3ENMA

The structure of the map2k mek6 reveals an autoinhibitory dimer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
288
structure length
279
Chain Sequence
FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the MAP2K MEK6 reveals an autoinhibitory dimer
pubmed doi rcsb
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
total genus 73
structure length 279
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3enmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3enmA01
5M56A 3FZOA 4CFWA 5AUTA 3WIKA 1RJBA 2B54A 2BZHB 1RW8A 3OUNB 4ITJA 5FEDA 2I6LA 4RIXA 4CFMA 2CNQA 3DBQA 5IQHA 4FKOA 4KBKA 3GU5A 3HEGA 4MXXA 5L6WL 3SRVB 3SVVA 5F94A 4KUJA 5FTGA 2DQ7X 3GQLA 4UBAA 2GSFA 3VJOA 3TNHA 3SXRA 5EQYA 3CIKA 4II5A 5ETIA 3R7VA 3RPYA 3VVHA 3MPMA 4V0GB 4OT5A 3VF9A 2E9PA 2VWWA 1WVYA 3P08A 4HJOA 4EC9A 5DNRA 5FEEA 1IAHA 3ZUTA 1NY3A 4C57A 2CKPA 3FZRA 3OHTA 4X6RA 4A7CA 3QKKA 4R7HA 3UP7A 1WBPA 3QZIA 4HZSA 1TQMA 3R7GA 1FINA 3PA3A 2G1TA 4TYIA 1XJDA 2F7ZE 4AFEA 1BUHA 3WF9A 5HBHA 3EQGA 1OIYA 3BE2A 3CP9A 3Q04A 4J71A 4JG7A 4YPDA 2GMXA 3BWJA 3QBNA 1X8BA 1H28A 2W5HA 3MFTA 2Z7SA 2WIHA 2NNWB 5AFVA 2UZEA 3AGMA 1H08A 5DBXA 1KOBA 1W82A 2BRBA 3FKOA 1XQZA 4AW1A 4F9YA 5ANIA 4CVAA 4G5JA 5KBQA 3FMDA 3DA6A 3Q4ZA 1PXOA 2OJ9A 5HU3A 3Q6WA 3NX8A 4FV3A 2WMAA 3O0GA 1A9UA 5HTBA 1IA9A 5JFVA 3E93A 4WSQA 2AUHA 2BDWA 4M15A 4EOQA 4ORKA 4WUAA 4M68A 3KVWA 2H8HA 4HGLA 3EQDA 5E8WA 2RGPA 3COHA 1NA7A 2PVHA 3GC0A 3NS9A 2XK7A 4B8MA 4BL1A 3BIZA 4WO5A 5KMIA 1FPUA 4YTHA 3K54A 5J5TA 3PZHA 3QLFA 5AUYA 3KMMA 5JZJA 3HX4A 3GBZA 4WHZA 2XNOA 3FQEA 3BV3A 4KKEA 4L46A 5HVJA 3F2RA 3MH0A 1KV1A 3FV8A 3TKUA 2UW5A 4ANNA 2J0IA 2X81A 4ZTLA 3OOMA 3VS3A 1Q4LA 1KE5A 3CPCA 4FOCA 3QGWA 4AAAA 2JIVA 4WRGA 2O2UA 4GT5A 2IVSA 1Y6AA 3P9JA 4RZWA 5CQUA 1QPJA 4DH3A 4Y46A 4TYEA 3D2IA 4E6DA 3ORIA 3ET7A 2BRHA 2XRUA 3KXGA 4CFFA 3OVVA 3BHVA 4FTNA 1OIQA 2FSMX 4G9CA 4GSBA 2PZIA 2WTCA 3KRJA 3FUPA 4I23A 4QPMA 5CU2A 2FO0A 3UIUA 1P4FA 2VX1A 3R9HA 2NP8A 2A0CX 3MGYA 2R3NA 4FZ6A 2YCSA 4KIKB 4FE2A 3C0GA 2VUWA 5CS6A 3WF8A 3AT3A 4PL5A 4FVPA 2R4BA 4DH8A 4KWPA 2PVNA 5HVYA 2QOFA 3DKCA 3V6SA 5CEOA 4EL9A 4KIKA 5JSMA 4D4VA 5CVGA 4TTHB 3WI6A 2KTYA 1AGWA 1VJYA 3LQ8A 3N51A 4LI5A 2YITA 4NSTA 2PHKA 3NYXA 4GUEA 3ZXTA 2OZOA 4WNPA 4JBPA 3QTIA 4FYOA 2GNHA 1GNGA 4L6QA 4QMVA 4ASEA 4E4XA 4G6OA 4FBXA 4WG5A 2NPQA 2BHEA 2J4ZA 3PVWA 3ALOA 3P1AA 4I94A 5JZNA 4CZUA 5KX8A 5CX9A 3NUUA 4K6ZA 3FC1X 5I9UA 4FG8A 3GCVA 4D1XA 4N57A 2VO3A 4F1OA 1U4DA 1R0PA 3HMIA 4FT9A 3DAEA 4IWQA 1H1PA 3F5XA 4IJ9A 3DAKA 3F82A 4L3LA 4N6YA 3ULZA 3LKMA 3AMAA 2UV2A 3LE6A 2XIXA 5LVLA 4BDAA 2CNUA 1Q8UA 4DG2E 5IDNA 2HZ4A 3TZ8A 1IRKA 4IMYA 2SRCA 2R3IA 4RX8A 4TL0A 2WAJA 3R9RA 4FV9A 4A9SA 3EKNA 3KF7A 4WNMA 4MXOA 4U81A 3H0YA 4GVJA 5DHJA 4FX3A 2VWVA 5EM6A 2C3KA 5J7BA 4DCAA 5L4QA 5L6PA 3FSFA 4MD7E 2X1NA 2UZLA 2B4SB 4TT7A 3L9PA 2R3LA 4O0XA 3WE4A 2RSVA 4W4VA 3ROYA 2HW6A 2XBAA 2XVDA 2RG5A 2YM8A 3BYUA 4G3FA 4YJVA 3VUMA 4RC4A 4BCJA 4BI1A 2VTMA 3L8VA 3LFSA 4I21A 4JBQA 1YRPA 2X2MA 3I6WA 2IN6A 3KY2A 3R00A 4ZTNA 5JRQA 2QONA 1NW1A 4EK4A 2BUJA 2EB2A 2ETKA 1CMKE 4FICA 3EN4A 4CFXA 4XG4A 5AV4A 4YJNA 2C1AA 3C50A 3OY1A 4XV2A 3FQSA 2WMQA 1URCA 4AGDA 3S0OA 4RVKA 4Y72A 4CMUA 3EIDA 4IVCA 3BQRA 3MIAA 4ASDA 4FV7A 3FI4A 3RPRA 5M57A 3LMHA 2OWBA 4MBIA 5HOAA 3KCFA 3OF0A 3ORTA 4HYUA 5IMXA 3LFDA 5BVKA 3I7CA 4I5MA 3ZZEA 4MNFA 3R9NA 3N9XA 4FSRA 2F9GA 4O7NA 3KEXA 2PTKA 5CT0A 2WGJA 3FI2A 2VGPA 2YIQA 4X2GA 3RPVA 4U9AA 4WT6A 3DV3A 2OG8A 2XKFA 3QA8A 5HCYA 3R7EA 4C58A 4C4JA 4CYIA 3G51A 5K4JA 3LFNA 3HP2A 4QP6A 2PZ5A 1UU8A 5CALA 3TNIA 4MEDA 2OH4A 2PUUA 4UXQA 4QTDA 1FBNA 2VWZA 3QTSA 4GU9A 4ZEGA 4HYHA 5IDPA 4DBNA 3G15A 2BHHA 2FSOX 4EH2A 4J53A 4JAIA 4UYAA 3HRCA 4FTQA 1KSWA 2VZ6A 4L3JA 3VS0A 1LEZA 4PNKA 4ANSA 2J51A 4QP7A 1K2PA 2ACXA 5M08A 3SV0A 3GU7A 5BMSA 2PSQA 2QR7A 3NYVA 3MV5A 4D2RA 4PP9A 3GC8A 1JSVA 5IG1A 2QOIA 2PMOX 2IW9A 3BRBA 1XH8A 3LFCA 5FDPA 5E9EA 4EK5A 5HX8A 4E5WA 2VTSA 3QYZA 4QMMA 3BQCA 3PYYA 3R22A 3IDPA 2YWPA 3MJ1A 4FTAA 4QMTA 4Y83A 3UBDA 3WOWA 3D0EA 4IX4A 4JG8A 4DH5A 2GHMA 2WQNA 3FL4A 4RFYA 5KHXA 1S9IA 5EFQA 4IX5A 5D12A 2QOQA 4WSYA 3KKVA 5BYZA 4JR7A 4EQUA 3KULA 1MRUA 3E7VA 2WMTA 3ZSIA 4OGRA 1GZOA 2P2IA 2XIRA 3OD6X 5DE2A 3BCEA 2XCKA 2VAGA 3EL7A 3FMHA 2RF9A 4ID7A 4RIYA 1CSNA 5E8UA 3D9VA 2A2AA 3LAUA 5IQAA 4RX7A 4O2PA 4E3CA 4TNBA 2WD1A 1J7IA 2GS2A 3QWKA 3EN5A 4IEBA 2VTRA 4DHFA 5A3XA 4XG2A 4MVFA 2RFDA 1S9JA 2VNYA 1Q99A 3G6HA 3LFQA 4NFNA 3BWFA 4PV0A 4X0MA 4FKRA 1JPAA 5TO8A 4L43A 1OKZA 1L3RE 2YM4A 4G34A 2J2IB 4L53A 4AX8A 3KREA 3NCZA 3QHWA 3CY2A 3TCPA 5A4LA 5A54A 5I9VA 5L2QA 2HELA 3TWJA 5J9ZA 4N0SA 5CSHA 3RWQA 4DEBA 4E4NA 4RQKA 3L1SA 3QCXA 2GHLA 3D5UA 4R5YA 3PLSA 2XMYA 4NCTA 3OWKA 2XM9A 3OWLA 3HRBA 3UOHA 3TV7A 3NUAA 2XNEA 5FD2A 2OK1A 4E73A 2WNTA 3Q3BA 3RM6A 5JFWA 5FDXA 3FSKA 3RK9A 3DZQA 4AN3A 4OTWA 4WIHA 5I9XA 4BI0A 1STCE 2OICA 4QPAA 1W0XC 3H30A 4W9XA 4XV9A 3BI6A 4NCTC 1OL6A 4NJDA 5E8YA 1BKXA 3F7WA 3NCGA 1QPCA 3CQWA 3FMKA 3GENA 2X6EA 4QTCA 5AR3A 3QLGA 4OTDA 4FV5A 5HG7A 4XS2A 2BIKB 4GEOA 1QPDA 4O6LA 2YFXA 2ZB0A 4IAZA 