3ENMA

The structure of the map2k mek6 reveals an autoinhibitory dimer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
279
Chain Sequence
FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
publication title The structure of the MAP2K MEK6 reveals an autoinhibitory dimer
pubmed doi rcsb
total genus 73
structure length 279
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3enmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3enmA01
2IVTA 3GFEA 4Z16A 4RMZA 4D2VA 5BPYA 3FSFA 2Y6MA 1MRVA 3F7ZA 4R5YA 2BFYA 5HG7A 1WVWA 3LMGA 3VC4A 4F6WA 4JAIA 2RIOA 3PIZA 5KNJA 2ACXA 4QMMA 2R3MA 5IPJA 3Q9XA 3ATSA 5AP0A 3NDMA 2VWXA 2W4JA 4MXXA 4QP2A 3OHTA 3T3UA 3FQEA 1O6KA 5AUUA 3GEQA 4JS8A 3VS6A 2CKQA 1FMKA 5J9LA 3QTZA 4FKWA 1OKYA 3V04A 2EWAA 3D9VA 3GCVA 1UWHA 5T3QA 5I9YA 2C68A 4RBLA 1NXKA 2CKEA 1G3NA 4TYEA 3W8LA 3UZTA 2NNWB 4KSQA 1YXTA 3EQBA 4YPSA 4O6EA 2WTWA 3UO4A 4F1OA 3QWKA 5F94A 3R9DA 2F9GA 4LOQA 2QLQA 3DY7A 3QRIA 2P2IA 4RA5A 3KMMA 4G2FA 5IA4A 3VHEA 2PK9A 3VULA 5B0XA 3E8CA 3R9OA 5HNGA 3KQ7A 1NVQA 1M14A 3DK6A 4M14A 3CQWA 3FXWA 1WFCA 5D7AA 2O0UA 4QP4A 3ENMA 3LCSA 4CTBA 2WEIA 4FT7A 4DEIA 3ORZA 3HL7A 2YIRA 4NL0A 3PJ1A 4LV8A 4KAOA 4P90A 3NUUA 5DHJA 2BTSA 5M44A 4BIBA 2ZV2A 2UZWE 3FE3A 4DEGA 2XEZA 3PZEA 4OTWA 4AZTA 4J53A 4KS7A 4LI5A 4G3EA 2H96A 4YUQA 1I09A 2C6MA 2WMBA 4QTDA 2AYPA 4PRJA 3UNZA 5BVOA 5HORA 5DN3A 2UVYA 3W2QA 3BU3A 3DA6A 3ULIA 3C0IA 5I9XA 5EI6A 2OSCA 2O64A 2HIWA 2ITVA 2QR8A 4AOIA 4RZWA 1ZXEA 4DFBA 3C4CA 5LVLA 5H8GA 4UMPA 2C6KA 3MY5A 1JSUA 5EFQA 4ZY5A 1S9IA 5KMIA 2VWZA 5CAOA 4MWHA 4YP8A 4M84A 5EOLA 3RMFA 4GT3A 3P5KA 4RQVA 4XG6A 5DH3A 5F20A 3EQIA 4JRVA 5E91A 5FP6A 5C01A 4ANSA 5CEQA 5JGBA 1YWNA 2JFLA 3KMWA 2E9VA 5L6OA 3UG2A 2R0UA 2Q0BA 5CF8A 3BWJA 4XUFA 4NK9A 4EQCA 2RSVA 3EWHA 4FNZA 4EZ7A 3OOGA 4A07A 3L9LA 3D5VA 4O2ZA 3FLNC 2BAQA 4XG4A 3WZJA 2F2CB 1X8BA 4M66A 1WMKA 1QPDA 3DDQA 1IA9A 4YTHA 5EW8A 4FOBA 3AC2A 3GP0A 3RP9A 2PMOX 3TZ7A 4OW8A 2GS6A 1PF8A 4FT9A 1BX6A 5HBEA 1JNKA 4I4FA 2CNVA 3H10A 1GOLA 3CSVA 4CCUA 3P7CA 4CD0A 3FKLA 3LM5A 4I21A 1JKLA 4AOJA 3E3BX 4G9CA 2C3IB 4QYFA 5BVNA 4XG9A 5M4UA 4A4XA 4O7SA 4QP1A 4A9SA 4WOVA 3RGFA 3LVPA 5CNOA 4I92A 2C1BA 3AGLA 4EH7A 4HNIA 1JSTA 4C37A 4N6ZA 1YVJA 3C4EA 3HRCA 4FV0A 4EWQA 2CHLA 1J7UA 2P0CA 3FI8A 2BRNA 3LXLA 1ATPE 3QLFA 4MQ2A 3QALE 4E3CA 3ZM4A 4YZNA 4FF8A 5AX9A 3FI2A 3Q9WA 3JVRA 4IAIA 3PWYA 4BN1A 2V62A 3BEAA 4BDDA 4R5SA 5FDPA 4QQJA 3C5IA 5EQPA 4WA9A 3U6IA 4J96A 3QYWA 3RTPA 2E9OA 4TWCA 3POOA 2FH9A 3QHWA 4O1PA 3MV5A 5FLFA 4IZAA 3WI6A 2VGPA 4W4XA 1GIHA 1Q8ZA 3CXWA 1HOWA 2HOGA 3K5UA 3BV3A 4ITIA 4TKSA 1AD5A 3R7YA 1PMNA 3OCSA 5CX9A 4U3ZA 3QQHA 3VAPA 1ZMVA 4JBPA 2VTNA 3CTHA 4UXQA 5CSWA 4AZEA 2UZBA 1LEZA 1PXOA 4BBFA 1XBBA 4CFWA 4YJQA 4YSMA 3SHEA 4E5AX 4YURA 3PLSA 3O8PA 2FSMX 4Y8DA 3O0GA 2B1PA 5KZIA 3C7QA 5LVNA 2WMRA 1JVPP 4YJUA 4HYUA 3CJFA 1QPCA 3RPSA 4E5WA 4HVGA 3F3ZA 2C3JA 4GL9A 1OKZA 4H58A 4OTRA 5CI6A 3RNIA 4XV1A 4MXAA 1CTPE 4PP9A 5HI2A 3R2BA 3FQHA 3I5NA 2IVUA 3IQ7A 3ZO1A 3HV4A 4CMTA 5GZ8A 1MRYA 4BDAA 4O21A 3OCTA 3QRKA 5DBXA 3RPYA 3ZBXA 4DH3A 2ITPA 4F99A 4OBPA 3DFAA 4BB4A 5A4EA 2W1IA 4Z55A 3MTLA 2V5QA 2J0LA 2OIDA 3F66A 1ZMWA 2RF9A 4U44A 3RINA 4D4VA 4I6QA 2DYLA 3A4OX 4EHEA 4ZTMA 4CQGA 4XG7A 1NVRA 4C2WA 4D2SA 4II5A 3VQHA 3UGCA 5D1JA 1RJBA 2GHMA 5J5SA 3SW7A 5DA3A 1H26A 3FEGA 2BAJA 2WQBA 3LW0A 3UDBA 4I94A 4JG8A 3C4WA 3HP2A 3LFQA 1H0VA 4C59A 4C35A 2OK1A 3AD4A 3E62A 2J51A 2C6EA 4QTAA 4RJ4A 5KMLA 2VNYA 3RWQA 5C8KA 1Z5MA 5IUIA 4DT9A 4PTGA 3HEGA 3GBZA 3IS5A 3PXYA 3R83A 4E26A 4ALUA 3KXHA 4MNEA 3Q9YA 1ZYCA 4EJNA 4F1TA 5HNIX 1T45A 5LMAA 2YERA 3CTQA 2QODA 3T9TA 5KMKA 3QZGA 3ZDUA 2A4LA 3PZHA 3ZLYA 3D7TA 5DR2A 2E9PA 4BKJA 4BIDA 4IX3A 4C3PA 3T8OA 3F7WA 3KK9A 3POZA 2C5YA 4RIXB 3V8WA 1JOWB 3ORKA 5E7RA 3RM6A 4D1ZA 4F9BA 4M0ZA 5EKOA 4JJRA 3EN6A 4GIIA 3Q5ZA 5K4JA 5CU3A 2C4GA 2OJFE 4BHZA 4MD8E 1H24A 3W18A 5L6WL 3PE1A 2QO9A 3TI1A 4FV3A 2J9MA 5CXZA 2PE2A 5HBJA 4BCNA 3LKMA 3DT1A 3O2MA 5AADA 3F3VA 5BQ0A 4NCTA 5BUIA 4BBEA 1F0QA 4S2ZA 4XJ0A 2ZYBA 5CTPA 3Q4CA 3W2CA 3OT8A 5KCVA 2VTLA 3QTXA 4RRVA 3TWJA 3UNKA 1CKJA 2VWIA 1J1BA 3B2TA 5IZFA 3WF9A 4QMWA 2X2KA 3KKVA 4IANA 4GK4A 2EU9A 2RFNA 1FVRA 4FV6A 2YAAA 5EYMA 1ZY4A 2FGIA 4BZDA 4G16A 1PXNA 2ITQA 4ERKA 5LVPA 2BRBA 2CCHA 2GSFA 3E8EA 4F7JA 1P2AA 2FYSA 4RSSA 4C4IA 5TOZA 4YMJA 5IQGA 4I0TA 1UKHA 2WQMA 4WG5A 5FDXA 3R7EA 3IOKA 4E73A 3CD8A 3MPAA 2PMLX 3UVRA 3WZDA 4KD1A 4Y85A 3EQRA 4TNDA 4BWPA 4OUCA 4PUZA 3R9NA 3KMUA 3I0OA 4FSYA 2XK7A 3B2WA 1P5EA 3HDMA 4ZZMA 3R8MA 4HZSA 3NYXA 3OG7A 2ONLC 3VBWA 3WBLA 4AGUA 3PRIA 4BTKA 3GU7A 1H00A 4O7VA 3VHKA 4H05A 5E1SA 4LG4A 2HCKA 5DEYA 2RFDA 3L8XA 3C5UA 3R28A 3EN7A 4JBQA 5ANIA 4FKRA 4YLLA 4BCJA 2XNOA 3PLAE 4DEHA 3F82A 4L67A 4X3FC 3NW5A 5FRIA 1ZZLA 4IW0A 3OW4A 3BLQA 3HECA 2Y6OA 2QCSA 2EUFB 4NWMA 1PMUA 1Q3DA 2R7BA 5BVKA 3GU6A 3NUXA 4XP2A 5CQWA 5E9EA 4KIPA 3MSSA 3L9MA 1ZZ2A 3CGFA 2XVDA 3SOAA 3TNQB 4E8AA 5IA0A 4E4NA 3S2PA 2B0QA 5GHVA 5EQYA 4O82A 3ORMA 3NLBA 4JRNA 5AR5A 4IFGA 2W5BA 3RPRA 2CPKE 3D2KA 2GPHA 1OECA 4BCGA 4G6LA 4YZMA 3QCSA 2GHGA 5LCKA 