5CF5A

Crystal structure of janus kinase 2 in complex with n,n-dicyclopropyl-7-[(dimethyl-1,3-thiazol-2-yl)amino]-10-ethyl-3-methyl-3,5,8,10-tetraazatricyclo[7.3.0.02,6] dodeca-1(9),2(6),4,7,11-pentaene-11-carboxamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
292
structure length
287
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Structure-Based Design of Selective Janus Kinase 2 Imidazo[4,5-d]pyrrolo[2,3-b]pyridine Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 287
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5cf5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5cf5A01
5KUPA 2QOCA 3KK8A 3BV3A 1SVEA 2V5QA 2C3LA 3ODYX 4MNFA 4JBQA 2UVXA 2H8HA 4QPAA 5CASA 3F5XA 5KE0A 4DEAA 1ZY5A 2E9PA 4BCGA 4DBNA 5HQ0A 3Q32A 4LI5A 3GQIA 3AC5A 5HG7A 2QD9A 4QMTA 1TVOA 4EOIA 1JPAA 2JKKA 3DFAA 2W96B 4N6YA 4UWBA 5IF1A 4LGGA 4R7IA 1PJKA 3OY1A 4LUDA 2WNTA 4ZSJA 3C4XA 3P4KA 1UKIA 3EFJA 5CENA 2JIIA 3C5IA 2CPKE 3FBVA 3ZUVA 3ORXA 3LM0A 4HNIA 2VTHA 3SX9A 4XG9A 2ITOA 4KBAA 4CRSA 5AIRA 3A99A 3WF5A 4F6SA 3O0GA 1U46A 1K2PA 4ZTSA 3PIXA 3O8TA 3E3PA 4I3ZA 4I5HA 4LMNA 4O91A 3Q53A 3R71A 2EWAA 3OWJA 2QOBA 3SW4A 2ZM3A 3IDCA 3ORLA 4Y5HA 4IB5A 5ANDA 2UZDA 1WVYA 3LJ0A 4O38A 3FUPA 4RJ7A 2B54A 4KB8A 3F5GA 4IDVA 4KNBA 3GXLA 5CWZA 3VUIA 3C4FA 3D7TB 5BQ0A 4OTPA 4A07A 3GU7A 1KUTA 1JLUE 4B0GA 3F7ZA 4TRLA 4YPSA 2VWBA 3QXOA 3V6SA 4RRVA 5DRBA 5CAQA 3G90X 2EXCX 4YO6A 4V01A 3NRMA 3ZM9A 1VR2A 3AOXA 4LL0A 3C13A 3C0IA 3UPZA 3S3IA 2OIQA 4IX4A 3VQUA 4BDKA 3MH2A 4XNEA 2R3JA 2F2CB 3GNIB 4GG7A 4FUXA 4CNHA 4J97A 5TR6A 2BAJA 2XVDA 5I4NA 5IG1A 4XV9A 3BEAA 5J1VA 2BVAA 3TNHA 1GJOA 4YUQA 2Y8OA 4MBIA 4BCFA 4CQEA 1VJYA 2XBAA 4ITJA 4YJVA 4QMXA 3P08A 2WQOA 2WEVA 5K0XA 2OW3A 4EOMA 4L52A 5BMSA 4ARKA 3PLAE 2FH9A 4FOBA 3CD3A 3QD2B 4ANLA 5K9IA 4QP1A 2V7OA 4DFLA 4C2VA 5KMMA 1XH9A 4TWCA 4GU6A 5C03A 5E8ZA 4BDIA 4B99A 2AYPA 5AA9A 1YXVA 5HOAA 5LWNA 3NYNA 1MP8A 4S34A 3MH3A 2P55A 1Q62A 5CI7A 4DF3A 5EDRA 4J8MA 2J5EA 4X7QA 4AGCA 4YJRA 1ZMUA 3QX2A 3EQPA 3RM6A 4ZY4A 1UU3A 4EUUA 4U44A 2W1DA 4NU1A 3QWKA 3ZLSA 5EYKA 4RIYB 5H9BA 1OPLA 1JKTA 3C0HA 1OL6A 1W7HA 3FXWA 3R83A 4TYHA 4FKJA 3F5PA 3AD5A 1PXMA 3IK3A 4PPBA 4BCJA 2QU6A 2R0IA 3QZGA 4NT4A 5C26A 2P4IA 4FG9A 4IJPA 4YJSA 4ALUA 3BWJA 4ACHA 5BVOA 3BV2A 2WB8A 5CI6A 4I1ZA 5E8XA 3LFSA 2VNYA 4G3GA 4DEHA 1QL6A 3PSDA 3OEFX 2R3NA 2YM3A 3FZPA 3R1QA 4FZDB 3L9NA 2JITA 5ICPA 4BDBA 5GJGA 3OCTA 3FV8A 1W83A 2BDJA 4BYIA 2P33A 5AUYA 2GHGA 2GS6A 3MPMA 4BDJA 4CGAA 2R5TA 4KRDA 4GYIA 2C6LA 5EW8A 1IA9A 4QMZA 2BZIB 2RGPA 4LOOA 2YABA 4BDGA 2GQRA 2IVVA 3NUUA 2LGCA 4NWMA 3V6RA 2NNWB 4A9TA 4Z7GA 4WIHA 2J0KA 4IAYA 2WMBA 4JBOA 4OLIA 1PW2A 3SXSA 1PXIA 2CN8A 3QUEA 3RALA 2YDKA 1FINA 3PIZA 4A4OA 3QZIA 3CIKA 4YHJA 4F65A 4ITHA 1PKDA 3UOHA 2VWZA 4O7NA 4O0WA 5I0BA 3FDNA 4FNWA 5HE3A 4ZLYA 1QPCA 4O83A 4FX3A 2WU6A 4RJ6A 4RIXA 5JFWA 2VTIA 3PZEA 3FMEA 5AR8A 4F1MA 5IKWA 5IPJA 5L3AA 3ZM4A 5K4JA 4H58A 1JVPP 3O50A 4UALA 4F6UA 1LR4A 3ZUTA 4TWOA 1REJA 2WTCA 3QYWA 3BBTB 4LGHA 3FC1X 4DYMA 5M57A 4ZMEA 4L3JA 3NYXA 3WI6A 2H96A 4GK3A 3W18A 4Y46A 5A4QA 5KMNA 3UE4A 3COMA 3ZHPC 5CF5A 4ANQA 3ZRMA 4JOAA 3CJFA 4BL1A 4BRXA 1F0QA 4ZP5A 5JZNA 3UODA 4AG8A 4LRMA 4NM3A 4O27B 4ZZNA 5CF6A 1A48A 3NZ0A 4LGDA 3D5VA 4OT6A 4FTRA 3OUKA 5CQWA 1YI3A 2PU8A 4M0YA 3KCKA 1H24A 4BKZA 4E5WA 3EN7A 2OGVA 4RFMA 3UZRA 1I09A 3D0EA 3PG3A 2X1NA 3R9HA 3Q4ZA 5TOZA 2YA9A 5E91A 3IW8A 1KOBA 2V22A 4FI1A 4YC8A 4CMOA 3MB7A 3GP0A 3P86A 4KSPA 4HYUA 4C4IA 3Q9ZA 3BYUA 2WAJA 3L8XA 4IVAA 4IX5A 3R73A 2G2IA 5TO8A 4HPTE 4MWHA 1ZYDA 2BHHA 3O71A 4M7IA 1Y91A 4FSQA 4AT4A 4O2ZA 1RW8A 3HA8A 4G3CA 3NCGA 4OR5A 1ZYSA 2OJGA 3R21A 4YZNA 3VS4A 3K5VA 4UY9A 3WZEA 4CFNA 3KF4A 5D41A 5DN3A 5HU9A 5A3XA 4CVAA 2ITPA 2XNPA 3GEQA 4IC8A 5FBOA 2X8DA 5HE0A 5L6PA 4FKGA 4ASDA 3LQ3A 5IDNA 5JKGA 4YZDA 5KMKA 4HVIA 5HG8A 3QD0A 4IAKA 4JRNA 4QPMA 2XJ0A 3QQKA 3GGFA 2BDFA 2BFXA 2CGUA 2CKEA 2W4JA 3VS1A 5JK3A 3ID6C 2F57A 3PPZA 1OM1A 5ANGA 4BZDA 5E9EA 4I0RA 4L7SA 3PXKA 4TYGA 3ZC6A 1APME 3QXPA 3JVSA 3TEIA 1O9UA 2W9FB 3U54A 3GB2A 2QO2A 3IW4A 4F7SA 3QUDA 3ITZA 5DT4A 3FE3A 3IQ7A 3QLFA 4ZMFA 4JDHA 3SGCA 1Q8TA 4CZUA 4GCJA 3C7QA 4GH2A 5C01A 5IQCA 3BKBA 4TN6A 5EK7A 4HYHA 4O6EA 4QP6A 3QQHA 4AN9A 4HYSA 3W8LA 5AV1A 2HY0A 4B9DA 3TV7A 3NS9A 4FTKA 4LV5A 4MQ2A 1I44A 5ANKA 3ORIA 5EYCA 4N6ZA 5K4IA 1ZY4A 3LLAA 1NT2A 3OCBA 3MV5A 3RPRA 3R7IA 3LZBA 2QHMA 3UOJA 3BU3A 3BQRA 4GL9A 4EJ7A 4C36A 2XF0A 3HGKA 4IC7A 2IW8A 3FXZA 4FKLA 2PY3A 3MSSA 4PMPA 4G3EA 3I6UA 3PXYA 2HELA 5KMOA 4CKIA 2X7FA 1ND4A 3L8SA 3IDBA 4GW8A 4B8MA 4JIKA 5J9ZA 2PUPA 2VWYA 4YO4A 1TKIA 4I4EA 4QP2A 4U0IA 3U4WA 3V8SA 4HGTA 3VUGA 3OWKA 4IMYA 4BCQA 4H36A 2WELA 4L68A 1T45A 1X8BA 2BKKA 3S1HA 5A14A 2GHMA 2XA4A 2XK9A 4DFNA 4HPUE 4ZS4A 3OHTA 2FSLX 3I6WA 2CNVA 4ZXTA 4EYJA 2C0TA 2DUVA 2XNMA 2ZYBA 4CFVA 1Y8GA 3HV6A 3QGYA 3QA8A 1XO2B 4P2KA 2BFYA 4FGBA 1BL7A 4D2WA 3CCNA 4W9WA 3TIYA 4I4FA 4OTDA 4U3YA 3VQHA 4FZFB 5L2QA 4D5HA 3F61A 5AX3A 5HU3A 4QMMA 4G6LA 2NRYA 4RQVA 4RZVA 4PTCA 5DNRA 2AC5A 3ZC5A 1SZMA 3G51A 1QPEA 3FJQE 3OT3A 4IFCA 5CALA 4C62A 5L4QA 5D12A 3CY2A 4WSQA 3R7EA 