1V0BA 2V7AA 2BIYA 3KCKA 5HLWA 4XEYA 5J87A 2CN5A 2UVYA 4YZBA 4U97A 5AUZA 3VUDA 5DGZA 4RLLA 4K9YA 4M66A 3E87A 3POOA 2UVXA 4UMQA 3UJGA 3BHHA 5A4TA 3U54A 3FPQA 2I40A 5DIAA 2BDFA 4EYMA 2GTNA 1OITA 2PVLA 3G0FA 4W4YA 5HE0A 3CCNA 4RVMA 1TVOA 4PQNA 3T8OA 3UPXA 3VHEA 5LMBA 4RZVA 2GFSA 1M2PA 5LCKA 1W7HA 3FLNC 2UZDA 2HENA 2ITUA 3DK7A 4FNWA 3K2LA 1BX6A 3RALA 2UZNA 3OT3A 3C1XA 1H25A 4NYEA 3JR1A 2JIUA 3SOCA 3JS2A 4JX3A 4C4FA 3ORZA 5AEPA 4ZOGA 2YM3A 2ITWA 2QO7A 3RZBA 2QURA 3FZSA 1GZKA 2C6TA 3F69A 5HNGA 3TTIA 4ZY5A 4IW0A 5IQBA 1O6LA 1M14A 5ACKA 4ZSAA 3UOJA 3VS1A 4JJRA 2UZOA 4GG5A 3HNGA 4I5HA 4NWMA 3S95A 3F3TA 4F6WA 2WOTA 4O22A 3IKAA 4A4LA 3HKOA 4BGGA 5DPVA 1O6YA 3NRMA 1ZARA 4UZDA 2WMBA 4CD0A 4F7LA 4O7ZA 4EHVA 3RAHA 5IQEA 1APME 3AOXA 4OLIA 4QOXA 2CGWA 3H3CA 5EH0A 3AC4A 2A27A 5JEBA 3KC3A 3U9CA 1UVRA 4FC0A 3SW7A 4IANA 3T3UA 4MH7A 5B2MA 5AP3A 1WCCA 1JKSA 3ZYAA 2YCFA 4RX9A 4D28A 3DBCA 3HMNA 4MKCA 3EQHA 3WILA 3NUSA 2X8IA 5K3YA 4RWLA 4E1ZA 3MESA 4Q5EA 1PMEA 4AW2A 4YO4A 1Q8WA 3GU6A 2VWIA 4CG9A 4FNZA 3PFQA 3KRWA 5T6KA 1PXKA 3E3BX 4LG4A 4PWNA 3ZC6A 4AG8A 4OTIA 2HW7A 4TZRA 5IA2A 3VW8A 4FK3A 4FGRA 1KE9A 4BDCA 3VBVA 1ZY4A 5DWRA 3PY0A 3CGOA 3GCSA 4RIYB 3BGPA 1NVSA 4HYSA 3I0QA 5B7VA 5CNOA 5EDQA 4ZY6A 3LIJA 4IHPA 4LGDA 4RLKA 4USFA 5LVOA 1H1RA 2VTIA 3MH3A 2WEVA 2PYWA 2JFMA 4BCPA 4I0TA 3W2CA 3AD4A 4GK2A 2JFLA 1A06A 1M2RA 3Q9WA 2W1FA 2FUMA 3UQFA 3C4XA 2RG6A 3HMPA 4XRJA 3G9NA 4I6QA 3W2SA 5IQDA 4U42A 4DFBA 4RBLA 4CT2A 3ZM4A 3JPVA 5C01A 1VZOA 4PTEA 4RA4A 3G6GA 4F6SA 1Y6BA 3ZEWA 1Q3DA 4YJSA 5AV3A 5B2KA 3SHEA 3UZTA 4IX3A 3DKOA 4IAIA 2VTAA 3ACKA 3OOGA 4DINA 3VJNA 4E26A 5H8BA 2GNJA 3K5VA 3U9NA 1BL6A 4BCFA 5CI6A 3A7JA 5CSVA 1GZNA 3FY2A 3R7OA 3DKGA 3R83A 2RFNA 4HNFA 4FL1A 1OBDA 4D2SA 4O83A 2HK5A 4ANLA 4R77A 3OC1A 4KSQA 2XNGA 3AXWA 2WFYA 4AA4A 4RPVA 3AD6A 3MA6A 4F1MA 1OPKA 3PJ2A 3VBYA 1H01A 5EOLA 3K3IA 3MY5A 5E8XA 4ACGA 5HD4A 4DEIA 5KUPA 4JR3A 2F7XE 4PMMA 4XP2A 5C27A 4I6HA 2QOCA 4K77A 1AQ1A 3Q53A 4N4SA 4YC8A 2BFXA 4AS0A 4BTKA 3NDMA 1PXPA 3DS6A 2ZYBA 3Q9ZA 3VUIA 3DFCB 3TV6A 5FRIA 4C35A 3RAKA 4CSVA 3P5KA 3LVPA 2BTRA 1U5RA 2VX0A 4H3BA 2VRXA 2WXVA 5IZFA 2PMLX 3F5GA 1YDTE 3MI9A 1FGKA 2VX3A 5GJGA 5AP1A 2ZVAA 4A4OA 3U51A 4JIAA 4IAAA 3LW0A 4R6VA 5KZIA 4V05A 4E4MA 2UVZA 3PE1A 4H36A 4FKIA 5DRBA 4GIHA 3E8NA 5BVWA 2R3MA 3PA5A 3QCQA 4X6QC 5FTQA 4ZJVA 2HWPA 2IZRA 5DT3A 5HG9A 4FV1A 4Y85A 3UE4A 3VUGA 4FODA 4ASZA 3PY3A 4A9TA 4ZSEA 2X7FA 2VV9A 4RVLA 4QMWA 2QC6A 3UGCA 4MAOA 5EYDA 1YHWA 2PUNA 5I9YA 3CD3A 4J97A 4ZMFA 3UG1A 5M4IA 5ANDA 1OPJA 1NT2A 4OTQA 4MQ2A 2VNWA 1W83A 2QHMA 4O6EA 2HZIA 2VTJA 5AIKA 5HCZA 3AC2A 3JY9A 1ZWSA 4OBPA 2H9VA 2R3RA 4QYYA 4RFMA 3T9TA 4F0FA 3UODA 4D55A 3ANQA 3QTUA 4RJ8A 3S4QA 1UU7A 5IQGA 1OKYA 3BEGA 4KKHA 3GCQA 4QMPA 4Y5HA 3RAIA 3KRXA 4HVGA 3PWDA 4CFUA 3MFUA 5HE1A 1YVJA 1P14A 2OJIA 3W2RA 4OAUC 2F57A 3KXZA 3FHRA 4W8DA 3ZUVA 4LOQA 3BYSA 4EKKA 5LVMA 3BLHA 4WRSA 4KIOA 3EQFA 4X3FC 4FOBA 4ANMA 4IM3A 4YJTA 1HCKA 4FKQA 2YIRA 4QYGA 3VUHA 5KHWA 3TM0A 3QQHA 3UVRA 2JKQA 3FLZA 5CT7A 5DFPA 3HAVA 5CSPA 3HUCA 5BVOA 2R7BA 2XA4A 4AW0A 4D0WA 5FEQA 1YOMA 1CKIA 4FV4A 1TQPA 1VEBA 4PMTA 1KE7A 4FT0A 5CU3A 3C4ZA 4MD8E 1YKRA 1EH4A 1M7NA 1UNGA 3GC7A 1KE6A 3ZO4A 4C0TA 5IISA 4JS8A 5J95A 2FB8A 4CLJA 4UX9A 4CG8A 1JKTA 4XJ0A 4I1ZA 3ZC5A 3CBLA 3GT8A 4CFVA 3EN9A 3ZS5A 5E92A 5AUXA 2JIIA 3QUEA 2BFYA 1I44A 1CKJA 2ETMA 3QL8A 3FAAA 4CQEA 3SD0A 4QMUA 4EK6A 4EBVA 3ZMMA 3ORKA 3PZEA 3C5UA 2PE0A 4HCUA 4YO6A 1DI9A 3O17A 4MK0A 3ALNA 3W2OA 3WF6A 1M52A 4RQVA 3NW6A 2NO3A 4XBUA 5HNIX 3WZDA 3SA0A 1WBWA 3LZBA 4FUYA 3I5ZA 3I7BA 3QUDA 5KE0A 2IG7A 4JVGA 3UO5A 1H4LA 3P4KA 3V8WA 3MH1A 2R7IA 4BKYA 1CTPE 2CGVA 3F3UA 4MXZA 3OEFX 4P90A 4I4EA 1UWJA 3NYOA 3PE2A 1ZOEA 1IR3A 4PPCA 4C3PA 3V04A 4PPAA 2GTMA 5KMJA 5I4NA 4UZHA 3D2KA 4E6AA 4JG6A 1JNKA 3ZZWA 4TPTA 3F5UA 1P4OA 3KN5A 2WQEA 4YPSA 4S31A 4BFMA 2JDTA 5AP2A 3CKXA 4JQEA 4F70A 3EFKA 3NLBA 4U79A 1ZMWA 3TUDA 4D2VA 2UW4A 3HUBA 4RJ3A 3TDWA 2PE1A 4BZNA 3M1SA 4R7IA 3OG7A 3S3IA 4G6LA 3DJ5A 4YZDA 4EOJA 4ZZOA 1KUTA 4EHZA 5KO1A 5FGKA 2BDJA 3G5DA 3LCDA 3R1NA 5CI7A 1XBCA 4UY9A 1U59A 4IB0A 4AOTA 3GVUA 5HICA 2O64A 5HLNA 2C5YA 2ZB1A 4MBLA 5C03A 4A9RA 3O96A 3W18A 2IVUA 2X6DA 5F1ZA 1ERKA 3MPAA 2R3GA 3TDVA 2QQ7A 5EM7A 3P7CA 4MCVA 4U80A 4FYNA 4XG8A 3A7IA 4FNYA 5FLFA 5A4CA 4B8LA 4X2KA 3WYYA 4QP2A 4FTKA 3W2QA 1CDKA 5IQCA 4FSMA 4ZTSA 1YXSA 4PL3A 4UMUA 3FZPA 1ZYLA 4FT7A 2XK9A 5FP5A 4AA5A 4DTKA 4ENYA 5CF5A 1PYEA 4GL9A 4H58A 2R9SA 3VUKA 2XEYA 4A9UA 4BCMA 4DGMA 3TZMA 4FKWA 4RC3A 2X8EA 2Q0BA 4IB5A 4JDKA 2A1AB 4DYMA 5LOHA 3LFEA 2XEZA 4AU8A 3PDTA 3Q2JA 5IUHA 4NW5A 1BL7A 1P5EA 3ZLYA 3EFJA 3V6RA 2G01A 3MVMA 3L8PA 3QWJA 5LARA 2RKUA 3ATTA 4NT4A 1MP8A 4FKUA 4GMYA 3V8TA 4CV8A 1OGUA 3OW4A 3KXNA 4KD1A 4ZSJA 4ARKA 4BDHA 2FGIA 4K18A 3AGLA 1B6CB 5BQ0A 3ZLXA 4O82A 2F7EE 2C5OA 3A2CA 3A8XA 3G33A 2X0GA 4C3FA 5CY3A 5BYLA 4KS7A 2R3OA 1LR4A 3DLSA 4TWCA 3EYGA 3DTCA 3KL8A 4FL2A 5ICPA 2F4JA 3I4BA 3SG9A 2XCHA 1YWNA 5CU4A 3BU6A 4U3YA 4Z9LA 2UZWE 3C0IA 4Y8DA 4DTAA 4O0UA 4DCEA 4I93A 1XBAA 4PMSA 3ZRMA 5G1XA 4Y5QA 5JK3A 4PDYA 