4JQ7A 4K11A 3A99A 3SXRA 1PXPA 2H6DA 2XYNA 4ZP5A 2YZLA 1ZOGA 4QMXA 4AE6A 4FT5A 5IG1A 2JBPA 4I5HA 3QTUA 3F3TA 1SYKA 1WBNA 4NJ3A 1YOJA 4GV1A 3DAJA 2FVDA 2P4IA 5EYCA 1KWPA 2GTMA 1YQJA 2GTNA 4FSQA 2Y4IC 2OF4A 4LMUA 4ACHA 5HLWA 5CASA 5JGAA 4RJ8A 3VBQA 2PUPA 1OIRA 5DFPA 2PVHA 1ZYJA 2BZHB 4WUAA 4FV7A 5F1ZA 2R7IA 3QC9A 3Q9ZA 4WUNA 3AMBA 3S4QA 4EORA 3D0EA 3IW7A 2LAVA 2I0VA 5I5ZA 2BMCA 3V6SA 2PSQA 1Z9XA 2QKRA 1OL6A 4TWPA 3MW1A 4PDYA 5D9HA 2VV9A 1TQIA 5I0BA 4KBAA 4CYIA 3P79A 3PP1A 4QRCA 5CY3A 3G51A 3QTRA 2F57A 4E4LA 3EKNA 4RIYB 4UN0C 3BE9A 3LFFA 3PRFA 4TWOA 2FSOX 3KXMA 4X3FB 3H0YA 4F70A 2DS1A 1LP4A 4O6LA 5EYKA 1OPLA 3VWAA 2V7OA 3AG9A 4F0FA 3HMMA 5JFWA 3ZHPC 4BRXA 3A4PA 1PRYA 3HGKA 3PVUA 3R0TA 2WTIA 3K3JA 5LVOA 4UWCA 3FBVA 4YNOA 5EW3A 5AR3A 3BBTB 4O7RA 3W2PA 3FC1X 3ZYAA 4RVTA 3MGYA 2NRYA 1OITA 3DBQA 2QOQA 5CVGA 5GJDA 3CBLA 2X8EA 3SAYA 3ZC6A 5CAQA 1VR2A 4DINA 3IK3A 2PYWA 5AIRA 5CAVA 4IAYA 3UG1A 3LMHA 3QTIA 4WO5A 4CZYB 5DGZA 5DR6A 1OI9A 2YM6A 4L00A 1FOTA 4ENXA 4IZ5A 1OMWA 4OGRA 1Q8YA 2QOLA 3HAMA 4LRKA 4IWQA 5F9EA 5M57A 3ODZX 4HOKA 1RE8A 2BTRA 3DAKA 4FV5A 4AFJA 3Q53A 3VS3A 4WD5A 4KIKA 3ALNA 2UW5A 4WG4A 5EDPA 2W1FA 3O8UA 5LVMA 3HVCA 4JG6A 3LIJA 4DYMA 3NMUF 3BEGA 3UO5A 2WMUA 2VX1A 3AC5A 4PX6A 4RQKA 4YNEA 1QPJA 1H07A 2WMTA 5T6KA 3SXSA 3ZONA 4ZTNA 4GJ2A 4I6BA 3O50A 3NVKI 2GNGA 2A0CX 4M15A 2ZV9A 4GT5A 4O96A 3UIMA 2R3PA 5EM7A 4PDSA 4FR4A 4DFXE 3ORXA 2J0IA 1H0WA 3DBDA 3A60A 3QZFA 5EHOA 1R0EA 3SRVA 4MYGA 1PW2A 4I23A 4PL5A 3OBJA 5JQ5A 2VTPA 3NSZA 3WYYA 4K77A 5CZIA 5AV2A 4FE2A 4BCIA 1BKXA 3HKOA 4FVQA 4BCKA 3TUDA 4YZDA 3FL5A 4AZFA 5K4IA 3EQGA 3AC8A 2IW8A 4C3FA 2I7QA 2C0TA 5AA8A 3LM0A 4IWDA 2EVAA 3R8VA 3THBA 1WBPA 3Q52A 3BI6A 2WHBA 5HBHA 1U4DA 1QMZA 4J99A 1REKA 3KF7A 4YZBA 2WD1A 3TIYA 3ZLWA 4C8BA 2XKFA 3KRRA 3ITZA 2O2UA 3QCYA 1T46A 2G1TA 2IWIA 5HO6A 3TV4A 3W10A 5ITAA 4C3RA 5KMNA 5AR4A 5EDRA 2RKUA 5TT7A 2QOCA 5DE2A 3V5QA 3NWWA 2JKOA 4DC2A 5IF1A 3R30A 2VWYA 4RX9A 5ANDA 3ZZEA 2ITOA 3GU8A 4DFUA 4LGGA 4ONAA 2FSTX 4TNBA 1U59A 4X6QC 3C50A 3UIBA 3BE2A 2ZVAA 4EBVA 3FMLA 3FY0A 4N0SA 4ASDA 5KKRC 3EKKA 1OL1A 5L2QA 2BAKA 3GNIB 2C1AA 2OG8A 2XJ1A 2YCQA 3MFTA 5LARA 5DT3A 4MHAA 5E8XA 2J0JA 2GFSA 2ITTA 2RFSA 2O5KA 3MA6A 2QHNA 3AQVA 4HGEA 1WBSA 1YRPA 3NYNA 3IO7A 4WNMA 2PWLA 2HK5A 3NS9A 2WTCA 4Y5HA 3DXNA 4YC8A 4TYHB 2PVRA 5JN2A 4KIOA 3ET7A 3MFRA 3OWPA 4FI1A 4V05A 4E7WA 2ESMA 2W1EA 5HTIA 3QBNA 3N4VA 1UA2A 4L9IA 4EYJA 4IIRA 3RNYA 1BL6A 5C8NA 3ANQA 5C8MA 2IW6A 4ITHA 2P33A 2JGZA 4AWIA 2XZSA 3K3IA 2ETRA 3FV8A 2UW3A 3R7UA 1KOAA 2YEXA 1OZ1A 4LUDA 4RT7A 4X0MA 5HCYA 3V8TA 4F4PA 3TJCA 4C2VA 3A62A 4HCUA 5M09A 2DQ7X 4O7LA 1MQBA 1M7NA 1OPKA 3LFBA 4PDOA 4EZ5A 2YM8A 2IPXA 2J90A 2EXEA 4U42A 3TNHA 4KSPA 4IBMA 3VNTA 3ZO4A 4F64A 4USEA 3O7LD 3LFNA 4G5PA 3KULB 2J6MA 3P1AA 4I5CA 4U5JA 5DG5A 5L8KA 1Q41A 1ZMUA 1KSWA 4FZDB 3BWFA 4AN3A 1UNLA 4AFEA 2XKCA 1OIQA 3AC3A 4OAVB 1OUYA 2QONA 3OP5A 5KKRB 5FD2A 5A3XA 4DAWA 5J7BA 5TKDA 5LWMA 4HVHA 3UOHA 1XH7A 4EH6A 4R7BA 2BCJA 1W83A 2YLEA 4FG9A 4H1JA 4ANOA 3TUCA 5DLSA 3JR1A 4IHPA 3SOCA 4H3QA 1M2PA 2Y9QA 4HVIA 1H28A 4AN2A 5CU0A 2W96B 1XR1A 3L9NA 4ZSGA 2CSNA 2GFCA 3NGAA 3EQHA 3UTOA 4FL1A 3A2CA 4L8MA 3LCDA 1CSNA 2B9IA 2OXDA 4YLJA 3EH9A 5CXHA 3VUKA 3PTGA 4BKYA 3R1QA 1WAKA 2W7XA 3ZUVA 2ERZE 3GFWA 4HYHA 4IADA 1ZY5A 5DT4A 3FAAA 2B7AA 4UEUA 1GZNA 1JAMA 4PMPA 3QQGA 3QXPA 3HMIA 4FTCA 3I6WA 4K9YA 4O7NA 3PE2A 4L3JA 2PHKA 4TL0A 4LOPA 2KULA 4C02A 2Z2WA 3QCXA 3QQLA 4UALA 4XOZA 2XJ0A 5CEMA 2OXXA 3OEZA 2J4ZA 3OXZA 2R3NA 4A9UA 1A48A 5HCXA 4BIEA 5IQCA 1XHAA 3MB7A 3BU6A 4A9YA 1K3AA 2BFXA 2YM3A 5HNBA 3NEWA 4EOIA 4PPCA 1F5QA 4O38A 1Q8WA 1WVYA 4K8AA 4GKIA 2VGOA 3ROCA 1UWJA 2B53A 3R21A 1R1WA 5AM6A 2VTMA 3D2IA 3EN4A 2GQGA 4RLLA 3E8NA 4ID7A 1QPEA 4KKGA 2X6DA 4BDEA 3SV0A 4O81A 1JBPE 2XA4A 4NM0A 5IQDA 1U54A 3WIKA 2VX3A 3FZTA 3PJ3A 5HG9A 4B8LA 4C61A 5F4NA 5J7HA 5CANA 3I4BA 2BRGA 4QMTA 4QP8A 2B9FA 2X81A 3A8XA 3R1YA 5CU4A 3IGOA 3PSCA 5A46A 2C6TA 4X3JA 2QR7A 5CAPA 3I6UA 3BZ3A 4BF2A 3TKHA 5CVHA 2G01A 5CWZA 5AAFA 2JKQA 2Q0NA 3MWUA 5KMOA 3E87A 2QU5A 3IPHA 2JLDA 1BUHA 4GCJA 4XBUA 5CLPA 4A4OA 4AW5A 1CKIA 2X1NA 4PV0A 5JRSA 3KRJA 4FNYA 4G9RA 3EQCA 2HZIA 4CFXA 4DH7A 3U6HA 3BKBA 2V22A 2GU8A 4ZIMA 4EYMA 5M4FA 2HXQA 1E1VA 4BKZA 3F61A 4MXYA 4DGLC 4BICA 2YIXA 5EQEA 2XKDA 2XKEA 3OCBA 2VO0A 4C4FA 1OUKA 2WOTA 3R1NA 4Q5HA 1ZARA 3R71A 4APPA 5CAUA 3S00A 3U6JA 4RA4A 4FKPA 3HV3A 4U3YA 1M2QA 5ANGA 1ND4A 4L42A 3VUMA 5AP7A 4DH5A 3IG7A 4QPMA 1R78A 2PVFA 1MUOA 4NZWB 3MH2A 1NA7A 2XIXA 5KBRA 2ITNA 1GZOA 3R8LA 3NR9A 2CDZA 4XV2A 4YBJA 4O7ZA 2F4JA 3LZBA 4I1ZA 4FEXA 3OT3A 2ERKA 4AOTA 4R6VA 3KULA 3O51A 4FKQA 1DI8A 3VW6A 4PPBA 2WO6A 5FEQA 2Z8CA 5CEPA 4FKIA 1YHVA 2OU7A 3GC7A 2R3FA 3R73A 4O0TA 5J87A 5DT0A 5AP3A 3OY1A 4UYAA 3K5VA 3F2AA 4B7TA 5LCJA 4BYIA 3RZBA 3ZUTA 4F9YA 5E8VA 3MFSA 4XG8A 5HIDA 2HY81 2ETKA 4CTCA 5IISA 3G6HA 3O7LB 4M69A 3KXNA 2R3HA 3TTJA 4ORKA 4FV4A 3UC3A 3RJCA 4FEQA 3QQJA 3MN3A 4NIFB 3FKOA 2X2LA 2OZAA 3FMDA 4BVUA 3P23A 5JMSA 1ZWSA 5L2TA 5LQFA 4F7LA 5CT7A 4KUJA 4MF0A 4MKCA 3RK7A 4RVMA 4BGGA 2JKKA 