4OAVB 4S31A 4FGRA 4LYNA 4UYAA 1OKWA 4C57A 2OH4A 3BGZA 3PYYA 1GZNA 4PTGA 4BIDA 3UG2A 4DH8A 3A7FA 3I1AA 4KD1A 3DXNA 5M4FA 3GC7A 1IG1A 1YOLA 4NUSA 4O0RA 1Y6AA 4AA5A 3NUAA 4F1OA 1PMVA 4NM7A 3W8QA 1XH6A 1KE6A 4MK0A 2WTJA 4BWPA 3DCVA 2C6DA 2BKZA 3JY9A 3FPQA 4M68A 2VO7A 3DA6A 3KXGA 4CD0A 3AC1A 3IONA 5K3YA 4M66A 5AP2A 2BRMA 4R3PA 3W16A 4O2PA 3CKXA 3KREA 4QYEA 3TTIA 4MBLA 5JT2A 3R2YA 2ONLA 4U41A 2HWOA 4BB4A 3FI4A 4E5BA 1Z5MA 3RNYA 3VUHA 4BTKA 1YI4A 4MF1A 4UB7A 4FV1A 4JLCA 3R9RA 5LCKA 3EL8A 1SVGA 1P14A 4EONA 2XK6A 3FMLA 2FA2A 5K5XA 3IW5A 4X3JA 3NAYA 4RX9A 5DT3A 2B0QA 5EI6A 2ZVAA 4S33A 3T3VA 3ZO1A 3HP5A 4EC9A 3A7GA 4EQUA 2BMCA 4OT5A 4OUCA 2C0OA 3PXQA 3D4QA 1RQQA 5DFPA 2QU5A 3KMMA 4JJRA 4MF0A 1JSTA 2I1MA 1FVVA 3I5ZA 1JNKA 3UJGA 4ZSGA 4I41A 4ALWA 3NW5A 4C59A 5HBJA 2CNUA 3E87A 3OFMA 5M55A 3DQWA 3V5JA 4C4JA 1EH4A 2HW7A 4XOZA 4RC4A 2XNEA 4FKOA 2PL0A 3ALNA 2OJFE 3JS2A 3LCDA 3R9NA 4J53A 2YIYA 3BCEA 3DAKA 4O21A 5E8WA 4FSMA 4EH8A 4FV0A 4YBJA 2VTPA 1GOLA 4DLIA 3QA0A 3G5DA 4FKIA 4XX9A 5DG5A 4D28A 3PJ8A 2IVTA 5AWMA 2FUMA 5JSMA 2RF9A 4MVFA 4WUNA 2VWWA 3FMNA 5E1EA 5IA4A 3IW6A 2BALA 4XLVA 3UC3A 5IEVA 5EH0A 5GIPE 3BYMA 3SXRA 3MW1A 3FZOA 1O6LA 5I9VA 1W84A 1WVXA 1AD5A 4I92A 4QMPA 2XRUA 1BL6A 3PJ3A 5C1QB 3IGOA 4XG6A 4C2WA 2YIQA 1JSUA 2WMQA 4K9YA 3HDNA 5DT0A 5L2TA 4IM2A 2PVRA 3FPMA 3AMYA 3KQ7A 1CDKA 4O0YA 4QMSA 4X3FB 3R8UA 3ZRLA 2J0LA 3KK9A 1RDQE 3DKOA 2W17A 2WMAA 3OCGA 4ID7A 3ZZWA 4B4LA 4E4MA 3PY0A 3QCSA 4MYGA 3S00A 3P7BA 4G31A 4F0IA 3KVXA 4F7LA 2IZUA 2YAAA 5CXHA 5KKRB 4LMUA 1H4LA 2JDOA 4KKHA 2VAGA 3QQLA 3RTPA 4U5JA 2NPQA 2ZV9A 4AA0A 4RWKA 4AE9A 4BDFA 4EOOA 2W1CA 3S2PA 2J4ZA 2ITVA 2RSVA 4IVBA 2BCJA 2VO0A 2H34A 2HXLA 3IO7A 1YHWA 3Q04A 2G2FA 2QKWB 3DBCA 3OWLA 4NK9A 2GMXA 3P0MA 4YNEA 5A4EA 3DK6A 3H3CA 2HXQA 1B6CB 1OL1A 2XYNA 4RC3A 4MD8E 3RAWA 3BHVA 5HCZA 1BKXA 3KC3A 4H1MA 5IU2A 2CHLA 4G2FA 2OG8A 4R7BA 3NWWA 3E92A 1BI8A 3FMDA 5I9WA 5AV3A 3AT3A 3UQFA 2OH0E 5EW9A 1M14A 2UW5A 3QAME 2ESMA 4XOYA 3SLSA 3ZO2A 5FM3A 2QG7A 2C5NA 3UPXA 3SRVA 4CFWA 1WBOA 2VO6A 3ZMMA 2KULA 3R7OA 4E6CA 5AUVA 5CNOA 4F4PA 2YWPA 4O7LA 1R3CA 5CNNA 3C0GA 2ITXA 5CEOA 3MIAA 2OK1A 4RVLA 3KXHA 3NNVA 5AR4A 2VO3A 2R3KA 4FSRA 4G6NA 3VAPA 2G9XA 4PDYA 3AC2A 4GJ3A 5IISA 1J7LA 2PVNA 3ORPA 3GOPA 3AXWA 2R3GA 4PDPA 4F7JA 2W5BA 5D11A 4DE4A 3LW0A 3AC8A 3PY3A 3MB6A 4TYHB 5DR6A 3DK7A 2A1AB 4PP9A 1U54A 4KA3A 1XH8A 5BVFA 4RIWA 4FTMA 2XK3A 4U3ZA 5KMIA 1G3NA 3UMWA 1S9JA 4M12A 3MH1A 3PPKA 2GS2A 4ALVA 1YOJA 4I6QA 4NYEA 4NZWB 4ACMA 1XH4A 1YRPA 2A27A 3QKMA 4FSYA 1MQ4A 4IB1A 3OTUA 4AOJA 3ORNA 2YJRA 3LXPA 3TCPA 4DFXE 2ZOQA 3CTJA 5AIKA 4JDIA 1KOAA 4GV1A 1LEZA 2PZ5A 4XRJA 2ZDTA 4LRKA 3OBJA 3MPTA 2GNHA 2JBPA 4P4CA 2UZVA 3LXLA 4QP7A 3V5QA 4ASEA 1WBTA 4JR3A 4TPTA 2J51A 3EIDA 3QQJA 4NJ3A 3RPYA 4GJ2A 3RWQA 3F88A 4CFFA 1OIRA 1YXXA 4JDKA 3W2OA 4B7TA 1OKYA 3F7WA 5CVFA 4L01A 1M7QA 3LMGA 4QO9A 3FHIA 4U81A 2ACXA 3D5WA 1MRUA 2QOIA 4GK2A 4DT8A 2X4FA 1H0VA 3TNIA 2FYSA 4Q9SA 2IW6A 4X2GA 2PTKA 1ZOEA 3R1NA 2GTMA 3U9NA 3WF6A 4RVKA 4FVQA 1KV1A 2QLUA 2XCHA 3KXXA 3LCOA 4RIXB 3MVJA 3S4QA 3TWJA 4EH5A 4H3QA 4R78A 1SVHA 1B38A 3SA0A 4GMYA 3Q5IA 5KX8A 1GAGA 3NW7A 2JBOA 3DAJA 3RJCA 2HY81 3MVMA 2YERA 4K18A 3WE8A 2VTOA 3BU6A 3P1AA 4HZSA 5I9ZA 4XG2A 1OUKA 4LFIA 4I23A 3G0EA 3QTZA 5ETCA 1R1WA 1H00A 5H8GA 5HHWA 4BKYA 4AN3A 2WGJA 5HD4A 2YIXA 3ZO4A 3VBWA 3QTSA 3KF7A 1YDRE 4IAAA 4NKSA 2I0VA 3KA0A 3CQUA 1RJBA 3KRJA 5C27A 1H26A 5C8MA 2PVMA 2EVAA 3BHHA 4JBPA 4QRCA 3TKHA 4DTKA 4OAUC 2O2UA 3CGOA 5A4LA 4DEEA 2ERZE 5K0KA 3SDJA 3VVHA 1J91A 3DZQA 4Y73A 2O64A 4DG2E 4FTNA 5JQ5A 4FV8A 2YFXA 3FKOA 4R8QA 3CGFA 3W33A 1UNHA 3M11A 1R0PA 5AR7A 3VF9A 3TUBA 2C6OA 2C6KA 4R1VA 4EKLA 3Q4UA 4NIFB 4WG3A 4ZJJA 4S2ZA 5AUZA 5IA0A 2V0DA 2Y9QA 4IZAA 4PDSA 4O7YA 3I0OA 1G5SA 4FT3A 3EKNA 4BKJA 4FV4A 4NW6A 4N0SA 3T3UA 3ATSA 3CC6A 4FTJA 5FXQA 3ZO3A 5M08A 5IDPA 2QONA 3BRBA 4FKUA 4XJ0A 3TV4A 2R3MA 2YCFA 1H07A 3OY3A 3MA6A 4OTGA 1U4DA 3HVCA 3QCQA 4E5AX 2W06A 3DBEA 2R3FA 3RZBA 5FG8A 1U5RA 1KV2A 4E6DA 3RINA 4DLJA 2OXYA 4GUBA 3FEGA 4U80A 3ZUUA 4E20A 2WU7A 3UOKA 3GCQA 3VJNA 4UMTA 4WNPA 5EHYA 3G9NA 3HV5A 2UVYA 5EI8A 1XWSA 5E8TA 3LFNA 2QCSA 4FV3A 4GU9A 2UZWE 2Z7QA 4I6HA 4YP8A 2Q0BA 3ORMA 5CF8A 4F08A 3NNXA 2HENA 2X7GA 2FSTX 3QRJA 3RHXA 3ZDUA 4GIIA 5GNKA 4DGMA 3DY7A 4W8DA 3EJ1A 4K1BA 4QNAA 1JSVA 3EQBA 3PVWA 4IAFA 3TKIA 3QTUA 1UWHA 2YHVA 4KS7A 4YZMA 1GZOA 2UZLA 4IE9A 3TKUA 4Q2AA 3FHRA 4GS6A 1V0OA 1YWNA 3HP2A 3ET7A 1PXOA 4F64A 4JG8A 4LL5A 5EQPA 1P4OA 5C4LA 3QALE 4V05A 1OIYA 3FC2A 4DINA 2E9OA 4O22A 3ZXZA 4C0TA 3R30A 3EZRA 3H9FA 2QG5A 4WNOA 1LP4A 2BILB 4YLKA 5M53A 3QZFA 3BHUA 4IB3A 3UO4A 2CMWA 4YHFA 2FO0A 2PUNA 3TTJA 3KY2A 4YPDA 3FKNA 3CTHA 4MCVA 2P2HA 3UP7A 5LARA 5KNJA 4E1ZA 2ZDUA 5H8BA 2X8EA 5ANIA 3L1SA 4PNKA 3K3JA 3F9NA 4PPCA 5A4CA 1FVTA 4FG8A 4L43A 4O1PA 4EH3A 5BYZA 3BYVA 4UZHA 5F94A 1TQIA 3CQWA 3NSZA 4GT3A 1AQ1A 3R04A 5AEPA 3MTLA 3PG1A 1KSWA 2C47A 2C6EA 3R02A 4N4SA 3UMXA 5LVOA 5DPVA 1WBWA 2Q0NA 4GT4A 5EOBA 3TT0A 4O96A 5KBRA 2YWVA 1OBGA 2F4JA 2OIDA 4I6FA 4DFZE 2PE2A 4OTRA 1JKLA 4D2VA 3OW3A 4JI9A 5AJQA 3QD3A 3FXXA 3HKOA 