3TUCA 3PG3A 3H9RA 3MWUA 4C4EA 3OT8A 3QTXA 5F9EA 2C0TA 2Y9QA 4DFLA 4IDVA 5M51A 1PW2A 3TKIA 2BALA 4GS6A 1JWHA 5A14A 5IEYA 4K8AA 1G5SA 2VO7A 3WZEA 4F9AA 4CKIA 5AA9A 3MVJA 2Y6OA 4LRKA 4EOSA 5L2TA 2WU7A 4O21A 3EB0A 5IQFA 5HEZA 4C7TA 5M09A 3HV6A 2WELA 4LMUA 4YJUA 5H8EA 3Q4CA 4P7EA 1TKIA 4ZK5A 4BDIA 4KIPA 3V5JA 4CYJA 1ZZ2A 4LFIA 3ZBXA 5KMLA 3ZU7A 3PXZA 3KA0A 2O8YA 3O71A 3VAPA 4BDDA 5AV2A 3GUBA 4E93A 1OKWA 4ZLZA 2BAQA 4NM0A 5HO8A 5EM5A 3VC4A 3QYWA 4KA3A 5HG5A 4PP7A 5IA5A 4AFJA 2DYLA 3MBLA 2V22A 1G8SA 4LYNA 4K33A 3SC1A 2Y6MA 3QQFA 3HGKA 3O50A 4XP3A 4Q9ZA 3QRKA 3HECA 4GJ2A 5D7AA 1H0WA 4NIFA 2QODA 3QC9A 3F6XA 3FZ1A 5DVRA 3ZTXA 5GIOE 4ZSLA 2UZUE 4LOOA 5CENA 4CTCA 4OTRA 4P2KA 1MUOA 4LGHA 1IEPA 2YZLA 4PDSA 3FLSA 5DOSA 2CLQA 1MQBA 1Q62A 4I5CA 3UVQA 3MY1A 2YM5A 2ZV8A 2FA2A 4O1OA 4FEVA 5KMKA 2ITYA 3NNXA 1GIIA 3GCUA 4BI2A 3QHRA 4EUTA 2WEIA 2H6DA 3ZONA 2Y0AA 3DDQA 1J1CA 2FSLX 1SVHA 2J5FA 5EOBA 3JXWA 2ZMDA 3PWYA 4M12A 4YHTA 4C2VA 3UC3A 5CLPA 4IX6A 1OUYA 5EYKA 2VTNA 1TQIA 2WMVA 4OT6A 4ZZNA 4ZS4A 3SXSA 2EWAA 5EDRA 3BV2A 3IDCA 4R3RA 4J7BA 3BU3A 3ZLSA 4OTHA 2OXXA 3NNVA 2H96A 2BRMA 5ETFA 5C8MA 5K9IA 3ZM9A 4XLIA 4BIBA 4BDEA 4IADA 3VBXA 4K1BA 4ASXA 2WPAA 3AMBA 5HHWA 4CCUA 4CKRA 5EYMA 4FT3A 3A4OX 4XCUA 1Y8YA 3D5XA 1OZ1A 3NUXA 2B9IA 2C0OA 2JKMA 5M53A 1JKKA 5EQEA 3GEQA 2ZV9A 4J1RA 3E8CA 1ZMUA 1YXXA 1PXMA 2ZM3A 3DTWA 4F09A 2JKKA 2J0KA 3EMGA 1E9HA 3L9LA 3GU8A 4RIOA 1WVWA 4AACA 2YIWA 2I0YA 2P3GX 2PMIA 1I09A 3GU4A 4FTCA 3D83A 4BBFA 2ZM4A 1PY5A 4DA5A 4DEDA 4AT5A 4S30A 1MQ4A 2ITTA 2JEDA 4P5QA 3MJ2A 3D7ZA 2BRNA 2O63A 2W4KA 5I9WA 2J50A 3EZRA 3QD0A 5CVFA 1NVRA 3UIBA 4MNEB 4O38A 3HMOA 1E1VA 3W8QA 3EKKA 2Z7RA 5IA4A 4TWOA 3GI3A 3UZPA 3NIEA 3RK5A 4M7IA 4Q5HA 1XBBA 3OXZA 4FTTA 3D7TB 3S00A 1E1XA 3MW1A 5DEWA 2WTWA 3V5PA 3QZFA 2RIOA 3CR0A 3KK9A 4PDOA 2CGXA 3O2MA 4QMXA 2GQSA 2W4OA 4ZTHA 3QCYA 4I20A 4PL4A 5DG5A 4G9RA 5F20A 4HVDA 4KRCA 3OBGA 4LM5A 1REJA 4Z55A 3DCVA 4QNAA 4YC6A 5CANA 3MPTA 3GB2A 4JT3A 1XH5A 2C4GA 4AQCA 4D2PA 4CV9A 2DS1A 2ZV2A 2I0HA 1SVEA 3UYSA 1IAJA 2QI8A 4JBVA 3BX5A 3GNIB 3JUHA 4D4SA 4BVUA 2JD5A 3V51A 2Z8CA 3TIZA 1ATPE 4ANOA 4BWPA 1YXVA 3LMIA 4J96A 1ZMVA 1DS5A 1OIUA 2C6LA 3G90X 1W84A 4D4RA 4CXAA 3OROA 1Q97A 4I22A 5M4UA 3U6HA 3ZO2A 1FMKA 3R8VA 2C6MA 2VWUA 4F9BA 2J7TA 5GZ8A 3R01A 2W1CA 4PNIA 4XX9A 4EOKA 2UZVA 2O0UA 3BHTA 3E92A 3PA4A 4WOVA 5TKDA 3WYXA 5EKNA 3Q6UA 5HVKA 5KKRB 4L01A 4C62A 3R8ZA 2WMXA 2QKRA 3UDBA 4ZTQA 4JLCA 4AT4A 3R2YA 5HTIA 4FA2A 2J5EA 5IF1A 1YHVA 4LV8A 3ZHPC 4APPA 4FSQA 4FSTA 3UNJA 2XNMA 2BKZA 2X7GA 3M11A 4R1YA 4FEQA 1OL2A 2BMCA 3F66A 4DGLC 1NVQA 3DK6A 4TWPA 2BROA 1OKVA 2R3FA 5JMSA 4GKIA 3HV3A 4F64A 4DF3A 2IZSA 4OTPA 2QR8A 1IA8A 2QG5A 4ONAA 4B6LA 1WFCA 3P86A 5CXHA 5AAEA 3NVMB 5KMNA 2EXCX 1B38A 5JN2A 4EOPA 4LL5A 5JQ8A 2OF2A 2UW3A 4D2TA 2XBJA 3GOPA 3Q4UA 1YOJA 4DBXA 4TN6A 3MFRA 3R71A 5GZAA 1ZLTA 3QALE 4YP8A 4IVBA 3VS2A 4CQGA 5AUUA 3QQJA 4C4IA 3UMWA 2W9ZB 3PP0A 3MY0A 2C0IA 2HZ0A 4CEGA 2JBOA 3CD8A 1UKIA 3I6UA 4XG3A 4BTFA 2PMNX 4BCNA 4O84A 1G8AA 4LQMA 1YOLA 3AT2A 2OFVA 2W05A 4IE9A 2E9UA 3D15A 3TG1A 3ZFXA 3P7BA 2W1DA 4UWCA 4MX9A 4RX5A 3KXXA 3VQUA 3MS9A 2GQRA 3IO7A 2CNVA 4YURA 2W06A 1OL1A 4BHNA 1O6KA 2B53A 2J6MA 2C68A 3HVCA 4R3PA 2F2UA 5CAVA 4FTMA 3A60A 3ELJA 5FP6A 4U7ZA 4E5BA 2HOGA 4GIIA 2ITQA 5EHOA 5HORA 4E5AX 4YZMA 3JVSA 3I1AA 3RNIA 2XH5A 2PVFA 4FTLA 3ODYX 4GG7A 4AE6A 4EWHA 3CXWA 2QOHA 4ACDA 2QHNA 4O91A 4U45A 3H9FA 4FTRA 1OVEA 3H9OA 3B2WA 4FI1A 4AF3A 3KB7A 4I24A 4YJOA 1JQHA 1YQJA 2ZDTA 4FSNA 3A7FA 3NWWA 4FNXA 4EK8A 3TNPC 3V5QA 4BRXA 2X2KA 4O7SA 4FIHA 3TXOA 5HZNA 2C3IB 4QMZA 5F4NA 5L8JA 4YGAA 5HESA 2G2HA 5HI2A 1JLUE 3PXYA 3PJCA 2OFUA 2YCRA 3OBJA 1T45A 1ND4A 4EC8A 1OMWA 3R04A 4CZTA 3UQCA 1HOWA 4QMSA 5D7VA 3LM0A 3WF7A 5AM6A 3HV4A 4FZDB 1DAWA 3U6IA 3PSDA 5BPYA 5LWMA 3FDNA 4QRCA 2W5BA 3DQXA 5H2UA 2VTLA 5AUWA 3SLSA 4GFGA 3PP1A 3ZLWA 3E63A 1OL7A 4Z7HA 3FKLA 3NW5A 4GT3A 4FG9A 2XZSA 3H10A 4HCTA 2YZAA 3T9IA 4HCVA 4WNOA 5CAPA 3UPZA 3UIXA 2YISA 3FKNA 1ZAOA 2FSTX 2AYPA 1REKA 2X7OA 3F9NA 3QF9A 3UC4A 3QD3A 5FXRA 4D5KA 5D10A 2BRGA 2WIPA 4XHKB 1XR1A 2XNPA 4G31A 4KS8A 5EW9A 4QP9A 3AC5A 4WBBB 1YW2A 2QOKA 3QQUA 5KNJA 4BR3A 4ZIMA 4OR5A 2PVKA 5HBEA 2CKEA 2BTSA 4YBJA 3ZRKA 4AUAA 4EWQA 1QCFA 4C33A 4KBCA 4BDFA 5BVNA 3R02A 4AXAA 4YNOA 3E62A 4XV1A 1PMNA 1KE8A 3Q32A 5CAQA 4XBRA 3N4TA 2PVRA 2UZTA 3Q9YA 4MXCA 3NUPA 5ANOA 5BX0A 5KCVA 3COKA 3PIZA 3RHKA 2W1HA 3R28A 3SKCA 4O7LA 4EH3A 4MNEA 2E9VA 5E8ZA 4R3CA 1V0OA 4RRVA 3R7UA 1M7QA 2X4FA 3Q60A 4DFUA 2YA9A 3F88A 1OB3A 3BLRA 4FF8A 4IDTA 3AMYA 4MXAA 3DNEA 3QTZA 4HW7A 2Y4IB 2O5KA 4BCIA 1PXNA 4RVTA 3FXZA 2WO6A 4FKJA 2ITOA 4IBMA 3FE3A 4MD9E 3SXFA 3IG7A 5CF4A 3MA3A 2GNIA 2H34A 5LMKA 3QD2B 4JIKA 1WZYA 5AP0A 5IA3A 1IASA 4WA9A 3OCGA 5CZIA 4O7WA 3VS7A 3EZVA 1U54B 4O86A 2BZKB 4NM7A 4JXFA 3QXPA 1RE8A 5GHVA 4YSMA 3WIGA 5JQ5A 4TW9A 1R0EA 5D41A 3FY0A 4F65A 3LMGA 3HV5A 4ITIA 3TT0A 5EQPA 3W1FA 2C30A 1JOWB 2WTKC 3I5NA 4IVAA 4EZ7A 1GAGA 1SYKA 4ACMA 4IM0A 3PLAE 3C51A 1K3AA 3O8TA 4IIRA 2VD5A 5DN3A 3BYMA 3C4FA 2G15A 2GNFA 3EQCA 3CTQA 2P55A 3W8LA 4GK4A 