5K0KA 2YISA 2C6LA 4D1XA 4EL9A 2GS7A 1PYXA 1WBWA 4FK3A 2IN6A 4ZJIA 5TO8A 4ZTHA 4RWKA 2YWVA 3Q6UA 4RX7A 4IB3A 4XHKB 3HMNA 3JS2A 2C3KA 4G1WA 3NUPA 1HCKA 3QF9A 3QQKA 4CQEA 3COKA 3QGWA 5A14A 2ZM1A 4NCTC 5JFXA 4D4YA 5CSHA 4BZOA 3BHHA 2YAKA 3CPCA 5I3OA 4FIEA 1P4OA 4KNBA 4W4YA 3ETAA 3JVSA 2X8DA 3COMA 5G1XA 3UPZA 1JWHA 2AUHA 2CCIA 3UMXA 3W16A 2GMXA 4R1VA 2CGXA 2QD9A 3IW5A 3Q4ZA 5ETIA 3TACA 3TKUA 4NT4A 5CALA 2R64A 4WG3A 1OKWA 2BIKB 4O7YA 4R7HA 1H4LA 1OM1A 3GCQA 3KXXA 3PJCA 1YHWA 2PMIA 2YIYA 3Q3BA 3PY3A 3QKKA 4YJVA 2W4OA 3E7OA 1OKVA 2CKPA 3D15A 4HYSA 3MVJA 5FXRA 3ANRA 5HQ0A 3BPRA 1WBVA 2VNWA 5CI7A 5B2LA 4H3BA 4P2KA 1TQMA 2XBJA 4MNEB 1XQZA 5JFSA 2QKWB 4YR8A 3GQIA 3RALA 4BTFA 4BCFA 4AACA 3P0MA 5KZ0A 4QMQA 2IJMA 4O0YA 2Y7JA 4ZSAA 3VBYA 4CFFA 3D14A 3I7BA 3D7TB 1M17A 2BUJA 4FKOA 2R4BA 4BBMA 1GIIA 5CNNA 4WBBB 3OEFX 2YDIA 4Y5QA 5AP2A 3SXFA 1KE9A 4MAOA 3MH1A 5IH6A 1NW1A 3O71A 4HPUE 3TCPA 4D5HA 3A61A 3MVMA 1DAWA 4IJ9A 1H01A 4P5ZA 5BYYA 1AQ1A 2CKOA 4BR3A 3DNEA 3NX8A 4L53A 3TIZA 3LQ3A 5ANOA 2BKKA 4IB5A 3UBDA 2E9UA 3N9XA 1VEBA 5KO1A 3OCGA 1MP8A 4GUEA 4L7FA 3GCPA 4I6HA 2XS0A 3TKIA 1SNUA 2R2PA 4FSRA 3CPBA 4D4RA 2I40A 3MBLA 5EH0A 4AUAA 2XNPA 4FVRA 2R0IA 4I41A 2E9NA 4NM7A 2IW9A 4C0TA 3KC3A 2GS2A 3COIA 4FNXA 4J52A 3VUGA 2V7AA 4EKLA 5HU9A 5EHLA 4UYNA 3V5LA 5FTQA 5FWKK 3VUHA 1UU8A 3EYGA 1Z57A 4YHJA 4MD7E 5K5NA 1V1KA 3NZ0A 4DCAA 4UBAA 4D4SA 5J9YA 1OL5A 5JK3A 1YXXA 2UUEA 4BWXA 4MXOA 4J1RA 3DGKA 4UMQA 1XH8A 4HGTA 3PIYA 4S31A 3R7VA 2CJMA 5JFVA 4FNWA 3EHAA 4Z3VA 4EQMA 4UV0A 3AC4A 1SM2A 5K9IA 4N57A 4J7BA 1YWRA 4JR3A 2ZMDA 3WILA 4EOLA 4D9UA 2VTRA 4EOOA 4NIFA 2C47A 3DB6A 5HESA 4IZ7A 3VO3A 1W7HA 2YABA 3AXWA 1FGIA 4FTRA 1FQ1B 3PSBA 3FLQA 2WNTA 2C3LA 4EH4A 5KHXA 3CGOA 4G31A 3MTFA 4DEAA 3DKCA 5D10A 4F7SA 3GOPA 3GC9A 3EQDA 3GVUA 2YZAA 5L4QA 3CKXA 5EK7A 3QRJA 4JLCA 4F08A 4OLIA 4YO6A 2XK4A 3UYTA 5GIPE 3FMJA 2XK8A 2B9HA 2A2AA 4K0YA 3W2OA 1Y8GA 1L3RE 3MFUA 3V6RA 3Q60A 5AAEA 1M7QA 3QX2A 1UU9A 4FSTA 4J98A 3E5AA 4QPSA 1G5SA 2OICA 3BQCA 1GIJA 2W9ZB 2CGUA 3KN6A 3L1SA 5EKNA 1FPUA 3FPQA 3I60A 1STCE 4O0RA 4HNFA 1PKDA 1Q4LA 2EB3A 5CZHA 3ZFMA 2WU6A 4FKVA 1FVVA 2OGVA 2R3GA 3EQPA 4IX5A 4A9RA 5E8TA 1PXIA 4AT3A 3MA3A 3ZEWA 5M56A 3LFDA 4FSUA 4I5PA 4XEYA 2ITWA 3VN9A 2NRUA 3PXQA 4K1BA 1KE6A 3HRBA 5LOHA 3UQFA 5M06A 1SVHA 1W98A 3OZ6A 5CT0A 3MY1A 4C34A 3OTUA 2IVSA 2GNLA 4CCBA 2YDJA 4I3ZA 4D0WA 1E9HA 3AMAA 3C4FA 5IQHA 5GJGA 2BALA 2XUUA 3V01A 4AGDA 1WBTA 4USDA 4NYEA 4C7TA 4FTAA 4QMSA 3QRTA 5H8BA 3UQGA 4EH9A 3UOJA 2R5TA 2W5HA 2R3IA 2WELA 3BX5A 4GK3A 4LGDA 4ZMFA 1QL6A 4CNHA 3R8UA 2WTJA 2JC6A 3DK3A 4BCMA 2VTSA 2VX0A 4FT0A 4N6YA 4YJTA 4U8ZA 3LFSA 4FX3A 2BPMA 3LMIA 3RAIA 1WZYA 3DU8A 3OW3A 4FVPA 5HIEA 4EOJA 2C0IA 4EQUA 5EYDA 3P7BA 1JSVA 3D4QA 3FXXA 4LUEA 3D7ZA 3ZSHA 3C51A 5L2IA 5AUXA 4M3QA 3V5PA 4HVSA 4AZSA 3GGFA 4LRMA 4ACGA 2QU6A 4EOPA 5TF9A 3FLSA 3MYGA 5HE1A 4FTKA 1XO2B 1B39A 4DEDA 3UIXA 2JDVA 3EL8A 2UW9A 3F5UA 4Q5EA 3R22A 4QOXA 4YBKA 3A7FA 2B4SB 4QMPA 5AP6A 2PMNX 4CXAA 3HA6A 4CVAA 4NH1A 4Q9SA 1Q8UA 3TZ8A 2V55A 3QRUA 4TN6A 3VF8A 2WMWA 3G33A 2UW4A 3R8PA 4X21A 4DHFA 5DEWA 3TV6A 4AZWA 1LEWA 3KF4A 3D94A 5CF6A 2BDJA 3FLZA 4ZTLA 3P86A 4KIKB 5EM5A 4B6LA 4YU2A 4PF4A 3U87A 5FBNC 4IAZA 2QOFA 2AC5A 4NW6A 2CGVA 3OD6X 4B4LA 2QOOA 3P9JA 2QOKA 5JRQA 1W8CA 4R8QA 4XBRA 3EOCA 4G3DA 4RGJA 5HE2A 4S33A 4NSTA 3ORIA 4EK3A 3CD3A 2R9SA 2W1ZA 2W9FB 2WMVA 2PL0A 2J5FA 3MIAA 4Y95A 4EEVA 2PVMA 5M55A 3QZHA 3KVWA 5AUZA 3ORLA 2XNEA 4HVDA 4I20A 5FTOA 4FGBA 2JFMA 4W9WA 4E5BA 3VQUA 4RC2A 3RZFA 2QURA 3ATTA 4GIHA 2XYUA 4X2KA 4DLIA 5IA3A 4EOSA 4EOMA 4C4JA 3SRVB 4CLJA 3BV2A 4O0SA 3SD0A 3OFMA 2Q83A 3ZEPA 4IDTA 5HTCA 4X2JA 2QOBA 4RFZA 4FTLA 4LFIA 4GFGA 2HWOA 3OY3A 3UJGA 4KA3A 4F63A 4V04A 4ARKA 2XH5A 4MD9E 3QCQA 5H3QA 2O8YA 1XWSA 3FHIA 3LLAA 3OVVA 3QX4A 3DZQA 5HX8A 3UOKA 2F7ZE 3HLLA 3NVMB 4PP7A 4ANNA 5FEDA 3DFCB 4AA0A 4RJ7A 2GNHA 3FI3A 2ZDUA 5GZ9A 3BIZA 5CENA 4AW0A 4EK8A 3OUKA 5CU6A 5AP1A 4IWOA 2CN5A 3I81A 4BI2A 3KXGA 4JDHA 3R1SA 4M97A 3DLSA 2ITZA 5EDQA 5HKMA 3DK7A 5DNRA 5AV1A 1W84A 5B2KA 4QMNA 4D5KA 5FM3A 5CSVA 4FUYA 5KHWA 3ORPA 4Z9LA 5CVFA 4BDJA 2QG7A 1O6LA 5H9BA 4ZJVA 3ZOSA 4YZCA 4MXCA 2Z7SA 5GZAA 4BCPA 4Q9ZA 5AV4A 2WTVA 5E8WA 5J79A 4DH8A 2C5VA 3ORNA 2YM5A 5J8IA 4F9AA 5HGIA 5CEKA 2WKMA 4KRDA 3D83A 3H0ZA 3MJ1A 4BCQA 3DBEA 3RWPA 3UP7A 3V51A 4CYJA 4L43A 4GH2A 4IX6A 4TZRA 4CEGA 4L7SA 3Q96A 4ZLOA 4YJSA 1YI6A 4PL3A 1YXSA 2HY0A 3GQLA 5TE0A 5JEBA 4Y83A 4MTAA 3KXZA 4OTPA 4BY9E 2X7GA 4GEOA 4JNWA 1Y57A 4EHVA 4DBXA 4EK6A 1CMKE 3TT0A 2BZJA 4AG8A 4YJRA 1YOLA 2UW0A 4MEDA 5KX8A 3EFLA 4O1OA 3CS9A 2DUVA 3VS0A 2W0JA 3CJGA 3QQFA 3AT4A 2XK9A 4C36A 4G17A 4X7QA 4MCVA 4ASXA 4TPTA 3FMHA 1K2PA 1BL7A 1RQQA 3PJ2A 4IX4A 4PL4A 4ZSEA 3PXRA 2OKRA 5A54A 4L44A 3DDPA 4QYEA 2XCKA 3NCGA 3KRWA 2WTKB 4V0GA 4FTUA 4F09A 3ZUUA 2B55A 4G5JA 4CFVA 3QGYA 3R7OA 3VW8A 2RL5A 4RIWA 3VVHA 5KBQA 3PDTA 1J7IA 4WNOA 1H1RA 3ENHA 2ZB0A 3QQUA 3N4TA 2R3KA 3DNDA 2PVJA 3GC8A 4H39A 3UO6A 1I44A 4GYGA 4JVGA 1LR4A 2I0HA 4IAFA 3FMMA 4FKGA 2YJSA 1JPAA 2GQRA 4QMLA 4JG7A 1OPJA 5EM8A 4JR7A 4E4MA 