3HZTA 3PE2A 1PXJA 3U8WA 2XKCA 4Q9ZA 3PP1A 1MQBA 1XBBA 4MH7A 3KB7A 3DK3A 4DG0E 4QMUA 2VTAA 3V3VA 1Q97A 2JIUA 3LXKA 5EM5A 4QTDA 3ULZA 5CU4A 3JY0A 4MHAA 4ZY5A 4I5CA 2EXMA 2JLDA 4EK3A 3DDQA 3OOMA 2PMIA 3GI3A 3PVBA 3VULA 4C4EA 1WCCA 2UV2A 2XK7A 4UWYA 1FOTA 2VX0A 4O81A 3FLQA 3ZYAA 3NYOA 3LKMA 4CCBA 2C1BA 4TTHB 5L8JA 1YWVA 2O3PA 4WHZA 3OCSA 2F49A 4A4LA 4FTTA 2YCRA 4RC2A 4UBAA 3MPAA 4FKVA 5L2SA 3MI9A 1W82A 2BUJA 3NEWA 2HOGA 4PMTA 4PV0A 4UMQA 2QKRA 4AGDA 4A9YA 5IZFA 2EB2A 2OZAB 3NIZA 1L8TA 4W4YA 4Y95A 1MRYA 2ITQA 2XKFA 4K2RA 4MX9A 3PWYA 5CTPA 3VIDA 3H0YA 5JGBA 3Q4CA 5CSVA 2FSOX 1UNLA 2ITNA 3ORZA 3MFSA 2I6LA 4S32A 2VTRA 4KS8A 4USDA 3QFVA 1H28A 3G2FA 4IHPA 1URCA 4RJ5A 2OF2A 5HNGA 2UZTA 4MXYA 5BMMA 5CEQA 2J0JA 3VS2A 4X2NA 3D7ZA 4ZTHA 3OXZA 2XKDA 4OBOA 3RZFA 3VBTA 4TWNA 5J5SA 5M06A 4G9CA 4TT7A 4BDDA 5AUTA 3W2RA 2YACA 3THBA 3O23A 3SKCA 2CKOA 2GQGA 4MTAA 3BI6A 2W1HA 2RL5A 1J3HA 5FBNC 4CQGA 4IFGA 2XEZA 1OKZA 3DBDA 4BGQA 1CKJA 2VRXA 3NNUA 5AMNA 4D2SA 3FLZA 1PMEA 1PHKA 3K54A 2A19B 3MJ2A 4H1JA 5HEZA 4C8BA 4ZTRA 3CQEA 5HGIA 2Y7JA 4PRJA 4QT1A 5FLFA 2VWUA 3VWAA 2X9EA 5IH6A 5G6VA 4MNEA 2F7ZE 5FGKA 4Q5EA 3FY2A 3EFWA 1UV5A 1REKA 1IRKA 3MH0A 5DGZA 4BN1A 4AZEA 4FL2A 5L6OA 3PRFA 4F0FA 3SW7A 1YOMA 5IQAA 4ANBA 1DM2A 1OI9A 2J90A 3DKFA 3OF0A 3QL8A 3EH9A 4LG4A 4ERKA 2PULA 4G17A 2Z7LA 4IZ5A 4C4GA 3GFWA 3KXNA 4FT0A 2BTSA 4UEUA 5DEWA 4PP7A 4EK6A 3FMMA 1A06A 3R6XA 4F9CA 4OW8A 3NYVA 2YIWA 4IAZA 5EQYA 5F9EA 3QTWA 2B9IA 4TYIA 5AR5A 3A62A 4X0MA 4EJNA 2XJ2A 2ZMCA 3KXZA 2C4GA 3AG9A 3UQGA 3ZFMA 3W10A 1FVRA 3LVPA 5CAVA 4JBVA 4A9UA 2QC6A 4XUFA 4BIBA 1H1RA 1GNGA 5HX8A 3WARA 3B8RA 4QMOA 4BHNA 1PMUA 3UNKA 2OKRA 4GUEA 4U97A 4RJ8A 4XRLA 3DKGA 5IA2A 3ZZEA 2EU9A 2OJIA 4KBCA 4LM5A 3BHYA 3L8PA 4EZ7A 5M51A 1CKIA 2XZSA 4RVTA 4F9WA 4D0WA 4KRCA 3U9CA 4RIOA 2JDTA 4ZZMA 1YDSE 4NM0A 1J1CA 3ACKA 4XV2A 4YTFA 4MXAA 5EM8A 2W4OA 1OKVA 3Q9YA 3NUXA 5E8YA 4HGLA 2HZ0A 3CKWA 5TE0A 2XCKA 3EQFA 4EEVA 5L6WL 2C6IA 2XIZA 5IH5A 3AGLA 4NFMA 1L3RE 2VV9A 1W8CA 2DWBA 3JYAA 4GYGA 4D2PA 3QZHA 2UVZA 4O1OA 3C4ZA 2GQSA 5TKDA 5L8KA 5E92A 1XH7A 4FSTA 3CE3A 4DH1A 3F66A 3DJ7A 4RPVA 3GCSA 4AE6A 4AWIA 4FODA 4AW2A 2ONLC 2JIVA 3SRVB 1Q3DA 2O63A 5FUTA 4PMMA 4KKGA 2C3JA 3ULIA 3EN4A 3OOGA 3VBYA 1H1PA 4KUJA 4ASZA 3PA3A 4AT3A 5DOSA 4CCUA 1OIUA 3DBQA 4ASXA 5CEIA 3P7AA 3SHEA 5LMKA 3COKA 3PE1A 4B6LA 3FLSA 5GZ9A 4YJTA 2YLEA 3FYJX 3B8QA 4FT9A 3TM0A 2ZB1A 4MWIA 4BGGA 2HZNA 4FSUA 4FEUA 5CXZA 3VO3A 3DLSA 2GNFA 3LCKA 1YQJA 3QRTA 3A7IA 1U54B 2UZNA 5CAPA 5JZJA 4RIWB 3R1YA 5AV0A 4AGUA 3BBWA 5AUXA 4I0SA 4IEBA 2IWIA 4BBEA 3MFUA 3DS6A 3POOA 3R9OA 3TJDA 4ZLZA 1OL7A 3V8TA 4DC2A 2I0HA 2PZRA 3QGWA 4QMNA 1Y8YA 2CSNA 4HYIA 2J9MA 3EFKA 5JGDA 2YM4A 4Z7HA 3Q9WA 1G8SA 3FY0A 2W99B 4X2JA 5HTBA 3WILA 2REIA 1BI7A 1QMZA 2YM7A 3RNIA 2CGXA 3OD6X 1Q8UA 5D7VA 4BFMA 5E7RA 2XRWA 4KINA 1W98A 2C69A 2GNIA 4KIOA 4NEUA 1OGUA 3CPBA 1WAKA 3CS9A 5GJFA 1QCFA 4JL9A 5B2KA 3F82A 5HNBA 3D2IA 5LWMA 3QF9A 4JXFA 4PMSA 1GIHA 1SNXA 2DYLA 2B1PA 3R1SA 4L53A 4RGJA 5AP0A 3BPRA 1XKKA 4K0YA 5HVYA 4YTIA 4RFYA 3R8VA 2WTDA 3CP9A 5L2IA 4BI0A 4EH4A 4OTIA 5FTQA 3GCPA 4IBMA 3MWUA 5ETAA 2YCQA 3DKCA 4CV8A 4EUTA 2YITA 5K5NA 5ANEA 4C61A 1NVSA 3DLZA 2XIRA 3PA5A 3TDWA 4XS2A 1HCLA 4TW9A 4EHGA 4EBVA 4UXQA 4AW0A 4GFOA 3LXNA 3TL8A 2GU8A 2BROA 2BIKB 2C5VA 2VX3A 3GQLA 4FICA 2QOQA 4EORA 4WRSA 1NVQA 3SQQA 3N4UA 2QOHA 4CLIA 4XG7A 2X0GA 3EHAA 5E4HA 1VEBA 3WF9A 2YN8A 4HGEA 1CSNA 3KL8A 2BR1A 4NH1A 4TNBA 1SNUA 5LMBA 2ERKA 2KTYA 3AQVA 5DI1A 5J1WA 3NVMB 3VBXA 4HVGA 3ZONA 4BDEA 4Z16A 3LFQA 3NUPA 3UVPA 4C58A 3MFTA 2V62A 3UYSA 3VUTA 4ACCA 5HTCA 4FTOA 2XP2A 2E9NA 2WXVA 5M44A 4YSJA 2XK8A 3P9JA 4IADA 4X2KA 3R7VA 3OVVA 2JAMA 1PF8A 1Q8WA 2BZJA 3D5XA 4QOXA 3ZFXA 5M4CA 2PMLX 5LQFA 2PMNX 2W1EA 3AC4A 3PSCA 3LIJA 2PVHA 4PX6A 3TG1A 4O7ZA 3I81A 1NA7A 4U8ZA 3VBQA 2PSQA 3PDTA 4PDOA 4ZY6A 5FXRA 2C0IA 2NO3A 2G01A 4HVDA 4XP0A 4F63A 2WOUA 3HMMA 4HCVA 3U6HA 3SG8A 3PP0A 3FQEA 5J8IA 1XJDA 4ANMA 1K3AA 1PMNA 5J9YA 3QTXA 1FGKA 2QNJA 2WTKC 2C5OA 2Z8CA 2QOLA 4FV2A 3COHA 4JX7A 3W2SA 4YC6A 4CSVA 4EH9A 1ZARA 2C3KA 5CYIA 3VS0A 4WSYA 5ETIA 3RPSA 1YKRA 1ZYJA 2B9HA 5HO8A 3VHKA 2BIYA 3LM5A 3O51A 1VYWA 4XYFA 3VHEA 4EQCA 3DXPA 1IEPA 2W1ZA 1OL2A 2R9SA 1YWRA 2UZUE 4LUEA 2XJ1A 4AN2A 3NUSA 5EM6A 3TNQB 2B55A 5DR2A 4O84A 2WZJA 4QYHA 1ZAOA 2CLQA 4IZYA 4YZBA 5C9CA 2J5FA 3U87A 3C4EA 2CCHA 4FSWA 4HZRA 2I0EA 1H27A 3W2PA 2CKPA 3EQRA 1AGWA 3REPA 3JVRA 3S95A 4IH8A 3WF7A 1Z57A 4M84A 3O2MA 2UZBA 4QD6A 2X2KA 3GFEA 2ZV2A 4AXAA 3QC4A 2B7AA 4FR4A 4DA5A 4BBFA 4D0XA 4RQKA 3WF8A 4FEWA 3NVKI 4QTCA 3DB8A 4PL5A 4U45A 3MIYA 4M0ZA 5AM6A 3G6GA 4Q5HA 2RFNA 4XP3A 3MY1A 4PQNA 1JBPE 4QYGA 5CAUA 3KRRA 4HNFA 3A7HA 2AUHA 3OC1A 3PXRA 5F1ZA 3NPCA 2P0CA 2WO6A 4DFBA 2OZOA 4XG4A 2BDWA 1OMWA 3CY3A 4DH7A 4D1ZA 2GHLA 4J7BA 4IWPA 2IZRA 2JKOA 5BX0A 1YXSA 3QCYA 4QQTA 2HZ4A 4CLJA 2OIBA 2W05A 5J87A 2HW6A 4HCUA 2EXEA 2IVSA 4BGHA 4KWPA 3HUBA 4UWCA 2YCSA 5EI2A 4QP4A 3ZSHA 2C1AA 3E8DA 4BDCA 4I24A 1FBNA 2WTVA 3LFEA 4QPSA 4J1RA 4Y85A 3PXZA 3ZS5A 4E73A 3FI8A 5AAFA 5IQBA 1V0PA 2OXDA 2W9ZB 4QTBA 5EKOA 3IOKA 1NY3A 3I79A 