5EW3A

Human vascular endothelial growth factor receptor 2 (kdr) kinase domain in complex with aal993
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
274
Chain Sequence
PYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title A Novel Potent Oral Series of VEGFR2 Inhibitors Abrogate Tumor Growth by Inhibiting Angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 274
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ew3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ew3A01
3QYZA 1R0EA 2J7TA 2WHBA 3PXKA 4R5YA 5D10A 2GFSA 1BUHA 5I9YA 5GZ8A 2YCSA 3EOCA 4YLKA 5IQCA 1GAGA 4RPVA 4FG9A 4UMTA 1YDSE 4WG5A 3GC9A 2WOTA 3GXLA 4I24A 1REJA 4USDA 2EU9A 4CVAA 4LI5A 3BU6A 4ALWA 4R1VA 2CLQA 4AZFA 2YEXA 3QTUA 4HOKA 2BCJA 1PKGA 4BFMA 4NKAA 4EH8A 1QPCA 3CTJA 1KE9A 3CLYA 5LMKA 5CLPA 5M53A 1ZYSA 4CEGA 3ZEWA 3QQKA 4JX3A 5BVKA 3KULB 3ZXZA 3HL7A 4XG9A 3JR1A 5D11A 1GNGA 3KCFA 2XIRA 4E7WA 3JY0A 4FKQA 2QU5A 2XMYA 4V01A 1LP4A 4KIKA 4QP8A 3E63A 4BWXA 3UNZA 3PPZA 1F0QA 4L7SA 3R1NA 2WQEA 5AR7A 4BZNA 4ANNA 2W9ZB 2WMVA 4QP9A 4E3CA 1S9IA 3AC3A 4FSZA 4N4SA 4ASZA 1DS5A 2I6LA 3EQDA 4JLCA 3ZO1A 4DFUA 2ITQA 2PTKA 3KKVA 5C9CA 3DJ5A 1RE8A 3V01A 5AR4A 3UMXA 2CNUA 2IWIA 2W4JA 4GFGA 3LFSA 4WHZA 1O6LA 1YWVA 5I4NA 3WZDA 3D5UA 3UOJA 4JL9A 3BQCA 3ROYA 3FYKX 3C4FA 5HLWA 4RX9A 5IA3A 4QYGA 3FQEA 2ITYA 2X81A 1H0WA 3BI6A 3MVHA 3DKFA 3AD6A 1W84A 5EI2A 4ARKA 3ZBFA 2FH9A 3E8EA 3HZTA 3PIZA 2VV9A 1JNKA 4NK9A 5AP1A 4QYYA 4C34A 5IA1A 2OZAB 1H1RA 2VGPA 5AADA 4YZNA 3HV7A 5ETFA 5KMOA 4YPSA 4BF2A 2X7FA 4D1ZA 5A4LA 4FSNA 5DBXA 5EYDA 4UEUA 4YC6A 3VJNA 2UW6A 4FA2A 4JG7A 3LXNA 4TYIA 4U6RA 3QL8A 4IZ5A 5C03A 4EOJA 4UYNA 3AC8A 1ZOEA 3QKKA 3VIDA 1OB3A 2WIPA 3PXRA 5HCYA 4CYJA 4C2WA 3OXIA 1MRYA 2H34A 3BU3A 2QR8A 4J99A 4F1TA 1TQIA 5DI1A 3VJOA 2V7AA 2XCKA 4JAIA 4AE9A 4C38A 4AG8A 4QPMA 4K77A 4ZTHA 2P0CA 