3WARA 4BTMA 4EC9A 3CLYA 3ZZWA 1OL7A 4JL9A 4S34A 2VD5A 4C62A 4L6QA 4QQTA 2SRCA 1UNGA 4CZTA 5I9WA 4IACA 3DQXA 4TWNA 3WF7A 4YSJA 4UWBA 3H30A 4F65A 5J5TA 3S3IA 4D2TA 4APCA 3JY0A 4DG0E 5CS6A 5J1VA 2B9JA 5HVJA 2O63A 2EB2A 4JBVA 2OZOA 4MK0A 4GUBA 5GJFA 4CT2A 2HXLA 2PE0A 2UV2A 2UZOA 3HX4A 3KRLA 4BYJA 2VWUA 2YJRA 4E6DA 4RPVA 3LCTA 4NM5A 5HO7A 4KINA 2OH0E 2VWVA 4G3FA 1YOMA 4I5MA 3LPBA 2FSLX 3FYJX 2XNMA 3LHJA 3FL4A 4RX5A 2A19B 3QLGA 4BDCA 3PSDA 4TYIA 4UXLA 3TNIA 3H9RA 5IH5A 4PQNA 1V0PA 4ZSLA 4OBQA 1TKIA 2X9FA 1L8TA 4K18A 3OUNB 4UY9A 4B9DA 4DH1A 4DFZE 4EI4A 5DOSA 3ACJA 1VJYA 4A9TA 4DEEA 1O9UA 1U54B 5C4LA 3ZRMA 3LQ8A 4E6AA 2QC6A 1PXLA 1FINA 4P5QA 1JQHA 1YW2A 3UZPA 2R3RA 4GW8A 3VBTA 4E6QA 5M07A 4KBKA 4QTEA 4BDKA 4KKHA 5E8ZA 3EQFA 2PE1A 2ZM3A 5JQ8A 2XK6A 5AUYA 3QFVA 1XH4A 4ZTQA 5JGDA 4L46A 3I7CA 5JT2A 3UOLA 2KTYA 3FYKX 5E8UA 2CMWA 3OXIA 1G8AA 3I1AA 3BGZA 2X39A 4WHZA 4FTQA 2UZVA 4QD6A 4FV8A 4FTIA 3FY2A 4PTCA 5DI1A 5IUGA 3BHUA 3QZIA 4FSMA 5IEVA 4ERWA 1YWVA 5FUTA 5IQBA 2VTOA 3FWQA 3V3VA 1WCCA 4NFMA 3D5WA 3FMEA 3MS9A 2XM8A 3M11A 3TV7A 3K54A 5I9ZA 3U8WA 3HMPA 4G6NA 3ZFYA 3WZUA 2H34A 2FB8A 3PY1A 1JKTA 2W4KA 4QYGA 4FOCA 2J0MB 3VS1A 3PG3A 1XBAA 3TXOA 3WYXA 3G9LX 4FTOA 1OB3A 4AXAA 3BHVA 1PJKA 3I0QA 3LXKA 4I22A 3A7GA 4QQCA 4YHTA 4DTAA 3H9FA 1SMHA 2VO6A 1H25A 2BR1A 4RC4A 4FKLA 4L01A 2ITUA 1APME 4OR5A 5AR2A 4FC0A 4UMRA 3NUAA 1B6CB 5EI2A 1J91A 2HZNA 4WNPA 2YDKA 3QUDA 2V0DA 3TNPC 4ZZNA 5C4KA 3BU5A 3E7VA 2W1GA 5CU2A 2WQNA 3UE4A 1CDKA 5CSPA 4LOOA 3UNJA 3UODA 4DEBA 3DXQA 1KV1A 2EXMA 4YZ9A 4G3CA 2XIYA 1P14A 3IDBA 4FIGA 2PVNA 1AGWA 3C4XA 4P4CA 4RWJA 4M69B 3QD4A 1Y6BA 4PNIA 5FP5A 5I9UA 4IVBA 4ZSJA 2VTTA 3BGPA 4FZFB 4D55A 4FL2A 2OZAB 4FZ7A 3QA0A 4O22A 5CSXA 4UMUA 2R3JA 4LL0A 4ZZOA 2FUMA 3VUTA 5IQEA 3GC0A 4UWYA 4M68A 4ZY4A 4ZS0A 5IMXA 2C6OA 3WIGA 3LOKA 1HCLA 4XV9A 2WFYA 4P7EA 3FZPA 4JQEA 4Y46A 5A4TA 5KMMA 3GB2A 3TUBA 4EHZA 4FZAB 5J1WA 5L8JA 4RJ6A 4YJNA 2GHLA 3LJ0A 4C33A 3RI1A 4EONA 4IH8A 2PZ5A 3FMNA 3D5UA 3M42A 2BROA 2XIZA 5CF4A 2YCFA 3R02A 3C0HA 4GU9A 2WB8A 2UZDA 5HE0A 3PXKA 3SVVA 3QXOA 5JH6A 5EOBA 4ZK5A 3DV3A 5DVRA 2WMAA 4NU1A 3KFAA 4U80A 4C38A 2XNGA 2BHHA 4H36A 4FGRA 3BQRA 4DG2E 3TZ9A 3ID6C 4FKJA 3HMOA 1OVEA 2A1AB 4DLJA 1CKPA 3VF9A 1FMOE 4F1MA 4ZY6A 4C58A 1DI9A 2VO7A 2FO0A 2JD5A 2OXYA 3DCVA 1IR3A 2YCSA 3ELJA 1XJDA 2PTKA 4AA4A 2WXVA 2BDWA 5H2UA 2BKZA 4ASEA 3KREA 3G6GA 3EN5A 2OJJA 2XIRA 3AT2A 4MVFA 4U97A 2I0YA 1NT2A 1ERKA 2REIA 3O17A 4IAAA 5DR9A 1NVSA 3L8VA 5AWMA 3SX9A 4QPAA 3W2SA 3PYYA 2BVAA 5GNKA 5K0XA 3KK8A 3FKNA 4HYIA 4HGLA 4O27B 5D41A 3JY9A 5FBOA 4AW1A 2W1HA 1H8FA 2W05A 2YIWA 4NW5A 5BNJA 1G8SA 2WIHA 3QA8A 3OBGA 3ROYA 4BDGA 1UVRA 2PZRA 3KN5A 4GU6A 5C26A 3S0OA 2H9VA 4BHNA 4PNKA 2CNQA 5GIOE 5AUWA 4IB0A 4TRLA 2XCHA 2XNNA 4FEWA 4R3RA 3OMVA 5ACBC 4IZYA 3M2WA 5ANJA 1ZYSA 3RM7A 3PA3A 5EHYA 4TYJA 4ZTSA 4FG8A 2J50A 5IA1A 2P55A 2PZYA 4XX9A 3BYUA 2Z60A 3N51A 2HAKA 2X2MA 3U4UA 4DGOA 1R39A 4QP6A 2B54A 4V01A 2JIVA 2C6IA 5TR6A 1OIYA 4NFNA 3SGCA 3BHYA 1YXUA 3OWJA 5IQAA 4ANBA 2UZNA 1DM2A 3MY0A 3DOGA 4O0WA 4BDHA 1PMEA 4K6ZA 2JDRA 3FLYA 4JX3A 4AF3A 4XP3A 5I9VA 5BX0A 4WIHA 2HW6A 2H8HA 5E92A 4QP9A 3FI4A 4XYFA 4M67A 4ZS4A 3M1SA 3ZXZA 3C0GA 2QO7A 2R3LA 1BI8A 1Q8TA 3OROA 2UVXA 2RFEA 4FTMA 3IOPA 4FV1A 3CIKA 4GG7A 4XH6A 1GAGA 3CEKA 2WIPA 4BI1A 5AAGA 2JKMA 3IDCA 4BFMA 3MB6A 3OWKA 3E63A 3ZO3A 3HP5A 4AZVA 5AR8A 3P4KA 2QVSE 2GNIA 2QG5A 2UVZA 2ZJWA 4E1ZA 5JKGA 1KUTA 2F7EE 4KKEA 4L45A 5I3RA 4GYIA 3QTWA 3EFKA 4AT5A 3Q2MA 1RDQE 1H1PA 1Y91A 2W5AA 2JITA 4YTFA 1Y6AA 4OBOA 5CEOA 1DAYA 2R3OA 2ZDTA 1W82A 3QD0A 2OWBA 4JBOA 4USFA 5B7VA 4ACMA 1H08A 3W2RA 5L6PA 5IDNA 5ICPA 3WZEA 1LPUA 2OLCA 2C30A 4DITA 4L3LA 4R78A 3RAKA 4FT3A 3G0FA 1YKRA 3CTJA 4CV8A 2UW8A 4I4EA 3GUBA 3ZU7A 3U9NA 3V5TA 5J9ZA 4BDFA 3IW8A 3NPCA 3QYZA 2YACA 4FK6A 3MIYA 3FPMA 4RFYA 2J7TA 4XV3A 4O91A 4MQ1A 5L8LA 3CR0A 1ZRZA 2JBOA 3EFWA 3Q5IA 4FTNA 4GVJA 4A4LA 4AX8A 4EH2A 5CF5A 3PVGA 4IC7A 1URCA 2GNFA 2QQ7A 4MBJA 4QO9A 2W17A 4UMTA 1MRUA 3FJQE 3FMKA 3C4ZA 5EW9A 3WE8A 2YLFA 4FMQA 4EH5A 4EUUA 3GXLA 5FG8A 3DTWA 3R01A 2Z7RA 4JX7A 4YTIA 2JEDA 2ZOQA 4MX9A 5HVKA 4IXPA 5M08A 4AW2A 5D7VA 5IMEA 4F6SA 4AN9A 4FEVA 4JIKA 3Q4UA 1BLXA 1ZYLA 3E8DA 3F3WA 1UNHA 5E90A 5HG8A 3T3VA 4ANMA 4D9TA 2BHEA 2BRHA 2Z7LA 1GZKA 4ZOGA 3HV6A 1Q99A 5IEYA 3LJ1A 4DA5A 3RKBA 3EZRA 5BVWA 3DKFA 3F5PA 3MI9A 2BRMA 1H1QA 2JAMA 3QKLA 5AUVA 4XG2A 3BHTA 4DFLA 2HZ4A 4IEBA 4CRSA 3LFAA 5LMKA 4S30A 1J3HA 5L2WA 4X2GA 3TNWA 3ZCLA 3F88A 4C57A 4BWKA 5EM6A 4R7IA 5IA2A 4CFMA 4RVKA 3H4JA 2IZSA 4F9CA 4D1SA 5M53A 4E93A 2X6EA 2OIBA 5KMJA 5D12A 4O83A 4XCUA 3LCOA 3ACKA 4JIAA 3IGGA 2WU7A 3RPOA 1UKIA 4IM0A 4JXFA 4XS2A 3EIDA 4QMZA 2I1MA 3PPKA 3NAXA 1ZAOA 4NKSA 4XRJA 2BZIB 4OTHA 2C5OA 3Q04A 5GINE 1Q5KA 1TVOA 4GFMA 2HW7A 3FXZA 3R9HA 1ZYDA 1SZMA 3MDYA 2OW3A 3L9PA 3RK9A 4KWPA 5C1QB 2X7FA 2EXCX 4N4SA 5K3YA 3VJOA 4IQ6A 3ERKA 4D2RA 3BBWA 3Q6WA 3NYVA 4DGMA 5BVFA 3WF6A 1R3CA 3Q4TA 3UVPA 4BI0A 3PXFA 5IA5A 3RBWA 5I4NA 3AOXA 2X4ZA 1V0OA 1H1WA 2OO8X 3DS6A 3DZOA 4ALWA 4EC8A 3DTCA 4JDKA 3SKCA 1M52A 2XEYA 