3JA 1FGKA 4CSVA 4JMQA 3FDNA 3VHKA 3P1AA 1UU9A 2OG8A 1KSWA 1YXXA 2P4IA 4PP9A 1SNUA 5CVFA 3HP5A 4QYHA 4QQCA 3I0QA 3BYSA 5I9WA 5JMSA 3OWLA 1B39A 3QRIA 4AAAA 2ONLC 2HW6A 2GQRA 3U87A 2IJMA 4J95A 3I81A 2WQMA 3UC3A 4EZ5A 5CSWA 4NTTA 4HGSA 4O0UA 3R2BA 3HMIA 4IEBA 3SA0A 5IDNA 5L6WL 1VYWA 3KXNA 4GFGA 3VS1A 2Z7QA 4RA5A 1XWSA 2Y4IC 4U80A 4DG2E 4IX4A 2GQSA 3BQRA 3OWKA 3Q4TA 2WTKC 2Y6MA 3E8DA 4RGJA 4D2RA 4IDVA 4DFYA 2PUUA 4FZ7A 1E1VA 3R9OA 2CKOA 3R7OA 3ZMMA 2GNLA 4PTEA 4WIHA 3OXIA 2ETKA 3N4VA 1J1CA 3P5KA 2CPKE 4RRVA 3QHRA 3MGYA 1FGIA 3HV4A 2RKUA 3OD6X 4FEWA 4YZBA 4UMRA 4IVCA 4O38A 1OM1A 2VTNA 3E93A 1OIQA 3CKXA 4GG5A 4M15A 3HNGA 4FT0A 2R3PA 2X6EA 3D5WA 3DZQA 3KRRA 2QLUA 1Q8YA 1FQ1B 1PXMA 4AAYA 3L9MA 4TYJA 3KRJA 4PQNA 4GW8A 3TM0A 4F08A 2GHGA 3MN3A 4RWIA 1PXKA 4L46A 3WOWA 1LP4A 2W05A 4RC4A 3ZS5A 4EEVA 3AC2A 3V3VA 1OL6A 2BKZA 3W0SA 3RM6A 3T8OA 5GIPE 5HE0A 2GPHA 4FEXA 5EQEA 5ANJA 1WBVA 3RAHA 2G9XA 2DQ7X 5FUTA 4ZZMA 4YZCA 4O82A 3CGFA 5KMIA 1RJBA 4IZYA 3ZO4A 4BCQA 3N4UA 4QDEA 4IZ7A 3FZPA 3QTRA 2J0MB 2R2PA 4QQTA 4WKQA 4W4XA 4OT6A 2VTPA 4BICA 5IISA 3LCKA 3DB8A 1GZ8A 3AOXA 4IWPA 4Q5EA 4BGGA 4H3BA 4Z16A 4R6VA 4EK6A 4QMNA 5CF5A 4E6QA 3SG8A 4XV3A 4DFNA 5F1ZA 2BILB 1G8JA 3TJCA 4WUAA 4DHJA 1OGUA 1VZOA 2RF9A 3HV7A 4EONA 2X9FA 5TR6A 3MFUA 2B4SB 3BU3A 5HOAA 5JQ5A 1KWPA 4M0YA 2YERA 4LFIA 3R22A 4QP2A 2OF2A 5L8KA 3EN9A 5D10A 3UDBA 3D0EA 5DEYA 2WTDA 1ZMVA 3F5XA 5CSVA 2JLDA 3BE9A 2ITPA 3LFCA 5ACBC 3NWWA 2BRBA 5EKOA 3NAXA 3ID6C 4QPMA 1Y6AA 4W4WA 4ANQA 1W98A 4H1JA 4L3JA 4WT6A 4AT4A 4C4FA 4PMSA 3NYNA 4FV4A 1IRKA 2PE1A 2XMYA 5IUIA 5HVKA 4P5QA 5EW9A 5K5NA 4XHKB 4XP3A 3F61A 2QCSA 4YZNA 2VN9A 2YJRA 3RCDA 3ZLYA 3DKCA 3OTUA 2F7ZE 5CVHA 5LARA 2FB8A 3KF7A 3VW8A 3BKBA 4FV1A 4L3LA 4LRJA 5HHWA 2RFSA 4S2ZA 3I5ZA 3VRZA 3CLYA 3DK3A 1I09A 2VUWA 4AF3A 4L7FA 5J1WA 3GC0A 4AU8A 1H27A 3WF7A 1OKVA 4I24A 4QTEA 3SOAA 5AR3A 4ZY4A 5HIDA 5IQIA 1KV1A 3FLYA 4APPA 2UZVA 4YC8A 5TO8A 3OW3A 3E8CA 2QO9A 2YM7A 4TRLA 1UU7A 5CU2A 4N57A 2F49A 4FTTA 2ZYBA 1ST4A 4BCJA 4U3YA 3D7TA 4YBKA 4F78A 4C33A 5CVGA 2WMRA 3OHTA 4BHZA 5HX8A 4XBRA 3ZO3A 4AXAA 3ORIA 5C27A 3LMHA 4FV7A 3DDQA 4L67A 4QP6A 3IG7A 3Q6UA 2YAKA 2WD1A 1H0VA 2ERZE 2IZTA 3NUNA 4BCNA 4C57A 2WGJA 3E62A 3QGYA 3AG9A 4RX7A 2YDIA 3C5IA 2R3FA 5LOHA 3IPHA 2AUHA 2YM8A 4RLLA 3AC1A 2X39A 3NAYA 4S30A 4Y5HA 1W2DA 4JR3A 5LVOA 5M4FA 2WTWA 4KS7A 2WIHA 5JN2A 1YHWA 5T68A 4AE6A 3EFKA 2VNYA 4I5HA 2IPXA 3QZIA 