4YHTA 4AZSA 4IZ7A 4MKCA 3WE4A 2HK5A 4CEGA 1OL5A 3BE2A 1MRVA 4FTCA 2JFLA 4L6QA 3ZCLA 4AOIA 1Q3WA 2VTLA 4YTHA 3QTRA 2R7BA 5FDPA 3RMFA 3GUBA 1R0EA 3GCUA 5IMEA 2QO7A 4NKAA 3TACA 3WOWA 3ZLWA 4IDTA 3T9TA 2YLFA 4RWLA 2YM8A 4ERWA 3ZEWA 5HVKA 2PUIA 3ZLXA 4UMRA 4J71A 3RK5A 4B8LA 3CEKA 5HIDA 4F70A 5FDXA 3ORKA 4DH3A 3EZVA 2PMOX 4GFGA 2UZOA 1FMKA 4OGRA 4YURA 2HYYA 4BY9E 3ALOA 3NR9A 4NTTA 3UYTA 4BC6A 3U6IA 3BU5A 5CX9A 3OS3A 4PUZA 2ETKA 2C5XA 2Z60A 5HIBA 1HCKA 1KE9A 3R01A 3MBLA 3FWQA 4Y72A 5CAOA 4F9BA 4JS8A 3G0FA 4Y83A 3NDMA 4C34A 3WZDA 3HNGA 2XKEA 3WYYA 3CTQA 3DFCB 3ZRKA 3E7VA 2BRBA 4W4VA 3D15A 2VTTA 3EKKA 2RIOA 3UC4A 2J0MB 3UO6A 2OF4A 5DRDA 3SOCA 5TT7A 5KHWA 2V7AA 5AX9A 3RI1A 3VW6A 2W1IA 1GIIA 2ZMDA 4NCTA 2JKMA 5EHOA 3EQGA 1S9IA 4Z9LA 4UZDA 1RE8A 2QO9A 3EQDA 4GT5A 4WRGA 1PXNA 4YLLA 3GU8A 4ZJIA 4BF2A 1K9AA 4L9IA 5C8KA 5HLNA 4U6RA 5IQEA 2X6EA 3KMWA 4FNXA 3LQ5A 4MNEB 5JRQA 2YDJA 5EYMA 3UZTA 2X81A 4WA9A 4IVDA 3QHWA 1OUYA 3KN5A 3BLRA 4X2FA 3R0TA 1ZMVA 3TNWA 3F3ZA 3G9LX 1URWA 5CU0A 3C51A 4Y8DA 4FK3A 3ROYA 1ATPE 4J99A 1B39A 5IUHA 3OXIA 5HNIX 5ANOA 2H9VA 2PZPA 4DGGA 4I94A 2OFUA 3UIMA 3BHTA 1Q8YA 2C30A 3KMUA 4WD5A 2X8IA 3ENHA 3HMNA 4RJ3A 3UVQA 4AAAA 3VS5A 2BZHB 2Q83A 2YAKA 4XV1A 3LE6A 5B0XA 1YDTE 2HZIA 3LOKA 4H39A 4U43A 3OT8A 4ZK5A 3DGKA 5L8LA 1UWJA 3C4WA 4FEVA 4FIJA 3NUYA 4YMJA 3LCTA 5CQUA 4D4SA 4RWJA 1PXPA 3QU0A 4X6QC 4F09A 4OTHA 3V5WA 4FK6A 3CSVA 4FTLA 1XR1A 5FM2A 2OU7A 4EC8A 4ANNA 1P2AA 1Q99A 4CZTA 4BR3A 5CSPA 4WO5A 3HRFA 4YJPA 4G1WA 1MUOA 3O96A 3PVGA 5CU2A 2BRHA 4W8EA 3E7OA 2OBJA 4GVAA 1BX6A 3MY0A 4G6OA 5AP5A 1ZRZA 2X9FA 4O0SA 4YNOA 4RX7A 3ANRA 5EM7A 4EK4A 4ANSA 4O7WA 4XCUA 4FTUA 1Q5KA 3NGAA 3AC3A 2G1TA 3E8CA 2F9GA 3AT2A 2WHBA 1ERKA 4RT7A 2PWLA 4ZSLA 5JFSA 1OPJA 4E3CA 4KIQA 5EOLA 5BVEA 3U4UA 5LXMA 4I20A 4WOVA 1ZZLA 2H6DA 3KULA 3E8NA 3WZUA 4IANA 5HO7A 3RPOA 4CMUA 3IGGA 3D2KA 3EYHA 3N51A 1DAYA 3UOLA 4RSSA 4BI1A 5D9HA 3TUCA 4XH6A 4CXAA 4TL0A 4DEGA 4JVGA 4CV9A 3UGCA 5D7AA 2VWVA 3UTOA 3A2CA 5CY3A 4AU8A 2UW0A 1UVRA 4EYMA 4RZWA 2PZIA 4RBLA 5BVKA 2C6MA 4MD9E 5C8NA 4FZ6A 3FI2A 2JEDA 4E4LA 2B9FA 3P7CA 1WBSA 4DHFA 5IQHA 5KZIA 4K77A 4AW5A 1UU9A 4YZ9A 4FC0A 2CGWA 5BPYA 5D1JA 1JKKA 3QD4A 4WUAA 3KRXA 4FEXA 5KBQA 4M3QA 1YI6A 2R3OA 1M2PA 4UX9A 3H9OA 5BUIA 2PVYA 2CN5A 2XIXA 5IQFA 2I40A 1OZ1A 1H0WA 2W0JA 4V04A 4WKQA 4DGNA 2PYWA 2IZTA 5BYYA 4D1XA 2CCIA 3EOCA 1WMKA 2PE0A 4XBUA 4ZIMA 1ZZ2A 3F3VA 2WKMA 2BAKA 4M8TA 5LJJA 5A9UA 4QQJA 1YXUA 3R2BA 2JAVA 2YM6A 3FQSA 3V5PA 4J52A 2VTNA 4O0XA 2WQNA 5EG3A 3V04A 4MXZA 4H3PA 1ZLTA 3KU2A 5HG9A 2GDOA 2VUWA 4WBOA 3WIKA 5H8EA 4GKIA 4WG5A 3GC9A 2X6DA 3FL4A 4LOPA 3DOGA 4YJUA 5FP5A 1JQHA 5H2UA 4BCPA 4FKPA 1U5QA 4O6LA 3AGMA 2OLCA 4QMWA 2HWPA 2QHNA 4FF8A 3E62A 3PWDA 2Y6MA 5TF9A 3V5TA 3LQ8A 2O8YA 5EQEA 1Q4LA 1J7IA 1E1VA 3GVUA 4L00A 2R2PA 4R6VA 5IQIA 1M17A 3R00A 4UMUA 3ACJA 2G15A 4FV9A 4G16A 5HI2A 3FLNC 4H05A 1SMHA 5FQDC 4JIAA 4MQ1A 3W2QA 2XM9A 5DA3A 3DB6A 4FOCA 3IECA 5AP3A 3TDVA 2QOOA 4G34A 1FGIA 5HE1A 2B53A 3BZ3A 3EQCA 2YZAA 1ZMWA 3ZTXA 4EQMA 1Q24A 4TXCA 4AUAA 4FL1A 2VZ6A 4G9RA 4KSQA 5CT0A 4E4XA 2E2BA 4O0TA 2BZKB 2JDVA 5JQ8A 4A06A 4BCKA 4KAOA 3AD4A 4E8AA 2X7OA 4ZTNA 4PNIA 5FXSA 3VUMA 2SRCA 4D9TA 4DFYA 3PUPA 4FL3A 4ZS0A 4V0GA 2VGPA 2ITWA 3EYGA 4L45A 4EZ5A 4Z55A 4BWXA 2XNBA 4QMVA 4C35A 2ZJWA 4FEQA 2ITZA 1BYGA 4BTMA 3A61A 5T3QA 5BVNA 5DHJA 3QRIA 5AM7A 4X6RA 2RG6A 5HD7A 2QODA 4YSMA 1IA8A 3BYSA 2OO8X 1W0XC 1H1QA 3BYOA 3JXWA 3P79A 4FTAA 4RLKA 3FKLA 5AP1A 2QR8A 4OTWA 4HW7A 3G15A 3T8OA 1PRYA 3N9XA 3LMIA 4F1TA 4LV8A 5M4IA 3OW4A 4L3LA 4FIGA 3I7BA 4J98A 1H25A 3EQIA 4GRBA 4K8AA 5JFXA 4EK8A 5IMXA 3Q6WA 1JKSA 5CSHA 3F2RA 3MESA 4CZYB 5HLWA 1WBNA 3ORTA 3ANQA 5LMKC 3SC1A 3KXMA 3HMPA 4OBQA 4P5ZA 3R8LA 2R4BA 4AZVA 3EWHA 1IASA 2WMUA 3DNEA 2PVJA 2IZSA 3IKAA 4IW0A 4X3FA 3TZ7A 3EB0A 4M13A 2JFMA 1Q8ZA 4K6ZA 5I9UA 3S0OA 2ETMA 3FLYA 4DEDA 2JDSA 1ZOGA 3MVLA 5DLSA 3GOKA 2X2LA 3I4BA 1T46A 4FKQA 3OEZA 5FEQA 3RWPA 5AV4A 4L8MA 2UW8A 1OIQA 4IX6A 5IQGA 3NUNA 3C9WA 1M7NA 3E64A 4Y5QA 5GINE 3HYHA 2WOTA 4D2TA 5EFQA 3VS7A 3DBFA 5KMJA 4BCMA 3TV6A 4E7WA 3KVWA 3EFLA 1PYXA 4UN0C 5F20A 1TQPA 3OUNB 3FZTA 2VTQA 4TZRA 4D4YA 5A6OA 3VW8A 2R0UA 2XMYA 4EHZA 4HOKA 3EN6A 4L3PA 3LFAA 4AZFA 4DAWA 5J79A 4U42A 3Q4TA 4J96A 3ETAA 4FV7A 5EDQA 4C3FA 4D4RA 5I5ZA 3NX8A 4QQCA 5J5TA 2XK4A 3QKLA 2BHEA 3VNTA 1Z9XA 2GFSA 4EWHA 3LAUA 2F7EE 4NSTA 5HKMA 4DT9A 2HCKA 3WBLA 3QTIA 3VC4A 3CPCA 1PYEA 2C6TA 4FT7A 3UIBA 2VD5A 1WZYA 4A7CA 1XBCA 5GJDA 2C3IB 4QTAA 4JG7A 1U59A 4FSNA 5AP4A 2Y4IB 5BNJA 4XG8A 5CSXA 4FA2A 1DS5A 2EUFB 4BICA 5M56A 2BAQA 2RFEA 3M42A 2J2IB 3PY1A 2ITTA 4PY1A 3RBWA 4QQ5A 1VZOA 3TXOA 4CTBA 5CVHA 4MXOA 4ZTQA 4TKSA 3CJGA 1XHAA 5IEXA 3RAIA 3OG7A 2PVKA 4RA4A 4IAIA 4DEIA 4PF4A 5AAGA 2B4SB 4FE2A 4MAOA 4MBJA 2J6MA 4R1YA 2WQMA 3HV4A 4QMQA 3SVVA 4CT1A 5LVPA 5AUWA 3TZ9A 3M2WA 2GNJA 3SXFA 4AA4A 3ZOSA 2OXXA 3IPHA 4NM5A 4QP8A 5AUUA 3IOPA 2E9UA 5LCJA 4C33A 2WIHA 4D4VA 3TNPC 4ANOA 2FSMX 3DJ6A 4I22A 4JQ8A 5CU6A 1NXKA 1E1XA 4S30A 5CVGA 3UG1A 4FIHA 3HRCA 1OBDA 3MY5A 3QUPA 4I0TA 2XYUA 3VS3A 4W9XA 3W55A 5IUIA 5LOHA 4U40A 4AQCA 