3MPTA 3OWLA 4A06A 3HAVA 3VBXA 4LGHA 3ZS5A 5AV0A 3VS7A 2OIQA 4HCVA 3DJ6A 2WOUA 1ZLTA 5E4HA 5HLNA 5IDPA 4PTEA 4PWNA 4YO4A 3IDPA 4NM3A 1SVEA 1H1SA 3FZOA 4XP0A 4Z7GA 4AQCA 4NUSA 5HD4A 3L8SA 3DLZA 3DBCA 4FKTA 4ZXTA 3RVGA 4TXCA 3VJNA 5FEEA 3ZH8A 3GU4A 4JAJA 3OOMA 4O86A 5JSMA 3P08A 5M4CA 5JZJA 1URWA 3TDVA 4GJ3A 2O65A 3G2FA 2CN8A 4RX8A 4IJPA 2VTJA 1Q24A 1K9AA 2PVKA 4XLIA 2PZIA 4ZJJA 3LXPA 3PVBA 5CYIA 4RG0A 3R7IA 3VUIA 3ZLXA 4FZ6A 3CKWA 3PJ8A 4QNYA 4IC8A 3BRBA 3NUYA 2NO3A 2AC3A 5G6VA 4CLIA 3E3PA 4EKKA 4YHFA 3HA8A 4PMMA 5BUEA 3DKOA 4CGAA 4CG9A 4FIFA 5E8SA 4B8MA 2W1DA 4D0XA 5AFVA 4JDJA 5DRBA 2RG6A 5KUPA 4XOYA 5HICA 4OTDA 3BYMA 3F5XA 4QQ5A 4TT7A 5ACKA 3UVQA 4ZEGA 1OIUA 3UYSA 3A7HA 4OT5A 3CQUA 4CFUA 1IRKA 3NCZA 2ZB1A 4WBOA 3AC1A 3SW4A 4FODA 2QOHA 4FIHA 3HUBA 4YTCA 5HOAA 2HWPA 3REPA 5IH4A 1IAJA 3C13A 3TDWA 3QAME 4LL5A 2OBJA 3QWJA 4A7CA 2VAGA 3BLHA 4XLVA 5KE0A 4ACCA 1PMVA 1Q3WA 3RHKA 3UPXA 3QC4A 3NIEA 2JAVA 2IZUA 3EMGA 3R6XA 5T68A 4DN5A 2PVYA 2WMXA 4LQMA 3I5ZA 3TG1A 3TEIA 4CG8A 3VS4A 4JT3A 2C5XA 3FHRA 3VBVA 4DFNA 4XG3A 1BYGA 4ZLYA 3F5GA 3QTQA 5DPVA 3ORTA 2XP2A 4OT6A 2PULA 2OH4A 3SA0A 5AUTA 3KL8A 4DBNA 4EBWA 2XB7A 3QUPA 2HELA 4GT4A 4BZNA 3UIUA 4QMUA 5AEPA 5DMZA 3BCEA 3EB0A 2CLQA 4QT1A 4LM5A 1JKSA 2YA9A 3NUNA 4Y72A 1NY3A 4NTSA 4R3PA 4O2PA 2WQEA 4JOAA 4IMYA 5AA9A 1J1CA 4I6FA 4JQ8A 4D2PA 4YPDA 3JUHA 4J71A 4C4GA 4CKJA 4M13A 2G15A 3ZTXA 2HZ0A 4IB1A 3CY3A 4ANLA 4FTJA 3PIXA 3DJ5A 2C6DA 5FXSA 3EN9A 3G0EA 3GI3A 2PU8A 1GY3A 3ZSGA 4CMUA 4O0UA 1Y8YA 3HDNA 4U43A 4GK2A 2ZM4A 4FEUA 3PFQA 2QI8A 4YGAA 5CEIA 3RK5A 3FUPA 4CZUA 4G3GA 3ZRLA 2PZPA 2Z7QA 4V0GB 5EG3A 1IG1A 3G15A 4KB8A 2ZAZA 4MF1A 4PMSA 5HLPA 1OBDA 2I6LA 1V0BA 3KEXA 4FKSA 4H3PA 5LMBA 2YCRA 4TTHB 2WQOA 3ZDIA 2G9XA 4MBLA 4RIWB 5HO8A 3DBFA 3BGQA 3E92A 4XMOA 3LFEA 5ETCA 1KE5A 1XH9A 2PVLA 4M8TA 2OJ9A 4I93A 3FQSA 3S1HA 4DT8A 4CRLA 2JDOA 3WZKA 1FVTA 2FA2A 2OI4X 3CP9A 1UU3A 3GOKA 3DPKA 3LQ5A 4EH3A 3HV7A 5K5XA 1JLUE 3BYOA 3TM0A 1RW8A 4NKAA 4QTBA 3VUDA 4F7NA 4KBCA 2OJGA 4UB7A 3UP2A 2XM9A 3FZRA 3WF5A 4TW9A 4ASZA 3EYHA 3CY2A 4J97A 3VS2A 2F49A 3WF8A 3R9RA 2ZMCA 2X7OA 3PP0A 4AP7A 4EUTA 4PY1A 5HVYA 2G2IA 2UW7A 3SQQA 4HGSA 4AAAA 1IEPA 1XH6A 3R2YA 1YI3A 4ENYA 4M12A 3FSKA 4C4EA 2IO6A 4U81A 2DWBA 4F9WA 4DGGA 1WVXA 2XF0A 2X0GA 2XK3A 1EH4A 3KCKA 3QUEA 4J8MA 4B99A 4GS6A 4AS0A 2W99B 4ZTRA 2ZV7A 5E8YA 2WTKC 2ZV8A 4EZ3A 3PG1A 3DXPA 5AMNA 3JYAA 5A6OA 3F9NA 4UX9A 3QTSA 4IAKA 2GNJA 3OXTA 3P78A 4FSWA 4AT4A 5M4IA 5H8EA 3O8TA 2F2UA 1P4FA 3IKAA 3R7GA 5HTBA 3AGMA 4D28A 2B52A 1KOBA 3GCSA 1YDRE 1A06A 3QD3A 1VZOA 3DJ7A 4RJ3A 4LRJA 2WZJA 5AV3A 3R8ZA 1OL2A 5BYLA 3U54A 3MVLA 1MQ4A 4D2WA 1GJOA 4ZAUA 3R63A 3RAHA 3SC1A 4ITJA 3HRFA 3VRZA 4GRBA 1S9JA 2X9EA 3NAYA 3OC1A 3LFCA 5CQUA 3GENA 3MJ2A 4QMYA 3W33A 2QHMA 3HV5A 4YJOA 2PUUA 3QL8A 4WNKA 4AGWA 3TJDA 4FSNA 4OTIA 4PMTA 4Y73A 4FV2A 5HCZA 2XBAA 3BYSA 5HHWA 4IM3A 3W55A 3LCKA 4EWHA 4HW7A 5HIBA 3S95A 5IQFA 1R0PA 4RIXA 4J8NA 3A7IA 5JZNA 3ALOA 3I79A 1F3MC 2IZTA 2P2HA 3EZVA 3NNXA 1UV5A 4IWPA 3NNVA 5C27A 4DTKA 5M51A 2IZRA 3AT3A 4FSZA 3NYOA 2YM4A 3NW7A 4E4XA 4YJPA 2VTIA 4DG3E 3H3CA 5E1EA 3QKMA 2CNUA 5C9CA 3G90X 3P7AA 2ITYA 4Z7HA 2RG5A 2YITA 2XIKA 3BYVA 5LWNA 3NIZA 1YDSE 2IVVA 3VIDA 2GQSA 3IONA 4FBXA 1VYWA 3D5XA 2UW6A 2HYYA 1BMKA 3O96A 4W8EA 2PUNA 2UZUE 3NW6A 4OTGA 4RC3A 4RLKA 4YC6A 4KIQA 2R3QA 3JXWA 4GSBA 2WMSA 1U5QA 3DQWA 4QP7A 3V5WA 4WSYA 2F7XE 3W32A 2GDOA 3B8RA 4O0VA 4EOKA 1VYZA 2PUIA 3OF0A 2QLUA 2QNJA 4S32A 5EI8A 1Q62A 1SNXA 4O84A 4BCOA 2J0KA 2VRXA 3SDJA 2IG7A 3F2RA 4L68A 4GKHA 4ZLZA 3KB7A 5ANEA 5BVEA 3MH3A 3ZFXA 3GCUA 4B0GA 2J5EA 3OTVA 4R77A 2Y4IB 4IVDA 4F6UA 5L2SA 3SLSA 4FL3A 3NRMA 4G34A 2OJIA 5J95A 2P3GX 3PXZA 5L3AA 3Q2JA 4ACDA 4D58A 5LJJA 1WBOA 3QU0A 2Y0AA 1KE7A 4RJ5A 4IDVA 3ZBFA 4EK5A 4CT1A 3II5A 4YLKA 4O0XA 4CFNA 4IM2A 5A4CA 4OAUC 4ZMEA 2XRUA 4IVAA 4FIIA 3LXNA 4LYNA 5AIKA 1U5RA 2VTHA 1YXVA 5AP5A 3ULZA 5ANKA 5LXMA 3TL8A 5F95A 4FYOA 4U45A 1E1XA 3PUPA 3C9WA 4FG7A 3B8QA 1OGUA 3OS3A 4RWLA 4W9XA 4BCHA 5BUJA 2BZKB 3U9CA 3DKGA 3GU5A 1A9UA 1XH5A 4ANQA 3KCFA 2XRWA 5DIAA 3NNWA 3R00A 3F69A 4JI9A 3CE3A 4E6CA 2BDFA 4BGHA 3Q32A 4MH7A 4DTBA 2VWBA 1B38A 5FTGA 4MWIA 4XRLA 3U55A 1Q61A 3EFJA 3QHRA 2C0OA 4QYYA 4WRGA 4FA2A 5HEZA 3ZSIA 3UQCA 3PPZA 5B2MA 2NP8A 4KS8A 1W0XC 2CGWA 4DE4A 5HZNA 5DYJA 3NNUA 4X2FA 3ZC5A 4QNAA 3NUSA 4H1MA 4NTTA 3UMWA 5AP4A 3COHA 2XJ2A 2XMYA 5BVDA 4CKRA 2O3PA 4LV5A 4EHGA 4X6RA 3FDNA 2Y4PA 3W8QA 4AE9A 5A9UA 4WT6A 4UZDA 2QOIA 3IW4A 3KRXA 4I0RA 3IECA 4KABA 3E93A 4OTFA 4W4VA 3UZRA 2JIIA 4FIJA 3IW6A 3G9NA 2ONLA 4NJDA 3V8SA 3L8PA 3ODYX 3TZMA 2Z02A 4BC6A 3A7JA 2HENA 4U9AA 5DRDA 4J95A 2YHVA 4EJ7A 5FQDC 3WOWA 2XNBA 3CQEA 3MPMA 2NPQA 4K2RA 4PPAA 2W1CA 2ETMA 4R1YA 3WE4A 2E2BA 4CKIA 4BTJA 4RIYA 2VZ6A 4X3FA 1PY5A 3CC6A 4AA5A 2WGJA 4DGNA 4MNFA 3MESA 3LJ2A 2WMQA 1BI7A 3ZO2A 3PA4A 3N4UA 1DS5A 4F0GA 5IKWA 4N70A 3RAWA 3BELA 1Q97A 3FZSA 4FYNA 5HE3A 2UZTA 5A4LA 4HPTE 4W8DA 4XNEA 2QO2A 5BMMA 1ZOHA 5FXQA 3ZLSA 3H9OA 5IEXA 3ZXTA 3HNGA 2I0EA 2VO3A 3VRYA 2PPQA 2WTDA 2OF2A 1YDTE 1FBNA 3SG9A 4DCEA 4CSVA 4EK4A 