4TYGA 4Z7HA 5JMSA 5I0BA 1Q8WA 4XX9A 3LJ1A 5HD7A 2WPAA 3K54A 4RJ6A 5CEOA 2J50A 3G33A 3P23A 5K0KA 2HZIA 4CTCA 4GT5A 3MFRA 4DITA 3HECA 5ICPA 3PY0A 3LFQA 1CTPE 3NS9A 3F69A 4J7BA 3LFCA 2YIYA 2XCHA 4OTWA 1R3CA 2OIBA 3S1HA 1R39A 1SNXA 3OOGA 4LOPA 3QF9A 2YDIA 5CSXA 4BDIA 4BWKA 4H05A 3ODZX 4JIAA 4D4SA 4J97A 2C3LA 3P7CA 1J3HA 3C4WA 3HNGA 4HYHA 4ANMA 5CANA 3EYHA 2Z7SA 3LXPA 4UMPA 5CAVA 4I3ZA 4YLLA 3QQGA 5H9BA 4BKJA 4IEBA 4R3CA 3UIBA 3PPJA 4H3QA 4ZLZA 5EOBA 3RALA 4FKWA 4O6LA 4IZAA 5GINE 2VD5A 1M2QA 4PPAA 4PP9A 5L6PA 1DAWA 2QO2A 2GTNA 3C4CA 4D9UA 1PYEA 3BEGA 5E8ZA 4EOQA 5KMJA 3C4EA 3FZOA 5L8JA 3TTJA 3EQHA 3F2AA 4LV8A 3HAVA 4F64A 3FMNA 1JOWB 2WQMA 3M1SA 3MIYA 3NUXA 2IW9A 3RAIA 5M06A 1ZMWA 4F6UA 3ANRA 4RC2A 3R21A 2GHMA 4L45A 3PSCA 4EONA 4I0SA 1LPUA 5FUTA 4CMOA 3JUHA 3MA3A 3MS9A 4PP7A 4G9RA 4O0XA 3PYYA 4BCHA 2C0TA 4XOZA 4G3DA 3HP5A 5L2TA 4M0ZA 3UZRA 4O7NA 1E1XA 4BIBA 4I92A 4C37A 1SMHA 3O71A 5AAGA 3ZDUA 1BYGA 3CC6A 3EN5A 2JC6A 4FSRA 3NSZA 5EI8A 2OJJA 3HV5A 2P3GX 3MPTA 5FBOA 4ITHA 4NEUA 5G6VA 4F6SA 4EH7A 2BTRA 2HY0A 4FICA 4G17A 3R9OA 5A6NA 2XK8A 4Y83A 4XEYA 1Q3WA 3LFNA 4AX8A 4IFCA 4RJ3A 5LWMA 4QTEA 4I23A 4KBKA 3F3UA 4FBXA 3CGOA 4C36A 1YI6A 1ZRZA 3QYWA 2C69A 2VU3A 4GUEA 2BILB 4Z7GA 3PDTA 4FK3A 4K2RA 3EQCA 2F7ZE 1KOBA 5KMNA 3I7BA 1H08A 5IA4A 5HBHA 4MWHA 2O8YA 2VWUA 2R3RA 4TPTA 2PWLA 2VWYA 2UZOA 2I1MA 4PNKA 2RG6A 3CR0A 4LRKA 1FGIA 4CCUA 4BDEA 2VTOA 2YCFA 4K18A 1H1SA 4KBAA 4LM5A 3IGGA 5EHOA 1GOLA 5ACKA 2PMLX 1Q99A 3ZZWA 2XB7A 3NUUA 2HCKA 3HRCA 3DV3A 3OMVA 5JGBA 4ZJIA 5ANKA 4FTCA 4WG3A 1JSUA 3FL4A 3JYAA 4XP2A 4KIPA 3FMKA 3E8NA 4L6QA 4YTCA 3ZC5A 2XA4A 4BR3A 3ZC6A 4XLIA 4ONAA 3LFDA 1ZYDA 3FHIA 3QTIA 1AGWA 4S30A 4Q2AA 4TRLA 5IG1A 4EQUA 5IMEA 3WF7A 5ITAA 1PRYA 4KSPA 3VS7A 1YXXA 3FJQE 4MNFA 4BB4A 1IAJA 4GVAA 4FV5A 4MD7E 4OBQA 3FMHA 3PJ1A 3W55A 5M4FA 4Y73A 3P08A 3R8LA 2OIDA 