3KEXA 2X39A 3GT8A 3GBZA 2XS0A 3R28A 4FIFA 4RX8A 3HRBA 4KBKA 4YBKA 4BYJA 3LFFA 4ZJVA 4CT2A 2GS7A 3E88A 3BX5A 4NJDA 4JRVA 5CT7A 3NAXA 5HESA 3C1XA 3QC9A 3Q9XA 4OTFA 4G5PA 5DYJA 4RX5A 2AC3A 2ZAZA 1JWHA 1H8FA 4TWPA 3TI1A 4BTFA 2P2IA 1OITA 3UNJA 1M2RA 3O8UA 2Y6OA 4KIKA 4U9AA 5DWRA 5HLPA 1R78A 4JAJA 2ITYA 3ZEPA 4DITA 5M09A 2BRNA 2WMVA 1PY5A 4FZAB 2PPQA 2I0YA 1BMKA 4IX3A 3BGPA 4MEDA 4UXLA 4BI2A 2OSCA 2RFSA 3LJ1A 3LFBA 4DN5A 1NVRA 4N57A 3M1SA 1YXTA 3RCDA 4CKJA 3VRZA 4UMPA 5CEKA 5FTGA 1KE5A 4D2RA 4D5KA 5DVRA 1XBAA 4YTCA 5CF4A 2W5HA 3SG9A 3LHJA 2I7QA 1ZOHA 2OJ9A 4ZLOA 1ZWSA 4BCIA 3E3BX 4IB0A 4XV3A 1NW1A 4DEBA 4ACGA 3E5AA 5JFVA 2GSFA 3PRIA 5GHVA 4KKEA 2JC6A 5D10A 4JG6A 2IJMA 2CKQA 1STCE 5BVWA 3TN8A 3QBNA 2R3IA 3QTQA 4EOJA 2Y4IC 2XEYA 4M69A 4NIFA 2BPMA 2V55A 2YJSA 3UZPA 4BHZA 2XNOA 2CLXA 2QR7A 1J7UA 3PXFA 2WTKB 3HAMA 3R7GA 1ZYCA 3N4VA 4MXCA 5DIAA 5J7BA 3IG7A 3Q2MA 4A4XA 3K5UA 4C4HA 1BUHA 3NNWA 1O6KA 3HUCA 4F99A 5LMAA 2R3RA 3FL5A 4LRJA 4F9YA 2J0IA 3WIGA 2PK9A 3QHRA 3NW6A 3BQCA 4APPA 3KRWA 3P23A 5ACBC 4IJ9A 3WYXA 4D9UA 4YGAA 3P78A 3FZSA 4HJOA 5I3OA 4D55A 4FYNA 4IM0A 3VBVA 4YR8A 5HBHA 3BE9A 3N4TA 3DQXA 3D94A 4KIPA 3OMVA 5HCXA 2YISA 2FGIA 3E63A 3QRKA 3PA4A 5EW3A 3DAEA 1FQ1B 4A9RA 3DZOA 5IUGA 3A60A 3DTCA 3HX4A 3ZU7A 3R9DA 4XP2A 3FSFA 4BDHA 3R22A 5FP6A 4L42A 2GTNA 1Y57A 2NP8A 4YJNA 1VYZA 5IA1A 3BGQA 4RA5A 4C38A 4DCAA 4FIIA 3E8EA 5FD2A 3UNZA 1GIJA 2ITUA 3I5NA 4M97A 5BYLA 2IO6A 1F3MC 2WQBA 4M15A 4P90A 1QPJA 2XNNA 4CKRA 3LCSA 4QP3A 5T6KA 3ZBXA 3ERKA 4XBRA 3QLGA 3F6XA 1UNGA 1ZXEA 4IM3A 1PXLA 3BWFA 4CYIA 4E93A 3GU4A 4MXXA 4IACA 2GCDA 3PIYA 5JEBA 4IIRA 3I7CA 3PPJA 4EOSA 4BZNA 4YLJA 4EH6A 2JKQA 2W1FA 3KULB 4NTSA 5DH3A 1WVWA 3UIXA 3WZJA 3SV0A 4O7TA 3LPBA 4RJ4A 4ENYA 5CEMA 3RVGA 5M4UA 1QPDA 2XBJA 3C5UA 3A8XA 5CEPA 5IA3A 2WEIA 4G3DA 2R64A 2WPAA 4TNDA 2PVLA 4U7ZA 3TJCA 3FMHA 5CSWA 3ROCA 3W2CA 4UYNA 3B2WA 4FKWA 4BCHA 4CFMA 5ACKA 4LOQA 3K2LA 5F95A 4ZEGA 3V5LA 3VS6A 5I9YA 2IN6A 3MS9A 5KMLA 3BEGA 5HZNA 2DS1A 4CTCA 2VTJA 4O7RA 2QOFA 4FG7A 1LEWA 4FNYA 5DEYA 4C3PA 3IS5A 3O7LD 3HA6A 3DTWA 1V1KA 1YHSA 5IQDA 2VTSA 1LPUA 5A54A 1A9UA 4II5A 4NCTC 4WNKA 3VRYA 5HTIA 3GU6A 4RVMA 2BTRA 5B2MA 2C68A 3D7TA 1OPKA 1M2QA 3POZA 2QLQA 4LQMA 4JT3A 4U79A 3CD8A 2VTMA 3COIA 2J50A 4ZAUA 4EBWA 5AV2A 3RHKA 1CKPA 5EHLA 3ELJA 3Q3BA 2B9JA 4CMTA 3W1FA 5AFVA 5CLPA 3KFAA 3DV3A 2UW3A 2ZB0A 5GZ8A 3A4PA 4GEOA 4CRLA 2UZEA 2BRGA 2C5YA 1YVJA 4YZCA 4EOLA 2Z2WA 5IA5A 3UVRA 4H3BA 3OWPA 2UUEA 3D5UA 4R5YA 5HG5A 3FZRA 3WZKA 4NW5A 2A2AA 1F5QA 3G33A 3AD6A 4GIHA 4ACDA 4PPAA 3PJ2A 2W1GA 3R7YA 3MTFA 1HOWA 2VX1A 3RK9A 4AW1A 4IXPA 4PL3A 4QYFA 3W32A 4BTJA 5KCVA 1UU8A 2OZAA 1DAWA 5HX6A 3ODZX 3VJOA 4ZOGA 3PVUA 4HVHA 1E9HA 5FEDA 4ZTLA 2Z7RA 1IR3A 3RGFA 5A4TA 2DQ7X 5JH6A 3QYZA 1H01A 1OB3A 3BELA 2XH5A 3ATTA 2O5KA 4M67A 5AAEA 2VNWA 4USEA 3KGAA 3R8PA 3KCFA 4FNZA 1YW2A 3HL7A 5CS6A 5BUEA 5KHXA 3ZSGA 4O0VA 2FVDA 4C3RA 3EMGA 4K11A 5C4KA 3A7JA 3QQFA 2OWBA 4BCOA 1BLXA 4DGOA 4G5JA 4X21A 3BLQA 3EN9A 3KKVA 1SYKA 4RIYA 2HIWA 4GKHA 1TQMA 2CJMA 5ANJA 4WBBB 4O82A 2WMXA 2XB7A 1IAJA 4IWDA 4YJOA 2YIRA 4R77A 4GG5A 2IW9A 4TYJA 3R8ZA 4I5PA 3RKBA 3SD0A 1V0BA 2QOKA 4V0GB 3RAKA 2ZV7A 5IEYA 5HORA 4W4WA 4IQ6A 2IPXA 2EB3A 5J95A 3F2AA 4R7HA 4RFZA 3UP2A 2CNQA 3HMIA 4ENXA 3IDPA 1DI8A 2JD5A 4ORKA 4AOTA 2QURA 1KE8A 3D9VA 4XLIA 3ENMA 4PL4A 2PVFA 4O86A 2XM8A 3II5A 4RG0A 3AMAA 3DDPA 4C4FA 5JN2A 3QRUA 3HLLA 1JOWB 4I21A 4FIEA 5G1XA 2LAVA 4DFUA 3JUHA 3D83A 5HCYA 2G2HA 2RKUA 5E90A 2IVUA 4WG4A 4YJQA 5AR2A 2GNGA 2YM5A 4JQ7A 2WTWA 3CLYA 4I6BA 4UV0A 3R8MA 4L44A 3MFRA 2WD1A 1LUFA 3SOAA 2B52A 3A8WA 3VUKA 3U55A 4YC3A 2GPHA 3DJ5A 4AP7A 3RPVA 2F2UA 1SM2A 3BLHA 2XIYA 4MD7E 3V8WA 3H9RA 4XG3A 5KO1A 3H4JA 3FQHA 4N70A 4F9AA 4EKKA 5J7HA 2JDRA 5DMZA 4ITIA 1OECA 3UIUA 3NMUF 4R3CA 5DBXA 1ZYLA 4I5MA 4E6QA 4EHEA 3RP9A 3TZ8A 3UO5A 2VU3A 4AACA 1P5EA 3HECA 2WTIA 1WBPA 3RAHA 4FV6A 4NFNA 3FSKA 4APCA 4BDAA 4TY1A 3L9LA 4YU2A 3HV3A 3PZHA 3UQCA 2QQ7A 2UW4A 2A4LA 2Y0AA 4AS0A 2WMTA 2WFYA 4K33A 4HVSA 4FSZA 4FTIA 2A0CX 3CBLA 4BWKA 4RLLA 4P5QA 2FB8A 5HO6A 1O6YA 4R5SA 2P3GX 5E8SA 4RWIA 4ZZOA 4DGLC 2R3QA 4JDJA 4QYYA 4JAIA 3RCJA 1GZKA 3QX4A 3L9MA 5LVNA 4AF3A 2R3PA 4D1SA 3O7LB 4AGWA 4F0GA 3QWJA 1R39A 2NRUA 4W4XA 4GFMA 3NIEA 3OXTA 3LJ2A 5JRSA 3UBDA 3GU5A 3ZSIA 3RK7A 2Z7SA 3CR0A 3MA3A 3EN5A 3OBGA 4AX8A 2IG7A 4CG8A 4L7FA 2YDIA 1XH5A 4M14A 4AT5A 4IWQA 3GC8A 5HVJA 4QNYA 3FMJA 2GFCA 2X4ZA 3T9IA 2F7XE 4FBXA 4HCTA 2PUUA 1CTPE 4EOKA 2W7XA 2HAKA 3DNDA 5E1SA 5ETFA 3U6JA 4DTBA 3C4CA 4GVJA 4QMYA 5AADA 4FUYA 4G3FA 4WNMA 3UDBA 4BVUA 3QKKA 4FV5A 5J9LA 1H08A 5CZIA 3I0QA 5AP6A 4FKSA 5KZ0A 4EOPA 2PZYA 3FI3A 5EYDA 5GIOE 2VWIA 4A9SA 5FEEA 4CFXA 1IAHA 3CXWA 3NLBA 5LVLA 5EKNA 3GENA 4FKTA 3FZ1A 5ITAA 3MJ1A 3HMOA 4NL0A 3C50A 1CM8A 2CGVA 3E93A 3MDYA 4AFJA 4BCNA 3B2TA 1XQZA 1PXKA 3A4OX 2ZM4A 4JQEA 1G8AA 2Z02A 5CU3A 4PWNA 3ZBFA 4DH5A 1DI9A 2O0UA 3H0ZA 4OTQA 3QQGA 3L9PA 1KWPA 3Q60A 4XMOA 4KABA 4EI4A 3AMBA 2WMRA 3BIZA 3FLWA 4HGSA 4DTAA 4O7SA 3NCZA 2YEXA 5H3QA 3OROA 2RG5A 2YZLA 3HEGA 3PLSA 5B7VA 2JGZA 3F69A 3O17A 3JR1A 3ZXTA 1UKHA 3FMKA 