3QAME 2NRYA 4QQJA 1Y91A 3V3VA 3ATSA 4YZNA 5L2IA 4L3PA 2PU8A 2R5TA 4YNEA 3WF5A 3PJ3A 2WMSA 3JYAA 5CVHA 3RKBA 3DB8A 3ODZX 3NW7A 4WUNA 2JDSA 4QQ5A 3A99A 2WOUA 5AAGA 3VUTA 3FC2A 5EKOA 4AZVA 4JL9A 3PXQA 4CZYB 3SOAA 5JT2A 4U40A 3LXKA 4G3GA 5IQIA 3A7GA 3IQ7A 4PY1A 3WE8A 4IC8A 4RJ7A 4HVHA 2OGVA 2PL0A 3Q2MA 4GRBA 3UQGA 3BBWA 4Q2AA 3QZHA 4CT1A 2X9EA 5J79A 3PVUA 4FEWA 2OJFE 4KKGA 5CWZA 1NXKA 4M97A 4A07A 1Q8ZA 4G17A 2X2LA 3P0MA 4YUQA 4BCHA 2R2PA 1WMKA 1UU3A 2PZYA 2WZJA 3KMWA 5I9ZA 2I0EA 1Y8GA 4XUFA 3DAJA 4FKSA 3P23A 4I6FA 4OTGA 3ZDUA 4E7WA 5KMOA 2PVYA 2WMUA 3FMEA 5D9HA 5A6OA 2ZOQA 3C4WA 4X2FA 2R64A 2FYSA 4QTAA 4BWXA 4XOYA 4TYGA 2OF4A 4W4XA 3GFWA 5JFSA 3LFFA 4WNKA 3F2NA 3NYNA 3Q4TA 5DR9A 3B8QA 4RMZA 4DH7A 2ZV7A 3R8PA 4RWKA 5AV0A 4N6ZA 3FLYA 3WZKA 5J9YA 4YC3A 3IECA 5CEPA 3U4UA 4F7NA 1M2QA 2W17A 4YHJA 3U8WA 1GY3A 3VHKA 5CEKA 3F3WA 5DT0A 2ESMA 3CEKA 5LQFA 3OXTA 4IACA 4F1TA 1CKPA 4KABA 2EVAA 4AW5A 3KN6A 4D1ZA 4FSWA 5DT4A 4QYFA 2YAKA 3IW6A 3TNQB 2W0JA 2CSNA 3O23A 4ERWA 3TKHA 4DFNA 5C4KA 2OZAA 3E8DA 3CJFA 4ALWA 5EK7A 2P33A 2R0UA 4C61A 3A62A 5FM2A 4O7TA 4FEXA 1H26A 1XKKA 4MBJA 4GYGA 4ZAUA 2VTOA 3N4UA 4FZ7A 4EHEA 3O51A 2QKWB 3C9WA 3ORNA 4L67A 4V01A 5AAFA 1SZMA 3MIYA 3TEIA 2W1EA 5AX3A 4AZSA 2A4LA 4DFXE 4X3JA 5IPJA 5IUGA 3QKLA 2HY0A 2YEXA 2GCDA 3UNKA 3ROCA 2ITPA 4IJPA 1RQQA 4BWKA 4ZSGA 4LGGA 2XJ2A 2HAKA 4QT1A 4YTCA 5IH6A 1H27A 1T46A 4GK3A 4X7QA 2IWIA 3QFVA 4U43A 5T3QA 3R63A 3CQUA 1BYGA 4RJ4A 3LPBA 3SAYA 3LM5A 2E9OA 5E91A 4DN5A 3KF4A 2WMRA 4FTOA 4R5SA 4O7YA 4CMTA 5FM3A 5LJJA 4AGWA 4CRLA 5DR6A 5AJQA 1GIHA 3F5PA 2GDOA 4GFMA 4L8MA 3ZO3A 2J0LA 2WU6A 3DU8A 3E3PA 4JOAA 3DDPA 4G5PA 4I5PA 4RG0A 5BVEA 5CEIA 4AN2A 4UV0A 2CKQA 4X3FA 4PUZA 1FGIA 3R8UA 3VRYA 3PRIA 4AWIA 4HPTE 3SG8A 5LWNA 1JKLA 3N4VA 3NAYA 4ZP5A 4FIFA 4FV2A 5HQ0A 3QTQA 4FVQA 4RC2A 3ULIA 4NL0A 3HZTA 3ORMA 3R7YA 3SRVA 3FWQA 4BCKA 2YJSA 3LOKA 1PMVA 4JBOA 4LOPA 4FTUA 5A6NA 3ZUUA 4FIIA 4CRSA 1JBPE 2CKOA 4EOMA 3VULA 1WBOA 3QX4A 4ACHA 3LFBA 5DLSA 3MB6A 4X2JA 3I0OA 4XNEA 3VS5A 2PPQA 4BF2A 2V5QA 5JGBA 2PZPA 3ZFMA 3K3JA 3DGKA 3FQHA 4KRDA 4FGBA 2VO6A 4P5ZA 3BHYA 3C7QA 3V5WA 1YI4A 3VW6A 1OL5A 2XK4A 2VO0A 1UV5A 4NFMA 2R3KA 3ZOSA 4QTEA 2HZNA 2C6KA 3VF8A 1ZOGA 4YJPA 4RJ6A 1KOAA 5CASA 3NEWA 4ALVA 2W96B 3BELA 2YIXA 4UMRA 3DQWA 4GV1A 4NH1A 4K2RA 2W1ZA 2W1GA 3IW7A 4L44A 5C26A 5E8SA 5IUIA 2UW0A 2ZAZA 4ZLYA 4S2ZA 5DH3A 3UZRA 4CFNA 4X3FB 1FOTA 4JQ8A 4TYHA 4O0YA 4QQTA 3OCTA 5GJFA 2O3PA 3IDBA 3KRLA 3AC3A 5I0BA 2YM7A 1O9UA 4M3QA 4R78A 4AE9A 5JRSA 4ITHA 3Q5IA 4ALUA 3DBFA 3C4CA 4NIFB 1F0QA 2QG7A 5F95A 3II5A 5DI1A 5ANKA 5KBRA 4JRVA 4FKVA 1GOLA 2YJRA 1XWSA 4FT5A 4DTBA 5M06A 1VYWA 3HP5A 4ANQA 2XNNA 2PUPA 1URWA 4UWYA 5GNKA 1CM8A 4EUUA 5BUJA 4C02A 1R1WA 3DK3A 4J8NA 2CDZA 3LXPA 2CCIA 3CLYA 4NTSA 4M0YA 4HVSA 5HLPA 4BKJA 5M4FA 3LLTA 3R9DA 4BDGA 4Y95A 1PYXA 2YWVA 2YAAA 1AD5A 4FG7A 4IFCA 1W98A 4BDBA 4WG3A 2WTDA 5EI6A 3OY3A 5TR6A 3FZTA 1FVVA 3VBQA 2XIKA 4O0TA 5BYYA 4DG3E 4I41A 3COMA 3IW5A 3ZSHA 5E1SA 3O8PA 3VO3A 2VN9A 3AC8A 4EH6A 3OW3A 3NR9A 2WTIA 3TN8A 4L68A 5FXQA 4D2WA 2JC6A 2JBPA 4FSYA 3FYKX 3D7TA 5IU2A 4RJ5A 2B55A 4B0GA 4PDPA 3FI3A 1Z9XA 5AUVA 3IK3A 2C5NA 3CPBA 4EQCA 4LUDA 3RGFA 4F7JA 4ZY4A 5BUEA 2YACA 5FTOA 5HIEA 5AX9A 5L8KA 3TTJA 4EONA 3KFAA 4IWPA 3A8WA 1J91A 5JGDA 2IVTA 3R21A 4F9WA 4HZRA 2W5AA 4I0RA 3EH9A 1OPLA 2ITXA 4O0SA 5TF9A 2YABA 3RJCA 3UP2A 1UNLA 1SNXA 1Z57A 4WBOA 2BVAA 5AM7A 5L8LA 3EYHA 4OW8A 3PPJA 4EH9A 2XIZA 3LCOA 4I6BA 4KB8A 3NIZA 4TRLA 2CPKE 3KVXA 2J90A 3BEAA 2VTHA 2YM6A 3KRRA 1XH9A 4PTCA 3QTRA 3LQ5A 4QPSA 3UNZA 4Z16A 1H24A 4WKQA 1PRYA 2B9JA 3MFSA 5CNNA 5DMZA 4YZ9A 3EQBA 4JDIA 2C1BA 2QOLA 2UW8A 3G9LX 4ZTMA 4K11A 4H1JA 2WQMA 3RWPA 4NJ3A 4QTBA 4DT9A 3RBWA 3L9NA 4C3RA 3D5WA 2PWLA 4YJQA 4QMLA 4BHZA 4XG6A 5IEXA 3EFWA 2CHLA 4IB3A 4LMNA 3UG2A 2X39A 4C4HA 3KU2A 2VWYA 2XJ0A 5DYJA 4X21A 3RI1A 1M17A 3C0HA 4H3QA 2Q0NA 3R73A 4U8ZA 4DC2A 3UYTA 4GYIA 4L9IA 4IQ6A 4O1PA 1ZY5A 2F49A 1ZZLA 2OIDA 2B0QA 2ZJWA 5KKRC 1HCLA 2V62A 4LRJA 5HTCA 1ZYCA 2CCHA 3NGAA 3DT1A 3IOKA 2WQBA 4BGQA 3S1HA 3MDYA 3DJ6A 5AP5A 5CU6A 1UWHA 3NPCA 4HGEA 5AWMA 5CU0A 1OM1A 4CTBA 5J9LA 4RWIA 2JITA 3PXRA 1GJOA 2YHVA 3HDNA 3F61A 2R3QA 2PUIA 4QMNA 1FVRA 1LPUA 3QQLA 2BPMA 4GH2A 5HBJA 3Q5ZA 3E64A 5C8KA 1H00A 1PHKA 3ORXA 3R9OA 1R3CA 3HLLA 3ORLA 4M13A 2WTKB 5CYIA 4E4LA 5CF6A 3FXWA 1JAMA 3PJ8A 2C6OA 4AOIA 1BMKA 1MRVA 5JKGA 3THBA 3FMLA 3ANRA 1QMZA 2C69A 1OI9A 1P2AA 4J95A 4M69B 4EH4A 4HPUE 3DB6A 2G2FA 2IO6A 3D94A 3RM7A 3A61A 3BYOA 3CC6A 2BCJA 4HGTA 2O65A 3LCTA 4APCA 4O2ZA 4XMOA 4RIXB 4A4XA 2DUVA 1Q5KA 4CLIA 1A48A 1XH6A 4IWOA 5FBNC 3M42A 5FBOA 5HIDA 3CTHA 3R6XA 4FK6A 4FV8A 4NKAA 2OH0E 3IS5A 3LXLA 5HGIA 1ZYSA 5HG8A 2GQGA 1VR2A 4W9WA 3UO6A 4DT8A 4C4GA 4EZ3A 1OBGA 2Y4PA 3WZUA 2LAVA 4BICA 2GNGA 4GT4A 3VBTA 4UYNA 2V55A 5HE3A 3ZEPA 3B2TA 4D5HA 3F3VA 3OEZA 4BIDA 1UNHA 4MHAA 5FG8A 4O0WA 3Q96A 4QP3A 3PSCA 3QUPA 4QQCA 3R8LA 5EG3A 4EJ7A 5D1JA 3AD5A 4BIEA 4O81A 4C34A 4X2NA 4GFOA 5EW8A 3KQ7A 2RFSA 2VWBA 2JKOA 4IAYA 3G2FA 3R1QA 5JGAA 1Q41A 2QCSA 3P79A 4G3DA 5AV1A 4EHGA 2QD9A 2XK3A 