4DAWA 1OECA 5ACBC 4U8ZA 4XS2A 3JY9A 3PZEA 3R8MA 3V6SA 1A48A 2ZV2A 4FV9A 3UOLA 2DWBA 1R78A 3F9NA 3VBQA 5CVGA 2YM8A 3DLSA 2HOGA 4S31A 5F9EA 4QYEA 4X2FA 2ZDTA 2VTAA 3EN4A 4IAIA 5DE2A 4AACA 3TIZA 4FC0A 4XBRA 5GIPE 4FV7A 4JDJA 4LG4A 3KRWA 3MFUA 3KVXA 5DA3A 1OKZA 4HNFA 3SV0A 5C4LA 3DNDA 4Q5EA 3GOPA 4HGSA 4BDJA 1UA2A 3FXXA 5HG9A 5BMSA 4QMLA 3EFLA 3GP0A 1BI8A 3UDBA 1Q41A 3W8LA 3NW5A 4CLIA 5K5NA 3EB0A 1JPAA 5HVJA 4WOVA 5AUWA 4CQGA 3HRBA 4MQ1A 3MESA 5M08A 5BX0A 4YTFA 2VRXA 4PWNA 4X2KA 4X3FC 3AMAA 2J0LA 4M15A 1WFCA 1VJYA 1UU8A 3SRVA 3V6RA 2WTDA 1XBAA 2O5KA 4GUBA 4MXYA 4FG8A 4XBUA 4FIHA 2W5HA 2W1FA 4MEDA 4EH3A 4AGDA 3WE8A 2VNYA 3LAUA 3PE1A 3O7LB 4K1BA 3LCKA 2P2HA 2FVDA 5A4CA 4DC2A 3QZIA 3DKCA 4PDPA 4DBXA 3QWKA 3K3IA 1Q61A 4YMJA 1WVWA 3GQIA 3QA8A 3P7AA 5TF9A 4IAZA 4FOBA 5IKWA 3TT0A 4DE4A 1SZMA 4FTUA 5IUIA 3V51A 2YN8A 2WD1A 5KMMA 3AOXA 3HKOA 4A9YA 1UWHA 3POZA 4HVHA 1S9JA 3HMOA 4ENXA 5HG5A 1DAYA 1KSWA 3G6HA 3LFBA 3PA4A 4C33A 3U4WA 2PE0A 3BWJA 3L8XA 4EOMA 4F6WA 5J9YA 1L8TA 4YC3A 3QQUA 4FYOA 4PMTA 4QTBA 4ZTLA 4ACMA 4H39A 4P90A 4ENYA 2WMXA 4J71A 2WTCA 5JK3A 1JQHA 4P2KA 3KXGA 4D2PA 3DNEA 4BDHA 4GT3A 5FTOA 3PXQA 5GNKA 4FUYA 4BTFA 3OD6X 4FV6A 4L44A 5DT4A 5AP5A 5BYYA 3TJDA 2ZM1A 4XP3A 5KZ0A 2AC5A 3EJ1A 4FTJA 3MN3A 4R5SA 2UW0A 3NYVA 3NX8A 3Q2MA 4Z3VA 3SG9A 3QQJA 4D55A 1CSNA 3KXXA 4PL5A 4DT9A 2R3PA 3FQHA 3FLZA 3OWJA 2R3IA 3QD4A 2VX3A 2HW6A 4MYGA 2XIYA 5L3AA 4FKTA 2X7OA 5K5XA 2CSNA 3EMGA 3R1QA 4M12A 4O1PA 3TCPA 4F0GA 4OLIA 3U6IA 2QOLA 1OKVA 4E8AA 3C9WA 1NA7A 4RFZA 4MXZA 2I40A 5CZIA 3GCSA 4P4CA 3R7OA 4XV1A 3FL5A 3UZTA 3ODYX 4FT9A 4BTJA 3EWHA 4FSMA 1CM8A 3K5UA 4EH6A 4DFBA 2JIUA 3DB6A 4Y5QA 1Q3DA 5E8TA 4G9CA 3V3VA 4C4IA 2PMNX 4NTSA 3OTVA 2WQOA 4Z55A 2GU8A 4FOCA 3ZM4A 1URCA 2ERZE 3C5UA 3CTHA 4KWPA 5F4NA 4FG7A 5M56A 3EFWA 4E6CA 1SNUA 4LL0A 2ONLA 4I0TA 4FGBA 4YNEA 1Y6AA 2BTSA 