4QP9A 4WT6A 1OVEA 3TZMA 3VUDA 1PKGA 1CMKE 2PHKA 3LFCA 3HDMA 2CDZA 4J95A 4IVCA 3F5UA 1JAMA 4E4NA 4FYOA 3PJ1A 2UW6A 4X3FC 2O65A 3F3TA 3VN9A 3PJCA 3LFDA 3AT4A 1UA2A 4AZTA 4GSBA 5AA8A 4CG9A 4J8NA 2UW7A 3ZLYA 4PTEA 2WIPA 3MGYA 4O7VA 3L8VA 2VWXA 4OBPA 5CZHA 2OFVA 2Y4PA 3IW7A 3KRLA 3HAVA 4KIKB 3ZFYA 5FTOA 4CYJA 5KKRC 4AZWA 3MN3A 2VGOA 2W5AA 3OP5A 3PSBA 1M52A 4RMZA 3HV7A 3R63A 4BBMA 4JX3A 1Q61A 5DR9A 4D58A 2ETRA 1KE7A 4EH7A 2RFDA 4USFA 4EHVA 3GCVA 4JNWA 3GC0A 5EDPA 4E26A 3EQHA 3ZDIA 4E6AA 3VF8A 3H30A 5A46A 3K3IA 4C37A 5B2LA 3EL7A 5FRIA 5T68A 4L67A 1Y6BA 3MVHA 5I9XA 4EZ3A 3TUDA 1YHVA 3P5KA 1GZ8A 4FTQA 3D14A 5HBEA 3PTGA 5FWKK 5A6NA 4DBXA 4ONAA 3F3UA 3OTVA 2ZV8A 2UW9A 3FAAA 5M07A 4QMLA 4IWOA 2WMWA 3SAYA 4F7NA 3PFQA 2OICA 4FZ7A 5HE2A 3I60A 3QQUA 4M69B 4EOQA 3Q5ZA 4QTEA 4F6WA 2E9VA 3LLTA 5HICA 2QI8A 2PE1A 4R3RA 4EL9A 3Q2JA 5IH4A 4L46A 4EWQA 3OZ6A 5BVDA 5HIEA 2XIKA 2QVSE 4TYEA 3MYGA 3JPVA 4FVPA 5DE2A 3TIZA 3LMHA 4FVRA 4DG3E 5L2WA 3ZH8A 4EK5A 2GNLA 2ZM1A 2WMSA 4P7EA 5JMSA 5GZAA 5E8UA 4O0UA 1GY3A 5LVMA 4ZTMA 1H1SA 3V01A 3F2NA 2XUUA 3Q52A 1FPUA 1WBVA 1FMOE 3O8PA 5I3RA 5CANA 3V51A 5AP7A 4C7TA 3RM7A 5F4NA 2VN9A 4CFUA 3DXQA 1H1WA 3R7UA 3DPKA 3FYKX 4ZSAA 4EH2A 4GK4A 2XNGA 4XEYA 4ZSEA 1Q41A 5BUJA 3U51A 3QCXA 3H10A 3Q6UA 4BIEA 3Q96A 4AFEA 4XHKB 4FKRA 2R3LA 2W4KA 2OI4X 2J7TA 5E8VA 3F3WA 3KN6A 1J1BA 3DT1A 5JGAA 3G6HA 2OJJA 5AR3A 1WFCA 1P4FA 3DU8A 2WQEA 4FT5A 4BZOA 1UU7A 4Z3VA 2R7IA 2R3HA 4FMQA 4C02A 4DCEA 2X2MA 4JR7A 4I93A
chains in the Genus database with same CATH superfamily
5KUPA 2QOCA 3KK8A 3BV3A 1SVEA 2V5QA 2C3LA 3ODYX 4MNFA 4JBQA 2UVXA 2H8HA 4QPAA 5CASA 3F5XA 5KE0A 4DEAA 1ZY5A 2E9PA 4BCGA 4DBNA 5HQ0A 3Q32A 4LI5A 3GQIA 3AC5A 5HG7A 2QD9A 4QMTA 1TVOA 4EOIA 1JPAA 2JKKA 3DFAA 2W96B 4N6YA 4UWBA 5IF1A 4LGGA 4R7IA 1PJKA 3OY1A 4LUDA 2WNTA 4ZSJA 3C4XA 3P4KA 1UKIA 3EFJA 5CENA 2JIIA 3C5IA 2CPKE 3FBVA 3ZUVA 3ORXA 3LM0A 4HNIA 2VTHA 3SX9A 4XG9A 2ITOA 4KBAA 4CRSA 5AIRA 3A99A 3WF5A 4F6SA 3O0GA 1U46A 1K2PA 3NFGB 4ZTSA 3PIXA 3O8TA 3E3PA 4I3ZA 4I5HA 4LMNA 4O91A 3Q53A 3R71A 2EWAA 3OWJA 2QOBA 3SW4A 2ZM3A 3IDCA 3ORLA 4Y5HA 4IB5A 5ANDA 2UZDA 1WVYA 4DHZA 3LJ0A 4O38A 3FUPA 4RJ7A 3VONA 2B54A 4KB8A 3F5GA 4IDVA 4KNBA 3GXLA 5CWZA 3VUIA 3C4FA 3D7TB 5BQ0A 4OTPA 4A07A 3GU7A 1KUTA 1JLUE 4B0GA 3F7ZA 1G8KA 4TRLA 4YPSA 2VWBA 3QXOA 3V6SA 4RRVA 5DRBA 5CAQA 3G90X 2EXCX 4YO6A 4V01A 3NRMA 3ZM9A 1VR2A 3AOXA 4LL0A 3C13A 3C0IA 3UPZA 3S3IA 2OIQA 4IX4A 3VQUA 4BDKA 3MH2A 4XNEA 2R3JA 2F2CB 3GNIB 4GG7A 4FUXA 4CNHA 4J97A 5TR6A 2BAJA 2XVDA 5I4NA 5IG1A 4XV9A 3BEAA 5J1VA 2BVAA 3TNHA 1GJOA 4YUQA 2Y8OA 4MBIA 4BCFA 4CQEA 1VJYA 2XBAA 4ITJA 4YJVA 4QMXA 3P08A 2WQOA 2WEVA 5K0XA 2OW3A 4EOMA 4L52A 5BMSA 4ARKA 3W0NA 3PLAE 2FH9A 4FOBA 3CD3A 3QD2B 4ANLA 5K9IA 4QP1A 2V7OA 4DFLA 4C2VA 5KMMA 1XH9A 4TWCA 4GU6A 5C03A 5E8ZA 4BDIA 4B99A 2AYPA 5AA9A 1YXVA 5HOAA 5LWNA 3NYNA 1MP8A 4S34A 3MH3A 2P55A 1Q62A 5CI7A 4DF3A 5EDRA 4J8MA 2J5EA 4X7QA 4AGCA 4YJRA 1ZMUA 3QX2A 3EQPA 3RM6A 4ZY4A 1UU3A 4EUUA 4U44A 2W1DA 4NU1A 3QWKA 3ZLSA 5EYKA 4RIYB 5H9BA 1OPLA 1JKTA 3C0HA 1OL6A 1W7HA 3FXWA 3R83A 4TYHA 4FKJA 3F5PA 3AD5A 1PXMA 3IK3A 4PPBA 4BCJA 2QU6A 2R0IA 3QZGA 4NT4A 5C26A 2P4IA 4FG9A 4IJPA 4YJSA 4ALUA 3BWJA 4ACHA 5BVOA 3BV2A 2WB8A 5CI6A 4I1ZA 5E8XA 3LFSA 2VNYA 4G3GA 4DEHA 1QL6A 3PSDA 3OEFX 2R3NA 2YM3A 3FZPA 3R1QA 4FZDB 3L9NA 2JITA 5ICPA 4BDBA 5GJGA 3OCTA 3FV8A 1W83A 2BDJA 4BYIA 2P33A 5AUYA 2GHGA 2GS6A 3MPMA 4BDJA 4CGAA 2R5TA 4KRDA 4GYIA 2C6LA 5EW8A 1IA9A 4QMZA 2BZIB 2RGPA 4LOOA 2YABA 4BDGA 2GQRA 2IVVA 3NUUA 2LGCA 4NWMA 3V6RA 2NNWB 4A9TA 4Z7GA 4WIHA 2J0KA 4IAYA 2WMBA 4JBOA 4OLIA 1PW2A 3SXSA 1PXIA 2CN8A 3QUEA 3RALA 2YDKA 1FINA 3PIZA 4A4OA 3QZIA 3CIKA 4YHJA 4AXDA 4F65A 4ITHA 1PKDA 3UOHA 2VWZA 4O7NA 4O0WA 5I0BA 3FDNA 4FNWA 5HE3A 4ZLYA 1QPCA 4O83A 4FX3A 2WU6A 4RJ6A 4RIXA 5JFWA 2VTIA 3PZEA 3FMEA 5AR8A 4F1MA 5IKWA 5IPJA 5L3AA 3ZM4A 5K4JA 4H58A 1JVPP 3O50A 4UALA 4F6UA 1LR4A 3ZUTA 4TWOA 1REJA 2WTCA 3QYWA 3BBTB 4LGHA 3FC1X 4DYMA 5M57A 4ZMEA 4L3JA 3NYXA 3WI6A 2H96A 4GK3A 3W18A 4Y46A 5A4QA 5KMNA 3UE4A 3ML1A 3COMA 3ZHPC 5CF5A 4ANQA 3ZRMA 4JOAA 3CJFA 4BL1A 4BRXA 1F0QA 4ZP5A 5JZNA 3UODA 3TMOA 4AG8A 4LRMA 4NM3A 4O27B 4ZZNA 5CF6A 1A48A 3NZ0A 4LGDA 3D5VA 4OT6A 4FTRA 3OUKA 5CQWA 1YI3A 2PU8A 4M0YA 3KCKA 1H24A 4BKZA 4E5WA 3EN7A 2OGVA 4RFMA 3UZRA 1I09A 3D0EA 3PG3A 2X1NA 3R9HA 3Q4ZA 5TOZA 2YA9A 5E91A 3IW8A 1KOBA 2V22A 4FI1A 4YC8A 4CMOA 3MB7A 3GP0A 3P86A 4KSPA 4HYUA 4C4IA 3Q9ZA 3BYUA 2WAJA 3L8XA 4IVAA 4IX5A 3R73A 2G2IA 5TO8A 4HPTE 4MWHA 1ZYDA 2BHHA 3O71A 4M7IA 1Y91A 4FSQA 4AT4A 4O2ZA 1RW8A 3HA8A 4G3CA 3NCGA 4OR5A 1ZYSA 2OJGA 3R21A 4YZNA 3VS4A 3K5VA 4UY9A 3WZEA 4CFNA 3KF4A 5D41A 5DN3A 5HU9A 5A3XA 4CVAA 2ITPA 2XNPA 3GEQA 4IC8A 5FBOA 2X8DA 5HE0A 5L6PA 4FKGA 4ASDA 3LQ3A 5IDNA 5JKGA 4YZDA 5KMKA 4HVIA 5HG8A 3QD0A 4IAKA 4JRNA 4QPMA 2XJ0A 3QQKA 3GGFA 2BDFA 2BFXA 2CGUA 2CKEA 2W4JA 3VS1A 5JK3A 3ID6C 2F57A 3PPZA 1OM1A 5ANGA 4BZDA 5E9EA 4I0RA 4L7SA 3PXKA 4TYGA 3ZC6A 1APME 3QXPA 3JVSA 3TEIA 1O9UA 2W9FB 3U54A 3GB2A 2QO2A 3IW4A 4F7SA 3QUDA 3ITZA 5DT4A 3FE3A 3IQ7A 3QLFA 4ZMFA 4JDHA 3SGCA 