3V01A 4EK3A 4JI9A 5L3AA 2VWXA 4F08A 5AA8A 3OUKA 3NNWA 5K0KA 2CGUA 1SMHA 1YI3A 4FUXA 4AZTA 4PTGA 2R0IA 1J1BA 4TNDA 1YWVA 2Z02A 4Z7GA 5J1WA 3DZOA 3EOCA 4IAKA 5DEYA 3CGFA 3ERKA 3GGFA 5CTPA 4UMTA 3RPSA 4FTJA 4BBMA 2PK9A 3KMUA 4AT3A 3GFEA 5ITAA 1U54A 2Z2WA 2B1PA 2PULA 2OJGA 1PF8A 3QRJA 4KIQA 5HO6A 3U4WA 2I1MA 4QNYA 3W16A 2RL5A 4CCBA 5GIPE 2Y7JA 3OTVA 4B4LA 4D9TA 3LCSA 3TZ7A 3DLZA 3BLQA 3MVLA 4IAFA 4Y73A 4C38A 3RAWA 4HYIA 4PPBA 3R30A 3QKMA 4NK9A 3H0ZA 4UMPA 5JFXA 5CQWA 5IA1A 3MN3A 3LJ0A 2JDVA 4BCQA 3KK8A 4XG7A 4FV6A 3EQPA 3E88A 4BN1A 5CF8A 4DLIA 5IA0A 4RA5A 4EEVA 1LEWA 2A19B 3DKFA 4J8MA 5GINE 3EHAA 5AR2A 1V1KA 1PXJA 3U87A 3PY1A 3B8RA 4KSPA 3ZDIA 3DBDA 4DEHA 4RT7A 4M69A 2HYYA 5HO7A 3DY7A 3UOLA 3U6JA 3NSZA 4OAVB 4IM2A 3OTUA 4ZZMA 3FMMA 3MVHA 3COIA 4JX7A 4BBEA 5IMEA 3OMVA 5AP7A 3RNYA 3W55A 4N70A 3JVRA 3OFMA 2ZDUA 3EJ1A 3IGOA 5ANJA 3V5TA 1R39A 2JLDA 4AZEA 3E5AA 4U0IA 3W10A 4OTFA 3ZH8A 2W7XA 4FTIA 4OBOA 3IW4A 3HYHA 3PUPA 4FKGA 4IH8A 5C9CA 2VTTA 3BPRA 3L9MA 4B9DA 4E6QA 5LVPA 3G0EA 2C6EA 2DWBA 4QMOA 3ZCLA 4FKLA 1SM2A 2HCKA 3D14A 4H3PA 4EBWA 4AN9A 2HY81 4Z3VA 3PRFA 4XH6A 3QGYA 5HNBA 4PRJA 3O8UA 5ANGA 4ZLOA 3W33A 4DEAA 3EQRA 2VTQA 4CGAA 3EFLA 4ZTRA 4J52A 1UKHA 2OXDA 3OP5A 1Q3WA 2XF0A 2WTJA 2HXQA 5IKWA 1YHSA 2FVDA 3REPA 5I5ZA 4A9YA 3EN6A 3IGGA 5EHLA 4EORA 1Q8TA 1WBNA 4H05A 1GIJA 1ZXEA 3DOGA 5C4LA 3Q9XA 3UOKA 5M44A 1WAKA 3PXKA 4RGJA 3TUBA 2BKKA 4WD5A 5H9BA 2P0CA 5LVNA 4TWNA 1Y57A 4CKJA 1J7UA 1PJKA 5H3QA 3FPMA 4ZJIA 3U55A 4KINA 3L8SA 5JH6A 4R7BA 5FXSA 4YR8A 2W99B 4O7VA 3ACJA 2XYUA 4D9UA 2XK6A 1ZRZA 4L7FA 2OW3A 2IW8A 3ZSGA 1YDSE 2IW6A 5CSWA 2IZTA 3GOKA 5GZ9A 3FBVA 2GPHA 4NM5A 4DGOA 4V04A 5ANEA 3RPOA 5B2LA 3FLQA 3CY3A 4YSJA 3QQKA 1Q24A 4JDJA 3BGZA 4ZXTA 3DBEA 5EW3A 4D58A 4UXLA 3DFAA 2ITVA 4E6CA 5C8NA 1UU9A 1H8FA 4BCOA 1L8TA 3P78A 3TIYA 2XB7A 2XIYA 1PMUA 1XH7A 3AT4A 3FMJA 4QYHA 1JSUA 4O96A 4NW6A 5L2SA 5AIRA 2ERKA 3SX9A 2PZRA 2GS6A 3QU0A 1LUFA 3R0TA 3DNDA 2W4JA 1SNUA 4FIEA 2XNBA 4JAJA 4R1VA 3VQHA 2C3JA 3C5IA 3PPKA 4G2FA 3PVBA 3A4PA 1Z5MA 2WMWA 5AR8A 4C59A 4O0VA 3TI1A 4IXPA 5ACBC 4EH8A 1F5QA 3FL5A 3C13A 5IEVA 3RINA 3ZXZA 4C2WA 2YDKA 3M2WA 2R3HA 5HE2A 1UA2A 5K4IA 2OKRA 4G3CA 3F2AA 3V5LA 2C6DA 3EN7A 3R8MA 3MTLA 3MB7A 3TL8A 1WVXA 2YLFA 1Q8YA 2R3PA 4BDKA 4FSUA 3OZ6A 3BYVA 3BE9A 2KULA 2OI4X 5B0XA 3CE3A 4M14A 2REIA 3GCPA 5HIBA 1BLXA 1YXTA 2X9FA 2F2CB 4XG9A 5E8TA 5T68A 3LLAA 4FEUA 4AZFA 2IVVA 3T3VA 4L52A 4F63A 2XKDA 5AP4A 3ZFYA 4QMQA 1RDQE 4O0RA 2BR1A 3WZJA 3LQ3A 4UWBA 2C6IA 1PKGA 2X8DA 3R1YA 4MWIA 4WG4A 1YWRA 2YDJA 3QXOA 2UUEA 4EOLA 4BGHA 1BI7A 1ZYDA 3RK7A 2ETRA 3R1SA 4UEUA 5HX6A 2ITNA 4V0GA 3CSVA 4L7SA 5K0XA 1K9AA 1SVGA 2JDRA 3CKWA 2UZBA 3GP0A 4FZAB 4QP8A 3ZBFA 2Q83A 4NEUA 2JGZA 4LRMA 3OXIA 4EH7A 3MH2A 2CN8A 4U44A 4EYJA 5K5XA 5FQDC 1ZYJA 3UTOA 2V7OA 4Q9SA 4CMOA 4DH1A 4RFZA 4F99A 4LL0A 1GZ8A 3MTFA 4PX6A 4UB7A 2ZM1A 4ZJJA 5HD7A 3RVGA 3BBTB 4EOOA 4FL3A 2W9FB 3FLWA 5DRDA 5AR4A 4AGCA 3SW4A 2IPXA 1G3NA 3KGAA 2XS0A 4IC7A 3ENHA 4F7SA 3K5UA 2V0DA 4ANBA 1YI6A 4EI4A 3IPHA 1MRYA 2XK8A 3ENMA 3NZ0A 2Y4IC 3UO4A 3I81A 4HVIA 2XJ1A 2PE2A 4FMQA 4FR4A 1XHAA 4IZ7A 4F9CA 4S33A 5J5SA 1FMOE 2JDOA 3NMUF 4QP1A 3NAXA 2C5VA 3LFAA 2OZAB 3KXMA 5BVDA 2QVSE 5AR5A 3HMMA 5HKMA 2R3JA 4JQ7A 4MTAA 2QO2A 3ITZA 3WARA 4TYJA 5TE0A 5J1VA 4FSZA 5M55A 4I0SA 3UVPA 3Q52A 4DEGA 2J0MB 5A46A 1J3HA 2B52A 4HOKA 4S32A 4FVRA 2OXYA 3S2PA 5CAUA 3RMFA 2YN8A 1Q61A 1XO2B 2RFEA 4MYGA 4TYHB 2CJMA 5DA3A 3RCDA 2G2IA 4YLKA 2BAKA 4XLVA 3FJQE 4GW8A 3F3ZA 4BDJA 3OCSA 4J98A 4U5JA 4P4CA 4ERKA 3HRFA 2UW7A 4TXCA 4I3ZA 4OBQA 4F4PA 4QMYA 4E20A 2XRWA 2YDIA 2YIYA 2XKEA 3PTGA 1PXLA 3TV4A 2VGOA 4BTJA 3NVKI 4IFGA 2AC5A 4XOZA 1JVPP 1OIRA 3HL7A 3OWPA 4IZYA 2EB3A 5A4EA 1R78A 2GHGA 2GU8A 3IOPA 1DM2A 4EKLA 2C47A 3BKBA 3EL8A 3EWHA 3POZA 5D11A 4YBKA 4D1SA 4IWDA 3R7IA 4G6NA 3E8EA 2WB8A 3QRUA 4M8TA 5AADA 2WQOA 4M0ZA 1KWPA 5TT7A 3VNTA 3JY0A 2GNLA 5EYCA 4D4YA 4UN0C 2C3LA 4W4WA 3RP9A 2E9NA 4GVAA 1WBVA 3CQEA 4JDHA 4YJRA 5H8GA 4BY9E 2IZUA 2Z7QA 4PMPA 4XV3A 3QCSA 5I3OA 3VIDA 4U6RA 3VRZA 2WHBA 3DJ7A 3LJ1A 4LUEA 3RTPA 4IZ5A 4FKPA 5GJDA 3RZFA 4YTFA 4K0YA 3SGCA 3C4EA 4XYFA 3RCJA 3QD4A 1YXUA 3R2BA 5E4HA 1B39A 2BAJA 2LGCA 1H07A 2OJJA 4QYEA 4FIGA 2XP2A 4YLLA 2UW6A 3AQVA 3AG9A 3VBWA 4NM3A 1U46A 4FZFB 5KZ0A 3MYGA 4BKZA 3W32A 5FWKK 4MF0A 2NRUA 4HGSA 4NZWB 2CLXA 3WBLA 4U3ZA 4QP4A 2EXEA 2HWOA 3NNUA 3L8XA 3ZRLA 1F3MC 4FKTA 3LXNA 5A9UA 4QO9A 4KBAA 3P7AA 5M07A 4RSSA 3QQGA 5LCJA 4GU6A 4MQ1A 3GC9A 1U5QA 3TACA 2QU5A 4DFYA 4BYJA 3EQIA 3CTJA 3FXXA 3I60A 4GCJA 4ENXA 4ZMEA 4YLJA 3BHUA 5J8IA 1QL6A 5HU9A 3PIXA 5IH4A 3BGQA 1H1QA 5CSXA 5EDPA 2P2HA 5LXMA 4QD6A 4XRLA 2C5XA 2ITZA 4KAOA 3E7OA 5CXZA 3SQQA 4KNBA 5CEQA 4USDA 4JRNA 4ACCA 5M4CA 3I79A 3LHJA 3MSSA 2B7AA 4DAWA 4W8EA 1H0VA 4M84A 4RWJA 5TOZA 4O27B 4RIWB 4DGGA 4DFZE 1DI8A 2OO8X 4H39A 4XP0A 4YHFA 3VN9A 3TZ9A 2OSCA 5I3RA 4JNWA 4S34A 1PKDA 4IVDA 1OECA 3TNWA 5BMMA 2I0VA 2QLUA 3AC1A 3OCBA 5J7HA 5IH5A 4F0IA 2GFCA 3FHIA 4BZOA 2UW9A 4GKHA 4O7RA 1FQ1B 1KV2A 5DR2A 3HA6A 3D5VA 5KMMA 3O7LB 2WKMA 5CEMA 2EXMA 4EOIA 1W8CA 3PVGA 