3KMMA 2X4ZA 1VEBA 1H24A 2VTHA 5HU3A 1FQ1B 4FSQA 3F61A 2WU7A 3OBJA 3QKLA 3BGPA 3OHTA 3SX9A 1PY5A 4NUSA 3KY2A 2BR1A 2IN6A 3QGWA 5BUEA 3G15A 3UVPA 4FODA 2QI8A 3KXMA 5E4HA 2F49A 1MRVA 3EYGA 3DS6A 4E1ZA 4APCA 3R9NA 2B0QA 3DLZA 3W2QA 1NY3A 5I9XA 4RC3A 3RAWA 5HIEA 4A07A 3QAME 1Q8YA 1APME 3DZQA 4PUZA 4ZJJA 4AZEA 3SQQA 5BQ0A 1XH5A 4CV8A 3DK3A 3OF0A 4L9IA 5A3XA 2YCQA 2W1HA 3D9VA 2VO6A 2FB8A 4LMUA 2WIHA 4HGEA 3II5A 2XKEA 4UALA 4EL9A 2QOFA 5CYIA 3IG7A 3FLQA 4FX3A 3UP7A 3TNPC 3ORMA 4IDVA 1M7NA 3QBNA 4DF3A 1PYXA 5C4KA 1ZY5A 2UZNA 2Y8OA 1STCE 4IM3A 4HW7A 3LFFA 5EKOA 3O8PA 2X2MA 3EQPA 3NIEA 3U6HA 2GNIA 2VWZA 2XNOA 3GENA 4QMOA 2PZ5A 5H2UA 3BZ3A 3QX4A 4GJ3A 3QQLA 3BYVA 3E7OA 4W4VA 4CT1A 3BBTB 5KMIA 2C3JA 3H4JA 1RDQE 2VWBA 2I0EA 3QC4A 1U54B 1H07A 1WCCA 2C4GA 3IGOA 3SOCA 4D2RA 2LGCA 4RGJA 3VUKA 3KCKA 4EQMA 2Y0AA 3B2WA 4RZVA 4G2FA 3TNHA 2VX1A 1XKKA 1EH4A 4NJ3A 5J87A 4K9YA 5KBRA 4BIEA 1ZYCA 4EHZA 4FKSA 5AR8A 1FVVA 3FZRA 3R7EA 5IA2A 4IB5A 1U46A 5C01A 3TNIA 4A4XA 1UU9A 3D2KA 3LCTA 2E9UA 5IQHA 2YABA 1U5RA 4FV3A 4KIKB 3FXWA 4L46A 3EN6A 3KQ7A 3JS2A 2XJ0A 4C4EA 3NNWA 4X7QA 5HLNA 5IDPA 1KE7A 2O65A 1Q5KA 4JBVA 1TQPA 4C0TA 1WBWA 2YIQA 3MH2A 3RPSA 3QRIA 3QGYA 3NCGA 4ZSJA 1MQ4A 2QHMA 5IA5A 4UV0A 3Q53A 4JR7A 4CRSA 4EOSA 2I7QA 4GG5A 2R3GA 5DT0A 3I7CA 5EM5A 2BALA 4WKQA 4DEAA 2CNVA 2ZV8A 2X1NA 3BPRA 1PXKA 2P33A 4NM3A 4L53A 5K4JA 3FMDA 3O7LD 4CG9A 4F63A 4O7WA 2JITA 5FXRA 2XNGA 1R1WA 3BV2A 1YWNA 5CSHA 3OW3A 3D83A 4TYHB 5CI6A 5HE1A 2W17A 5AUZA 3GU6A 4KS8A 5M4UA 3C13A 5LVNA 4IWQA 2QKRA 3LPBA 2P55A 4ZZNA 1ZZ2A 3NLBA 3TI1A 3NUAA 4OTGA 5HTCA 4G6NA 4R8QA 3I60A 5ETCA 3COMA 4JT3A 4Y95A 2JDTA 4FV0A 2CLXA 2QLUA 1KE5A 2FUMA 4LUEA 4QNYA 4C02A 5DLSA 5EW9A 2XYUA 4QPSA 5IMXA 3DOGA 3LXLA 4AFEA 3I0QA 2GQSA 5H8GA 3EL8A 2ZOQA 1M17A 3NWWA 5CASA 4LGHA 1ATPE 4QMVA 5JRSA 5H8BA 5JZJA 3FKLA 4BCFA 4FKPA 2BAKA 