4IE9A 4O7WA 1TQPA 3U51A 2JIUA 4LMNA 4QTCA 4CV9A 4OTQA 1REJA 1KE8A 4HCTA 4X2NA 3VS5A 1IAHA 3SG8A 2JDTA 4UZHA 4DFYA 5HU3A 4KRCA 3EL7A 4BL1A 4U41A 4FUXA 3AD5A 2WPAA 5ETFA 5IUHA 1PXJA 1SVGA 2OFVA 3T9IA 4L52A 1LUFA 3KA0A 4QYHA 3HZTA 4L3PA 3ZRKA 4WRSA 3V5JA 4E20A 5C03A 2A27A 3CCNA 4FKUA 2VTQA 5ETAA 3ZMMA 5HX6A 1J7LA 1IA8A 3F6XA 4NEUA 1PHKA 3DAEA 4YC3A 2VUWA 3MVHA 3E64A 3TN8A 4TY1A 2X8IA 5HG5A 4MXZA 1UU7A 5FGKA 4MBIA 5LMKC 4QP3A 3KY2A 4AGCA 5BMSA 1QCFA 5DWRA 5IQIA 4FICA 3ZM9A 2C69A 1M2RA 2VWWA 3O23A 2W06A 3AD6A 4W4WA 3PA5A 3TTIA 5HD7A 5D11A 2UZEA 4GG5A 2Y8OA 4HZRA 1PKGA 2PY3A 3A8WA 3LLTA 5AR7A 3LE6A 2WAJA 4WKQA 4R3CA 2ITXA 2OFUA 2VN9A 1PXMA 3G5DA 3DB8A 4M7IA 4WSQA 3BLRA 1IASA 3GT8A 2VTAA 4GVAA 3KVXA 4U40A 5AX3A 4QMVA 1CM8A 2YWPA 2C5NA 4PDPA 2G2FA 2UZLA 3W1FA 4O7TA 5AJQA 2G2HA 3C1XA 4RWIA 4RVLA 3AMYA 1PXKA 2YM7A 3KGAA 5AM7A 2BIYA 2CLXA 1ZOEA 3EJ1A 3F3UA 4RZVA 4AU8A 4RIOA 2YN8A 3E88A 2RGPA 4JDIA 1YHSA 4I0SA 3PWDA 4BDBA 4EOQA 1O6YA 3KU2A 4DF3A 3FLWA 3FC2A 4F0IA 4IVCA 4HJOA 3RCJA 3RHXA 4ALVA 1OBGA 3RPVA 4IFCA 3HYHA 4QMOA 1YI4A 3F2NA 2LGCA 1XBCA 3RCDA 4U7ZA 4G6OA 4TYGA 4CMOA 3MH0A 3QD2B 4M0YA 4FTTA 1JKKA 4U79A 2GCDA 2X4FA 3PPJA 4BDIA 5A6NA 5FM2A 3K2LA 5A4QA 2JDSA 4BGQA 4RFMA 3R04A 4I24A 4K33A 2J2IB 4U6RA 3U4WA 4FV9A 1U46A 4TYHA 3JPVA 5IU2A 1FGKA 1KV2A 2YFXA 1PYEA 4Q2AA 5BYZA 1GZ8A 2VU3A 4GFOA 3FZ1A 1XKKA 3PVWA 1H27A 2YIQA 4EH8A 2WEVA 3UC4A 3PY0A 3HUCA 4GMYA 2BILB 3LAUA 1GNGA 4C4HA 4U0IA
chains in the Genus database with same CATH superfamily
2IVTA 3GFEA 4Z16A 4RMZA 4D2VA 5BPYA 3FSFA 2Y6MA 1MRVA 3F7ZA 4R5YA 2BFYA 5HG7A 1WVWA 3LMGA 3VC4A 4F6WA 4JAIA 2RIOA 3PIZA 5KNJA 2ACXA 4QMMA 2R3MA 5IPJA 3Q9XA 3ATSA 5AP0A 3NDMA 2VWXA 2W4JA 4MXXA 4QP2A 3OHTA 3T3UA 3FQEA 1O6KA 5AUUA 3GEQA 4JS8A 3VS6A 2CKQA 1FMKA 5J9LA 3W0MA 3QTZA 4FKWA 1OKYA 3V04A 2EWAA 4QDVA 3D9VA 3GCVA 1UWHA 5T3QA 5I9YA 2C68A 4RBLA 1NXKA 2CKEA 1G3NA 4TYEA 3W8LA 3UZTA 2NNWB 4KSQA 1YXTA 3EQBA 4YPSA 4O6EA 2WTWA 3UO4A 4F1OA 3QWKA 5F94A 3R9DA 2F9GA 4LOQA 2QLQA 3DY7A 3QRIA 4O4EA 2P2IA 4RA5A 3KMMA 4G2FA 5IA4A 3VHEA 2PK9A 3VULA 5B0XA 3E8CA 3R9OA 5HNGA 3KQ7A 1NVQA 1M14A 3DK6A 4M14A 3CQWA 2A98A 1WFCA 3FXWA 5D7AA 3AKJA 2O0UA 4QP4A 3ENMA 3LCSA 4CTBA 2WEIA 4FT7A 4DEIA 3ORZA 3HL7A 2YIRA 4NL0A 3PJ1A 4LV8A 4BJJA 4KAOA 4P90A 3NUUA 5DHJA 2BTSA 5M44A 4BIBA 2ZV2A 2UZWE 3FE3A 4DEGA 3BL7A 2XEZA 3PZEA 4OTWA 4AZTA 4J53A 4KS7A 4LI5A 4G3EA 2H96A 4YUQA 1I09A 2C6MA 2WMBA 4QTDA 2AYPA 4PRJA 3UNZA 5BVOA 5HORA 5DN3A 2UVYA 3W2QA 3BU3A 3DA6A 3ULIA 3C0IA 5I9XA 5EI6A 2OSCA 2O64A 2HIWA 2ITVA 2QR8A 4AOIA 4RZWA 1ZXEA 4DFBA 3C4CA 5LVLA 5H8GA 4UMPA 2C6KA 3MY5A 1JSUA 5EFQA 4ZY5A 1S9IA 5KMIA 2VWZA 5CAOA 4MWHA 4YP8A 4M84A 5EOLA 3RMFA 4GT3A 3P5KA 4RQVA 4XG6A 5DH3A 5F20A 3EQIA 4JRVA 5E91A 5FP6A 5C01A 4ANSA 5CEQA 5JGBA 1YWNA 2JFLA 3KMWA 2E9VA 5L6OA 3UG2A 2R0UA 2Q0BA 5CF8A 3BWJA 4XUFA 4NK9A 4EQCA 2RSVA 3EWHA 4FNZA 4EZ7A 3OOGA 4A07A 3L9LA 3D5VA 4O2ZA 3FLNC 2BAQA 4XG4A 3WZJA 2F2CB 1X8BA 4M66A 1WMKA 1QPDA 3DDQA 1IA9A 4YTHA 5EW8A 4FOBA 3AC2A 3GP0A 3RP9A 2PMOX 3TZ7A 4OW8A 2GS6A 1PF8A 4FT9A 1BX6A 5HBEA 1JNKA 4I4FA 2CNVA 3H10A 1GOLA 3CSVA 4CCUA 3P7CA 4CD0A 3FKLA 3LM5A 4I21A 1JKLA 4AOJA 3E3BX 4G9CA 2C3IB 4QYFA 5BVNA 4XG9A 5M4UA 4A4XA 4DDGA 4O7SA 4QP1A 4A9SA 4WOVA 3RGFA 3LVPA 5CNOA 4I92A 2C1BA 3AGLA 4EH7A 4HNIA 1JSTA 4C37A 4N6ZA 1YVJA 3C4EA 3HRCA 4FV0A 4EWQA 2CHLA 1J7UA 2P0CA 3FI8A 2BRNA 3LXLA 1ATPE 3QLFA 4MQ2A 3QALE 4E3CA 3ZM4A 4YZNA 4FF8A 5AX9A 3FI2A 3Q9WA 3JVRA 4IAIA 3PWYA 4BN1A 2V62A 3BEAA 4BDDA 4R5SA 5FDPA 4QQJA 3C5IA 5EQPA 4WA9A 3U6IA 4J96A 3QYWA 3RTPA 2E9OA 4TWCA 3POOA 2FH9A 3QHWA 4O1PA 3MV5A 5FLFA 4IZAA 3WI6A 2VGPA 4W4XA 1GIHA 1Q8ZA 3CXWA 1HOWA 2HOGA 3K5UA 3BV3A 4ITIA 4TKSA 1AD5A 3R7YA 1PMNA 3OCSA 5CX9A 4U3ZA 3QQHA 3VAPA 1ZMVA 4JBPA 2VTNA 3CTHA 4UXQA 5CSWA 4AZEA 2UZBA 1LEZA 1PXOA 4BBFA 1XBBA 4CFWA 4YJQA 4YSMA 3SHEA 4E5AX 4YURA 3PLSA 3O8PA 2FSMX 4Y8DA 3O0GA 2B1PA 5KZIA 3C7QA 5LVNA 2WMRA 1JVPP 4YJUA 4HYUA 3CJFA 1QPCA 3RPSA 4E5WA 4HVGA 3F3ZA 2C3JA 4GL9A 1OKZA 4H58A 4OTRA 5CI6A 3RNIA 1TZDA 4XV1A 4MXAA 1CTPE 4PP9A 5HI2A 3R2BA 3FQHA 3I5NA 2IVUA 3IQ7A 3ZO1A 3HV4A 4CMTA 5GZ8A 1MRYA 4BDAA 4O21A 3OCTA 3QRKA 5DBXA 3RPYA 3ZBXA 4DH3A 2ITPA 4F99A 4OBPA 3DFAA 4BB4A 5A4EA 2W1IA 4Z55A 3MTLA 2V5QA 2J0LA 2OIDA 3F66A 1ZMWA 2RF9A 4U44A 3RINA 4D4VA 4I6QA 2DYLA 3A4OX 4EHEA 4ZTMA 4CQGA 4XG7A 1NVRA 4C2WA 4D2SA 4II5A 3VQHA 3UGCA 5D1JA 1RJBA 2GHMA 5J5SA 3SW7A 5DA3A 1H26A 3FEGA 2BAJA 2WQBA 3LW0A 3UDBA 4I94A 4JG8A 3C4WA 3HP2A 1W2DA 3LFQA 1H0VA 4C59A 4C35A 2OK1A 3AD4A 3E62A 2J51A 2C6EA 4QTAA 4RJ4A 5KMLA 2VNYA 3RWQA 5C8KA 1Z5MA 5IUIA 4DT9A 4PTGA 3HEGA 3GBZA 3IS5A 3PXYA 3R83A 4E26A 4ALUA 3KXHA 4MNEA 3Q9YA 1ZYCA 4EJNA 4F1TA 5HNIX 1T45A 5LMAA 2YERA 3CTQA 2QODA 3T9TA 5KMKA 3QZGA 3ZDUA 2A4LA 3PZHA 3ZLYA 3D7TA 5DR2A 2E9PA 4BKJA 4BIDA 4IX3A 4C3PA 3T8OA 3F7WA 3KK9A 3POZA 2C5YA 4RIXB 3V8WA 1JOWB 3ORKA 5E7RA 3RM6A 4D1ZA 4F9BA 4M0ZA 5EKOA 4JJRA 3EN6A 4GIIA 3Q5ZA 5K4JA 5CU3A 2C4GA 2OJFE 4BHZA 4MD8E 1H24A 3W18A 5L6WL 3PE1A 2QO9A 3TI1A 4FV3A 2J9MA 5CXZA 2PE2A 5HBJA 