2ZDTA 1UU8A 5DGZA 3LFNA 5KBQA 2VTIA 3CPBA 2WMUA 3QKKA 3F2NA 4KIOA 4OTGA 4P5ZA 1U54A 5AP1A 3RK7A 4BTJA 5CAUA 4YTFA 5KBRA 5LWNA 3BCEA 4IQ6A 4IWDA 4RJ3A 1QL6A 1EH4A 5J7BA 2X1NA 4NL0A 1FINA 3FMNA 4W8EA 1RW8A 2FH9A 4G6NA 5DBXA 1J3HA 4GRBA 4J99A 4ACGA 3TUCA 3QZHA 2XCKA 5BVWA 3FC2A 4EOJA 4QEBA 5GNKA 4YTIA 4EKKA 4IC7A 2YHVA 3ANRA 2E9PA 2RFEA 4KIPA 4EK3A 4DH8A 3VBVA 3F7WA 2I1MA 4UXLA 3RHKA 5KMMA 4MTAA 2J0JA 2QNJA 2JDTA 4M14A 5D9HA 4DH7A 2EWAA 2J51A 3HMNA 4IB1A 4DBNA 4GJ3A 4K6ZA 5JQ8A 2SRCA 2YIYA 1ZYCA 4U40A 4IC8A 4OGRA 3QZFA 4BZOA 5JFSA 3QUEA 1JKSA 5T6KA 3SAYA 4RX9A 3OUKA 3S00A 3D2IA 4LL5A 2VWYA 4C7TA 4FZFB 4EZ3A 3GC8A 4MWIA 4CNHA 4QYEA 3RM7A 3A61A 1NT2A 4W9WA 1ZRZA 1MQBA 4ZSEA 4OBQA 3TTJA 1YRPA 1YI6A 2XZSA 3UZTA 3A99A 5B0XA 4WNPA 4I5PA 1YDSE 4WD5A 2WEIA 3DBFA 5HNIX 4EK5A 4BCGA 5H8EA 2BROA 4AXDA 3CJFA 4JDIA 1YWRA 3QTQA 1XR1A 2BRGA 4JBVA 3RPVA 5ETFA 5GHVA 3E87A 4AOTA 5JGBA 4U3ZA 2Z02A 3ML1A 3W0NA 2R3LA 3EKKA 4HVIA 2OWBA 2QLQA 3LFBA 2ZB0A 4OW8A 1GIHA 3ORTA 4C3FA 1AGWA 4I23A 4X3FB 3UPXA 2C5NA 2X7GA 4Y83A 4AACA 4DEDA 5HIBA 2VO3A 3JS2A 3E7OA 5CANA 2X4FA 2JIIA 2Y7JA 1PMEA 3R7GA 3LPBA 4ZTLA 3VC4A 3ORLA 4Z9LA 4U97A 5HG8A 4A9TA 4PDYA 2DWBA 4D1SA 3PSBA 5EYKA 4EBVA 3ET7A 3QTSA 1STCE 3UNZA 3LFQA 5CEPA 4XOZA 4DGMA 2ZB1A 4KSPA 2Y6OA 5HLWA 3R28A 4A4LA 1ERKA 4EH6A 5AAEA 5BVEA 4MHAA 3F69A 2NPQA 3NUUA 3OCTA 5BQ0A 3UPZA 4RWJA 3LMIA 2B54A 3CJGA 4E6AA 3CR0A 4FI1A 3RPRA 3M42A 4FL3A 4L45A 3CC6A 2J0KA 2WQBA 3SRVB 3OTVA 4NT4A 2B55A 4TN6A 4EQMA 1QCFA 1SYKA 1YHVA 2H6DA 3JXWA 4YTHA 5IQHA 3GBZA 3ORXA 4EH8A 2E9UA 1UVRA 4JS8A 3VBQA 5L6OA 3VS7A 2VTOA 3FSKA 3QQJA 4C62A 4I6HA 5HCYA 3NUPA 3OBGA 3W8QA 1Q4LA 3GU6A 4M66A 1G5SA 5AMNA 4C36A 5L8LA 5AP3A 3TDVA 4EK8A 3F5GA 4CMOA 1X8BA 2P0CA 1XKKA 3LMGA 4D4VA 2XRUA 2ZAZA 3HRCA 2XYUA 4FTRA 2OH0E 2XK4A 3UZPA 3TG1A 3CQEA 3KVXA 3BEGA 1PYXA 3U9CA 2PVJA 4JXFA 2B9HA 4RWLA 4BKJA 2QKRA 4CT1A 3GFWA 3VS2A 3ACKA 3BLQA 3ORKA 3G2FA 3BV3A 3VUIA 3GP0A 4D1XA 2ITQA 4R3RA 3RMFA 3ACJA 4O7SA 3ZXZA 4Z7HA 2VRXA 3GUBA 4HYIA 3T3UA 3JY0A 4AS0A 3ITZA 4YJTA 3FEGA 4E1ZA 3TZ7A 1UWJA 3EQFA 4TTHB 5FP5A 3R8MA 4HNIA 4RIXB 3LQ8A 4A06A 4G5PA 2WXVA 2PUNA 3LW0A 4EH3A 5KUPA 3ORMA 4BTFA 4RIXA 5CQWA 2PVFA 3NYXA 2W5BA 4AG8A 5CLPA 3MVHA 1U4DA 4TYEA 5DH3A 3ATSA 2X7OA 4GUEA 4O81A 3OWJA 3UO4A 2W1IA 4D2SA 5L4QA 2VO7A 4FSUA 5IMXA 5AWMA 2WQOA 1YWVA 3K5UA 3VO3A 4XG3A 1JLUE 5ANOA 5FDPA 2I40A 2J50A 3W8LA 4EOIA 2WMAA