3NDMA 3RMFA 3BHUA 4U80A 2BFXA 3ZO2A 4E6DA 5BYZA 1BMKA 2IPXA 3ORPA 2YDJA 2W1CA 4GL9A 3KK9A 4TY1A 3P1AA 3RZFA 2ITVA 4BIDA 4USEA 3EIDA 4IHPA 3WF5A 4IVBA 3SC1A 3RK5A 5JH6A 3MH0A 4IJPA 3P5KA 3NR9A 4IWOA 3BE2A 4U5JA 4AN9A 4DEBA 3PG1A 3LE6A 1H25A 4MH7A 1J1BA 3QFVA 4XUFA 5FM3A 4CFMA 4DGNA 4E5WA 1Q97A 3GI3A 3W2RA 1UNHA 1AQ1A 2W5AA 3BYSA 2X8EA 2LAVA 3UZPA 3VUMA 2V22A 3GU5A 2ZB1A 3OXTA 4FNYA 4V04A 5HO6A 5GJGA 3BEAA 4OW8A 3MWUA 2SRCA 4IAFA 5JSMA 3UIUA 2C0IA 3A99A 3KREA 2YFXA 3OBGA 2CKOA 4I22A 3GCQA 4IZ7A 4MBLA 5BUJA 4O83A 3F3ZA 3UTOA 2E9VA 2PZPA 2IG7A 2YIRA 3M11A 1OM1A 3L8PA 3LMHA 4D4RA 4G1WA 4RVLA 2RGPA 5A9UA 2ZV7A 5CSVA 3E3PA 2JLDA 3A7FA 3KB7A 1JBPE 4BCIA 2UZLA 3ETAA 3PA3A 3BCEA 4FL1A 3UG1A 1H00A 4FIGA 2GHLA 3VS2A 3D7ZA 2ESMA 3PJ8A 3UVQA 4TWOA 4DCAA 4QMPA 3MGYA 3H9RA 3T8OA 2PUPA 4O91A 4MCVA 4O7VA 4DG0E 5KKRC 4TWCA 4E4MA 3EN9A 2BROA 3GOKA 2Q0NA 2Z7LA 4GVJA 4EH2A 3U8WA 3ZZEA 2XIKA 3HUCA 1CKJA 4OBPA 5AUVA 4JG6A 4AUAA 4FK6A 4FTAA 2XJ2A 3OY1A 2Y6MA 4AWIA 5M51A 2XF0A 3VF9A 3TDVA 5LMKC 5CNNA 4IH8A 1ZXEA 1V1KA 3S4QA 4ZZOA 4O0RA 3NNXA 3TJCA 3BHVA 3DBEA 4FTIA 4YBJA 2WMUA 5C26A 4HCVA 4D58A 1ZOGA 3P79A 1GIIA 5FQDC 3R7YA 3ZS5A 3ZSGA 1XQZA 4D9TA 4EBWA 4U0IA 3WZUA 3HX4A 4YHTA 1L3RE 3JPVA 5CU3A 1TKIA 3F2NA 5ANDA 3O23A 4ZLOA 5AR5A 5H8EA 5A14A 4DFZE 3ET7A 4FVRA 4EZ3A 4HVIA 5L6OA 4RX5A 3ZLYA 3DQXA 4W4XA 4QMUA 4YP8A 3VS3A 5AUUA 3OCBA 3TM0A 4YZDA 4BZOA 5CX9A 4C8BA 2WMQA 1OKWA 3F3WA 3FKOA 5BUIA 3A8WA 3OVVA 2XK4A 2WAJA 2X6DA 3FUPA 3OROA 1ZYLA 4UMQA 5DYJA 1YVJA 5E9EA 2EUFB 4C3RA 3OWPA 3UO4A 3Q3BA 4HYSA 4R3RA 4TW9A 5AAFA 4CZYB 2X2LA 3UOHA 4FKJA 3VBWA 5AEPA 5A4TA 3NVKI 3ZXTA 1OMWA 5HEZA 3REPA 2NNWB 3NVMB 3HAMA 3FEGA 4AZSA 3A7JA 4FEXA 4O7RA 3BHTA 4HJOA 4EJNA 1J7UA 4R7IA 4L43A 3L8VA 3LXKA 5TE0A 4B6LA 4C4JA 3UODA 3U54A 1OL5A 1JKTA 3B8RA 3AC1A 2VTNA 3BYUA 3I6WA 1Y6BA 2GQGA 3FY0A 4JDKA 