4BCNA 3LKMA 3DT1A 3O2MA 5AADA 3F3VA 5BQ0A 4NCTA 5BUIA 4BBEA 1F0QA 4S2ZA 4XJ0A 2ZYBA 5CTPA 3Q4CA 3W2CA 3OT8A 5KCVA 2VTLA 3QTXA 4RRVA 3TWJA 3UNKA 1CKJA 2VWIA 1J1BA 3B2TA 5IZFA 3WF9A 4QMWA 2X2KA 3KKVA 4IANA 4GK4A 2EU9A 2RFNA 1FVRA 4FV6A 2YAAA 5EYMA 1ZY4A 2FGIA 4BZDA 4G16A 1PXNA 2ITQA 4ERKA 5LVPA 2BRBA 2CCHA 2GSFA 3E8EA 4F7JA 1P2AA 2FYSA 4RSSA 4C4IA 5TOZA 4YMJA 5IQGA 4I0TA 1UKHA 2WQMA 4WG5A 5FDXA 3R7EA 3IOKA 4E73A 3CD8A 3MPAA 2PMLX 3UVRA 3WZDA 4KD1A 4Y85A 3EQRA 4TNDA 4BWPA 4OUCA 4PUZA 3R9NA 3KMUA 3I0OA 4FSYA 2XK7A 3B2WA 1P5EA 3HDMA 4ZZMA 3R8MA 4HZSA 3NYXA 3OG7A 2ONLC 3VBWA 3WBLA 4AGUA 3PRIA 4BTKA 3GU7A 1H00A 4O7VA 3VHKA 4H05A 5E1SA 4AXFA 4LG4A 2HCKA 5DEYA 2RFDA 3L8XA 3C5UA 3R28A 3EN7A 4JBQA 5ANIA 4FKRA 4YLLA 4BCJA 2XNOA 3PLAE 4DEHA 3F82A 4L67A 4X3FC 3NW5A 5FRIA 1ZZLA 4IW0A 3UDSA 3OW4A 3BLQA 3HECA 2Y6OA 2QCSA 2EUFB 4NWMA 1PMUA 1Q3DA 2R7BA 5BVKA 3GU6A 3NUXA 4XP2A 5CQWA 5E9EA 4KIPA 3MSSA 3L9MA 1ZZ2A 3CGFA 2XVDA 3SOAA 3TNQB 4E8AA 5IA0A 4E4NA 3S2PA 2B0QA 5GHVA 5EQYA 4O82A 2IEWA 3ORMA 3NLBA 4JRNA 5AR5A 4IFGA 2W5BA 3RPRA 2CPKE 3D2KA 2GPHA 1OECA 4BCGA 4G6LA 4YZMA 3QCSA 2GHGA 5LCKA 4JQ7A 4K11A 3A99A 3SXRA 3PUFC 1PXPA 2H6DA 2XYNA 4ZP5A 2YZLA 1ZOGA 4QMXA 4AE6A 4FT5A 5IG1A 2JBPA 4I5HA 3QTUA 3F3TA 1SYKA 1WBNA 4NJ3A 1YOJA 4GV1A 3DAJA 2FVDA 3NFGB 2P4IA 5EYCA 1KWPA 2GTMA 1YQJA 2GTNA 4FSQA 2Y4IC 2OF4A 4LMUA 4ACHA 5HLWA 5CASA 5JGAA 4RJ8A 3VBQA 2PUPA 1OIRA 5DFPA 2PVHA 1ZYJA 2BZHB 4WUAA 4FV7A 5F1ZA 2R7IA 3QC9A 3Q9ZA 4WUNA 3AMBA 3S4QA 4EORA 3D0EA 3IW7A 2LAVA 2I0VA 5I5ZA 3W0RA 2BMCA 3V6SA 2PSQA 1Z9XA 2QKRA 1OL6A 4TWPA 3MW1A 4PDYA 5D9HA 2VV9A 1TQIA 5I0BA 4KBAA 4CYIA 3P79A 3PP1A 4QRCA 5CY3A 3G51A 3QTRA 2F57A 4E4LA 3EKNA 4RIYB 4UN0C 3BE9A 3LFFA 3PRFA 4TWOA 2FSOX 3KXMA 4X3FB 3H0YA 4F70A 2DS1A 1LP4A 4O6LA 5EYKA 1OPLA 3VWAA 2V7OA 3AG9A 4F0FA 3HMMA 5JFWA 3ZHPC 4BRXA 3A4PA 1PRYA 3HGKA 3PVUA 3R0TA 2WTIA 3K3JA 5LVOA 4UWCA 3FBVA 4YNOA 5EW3A 5AR3A 3BBTB 4O7RA 3W2PA 5BV3A 3FC1X 3ZYAA 4RVTA 3MGYA 2NRYA 1OITA 3DBQA 2QOQA 5CVGA 5GJDA 3CBLA 2X8EA 3SAYA 3ZC6A 5CAQA 1VR2A 4DINA 3IK3A 2PYWA 5AIRA 5CAVA 4IAYA 3UG1A 3LMHA 3QTIA 4WO5A 4CZYB 5DGZA 5DR6A 1OI9A 2YM6A 4L00A 1FOTA 4ENXA 4IZ5A 1OMWA 4OGRA 1Q8YA 2QOLA 3HAMA 4LRKA 4IWQA 5F9EA 5M57A 3ODZX 4HOKA 1RE8A 2BTRA 3DAKA 4FV5A 4AFJA 3Q53A 3VS3A 4WD5A 4KIKA 3ALNA 2UW5A 4WG4A 5EDPA 2W1FA 3O8UA 5LVMA 3HVCA 4JG6A 3LIJA 4DYMA 3NMUF 3BEGA 3UO5A 4QDEA 2WMUA 2VX1A 3AC5A 4PX6A 4RQKA 4YNEA 1QPJA 1H07A 2WMTA 5T6KA 3SXSA 3ZONA 4ZTNA 4GJ2A 4I6BA 3O50A 3NVKI 2GNGA 2A0CX 4M15A 2ZV9A 4GT5A 4O96A 3UIMA 2R3PA 5EM7A 4PDSA 4FR4A 4DFXE 3ORXA 2J0IA 1H0WA 3DBDA 3A60A 3QZFA 5EHOA 1R0EA 3SRVA 4MYGA 1PW2A 4I23A 4PL5A 3OBJA 5JQ5A 2VTPA 3NSZA 3WYYA 4K77A 5CZIA 5AV2A 4FE2A 4BCIA 1BKXA 3HKOA 4FVQA 4BCKA 3TUDA 4YZDA 3FL5A 4AZFA 5K4IA 3EQGA 3AC8A 2IW8A 4C3FA 2I7QA 2C0TA 5AA8A 3LM0A 4IWDA 2EVAA 3R8VA 3THBA 1WBPA 3Q52A 3BI6A 2WHBA 5HBHA 1U4DA 1QMZA 4J99A 1REKA 4O4CA 3KF7A 4YZBA 2WD1A 3TIYA 3ZLWA 4C8BA 2XKFA 3KRRA 3ITZA 2O2UA 3QCYA 1T46A 2G1TA 2IWIA 5HO6A 3TV4A 3W10A 5ITAA 4C3RA 5KMNA 5AR4A 5EDRA 2RKUA 5TT7A 2QOCA 5DE2A 3V5QA 3NWWA 2JKOA 4DC2A 5IF1A 3R30A 2VWYA 4RX9A 5ANDA 3ZZEA 2ITOA 3GU8A 4DFUA 4LGGA 4ONAA 2FSTX 4TNBA 1U59A 4X6QC 3C50A 3UIBA 3BE2A 2ZVAA 4EBVA 3FMLA 3FY0A 4N0SA 4ASDA 5KKRC 3EKKA 1OL1A 5L2QA 2BAKA 3GNIB 2C1AA 2OG8A 2XJ1A 2YCQA 3MFTA 5LARA 5DT3A 4MHAA 5E8XA 2J0JA 2GFSA 2ITTA 2RFSA 2O5KA 3MA6A 2QHNA 3AQVA 4HGEA 1WBSA 1YRPA 3NYNA 3IO7A 4WNMA 2PWLA 2HK5A 3O5AA 3NS9A 2WTCA 4Y5HA 3DXNA 4YC8A 4TYHB 2PVRA 5JN2A 4KIOA 3ET7A 2XARA 3BLAA 3MFRA 3OWPA 4FI1A 4V05A 4E7WA 2ESMA 2W1EA 5HTIA 3QBNA 3N4VA 1UA2A 4L9IA 4EYJA 4IIRA 3RNYA 1BL6A 5C8NA 3ANQA 5C8MA 2IW6A 4ITHA 2P33A 2JGZA 4AWIA 2XZSA 3K3IA 2ETRA 3FV8A 2UW3A 3R7UA 1KOAA 2YEXA 1OZ1A 4LUDA 4RT7A 4X0MA 5HCYA 3V8TA 4F4PA 3TJCA 4C2VA 3A62A 4HCUA 5M09A 2DQ7X 4O7LA 1MQBA 1M7NA 1OPKA 3LFBA 4PDOA 4EZ5A 2YM8A 2IPXA 2J90A 2EXEA 4U42A 3TNHA 4KSPA 4IBMA 3VNTA 3ZO4A 4F64A 4USEA 3O7LD 4FJVA 3LFNA 4G5PA 3KULB 2J6MA 3P1AA 4I5CA 4U5JA 5DG5A 5L8KA 1Q41A 1ZMUA 1KSWA 4FZDB 3BWFA 4AN3A 1UNLA 4AFEA 2XKCA 1OIQA 3AC3A 4OAVB 1OUYA 2QONA 3OP5A 5KKRB 5FD2A 5A3XA 4DAWA 5J7BA 5TKDA 5LWMA 4HVHA 3UOHA 1XH7A 4EH6A 4R7BA 2BCJA 1W83A 2YLEA 4FG9A 4H1JA 4ANOA 3TUCA 5DLSA 3JR1A 4IHPA 3SOCA 4H3QA 1M2PA 2Y9QA 4HVIA 1H28A 4AN2A 5CU0A 2W96B 1XR1A 3L9NA 4ZSGA 2CSNA 2GFCA 3NGAA 3EQHA 3UTOA 4FL1A 3A2CA 4L8MA 3LCDA 1CSNA 2B9IA 2OXDA 4YLJA 3EH9A 5CXHA 3VUKA 3PTGA 4BKYA 3R1QA 1WAKA 2W7XA 3ZUVA 2ERZE 4JMQA 3GFWA 4AXEA 4HYHA 4IADA 4BJJB 1ZY5A 5DT4A 3FAAA 2B7AA 4UEUA 1GZNA 1JAMA 4PMPA 3QQGA 3QXPA 3HMIA 4FTCA 3I6WA 4K9YA 4O7NA 3PE2A 4L3JA 2PHKA 4TL0A 4LOPA 2KULA 4C02A 2Z2WA 3QCXA 3QQLA 4UALA 4XOZA 2XJ0A 5CEMA 2OXXA 3OEZA 2J4ZA 3OXZA 2R3NA 4A9UA 1A48A 5HCXA 4BIEA 5IQCA 1XHAA 3MB7A 3BU6A 4A9YA 1K3AA 2BFXA 2YM3A 5HNBA 3NEWA 4EOIA 4PPCA 1F5QA 4O38A 1Q8WA 1WVYA 4K8AA 4GKIA 2VGOA 3ROCA 1UWJA 2B53A 3R21A 1R1WA 5AM6A 2VTMA 3D2IA 3EN4A 2GQGA 4RLLA 3E8NA 4ID7A 1QPEA 4KKGA 2X6DA 4BDEA 3SV0A 4O81A 1JBPE 2XA4A 4NM0A 5IQDA 1U54A 3WIKA 2VX3A 3FZTA 3PJ3A 