2ERZE 5E1EA 4YU2A 1YDRE 4G16A 2PVJA 2AC3A 3UMXA 2HXLA 1XH4A 2GS7A 4A06A 4G1WA 4AOJA 5A4QA 3VS4A 1QPEA 3HV7A 5EHYA 3O7LD 1IG1A 3PXFA 2ONLC 3V8SA 3QTWA 3QX2A 4EH5A 5HCXA 4DITA 3BU5A 4LV5A 4UALA 4TY1A 4YZCA 2XM8A 3QRTA 2EUFB 3D4QA 4D0XA 1V0PA 2Z60A 2Z7LA 4BZDA 4J99A 3NUYA 1WBSA 4DG0E 2ONLA 3PJ1A 3QC4A 2B9HA 5C1QB 4U41A 3DXPA 3FMNA 4I4FA 4AZWA 4L45A 4M67A 2ZMCA 4BTMA 4R8QA 4NU1A 5E7RA 2E2BA 2G9XA 2XKCA 5E90A 3OS3A 5AP6A 4BC6A 2OLCA 4GJ3A 2VTPA 3IW8A 3PG1A 2OIQA 3F7ZA 4EJNA 5CAOA 3FI8A 4G3EA 5AR7A 3HDMA 3HAMA 3NUNA 3RHXA 3DXNA 1OUKA 2QOOA 4DEEA 3ETAA 2HIWA 4BCGA 4AP7A 2J0JA 3GXLA 3HA8A 4EZ5A 3PPZA 4F6UA 5CZHA 4USEA 4CNHA 2OU7A 2PY3A 1LP4A 4EQMA 4C37A 5EI2A 4B99A 3ID6C 2QLQA 3CJGA 3H4JA 3VWAA 2JAMA 4DE4A 5L2WA 1JSTA 4MF1A 3OWJA 1FVTA 4DLJA 5BUIA 5ETCA 2JAVA 4I92A 2J9MA 3TJDA 4DGNA 2EU9A 5ETAA 5L6OA 3QZGA 5EI8A 2IJMA 2OIBA 2QU6A 4MWHA 3PSBA 3KXHA 3DXQA 3LJ2A 3FEGA 5BVFA 3TJCA 4OUCA 5G6VA 3QRIA 3A7HA 3DPKA 4ZS0A 4IZAA 2X4ZA 1H1SA 2P4IA 3ORPA 2QO9A 2BZJA 2BILB 2XYNA 3UIMA 4NUSA 5K5NA 5FUTA 5BNJA 1WBTA 3ZO1A 4YTIA 2OBJA 2QNJA 2YERA 3LCKA 4IB1A 2FH9A 2I7QA 1J7LA 4HNIA 3KULB 3VS6A 5LMAA 1BI8A 2CMWA 2Y8OA 4FV0A 4MXYA 4RIWA 5LMKC 4H1MA 4AGUA 4C36A 4PF4A 4NTTA 4BB4A 1DAYA 4NKSA 4BYIA 3BZ3A 3GQIA 3CS9A 4L42A 5EM8A 4E8AA 1PXIA 1ZOHA 3IONA 2XUUA 2WTVA 2BZIB 4TKSA 2VU3A 5E8VA 2QOBA 4AA0A 4GUBA 3W2PA 4F0GA 4C8BA 3PIYA 4FIJA 2YCQA 2W1IA 3QA0A 4B7TA 3SDJA 4YMJA 4L00A 5AMNA 2PVMA 1VYZA 2YLEA 3FYJX 2B9FA 1H1WA
chains in the Genus database with same CATH superfamily
5M56A 3FZOA 4CFWA 5AUTA 3WIKA 1RJBA 2B54A 2BZHB 1RW8A 3OUNB 4ITJA 5FEDA 2I6LA 4RIXA 4CFMA 2CNQA 3DBQA 5IQHA 4FKOA 4KBKA 3GU5A 3HEGA 4MXXA 5L6WL 3SRVB 4DHIB 3SVVA 5F94A 4KUJA 5FTGA 2DQ7X 3GQLA 4UBAA 2GSFA 3VJOA 3TNHA 3SXRA 5EQYA 3CIKA 4II5A 5ETIA 3R7VA 3RPYA 3VVHA 3MPMA 4V0GB 4OT5A 3VF9A 2E9PA 2VWWA 1WVYA 3P08A 4HJOA 4EC9A 5DNRA 5FEEA 1IAHA 3ZUTA 1NY3A 4C57A 2CKPA 3FZRA 3OHTA 4X6RA 4A7CA 3QKKA 4R7HA 3UP7A 1WBPA 3QZIA 4HZSA 1TQMA 3R7GA 1FINA 3PA3A 2G1TA 4TYIA 1XJDA 2F7ZE 4AFEA 1BUHA 3WF9A 5HBHA 3EQGA 1OIYA 3BE2A 3CP9A 3Q04A 4J71A 4JG7A 4YPDA 2GMXA 3BWJA 3QBNA 1X8BA 1H28A 2W5HA 3MFTA 2Z7SA 2WIHA 2NNWB 5AFVA 2UZEA 3AGMA 1H08A 5DBXA 1KOBA 1W82A 2BRBA 3FKOA 1XQZA 4AW1A 4F9YA 5ANIA 4CVAA 4G5JA 5KBQA 3FMDA 3DA6A 3Q4ZA 1PXOA 2OJ9A 5HU3A 3Q6WA 3NX8A 4FV3A 2WMAA 3O0GA 1A9UA 5HTBA 1IA9A 5JFVA 3E93A 4WSQA 2AUHA 2BDWA 4M15A 4EOQA 4ORKA 4WUAA 4M68A 3KVWA 2H8HA 4HGLA 3EQDA 5E8WA 2RGPA 3COHA 5BV3A 1NA7A 2PVHA 3GC0A 3NS9A 2XK7A 4B8MA 4BL1A 3BIZA 4WO5A 5KMIA 1FPUA 4YTHA 3K54A 5J5TA 3PZHA 3QLFA 5AUYA 3KMMA 5JZJA 3HX4A 3GBZA 4WHZA 2XNOA 3FQEA 3BV3A 4KKEA 4L46A 5HVJA 3F2RA 3MH0A 1KV1A 3FV8A 3TKUA 2UW5A 4ANNA 2J0IA 2X81A 4ZTLA 3OOMA 3VS3A 1Q4LA 1KE5A 3CPCA 4FOCA 3QGWA 4AAAA 2JIVA 4WRGA 2O2UA 4GT5A 2IVSA 1Y6AA 3P9JA 4RZWA 5CQUA 1QPJA 4DH3A 4Y46A 4TYEA 3D2IA 4E6DA 3ORIA 3ET7A 2BRHA 2XRUA 3KXGA 4CFFA 3OVVA 3BHVA 4FTNA 1OIQA 2FSMX 4G9CA 4GSBA 2PZIA 2WTCA 3KRJA 3FUPA 4I23A 4QPMA 5CU2A 2FO0A 3UIUA 1P4FA 2VX1A 3R9HA 2NP8A 2A0CX 3MGYA 2R3NA 4FZ6A 2YCSA 4KIKB 4FE2A 3C0GA 2VUWA 5CS6A 3WF8A 3AT3A 4PL5A 4FVPA 2R4BA 4DH8A 4KWPA 2PVNA 5HVYA 2QOFA 3DKCA 3V6SA 5CEOA 4EL9A 4KIKA 5JSMA 4D4VA 5CVGA 4TTHB 3WI6A 2KTYA 1AGWA 1VJYA 3LQ8A 3N51A 4LI5A 2YITA 4NSTA 2PHKA 3NYXA 4GUEA 3ZXTA 2OZOA 4WNPA 4JBPA 3QTIA 4FYOA 2GNHA 1GNGA 4L6QA 4QMVA 4ASEA 3PUFC 4E4XA 4G6OA 4FBXA 4WG5A 2NPQA 2BHEA 2J4ZA 3PVWA 3ALOA 3P1AA 4I94A 5JZNA 4CZUA 5KX8A 5CX9A 3NUUA 4K6ZA 3FC1X 5I9UA 4FG8A 3GCVA 4D1XA 4N57A 2VO3A 4MUQA 4F1OA 1U4DA 1R0PA 3HMIA 4FT9A 3DAEA 4IWQA 1H1PA 3F5XA 4IJ9A 3DAKA 3F82A 4L3LA 4N6YA 3ULZA 3LKMA 3AMAA 2UV2A 3LE6A 2XIXA 5LVLA 4BDAA 2CNUA 1Q8UA 4DG2E 5IDNA 2HZ4A 3TZ8A 1IRKA 4IMYA 2SRCA 2R3IA 4RX8A 4TL0A 2WAJA 3R9RA 4FV9A 4A9SA 3EKNA 3KF7A 4WNMA 4MXOA 4U81A 3H0YA 4GVJA 5DHJA 4FX3A 2VWVA 5EM6A 2C3KA 5J7BA 4DCAA 5L4QA 5L6PA 1VLRA 3FSFA 4MD7E 2X1NA 2UZLA 2B4SB 4TT7A 3L9PA 2R3LA 4O0XA 3WE4A 2RSVA 4W4VA 3ROYA 2HW6A 2XBAA 2XVDA 2RG5A 2YM8A 3BYUA 4G3FA 4YJVA 3VUMA 4RC4A 4BCJA 4BI1A 2VTMA 3L8VA 3LFSA 4I21A 4JBQA 1YRPA 2X2MA 3I6WA 2IN6A 3KY2A 3R00A 4ZTNA 5JRQA 2QONA 1NW1A 4EK4A 2BUJA 2EB2A 2ETKA 1CMKE 4FICA 3EN4A 4CFXA 4XG4A 5AV4A 4YJNA 2C1AA 3C50A 3OY1A 4XV2A 3FQSA 2WMQA 1URCA 4AGDA 3S0OA 4RVKA 4Y72A 4CMUA 3EIDA 4IVCA 3BQRA 3MIAA 4ASDA 4FV7A 3FI4A 3RPRA 5M57A 3LMHA 2OWBA 4MBIA 5HOAA 3KCFA 3OF0A 3ORTA 4HYUA 3W0MA 5IMXA 3LFDA 5BVKA 3I7CA 4I5MA 3ZZEA 4MNFA 3R9NA 3N9XA 4FSRA 2F9GA 4O7NA 3KEXA 2PTKA 5CT0A 2WGJA 3FI2A 2VGPA 2YIQA 4X2GA 3RPVA 4U9AA 4WT6A 3DV3A 2OG8A 2XKFA 3QA8A 5HCYA 3R7EA 4C58A 4C4JA 4CYIA 3G51A 5K4JA 3LFNA 3HP2A 4QP6A 2PZ5A 1UU8A 5CALA 3TNIA 4MEDA 2OH4A 2PUUA 4UXQA 4QTDA 1FBNA 2VWZA 3QTSA 4GU9A 4ZEGA 4HYHA 5IDPA 4DBNA 3G15A 2BHHA 2FSOX 4EH2A 4J53A 4JAIA 4UYAA 3HRCA 4FTQA 1KSWA 2VZ6A 4L3JA 3VS0A 1LEZA 4PNKA 4ANSA 2J51A 4QP7A 1K2PA 2ACXA 5M08A 3SV0A 3GU7A 5BMSA 2PSQA 2QR7A 3NYVA 3MV5A 4D2RA 4PP9A 3GC8A 1JSVA 5IG1A 2QOIA 2PMOX 2IW9A 3BRBA 1XH8A 3LFCA 5FDPA 5E9EA 4EK5A 5HX8A 4E5WA 2VTSA 3QYZA 4QMMA 3BQCA 3PYYA 3R22A 3IDPA 2YWPA 3MJ1A 