1Q8TA 4CZUA 5J9LA 4GCJA 3C7QA 4GH2A 5C01A 5IQCA 3BKBA 4TN6A 5EK7A 4HYHA 4O6EA 4QP6A 3QQHA 4AN9A 4HYSA 3W8LA 5AV1A 2HY0A 4B9DA 3TV7A 3NS9A 4FTKA 4LV5A 4MQ2A 1I44A 5ANKA 3ORIA 5EYCA 4N6ZA 5K4IA 1ZY4A 3LLAA 1NT2A 3OCBA 3MV5A 3RPRA 3R7IA 3LZBA 2QHMA 3UOJA 3BU3A 3BQRA 4GL9A 4EJ7A 4C36A 2XF0A 3HGKA 4IC7A 2IW8A 3FXZA 4FKLA 2PY3A 3MSSA 4PMPA 4G3EA 3I6UA 3PXYA 2HELA 5KMOA 4CKIA 2X7FA 1ND4A 3L8SA 3IDBA 4GW8A 4B8MA 4JIKA 5J9ZA 2PUPA 2VWYA 4YO4A 1TKIA 4I4EA 4QP2A 4U0IA 3U4WA 3V8SA 4HGTA 3VUGA 3OWKA 4IMYA 4BCQA 4H36A 2WELA 4L68A 1T45A 1X8BA 2BKKA 3S1HA 5A14A 2GHMA 2XA4A 2XK9A 4DFNA 4HPUE 4ZS4A 3OHTA 2FSLX 3I6WA 2CNVA 3W0OA 4ZXTA 4EYJA 2C0TA 2DUVA 2XNMA 2ZYBA 4CFVA 1Y8GA 3HV6A 3QGYA 3QA8A 1XO2B 4P2KA 2BFYA 4FGBA 1BL7A 4D2WA 3CCNA 4W9WA 3TIYA 4I4FA 4OTDA 4U3YA 3VQHA 4FZFB 5L2QA 4D5HA 3F61A 5AX3A 5HU3A 4QMMA 4G6LA 2NRYA 4RQVA 4RZVA 4PTCA 5DNRA 2AC5A 3ZC5A 1SZMA 3G51A 1QPEA 3FJQE 3OT3A 4IFCA 5CALA 4C62A 5L4QA 5D12A 3CY2A 4WSQA 3R7EA 4OAVB 4S31A 4FGRA 4LYNA 4UYAA 1OKWA 4C57A 2OH4A 3BGZA 3PYYA 1GZNA 4PTGA 4BIDA 3UG2A 4DH8A 3A7FA 3I1AA 4KD1A 3DXNA 5M4FA 3GC7A 1IG1A 1YOLA 4NUSA 4O0RA 1Y6AA 4AA5A 3NUAA 4F1OA 1PMVA 4NM7A 3W8QA 1XH6A 1KE6A 4MK0A 2WTJA 4BWPA 3DCVA 2C6DA 2BKZA 3JY9A 3FPQA 4M68A 2VO7A 3DA6A 3KXGA 4CD0A 3AC1A 3IONA 5K3YA 4M66A 5AP2A 2BRMA 4R3PA 4DDGA 3W16A 4O2PA 3CKXA 3KREA 4QYEA 3TTIA 4MBLA 5JT2A 3R2YA 2ONLA 4U41A 2HWOA 4BB4A 3FI4A 4E5BA 1Z5MA 3RNYA 3VUHA 4BTKA 1YI4A 4MF1A 4UB7A 4FV1A 4JLCA 3R9RA 5LCKA 3EL8A 1SVGA 1P14A 4EONA 2XK6A 3FMLA 2FA2A 5K5XA 3IW5A 4X3JA 3NAYA 4RX9A 5DT3A 2B0QA 5EI6A 2ZVAA 4S33A 3T3VA 3ZO1A 3HP5A 4EC9A 3A7GA 4EQUA 2BMCA 4OT5A 4OUCA 2C0OA 3PXQA 3D4QA 1RQQA 5DFPA 2QU5A 3KMMA 4JJRA 4MF0A 1JSTA 2I1MA 1FVVA 3I5ZA 1JNKA 3UJGA 4ZSGA 4I41A 4ALWA 3NW5A 4C59A 5HBJA 2CNUA 3E87A 3OFMA 5M55A 3DQWA 3V5JA 4C4JA 1EH4A 2HW7A 4XOZA 4RC4A 2XNEA 4FKOA 2PL0A 3ALNA 2OJFE 3JS2A 3LCDA 3R9NA 4J53A 2YIYA 3BCEA 3DAKA 4O21A 5E8WA 4FSMA 4EH8A 4FV0A 4YBJA 2VTPA 1GOLA 4DLIA 3QA0A 3G5DA 4FKIA 4XX9A 5DG5A 4LDTA 4D28A 3PJ8A 2IVTA 5AWMA 2FUMA 5JSMA 2RF9A 4MVFA 4WUNA 2VWWA 3FMNA 5E1EA 5IA4A 3IW6A 2BALA 4XLVA 3UC3A 5IEVA 5EH0A 5GIPE 3BYMA 3W0RA 3SXRA 3MW1A 3FZOA 1O6LA 5I9VA 1W84A 1WVXA 1AD5A 4I92A 4QMPA 2XRUA 1BL6A 3PJ3A 5C1QB 3IGOA 4XG6A 4C2WA 2YIQA 1JSUA 2WMQA 4K9YA 3HDNA 5DT0A 5L2TA 4IM2A 2PVRA 3FPMA 3AMYA 3KQ7A 1CDKA 4O0YA 4QMSA 4X3FB 3R8UA 3ZRLA 2J0LA 3KK9A 1RDQE 3DKOA 2W17A 2WMAA 3OCGA 4ID7A 3ZZWA 4B4LA 4E4MA 3PY0A 3QCSA 4MYGA 3S00A 3P7BA 4G31A 4F0IA 3KVXA 4F7LA 2IZUA 2YAAA 5CXHA 5KKRB 4LMUA 1H4LA 2JDOA 4KKHA 2VAGA 3QQLA 3RTPA 4U5JA 2NPQA 2ZV9A 4AA0A 4RWKA 4AE9A 4BDFA 4EOOA 2W1CA 3S2PA 2J4ZA 2ITVA 2RSVA 4IVBA 2BCJA 2VO0A 2H34A 2HXLA 3IO7A 1YHWA 3Q04A 2G2FA 2QKWB 3DBCA 3OWLA 4NK9A 2GMXA 3P0MA 4YNEA 5A4EA 3DK6A 3H3CA 2HXQA 1B6CB 1OL1A 2XYNA 4RC3A 4JMQA 4MD8E 3RAWA 3BHVA 5HCZA 1BKXA 3KC3A 4H1MA 5IU2A 2CHLA 4G2FA 2OG8A 4R7BA 3NWWA 3E92A 1BI8A 3FMDA 5I9WA 5AV3A 3AT3A 3UQFA 2OH0E 5EW9A 1M14A 2UW5A 3QAME 2ESMA 4XOYA 3SLSA 3ZO2A 5FM3A 2QG7A 2C5NA 3UPXA 3SRVA 4CFWA 1WBOA 2VO6A 3ZMMA 2KULA 3R7OA 4E6CA 5AUVA 5CNOA 4F4PA 2YWPA 4O7LA 1R3CA 5CNNA 3C0GA 2ITXA 5CEOA 3MIAA 2OK1A 4RVLA 3KXHA 3NNVA 5AR4A 2VO3A 2R3KA 4FSRA 4G6NA 3VAPA 2G9XA 4PDYA 3AC2A 4GJ3A 5IISA 1J7LA 2PVNA 3ORPA 3GOPA 3AXWA 2R3GA 4PDPA 4F7JA 2W5BA 5D11A 4DE4A 3LW0A 3AC8A 3PY3A 2X0OA 3MB6A 4TYHB 5DR6A 3DK7A 2A1AB 4PP9A 1U54A 4KA3A 1XH8A 5BVFA 4RIWA 4FTMA 2XK3A 4U3ZA 5KMIA 1G3NA 3UMWA 1S9JA 4M12A 3MH1A 3PPKA 2GS2A 4ALVA 1YOJA 4I6QA 4NYEA 4NZWB 4ACMA 1XH4A 1YRPA 2A27A 3QKMA 4FSYA 1MQ4A 4IB1A 3W0QA 3OTUA 4AOJA 3ORNA 2YJRA 3LXPA 3TCPA 4DFXE 2ZOQA 3CTJA 5AIKA 4JDIA 1KOAA 4GV1A 1LEZA 2PZ5A 4XRJA 2ZDTA 4LRKA 3OBJA 3MPTA 2GNHA 2JBPA 4P4CA 2UZVA 3LXLA 4QP7A 3V5QA 4ASEA 1WBTA 4JR3A 4TPTA 2J51A 3EIDA 3QQJA 4NJ3A 3RPYA 4GJ2A 3RWQA 3F88A 4CFFA 1OIRA 1YXXA 4JDKA 3W2OA 4B7TA 1OKYA 3F7WA 5CVFA 4L01A 1M7QA 3LMGA 4QO9A 3FHIA 4U81A 2ACXA 3D5WA 1MRUA 2QOIA 4GK2A 4DT8A 2X4FA 1H0VA 3TNIA 2FYSA 4Q9SA 2IW6A 4X2GA 2PTKA 1ZOEA 3R1NA 2GTMA 3U9NA 3WF6A 4RVKA 4FVQA 1KV1A 2QLUA 2XCHA 3KXXA 3LCOA 4RIXB 3MVJA 3S4QA 3TWJA 4EH5A 3AKKA 4H3QA 4DHIB 4R78A 1SVHA 1B38A 3SA0A 4GMYA 3Q5IA 5KX8A 1GAGA 3NW7A 2JBOA 3DAJA 3RJCA 2HY81 3MVMA 2YERA 4K18A 3WE8A 2VTOA 3BU6A 3P1AA 4HZSA 5I9ZA 4XG2A 1OUKA 4LFIA 4I23A 3G0EA 3QTZA 5ETCA 1R1WA 1H00A 5H8GA 5HHWA 4BKYA 4AN3A 2WGJA 5HD4A 2YIXA 3ZO4A 1W2DA 3VBWA 3QTSA 3KF7A 1YDRE 4IAAA 4NKSA 2I0VA 3KA0A 3CQUA 3W0SA 1RJBA 3KRJA 5C27A 1H26A 5C8MA 2PVMA 2EVAA 3BHHA 4JBPA 4QRCA 3TKHA 4DTKA 4OAUC 2O2UA 3CGOA 5A4LA 4DEEA 2ERZE 5K0KA 3SDJA 3VVHA 1J91A 3DZQA 4Y73A 2O64A 4DG2E 4FTNA 5JQ5A 4FV8A 2YFXA 3FKOA 4DDIA 4R8QA 3CGFA 3W33A 1UNHA 3M11A 1R0PA 5AR7A 3VF9A 3TUBA 2C6OA 2C6KA 4R1VA 4EKLA 3Q4UA 4NIFB 4WG3A 4ZJJA 4S2ZA 5AUZA 5IA0A 2V0DA 2Y9QA 4IZAA 4PDSA 4O7YA 3I0OA 1G5SA 4FT3A 3EKNA 4BKJA 4FV4A 4NW6A 4N0SA 3T3UA 3ATSA 3CC6A 4FTJA 5FXQA 3ZO3A 5M08A 5IDPA 2QONA 3BRBA 4FKUA 4XJ0A 3TV4A 2R3MA 2YCFA 1H07A 3OY3A 3MA6A 4OTGA 1U4DA 3HVCA 3QCQA 4E5AX 2W06A 3DBEA 2R3FA 3RZBA 5FG8A 1U5RA 1KV2A 4E6DA 3RINA 4DLJA 2OXYA 4GUBA 3FEGA 4U80A 