5HG9A 4B8LA 4C61A 5F4NA 5J7HA 5CANA 3I4BA 2BRGA 4QMTA 4QP8A 2B9FA 2X81A 3A8XA 3R1YA 5CU4A 3IGOA 3PSCA 5A46A 2C6TA 4X3JA 2QR7A 5CAPA 3TMOA 3I6UA 3BZ3A 4BF2A 3TKHA 3W0SA 5CVHA 2G01A 5CWZA 5AAFA 2JKQA 2Q0NA 3MWUA 5KMOA 3E87A 2QU5A 3IPHA 2JLDA 1BUHA 4GCJA 4XBUA 5CLPA 4A4OA 4AW5A 1CKIA 2X1NA 4PV0A 5JRSA 3KRJA 4FNYA 4G9RA 3EQCA 2HZIA 4CFXA 4DH7A 3U6HA 3BKBA 2V22A 2GU8A 4ZIMA 4EYMA 5M4FA 2HXQA 1E1VA 4BKZA 3F61A 4MXYA 4DGLC 4BICA 2YIXA 5EQEA 2XKDA 2XKEA 3OCBA 2VO0A 4C4FA 1OUKA 2WOTA 3R1NA 4Q5HA 1ZARA 3R71A 4APPA 5CAUA 3S00A 3U6JA 4RA4A 4FKPA 3HV3A 4U3YA 1M2QA 5ANGA 1ND4A 4L42A 3VUMA 5AP7A 4DH5A 3IG7A 4QPMA 1R78A 2PVFA 1MUOA 4NZWB 3MH2A 1NA7A 2XIXA 5KBRA 3W0NA 2ITNA 1GZOA 3R8LA 3NR9A 2CDZA 4XV2A 4YBJA 4O7ZA 2F4JA 3LZBA 4I1ZA 4FEXA 3OT3A 2ERKA 4AOTA 4R6VA 3KULA 3O51A 4FKQA 3AKLA 1DI8A 3VW6A 4PPBA 2WO6A 5FEQA 2Z8CA 5CEPA 4FKIA 1YHVA 2OU7A 3GC7A 2R3FA 3R73A 4O0TA 5J87A 5DT0A 5AP3A 3OY1A 4UYAA 3K5VA 3F2AA 4B7TA 5LCJA 4BYIA 3RZBA 3ZUTA 4F9YA 5E8VA 3MFSA 4XG8A 5HIDA 2HY81 2ETKA 4CTCA 5IISA 3G6HA 3O7LB 4M69A 3KXNA 2R3HA 3TTJA 4ORKA 4FV4A 3UC3A 3RJCA 4FEQA 3QQJA 3MN3A 4NIFB 3FKOA 2X2LA 2OZAA 3FMDA 4BVUA 3P23A 5JMSA 1ZWSA 5L2TA 5LQFA 4F7LA 5CT7A 4KUJA 4MF0A 4MKCA 3RK7A 4RVMA 4BGGA 2JKKA 5K0KA 2YISA 2C6LA 4D1XA 4EL9A 2GS7A 1PYXA 1WBWA 4FK3A 2IN6A 4ZJIA 5TO8A 4ZTHA 4RWKA 2YWVA 3Q6UA 4RX7A 4IB3A 4XHKB 3HMNA 3JS2A 2C3KA 4G1WA 3NUPA 1HCKA 3QF9A 3QQKA 4CQEA 3COKA 3QGWA 5A14A 2ZM1A 1XMLA 4NCTC 5JFXA 4D4YA 5CSHA 4BZOA 3BHHA 2YAKA 3CPCA 5I3OA 4FIEA 1P4OA 4KNBA 4W4YA 3ETAA 3JVSA 2X8DA 3COMA 5G1XA 3UPZA 1JWHA 2AUHA 2CCIA 3UMXA 3W16A 2GMXA 4R1VA 2CGXA 2QD9A 3IW5A 3Q4ZA 5ETIA 3TACA 3TKUA 4NT4A 5CALA 2R64A 4WG3A 1OKWA 2BIKB 4O7YA 4R7HA 1H4LA 1OM1A 3GCQA 3KXXA 3PJCA 1YHWA 2PMIA 2YIYA 3Q3BA 3PY3A 3QKKA 4YJVA 2W4OA 3E7OA 1OKVA 2CKPA 3D15A 4HYSA 3MVJA 5FXRA 3ANRA 5HQ0A 3BPRA 1WBVA 2VNWA 5CI7A 5B2LA 4H3BA 4P2KA 1TQMA 2XBJA 4MNEB 1XQZA 5JFSA 2QKWB 4YR8A 3GQIA 3RALA 4BTFA 4BCFA 4AACA 3P0MA 5KZ0A 4QMQA 2IJMA 4O0YA 2Y7JA 4ZSAA 3VBYA 4CFFA 3D14A 3I7BA 3D7TB 1M17A 2BUJA 4FKOA 2R4BA 4BBMA 1GIIA 5CNNA 4WBBB 3W0PA 3OEFX 2YDIA 4Y5QA 5AP2A 3SXFA 1KE9A 4MAOA 3MH1A 5IH6A 1NW1A 3O71A 4HPUE 3TCPA 4D5HA 3A61A 3MVMA 1DAWA 4IJ9A 1H01A 4P5ZA 5BYYA 1AQ1A 2CKOA 4BR3A 3DNEA 3NX8A 4L53A 3TIZA 3LQ3A 5ANOA 2BKKA 4IB5A 3UBDA 2E9UA 3N9XA 1VEBA 5KO1A 3OCGA 1MP8A 4GUEA 4L7FA 3GCPA 4I6HA 2XS0A 3TKIA 1SNUA 2R2PA 4FSRA 3CPBA 4D4RA 2I40A 3MBLA 5EH0A 4AUAA 2XNPA 4FVRA 2R0IA 4I41A 2E9NA 4NM7A 2IW9A 4C0TA 3KC3A 2GS2A 3COIA 4FNXA 4J52A 3VUGA 2V7AA 4EKLA 5HU9A 5EHLA 4UYNA 3V5LA 5FTQA 5FWKK 3VUHA 1UU8A 3EYGA 1Z57A 4YHJA 4MD7E 5K5NA 1V1KA 3NZ0A 4DCAA 4UBAA 4D4SA 5J9YA 1OL5A 5JK3A 1YXXA 2UUEA 4BWXA 4MXOA 4J1RA 3DGKA 4UMQA 1XH8A 4HGTA 3PIYA 4S31A 3R7VA 2CJMA 5JFVA 4FNWA 3EHAA 4Z3VA 4EQMA 4UV0A 3AC4A 1SM2A 5K9IA 4N57A 3W0QA 4J7BA 1YWRA 4JR3A 2ZMDA 3WILA 4EOLA 4D9UA 2VTRA 4EOOA 4NIFA 2C47A 3DB6A 5HESA 4IZ7A 3VO3A 1W7HA 2YABA 3AXWA 1FGIA 4FTRA 1FQ1B 3PSBA 3FLQA 2WNTA 2C3LA 4EH4A 5KHXA 3CGOA 4G31A 3MTFA 4DEAA 2XANA 3DKCA 5D10A 4F7SA 3GOPA 3GC9A 3EQDA 3GVUA 2YZAA 5L4QA 3CKXA 5EK7A 3QRJA 4JLCA 4F08A 4OLIA 4YO6A 2XK4A 3UYTA 5GIPE 3FMJA 2XK8A 2B9HA 2A2AA 4K0YA 3W2OA 1Y8GA 1L3RE 3MFUA 3V6RA 3Q60A 5AAEA 1M7QA 3QX2A 1UU9A 4FSTA 4J98A 3E5AA 4QPSA 1G5SA 2OICA 3BQCA 1GIJA 2W9ZB 2CGUA 3KN6A 3L1SA 5EKNA 1FPUA 3FPQA 3I60A 1STCE 4O0RA 4HNFA 1PKDA 1Q4LA 2EB3A 5CZHA 3ZFMA 4I6LA 2WU6A 4FKVA 1FVVA 2OGVA 2R3GA 3EQPA 4IX5A 4A9RA 5E8TA 1PXIA 4AT3A 3MA3A 3ZEWA 5M56A 3LFDA 4FSUA 4I5PA 4XEYA 2ITWA 3VN9A 2NRUA 3PXQA 4K1BA 1KE6A 3HRBA 5LOHA 3UQFA 5M06A 1SVHA 1W98A 3OZ6A 5CT0A 3MY1A 4C34A 3OTUA 4AQKA 2IVSA 2GNLA 4CCBA 2YDJA 4I3ZA 4D0WA 1E9HA 3AMAA 3C4FA 5IQHA 5GJGA 2BALA 2XUUA 3V01A 4AGDA 1WBTA 4USDA 4NYEA 4C7TA 4FTAA 4QMSA 3QRTA 5H8BA 3UQGA 4EH9A 3UOJA 1VLRA 1XMMA 2R5TA 2W5HA 2R3IA 2WELA 3BX5A 4GK3A 4LGDA 4ZMFA 1QL6A 4CNHA 3R8UA 2WTJA 2JC6A 3DK3A 4BCMA 2VTSA 2VX0A 4FT0A 4N6YA 4YJTA 4U8ZA 3LFSA 4FX3A 2BPMA 3LMIA 3RAIA 1WZYA 3DU8A 3OW3A 4FVPA 5HIEA 4EOJA 2C0IA 4EQUA 5EYDA 3P7BA 1JSVA 3D4QA 3FXXA 4LUEA 3D7ZA 3ZSHA 3C51A 5L2IA 5AUXA 4M3QA 3V5PA 4HVSA 4AZSA 3GGFA 4LRMA 4ACGA 2QU6A 4EOPA 5TF9A 3FLSA 3MYGA 5HE1A 4FTKA 4QEBA 1XO2B 1B39A 4DEDA 3UIXA 2JDVA 3EL8A 2UW9A 3F5UA 4Q5EA 3R22A 4QOXA 4YBKA 3A7FA 2B4SB 4QMPA 5AP6A 2PMNX 4CXAA 3HA6A 4CVAA 4NH1A 4Q9SA 1Q8UA 3TZ8A 2V55A 3QRUA 4TN6A 3VF8A 2WMWA 3G33A 2UW4A 3R8PA 4X21A 4DHFA 5DEWA 3TV6A 4AZWA 1LEWA 3KF4A 3D94A 5CF6A 2BDJA 3FLZA 4ZTLA 3P86A 4KIKB 5EM5A 4B6LA 4YU2A 4PF4A 3U87A 5FBNC 4IAZA 2QOFA 2AC5A 4NW6A 2CGVA 3OD6X 4B4LA 2QOOA 3P9JA 2QOKA 5JRQA 1W8CA 4R8QA 4XBRA 3EOCA 4G3DA 4RGJA 5HE2A 4S33A 4NSTA 3ORIA 4EK3A 3CD3A 2R9SA 2W1ZA 2W9FB 2WMVA 2PL0A 2J5FA 3MIAA 4Y95A 4EEVA 2PVMA 5M55A 3QZHA 3KVWA 5AUZA 3ORLA 2XNEA 4HVDA 4I20A 5FTOA 4FGBA 2JFMA 4W9WA 4E5BA 3VQUA 4RC2A 3RZFA 2QURA 3ATTA 4GIHA 2XYUA 4X2KA 4DLIA 5IA3A 4EOSA 4EOMA 4C4JA 3SRVB 4CLJA 3BV2A 4O0SA 3SD0A 3OFMA 2Q83A 3ZEPA 4IDTA 5HTCA 4X2JA 2QOBA 4RFZA 4FTLA 4LFIA 4GFGA 2HWOA 3OY3A 3UJGA 4KA3A 4F63A 4V04A 4ARKA 2XH5A 4MD9E 3QCQA