4FTAA 4QMTA 4Y83A 3UBDA 3WOWA 3D0EA 4IX4A 4JG8A 4DH5A 2GHMA 2WQNA 3FL4A 4RFYA 5KHXA 1S9IA 5EFQA 4IX5A 5D12A 2QOQA 4WSYA 3KKVA 5BYZA 4JR7A 4EQUA 3KULA 1MRUA 3E7VA 2WMTA 3ZSIA 4OGRA 1GZOA 2P2IA 2XIRA 3OD6X 5DE2A 3BCEA 2XCKA 2VAGA 3EL7A 3FMHA 2RF9A 4ID7A 4RIYA 1CSNA 5E8UA 3D9VA 2A2AA 3LAUA 5IQAA 4RX7A 4O2PA 4E3CA 4TNBA 2WD1A 1J7IA 2GS2A 3QWKA 3EN5A 4IEBA 2VTRA 4DHFA 5A3XA 4XG2A 4MVFA 2RFDA 1S9JA 2VNYA 1Q99A 3G6HA 3LFQA 4NFNA 3BWFA 4PV0A 4X0MA 4FKRA 1JPAA 5TO8A 4L43A 1OKZA 1L3RE 2YM4A 4G34A 2J2IB 4L53A 4AX8A 3KREA 3NCZA 3QHWA 3CY2A 3TCPA 5A4LA 5A54A 5I9VA 5L2QA 2HELA 3TWJA 5J9ZA 4N0SA 5CSHA 3RWQA 4DEBA 4E4NA 4RQKA 3L1SA 3QCXA 2GHLA 3D5UA 4R5YA 3PLSA 2XMYA 4NCTA 3OWKA 2XM9A 3OWLA 3HRBA 3UOHA 3TV7A 3NUAA 2XNEA 5FD2A 2OK1A 4E73A 2WNTA 3Q3BA 3RM6A 5JFWA 5FDXA 3FSKA 3RK9A 3DZQA 4AN3A 4OTWA 4WIHA 5I9XA 4BI0A 1STCE 2OICA 4QPAA 1W0XC 3H30A 4W9XA 4XV9A 3BI6A 4NCTC 1OL6A 4NJDA 5E8YA 1BKXA 3F7WA 3NCGA 1QPCA 3CQWA 3FMKA 3GENA 2X6EA 4QTCA 5AR3A 3QLGA 4OTDA 4FV5A 5HG7A 4XS2A 2BIKB 4GEOA 1QPDA 4O6LA 2YFXA 2ZB0A 4IAZA 1V0BA 2V7AA 2BIYA 3KCKA 5HLWA 4XEYA 5J87A 2CN5A 2UVYA 4YZBA 4U97A 5AUZA 3VUDA 5DGZA 4RLLA 4K9YA 4M66A 3E87A 3POOA 2UVXA 4UMQA 3UJGA 3BHHA 5A4TA 3U54A 3FPQA 3W0SA 2I40A 5DIAA 2BDFA 4EYMA 2GTNA 1OITA 2PVLA 3G0FA 4W4YA 5HE0A 3CCNA 4RVMA 1TVOA 4PQNA 3T8OA 3UPXA 3VHEA 5LMBA 4RZVA 2GFSA 1M2PA 5LCKA 1W7HA 3FLNC 2UZDA 2HENA 2ITUA 3DK7A 4FNWA 3K2LA 1BX6A 3RALA 2UZNA 3OT3A 3C1XA 1H25A 4NYEA 3JR1A 2JIUA 3SOCA 3JS2A 4JX3A 4C4FA 3ORZA 5AEPA 4ZOGA 2YM3A 2ITWA 2QO7A 3RZBA 2QURA 3FZSA 1GZKA 2C6TA 3F69A 5HNGA 2XANA 3TTIA 4ZY5A 4IW0A 5IQBA 1O6LA 4O4FA 1M14A 5ACKA 4ZSAA 3UOJA 3VS1A 4JJRA 2UZOA 4GG5A 3HNGA 4I5HA 4NWMA 3S95A 3F3TA 4F6WA 2WOTA 4O22A 3IKAA 4A4LA 3HKOA 4BGGA 5DPVA 1O6YA 3NRMA 1ZARA 4UZDA 2WMBA 4CD0A 4F7LA 4O7ZA 4EHVA 3RAHA 4QDVA 5IQEA 1APME 3AOXA 4OLIA 4QOXA 2CGWA 3H3CA 5EH0A 3AC4A 2A27A 5JEBA 3KC3A 3U9CA 1UVRA 4FC0A 3SW7A 4IANA 3T3UA 4MH7A 5B2MA 5AP3A 1WCCA 1JKSA 3ZYAA 2YCFA 4RX9A 4D28A 3DBCA 3HMNA 4MKCA 3EQHA 3WILA 3NUSA 2X8IA 5K3YA 4RWLA 4E1ZA 3MESA 4Q5EA 1PMEA 4AW2A 4YO4A 3W0NA 1Q8WA 3GU6A 2VWIA 4CG9A 4FNZA 3PFQA 4QDEA 3KRWA 5T6KA 1PXKA 3E3BX 4LG4A 4PWNA 3ZC6A 4AG8A 4OTIA 2HW7A 4TZRA 5IA2A 3VW8A 4FK3A 4FGRA 1KE9A 4BDCA 3VBVA 1ZY4A 5DWRA 3PY0A 3CGOA 3GCSA 4RIYB 3BGPA 1NVSA 4HYSA 3I0QA 5B7VA 5CNOA 5EDQA 4ZY6A 3LIJA 4IHPA 4LGDA 4RLKA 4USFA 5LVOA 1H1RA 2VTIA 3MH3A 2WEVA 2PYWA 2JFMA 4BCPA 4I0TA 3W2CA 3AD4A 4GK2A 2JFLA 4AXDA 1A06A 1M2RA 3Q9WA 2W1FA 2FUMA 3UQFA 3C4XA 2RG6A 3HMPA 4XRJA 3G9NA 4I6QA 3W2SA 5IQDA 4U42A 4DFBA 4RBLA 4CT2A 3ZM4A 3JPVA 5C01A 1VZOA 4PTEA 4RA4A 3G6GA 4F6SA 1Y6BA 3ZEWA 1Q3DA 4YJSA 5AV3A 5B2KA 3SHEA 3UZTA 4IX3A 3DKOA 4IAIA 2VTAA 3ACKA 3OOGA 4DINA 3VJNA 4E26A 5H8BA 2GNJA 3K5VA 3U9NA 1BL6A 4BCFA 5CI6A 3A7JA 5CSVA 1GZNA 3FY2A 3R7OA 4O4BB 3DKGA 3R83A 2RFNA 4HNFA 4FL1A 1OBDA 4D2SA 4O83A 2HK5A 4ANLA 4R77A 3OC1A 4KSQA 2XNGA 3AXWA 2WFYA 4AA4A 4RPVA 3AD6A 3MA6A 4F1MA 1OPKA 3PJ2A 4F78A 3VBYA 1H01A 5EOLA 3K3IA 3MY5A 4AQKA 5E8XA 4ACGA 5HD4A 4DEIA 5KUPA 4JR3A 2F7XE 4PMMA 4XP2A 5C27A 4I6HA 2QOCA 4K77A 1AQ1A 3Q53A 4N4SA 4YC8A 2BFXA 4AS0A 4BTKA 3NDMA 1PXPA 3DS6A 2ZYBA 3Q9ZA 3VUIA 3DFCB 3TV6A 5FRIA 4C35A 3RAKA 4CSVA 3P5KA 4I6LA 3LVPA 2BTRA 1U5RA 2VX0A 4H3BA 2VRXA 2WXVA 4DDIA 5IZFA 2PMLX 3F5GA 3UDTA 1YDTE 3MI9A 1FGKA 2VX3A 5GJGA 5AP1A 2ZVAA 4A4OA 3U51A 4JIAA 4IAAA 3LW0A 4R6VA 5KZIA 4V05A 4E4MA 2UVZA 3PE1A 4H36A 4FKIA 5DRBA 4GIHA 3E8NA 5BVWA 2AEGA 2R3MA 3PA5A 3QCQA 4X6QC 5FTQA 4ZJVA 2HWPA 2IZRA 5DT3A 5HG9A 4FV1A 4Y85A 3UE4A 3VUGA 4FODA 4ASZA 3PY3A 4A9TA 4ZSEA 2X7FA 2VV9A 4RVLA 4QMWA 2QC6A 3UGCA 4MAOA 5EYDA 1YHWA 2PUNA 5I9YA 3CD3A 4J97A 4ZMFA 3UG1A 5M4IA 5ANDA 1OPJA 1NT2A 4OTQA 4MQ2A 2VNWA 1W83A 2QHMA 4O6EA 2HZIA 2VTJA 5AIKA 5HCZA 3AC2A 3JY9A 1ZWSA 4OBPA 2H9VA 2R3RA 4QYYA 4RFMA 3T9TA 4F0FA 3UODA 1W2FA 4D55A 3ANQA 3QTUA 4RJ8A 3S4QA 1UU7A 5IQGA 1OKYA 3BEGA 4KKHA 3GCQA 4QMPA 4Y5HA 3RAIA 3KRXA 4HVGA 3PWDA 4CFUA 3MFUA 5HE1A 1YVJA 1P14A 2OJIA 3W2RA 4OAUC 2F57A 3KXZA 3FHRA 4W8DA 3ZUVA 4LOQA 3BYSA 4EKKA 3TYKA 5LVMA 3BLHA 4WRSA 4KIOA 3EQFA 2AQXA 4X3FC 4FOBA 4ANMA 4IM3A 4YJTA 1HCKA 4FKQA 2YIRA 4QYGA 3VUHA 5KHWA 3TM0A 3QQHA 3UVRA 2JKQA 3FLZA 5CT7A 5DFPA 3HAVA 5CSPA 3HUCA 5BVOA 2R7BA 2XA4A 4O4CA 4AW0A 5FEQA 1YOMA 4D0WA 1CKIA 4FV4A 1TQPA 1VEBA 4PMTA 1KE7A 4FT0A 5CU3A 3C4ZA 4MD8E 1YKRA 1EH4A 1M7NA 1UNGA 3GC7A 1KE6A 3ZO4A 4C0TA 5IISA 4JS8A 5J95A 2FB8A 4CLJA 4UX9A 4CG8A 1JKTA 4XJ0A 4I1ZA 3ZC5A 4QEBA 3CBLA 3GT8A 4CFVA 3EN9A 3ZS5A 5E92A 5AUXA 2JIIA 3QUEA 2BFYA 1I44A 1CKJA 2ETMA 3QL8A 3FAAA 4CQEA 3SD0A 4QMUA 4EK6A 4EBVA 3ZMMA 3ORKA 3PZEA 3C5UA 2PE0A 4HCUA 4YO6A 1DI9A 3O17A 4MK0A 3ALNA 3W2OA 3WF6A 1M52A 4RQVA 3NW6A 2NO3A 4XBUA 5HNIX 3WZDA 3SA0A 1WBWA 3LZBA 4FUYA 3I5ZA 3I7BA 3QUDA 4FRFA 5KE0A 4JVGA 2IG7A 3UO5A 1H4LA 3P4KA 3V8WA 3MH1A 2R7IA 4BKYA 1CTPE 2CGVA 3F3UA 4MXZA 3OEFX 4P90A 4I4EA 1UWJA 3NYOA 3PE2A 1ZOEA 1IR3A 4PPCA 4C3PA 3V04A 4PPAA 2GTMA 5KMJA 5I4NA 4UZHA 3D2KA 4E6AA 4JG6A 1JNKA 3ZZWA 4TPTA 3F5UA 1P4OA 3KN5A 1W2CA 2WQEA 4S31A 4YPSA 4BFMA 2JDTA 