3ZUUA 4E20A 2WU7A 3UOKA 3GCQA 3VJNA 2NYAA 4UMTA 4WNPA 5EHYA 3G9NA 3HV5A 2UVYA 5EI8A 1XWSA 5E8TA 3LFNA 2QCSA 4FV3A 4GU9A 2UZWE 2Z7QA 4I6HA 4YP8A 2Q0BA 3ORMA 5CF8A 4F08A 3NNXA 2HENA 2X7GA 2FSTX 3QRJA 3RHXA 3ZDUA 4GIIA 5GNKA 4DGMA 3DY7A 4W8DA 3EJ1A 4K1BA 4QNAA 1JSVA 3EQBA 3PVWA 4IAFA 3TKIA 3QTUA 1UWHA 2YHVA 4KS7A 4YZMA 1GZOA 2UZLA 4IE9A 3TKUA 4Q2AA 3FHRA 4GS6A 1V0OA 1YWNA 3HP2A 3ET7A 1PXOA 4F64A 4JG8A 4LL5A 5EQPA 1P4OA 5C4LA 3QALE 4V05A 1OIYA 3FC2A 4DINA 2E9OA 4O22A 3ZXZA 4C0TA 3R30A 3EZRA 3H9FA 2QG5A 4WNOA 1LP4A 2BILB 4YLKA 5M53A 3QZFA 3BHUA 4IB3A 3UO4A 2CMWA 4YHFA 2FO0A 2PUNA 3TTJA 3KY2A 4YPDA 3FKNA 3CTHA 4MCVA 2P2HA 3UP7A 5LARA 5KNJA 4E1ZA 2ZDUA 5H8BA 2X8EA 5ANIA 3L1SA 4PNKA 3K3JA 3F9NA 4PPCA 5A4CA 1FVTA 4FG8A 4L43A 4O1PA 4EH3A 5BYZA 3BYVA 4UZHA 5F94A 1TQIA 2IEWA 3BL9A 3CQWA 3NSZA 4GT3A 1AQ1A 3R04A 5AEPA 3MTLA 3PG1A 1KSWA 2C47A 2C6EA 3R02A 4N4SA 3UMXA 5LVOA 5DPVA 1WBWA 2Q0NA 4GT4A 5EOBA 3TT0A 4O96A 5KBRA 2YWVA 1OBGA 2F4JA 2OIDA 4I6FA 4DFZE 2PE2A 4OTRA 1JKLA 4D2VA 3OW3A 4JI9A 5AJQA 3QD3A 3FXXA 3HKOA 3HZTA 3PE2A 1PXJA 3U8WA 2XKCA 4Q9ZA 3PP1A 1MQBA 1XBBA 4MH7A 3KB7A 3DK3A 4DG0E 4QMUA 2VTAA 3V3VA 1Q97A 2JIUA 3LXKA 5EM5A 4QTDA 3ULZA 5CU4A 3JY0A 4MHAA 4ZY5A 4I5CA 2EXMA 2JLDA 4EK3A 3DDQA 3OOMA 2PMIA 3GI3A 3PVBA 3VULA 4C4EA 1WCCA 2UV2A 2XK7A 4UWYA 1FOTA 2VX0A 4O81A 3FLQA 3ZYAA 3NYOA 3LKMA 4CCBA 2C1BA 4TTHB 5L8JA 1YWVA 2O3PA 4WHZA 3OCSA 2F49A 4A4LA 4FTTA 2YCRA 4RC2A 4UBAA 3MPAA 4FKVA 5L2SA 3MI9A 1W82A 2BUJA 3NEWA 2HOGA 4PMTA 4PV0A 4UMQA 2QKRA 4AGDA 4A9YA 5IZFA 2EB2A 2OZAB 3NIZA 1L8TA 4W4YA 4Y95A 1MRYA 2ITQA 2XKFA 4K2RA 4MX9A 3PWYA 5CTPA 3VIDA 3H0YA 5JGBA 3Q4CA 5CSVA 2FSOX 1UNLA 2ITNA 3ORZA 3MFSA 1TZDA 2I6LA 4S32A 2VTRA 4KS8A 4USDA 3QFVA 1H28A 3G2FA 4IHPA 1URCA 4RJ5A 2OF2A 5HNGA 2UZTA 4MXYA 5BMMA 5CEQA 2J0JA 3VS2A 4X2NA 3D7ZA 4ZTHA 3OXZA 2XKDA 4OBOA 3RZFA 3VBTA 4TWNA 5J5SA 5M06A 4G9CA 4TT7A 4BDDA 5AUTA 3W2RA 2YACA 3THBA 3O23A 3SKCA 2CKOA 2GQGA 4MTAA 3BI6A 2W1HA 2RL5A 1J3HA 5FBNC 4CQGA 4IFGA 2XEZA 1OKZA 3DBDA 4BGQA 1CKJA 2VRXA 3NNUA 5AMNA 4D2SA 3FLZA 1PMEA 1PHKA 3K54A 2A19B 3MJ2A 4H1JA 5HEZA 4C8BA 4ZTRA 3CQEA 5HGIA 2Y7JA 4PRJA 4QT1A 5FLFA 2VWUA 3VWAA 2X9EA 5IH6A 5G6VA 4MNEA 2F7ZE 5FGKA 2AEGA 4Q5EA 3FY2A 3EFWA 1UV5A 1REKA 1IRKA 3MH0A 5DGZA 4BN1A 4AZEA 4FL2A 5L6OA 4I6LA 3PRFA 4F0FA 3SW7A 1YOMA 5IQAA 4ANBA 1DM2A 1OI9A 2J90A 3DKFA 3OF0A 3QL8A 3EH9A 4LG4A 4ERKA 2PULA 4G17A 2Z7LA 4IZ5A 4C4GA 3GFWA 3KXNA 4FT0A 2BTSA 4UEUA 5DEWA 4PP7A 4EK6A 3FMMA 1A06A 3R6XA 4F9CA 4OW8A 3NYVA 1W2CA 2YIWA 4IAZA 5EQYA 5F9EA 3QTWA 2B9IA 4TYIA 5AR5A 3A62A 4X0MA 4EJNA 2XJ2A 2ZMCA 3KXZA 2C4GA 3AG9A 3UQGA 3ZFMA 3W10A 1FVRA 3LVPA 5CAVA 4JBVA 4A9UA 2QC6A 4XUFA 4BIBA 1H1RA 1GNGA 5HX8A 3WARA 3B8RA 4QMOA 4BHNA 1PMUA 3UNKA 2OKRA 4GUEA 4U97A 4RJ8A 4XRLA 3DKGA 5IA2A 3NFFB 3ZZEA 2EU9A 2OJIA 4KBCA 4LM5A 3BHYA 3L8PA 4EZ7A 5M51A 3W0PA 1CKIA 2XZSA 4RVTA 4F9WA 4D0WA 4KRCA 3U9CA 4RIOA 2JDTA 4ZZMA 1YDSE 4NM0A 1J1CA 3ACKA 4XV2A 4YTFA 4MXAA 5EM8A 2W4OA 1OKVA 3Q9YA 3NUXA 5E8YA 4HGLA 2HZ0A 3BL7A 3CKWA 5TE0A 2XCKA 3EQFA 4EEVA 5L6WL 2C6IA 2XIZA 5IH5A 3AGLA 4NFMA 1L3RE 2VV9A 1W8CA 2DWBA 3JYAA 4GYGA 4D2PA 3QZHA 2UVZA 4O1OA 3C4ZA 2GQSA 5TKDA 5L8KA 5E92A 1XH7A 4FSTA 3CE3A 4DH1A 3F66A 3DJ7A 4RPVA 3GCSA 4AE6A 4AWIA 4FODA 4AW2A 2ONLC 2JIVA 3SRVB 1Q3DA 2O63A 5FUTA 4PMMA 4KKGA 2C3JA 3ULIA 3EN4A 3OOGA 3VBYA 1H1PA 4KUJA 4ASZA 3PA3A 4AT3A 5DOSA 4CCUA 1OIUA 3DBQA 3AKJA 4ASXA 5CEIA 3P7AA 3SHEA 5LMKA 3COKA 3PE1A 4B6LA 3FLSA 5GZ9A 4YJTA 4FRFA 2YLEA 3FYJX 3B8QA 4FT9A 4QDEA 3TM0A 2ZB1A 4MWIA 4BGGA 2HZNA 4FSUA 4FEUA 5CXZA 3VO3A 3DLSA 2GNFA 3LCKA 1YQJA 3QRTA 3A7IA 1U54B 2UZNA 5CAPA 5JZJA 4RIWB 3R1YA 5AV0A 4AGUA 3BBWA 5AUXA 4I0SA 4IEBA 2IWIA 4BBEA 3MFUA 3DS6A 3POOA 3R9OA 3TJDA 4ZLZA 1OL7A 3V8TA 4DC2A 2I0HA 2PZRA 3QGWA 4QMNA 1Y8YA 2CSNA 4HYIA 2J9MA 3EFKA 5JGDA 2YM4A 4Z7HA 3Q9WA 1G8SA 3FY0A 2W99B 4X2JA 5HTBA 3WILA 2REIA 1BI7A 1QMZA 2YM7A 3RNIA 2CGXA 3OD6X 1Q8UA 5D7VA 4BFMA 5E7RA 2XANA 2XRWA 4KINA 1W98A 2C69A 2GNIA 4KIOA 4NEUA 1OGUA 3CPBA 1WAKA 3CS9A 5GJFA 1QCFA 4JL9A 5B2KA 3F82A 5HNBA 3D2IA 5LWMA 3QF9A 4JXFA 4PMSA 1GIHA 1SNXA 2DYLA 2B1PA 3R1SA 4L53A 4RGJA 5AP0A 2XAOA 3BPRA 1XKKA 4K0YA 5HVYA 4YTIA 4RFYA 3R8VA 2WTDA 3CP9A 5L2IA 4BI0A 4EH4A 4OTIA 5FTQA 3GCPA 4IBMA 3MWUA 5ETAA 2YCQA 3DKCA 4CV8A 4EUTA 2YITA 5K5NA 5ANEA 4C61A 1NVSA 3DLZA 2XIRA 3PA5A 3TDWA 4XS2A 1HCLA 4TW9A 4EHGA 4EBVA 4UXQA 4AW0A 4GFOA 3LXNA 3TL8A 2GU8A 2BROA 2BIKB 2C5VA 2VX3A 3GQLA 4FICA 2QOQA 4EORA 4WRSA 1NVQA 3SQQA 3N4UA 2QOHA 4CLIA 4XG7A 2X0GA 3EHAA 5E4HA 1VEBA 3WF9A 2YN8A 4HGEA 1CSNA 3KL8A 2BR1A 4NH1A 4TNBA 1SNUA 5LMBA 2ERKA 2KTYA 3AQVA 5DI1A 5J1WA 3NVMB 3VBXA 4HVGA 3ZONA 4BDEA 4Z16A 3LFQA 3NUPA 3UVPA 4C58A 3MFTA 2V62A 3UYSA 3VUTA 4ACCA 5HTCA 4FTOA 2XP2A 2E9NA 2WXVA 5M44A 4YSJA 2XK8A 3P9JA 4IADA 4X2KA 3R7VA 3OVVA 2JAMA 1PF8A 1Q8WA 2BZJA 3D5XA 4QOXA 3ZFXA 5M4CA 2PMLX 5LQFA 2PMNX 2W1EA 3AC4A 3PSCA 3LIJA 2PVHA 4PX6A 3TG1A 4O7ZA 3I81A 1NA7A 4U8ZA 3VBQA 2PSQA 3PDTA 4PDOA 4ZY6A 5FXRA 2C0IA 2NO3A 2G01A 4HVDA 4XP0A 4F63A 2WOUA 3HMMA 4HCVA 3U6HA 3SG8A 3PP0A 3FQEA 5J8IA