5AP2A 3CKXA 4JQEA 4F70A 3EFKA 3NLBA 4U79A 1ZMWA 3TUDA 4D2VA 2UW4A 3HUBA 4RJ3A 3TDWA 2PE1A 4BZNA 3M1SA 4R7IA 3OG7A 3S3IA 4G6LA 3DJ5A 4YZDA 4EOJA 4ZZOA 1KUTA 4EHZA 5KO1A 5FGKA 2BDJA 3G5DA 3LCDA 3R1NA 5CI7A 1XBCA 4UY9A 1U59A 4IB0A 4AOTA 3GVUA 5HICA 2O64A 5HLNA 2C5YA 2ZB1A 4MBLA 5C03A 4A9RA 3O96A 3W18A 2IVUA 2X6DA 5F1ZA 1ERKA 3MPAA 2R3GA 3TDVA 2QQ7A 5EM7A 3P7CA 3BL9A 4MCVA 4U80A 4FYNA 4XG8A 3A7IA 4FNYA 2XARA 5FLFA 5A4CA 4B8LA 4X2KA 3WYYA 4QP2A 4FTKA 3W2QA 1CDKA 5IQCA 4FSMA 4ZTSA 1YXSA 4PL3A 4UMUA 1XMLA 3FZPA 1ZYLA 4FT7A 2XK9A 5FP5A 4AA5A 4DTKA 4ENYA 5CF5A 1PYEA 4GL9A 4H58A 2R9SA 3VUKA 2XEYA 4A9UA 4BCMA 4DGMA 3TZMA 4FKWA 4RC3A 2X8EA 2Q0BA 4IB5A 4JDKA 2A1AB 4DYMA 5LOHA 3LFEA 2XEZA 4AU8A 3PDTA 3Q2JA 5IUHA 4NW5A 1BL7A 1P5EA 3ZLYA 3EFJA 3V6RA 2G01A 3MVMA 3L8PA 3QWJA 5LARA 2RKUA 3ATTA 4NT4A 1MP8A 4FKUA 4GMYA 3V8TA 4CV8A 1OGUA 3OW4A 3KXNA 4KD1A 4ZSJA 4ARKA 4BDHA 2FGIA 4K18A 3AGLA 1B6CB 5BQ0A 3ZLXA 4O82A 2F7EE 2C5OA 3A2CA 3A8XA 3G33A 2X0GA 4C3FA 5CY3A 5BYLA 4KS7A 2R3OA 1LR4A 3DLSA 4TWCA 3EYGA 3DTCA 3KL8A 4FL2A 5ICPA 2F4JA 3I4BA 3SG9A 2XCHA 1YWNA 5CU4A 3BU6A 4U3YA 4Z9LA 2UZWE 3C0IA 4Y8DA 4DTAA 4O0UA 4DCEA 4I93A 1XBAA 4PMSA 3ZRMA 5G1XA 4Y5QA 5JK3A 4PDYA 3TUCA 3PG3A 3H9RA 3MWUA 4C4EA 2XALA 3OT8A 3QTXA 5F9EA 2C0TA 2Y9QA 4DFLA 4IDVA 5M51A 1PW2A 3TKIA 2BALA 4GS6A 1JWHA 5A14A 5IEYA 4K8AA 1G5SA 2VO7A 3WZEA 4F9AA 4CKIA 5AA9A 3MVJA 2Y6OA 4LRKA 4EOSA 5L2TA 2WU7A 4O21A 3EB0A 5IQFA 5HEZA 4C7TA 5M09A 3HV6A 2WELA 4LMUA 4YJUA 5H8EA 3Q4CA 4P7EA 1TKIA 4ZK5A 4BDIA 4KIPA 3V5JA 4CYJA 1ZZ2A 4LFIA 3ZBXA 5KMLA 3ZU7A 3PXZA 3KA0A 2O8YA 3O71A 3VAPA 4BDDA 5AV2A 3GUBA 4E93A 1OKWA 4ZLZA 2BAQA 4NM0A 5HO8A 5EM5A 3VC4A 3QYWA 4KA3A 5HG5A 4PP7A 5IA5A 4AFJA 2DYLA 3MBLA 2V22A 1G8SA 4LYNA 4K33A 3SC1A 2Y6MA 3QQFA 3HGKA 3O50A 4XP3A 4Q9ZA 3QRKA 3HECA 4GJ2A 5D7AA 1H0WA 4NIFA 2QODA 3QC9A 3F6XA 3FZ1A 5DVRA 3ZTXA 5GIOE 4ZSLA 2UZUE 4LOOA 5CENA 4CTCA 4AXEA 4OTRA 4P2KA 1MUOA 4LGHA 1IEPA 2YZLA 4PDSA 3FLSA 5DOSA 2CLQA 1MQBA 1Q62A 4I5CA 3UVQA 3MY1A 2YM5A 2ZV8A 2FA2A 4O1OA 4FEVA 5KMKA 2ITYA 3NNXA 1GIIA 3GCUA 4BI2A 3QHRA 4EUTA 2WEIA 2H6DA 3ZONA 2Y0AA 3DDQA 1J1CA 2FSLX 1SVHA 2J5FA 5EOBA 3JXWA 2ZMDA 3PWYA 4M12A 4YHTA 4C2VA 3UC3A 5CLPA 4IX6A 1OUYA 5EYKA 2VTNA 1TQIA 2WMVA 4OT6A 4ZZNA 4ZS4A 3SXSA 2EWAA 5EDRA 3BV2A 3IDCA 4R3RA 4J7BA 3BU3A 3ZLSA 4OTHA 2OXXA 3NNVA 2H96A 2BRMA 2X0OA 5ETFA 5C8MA 5K9IA 3ZM9A 4XLIA 4BIBA 4BDEA 4IADA 3VBXA 4K1BA 4ASXA 2WPAA 3AMBA 5HHWA 4CCUA 4CKRA 5EYMA 4FT3A 3A4OX 4XCUA 1Y8YA 3D5XA 1OZ1A 3NUXA 2B9IA 2C0OA 4DHZA 2JKMA 5M53A 1JKKA 5EQEA 3GEQA 2ZV9A 4J1RA 3E8CA 1ZMUA 1YXXA 4DDGA 1PXMA 4DHJA 2ZM3A 3DTWA 4F09A 2JKKA 2J0KA 3EMGA 1E9HA 3L9LA 3GU8A 4RIOA 1WVWA 3ML1A 4AACA 2YIWA 2I0YA 2P3GX 2PMIA 1I09A 3GU4A 4FTCA 3D83A 4BBFA 2ZM4A 1PY5A 4DA5A 4DEDA 4AT5A 4S30A 1MQ4A 2ITTA 2JEDA 4P5QA 3MJ2A 3D7ZA 2BRNA 2O63A 2W4KA 5I9WA 2J50A 3EZRA 3QD0A 5CVFA 1NVRA 3UIBA 4MNEB 4O38A 3HMOA 1E1VA 3W8QA 3EKKA 2Z7RA 5IA4A 4TWOA 3GI3A 3UZPA 3NIEA 3RK5A 4M7IA 4Q5HA 1XBBA 3OXZA 4FTTA 3D7TB 3S00A 1E1XA 3MW1A 5DEWA 2WTWA 3V5PA 3QZFA 2RIOA 3CR0A 3KK9A 4PDOA 2CGXA 3O2MA 4QMXA 2GQSA 2W4OA 4ZTHA 3QCYA 4I20A 4PL4A 5DG5A 4G9RA 5F20A 4HVDA 4KRCA 3OBGA 4LM5A 1REJA 4Z55A 3DCVA 4QNAA 4YC6A 5CANA 3MPTA 3GB2A 4JT3A 1XH5A 2C4GA 4AQCA 4D2PA 4CV9A 2DS1A 2ZV2A 2I0HA 1SVEA 3UYSA 1IAJA 2QI8A 4JBVA 3BX5A 3GNIB 3JUHA 4D4SA 4BVUA 2JD5A 3V51A 2Z8CA 3TIZA 1ATPE 4ANOA 4BWPA 1YXVA 3LMIA 4J96A 1ZMVA 1DS5A 1OIUA 2C6LA 3G90X 1W84A 4D4RA 4CXAA 3OROA 1Q97A 4I22A 5M4UA 3U6HA 3ZO2A 1FMKA 3R8VA 2C6MA 2VWUA 4F9BA 2J7TA 5GZ8A 3R01A 2W1CA 4PNIA 4XX9A 4EOKA 2UZVA 2O0UA 3BHTA 3E92A 3PA4A 4WOVA 5TKDA 3WYXA 5EKNA 3Q6UA 5HVKA 5KKRB 4L01A 4C62A 3R8ZA 2WMXA 2QKRA 3UDBA 4ZTQA 4JLCA 4AT4A 3R2YA 5HTIA 4FA2A 2J5EA 5IF1A 1YHVA 4LV8A 3ZHPC 4APPA 4AAYA 3W0OA 4FSQA 4FSTA 3UNJA 2XNMA 2BKZA 2X7GA 3M11A 4R1YA 4FEQA 1OL2A 2BMCA 3F66A 4DGLC 1NVQA 3DK6A 4TWPA 2BROA 1OKVA 2R3FA 5JMSA 4GKIA 3HV3A 4F64A 4DF3A 2IZSA 4OTPA 2QR8A 1IA8A 2QG5A 4ONAA 4B6LA 1WFCA 3P86A 5CXHA 5AAEA 3NVMB 5KMNA 2EXCX 1B38A 5JN2A 4EOPA 4LL5A 5JQ8A 2OF2A 2UW3A 4D2TA 2XBJA 3GOPA 3Q4UA 1YOJA 4DBXA 4TN6A 3MFRA 3R71A 5GZAA 1ZLTA 2X0QA 3QALE 4IVBA 4YP8A 3VS2A 4CQGA 3QQJA 4C4IA 3UMWA 5AUUA 2W9ZB 3PP0A 4O4EA 3MY0A 2C0IA 2HZ0A 4CEGA 2JBOA 3CD8A 1UKIA 3I6UA 4XG3A 4BTFA 2PMNX 4BCNA 4O84A 1G8AA 4LQMA 1YOLA 3AT2A 2OFVA 2W05A 4IE9A 2E9UA 3D15A 3TG1A 3ZFXA 3P7BA 2W1DA 4UWCA 4MX9A 4RX5A 3KXXA 3VQUA 3MS9A 2GQRA 3IO7A 2CNVA 4YURA 2W06A 1OL1A 4BHNA 1O6KA 2B53A 2J6MA 2C68A 3HVCA 4R3PA 4LDTA 2F2UA 5CAVA 4FTMA 3A60A 3ELJA 5FP6A 4U7ZA 4E5BA 2HOGA 4GIIA 2ITQA 5EHOA 5HORA 4E5AX 4YZMA 3JVSA 3I1AA 3RNIA 2XH5A 2PVFA 4FTLA 3ODYX 4GG7A 4AE6A 4EWHA 3CXWA 2QOHA 4ACDA 2QHNA 4O91A 4U45A 3H9FA 4FTRA 1OVEA 3H9OA 3B2WA 4FI1A 4AF3A 3KB7A 4I24A 4YJOA 1JQHA 1YQJA 2ZDTA 4FSNA 3A7FA 3NWWA 4FNXA 4EK8A 3TNPC 3V5QA 4BRXA 2X2KA 4O7SA 4FIHA 3TXOA 5HZNA 2C3IB 4QMZA 5F4NA 5L8JA 4YGAA 5HESA 2G2HA 5HI2A 1JLUE 3PXYA 3PJCA 2OFUA 2YCRA 3OBJA 1T45A 1ND4A 4EC8A 1OMWA 3R04A 4CZTA 3UQCA 1HOWA 4QMSA 5D7VA 3LM0A 3WF7A 5AM6A 3HV4A 4FZDB 1DAWA