4EK6A 4O7YA 4G6OA 3ZBXA 2EXMA 2E9OA 2RF9A 3EZRA 3HMMA 3T9TA 4EQCA 5IQBA 3A4PA 5DWRA 4ZY6A 2XM8A 3R00A 5IQEA 4XH6A 2PZIA 2BAJA 3F5GA 4ZZMA 3QCQA 4RFYA 4IX3A 1PXMA 2C6LA 3R7IA 3G5DA 4BCMA 1I44A 1O6YA 4TWNA 3FZPA 2B4SB 3SW7A 1YDTE 2J5FA 5ANIA 1PMVA 2H6DA 4U45A 3VW8A 4YUQA 2GCDA 2UZEA 2YITA 2PU8A 3ORZA 5L4QA 3TUCA 4DTBA 3ZFYA 3I0OA 3ZFMA 2OH0E 3L8SA 4EKLA 4H1MA 2R3LA 4I5PA 3BGQA 3F5PA 4M3QA 2ETMA 4BBEA 1NT2A 4BN1A 3LJ0A 3LMIA 3TZ9A 3E8DA 3I6UA 4FT7A 4A9TA 2RG5A 4L8MA 4JQEA 3WYYA 4WT6A 5CU4A 2W1EA 3B2TA 5CQWA 3QTSA 3I1AA 4YJNA 4LRJA 3HVCA 5CAUA 4YC8A 2W1DA 2XUUA 4TXCA 4C3PA 2G01A 4RVKA 4IX6A 4BCJA 4PF4A 3R0TA 2C1AA 1OBDA 4NYEA 1OIYA 2QG7A 1XH6A 5BNJA 3QTXA 4DLIA 3F7ZA 4QMTA 2PZYA 3RM7A 5LVMA 1W0XC 4NCTA 4XP0A 2VN9A 4QNAA 4RFMA 2VTLA 3FPQA 2C6TA 5FG8A 4PMPA 3CBLA 3L9LA 5IH4A 4GFMA 2UZBA 3HV6A 3QXOA 3DT1A 3OTUA 4F9AA 3ORLA 2XH5A 5EFQA 2QOKA 2F57A 3SOAA 2GQRA 3HGKA 4AFJA 3P7BA 3R7UA 3UMWA 5HORA 1WBNA 3QCXA 4ZP5A 4O38A 3BYOA 4FT5A 4H36A 4RG0A 5E8UA 5KO1A 2IZSA 3QRUA 3E92A 4ACHA 2WTKC 4YZMA 5AP6A 1P5EA 1V0BA 2G2HA 3SG8A 2QODA 3GB2A 1RQQA 5M09A 2X6EA 3FLWA 5K0XA 5EW8A 3D4QA 5FBNC 5J1WA 4R7BA 3DK6A 3PVBA 2OICA 3I4BA 3LIJA 3KFAA 4HYUA 2CKPA 1CKIA 3A7GA 5AUYA 5LVLA 2QONA 3QCYA 4F9YA 4ANQA 3PY3A 3N4TA 4OGRA 4G3FA 4X3FB 3IDCA 1MQBA 4P5QA 4FTRA 4J95A 5HQ0A 3OEZA 3UJGA 4YHJA 3QZHA 3GC7A 2G15A 4N6YA 5HNGA 2HW7A 3Q9YA 4XV9A 3BWFA 5IQAA 2X9FA 2KTYA 2GMXA 2J4ZA 5GZ9A 4YSJA 3PZHA 3DXPA 2CCHA 1WZYA 5JFWA 3E7VA 3RZBA 3WYXA 2R3NA 4PV0A 3SXFA 2Y4PA 3F88A 4NSTA 4CTBA 5EQYA 4AE6A 2HELA 2O64A 5HD4A 1BX6A 2XVDA 3DDPA 5J5TA 1OVEA 2PE2A 1KOAA 2R9SA 3BX5A 4KSQA 4NH1A 3PWDA 3ZO3A 4BHZA 5F95A 3ZCLA 5E8WA 3MTLA 4CKJA 5GZAA 1UU3A 5A46A 4QP4A 4JVGA 3R8VA 4YO6A 3F5UA 2PVJA 5EI6A 3PLSA 1J7IA 4S34A 1LUFA 4IB3A 5EYCA 2V0DA 4ALUA 4ITIA 1GY3A 4ID7A 1YI4A 5C8MA 3COHA 1A9UA 2UW3A 4F7LA 5HBJA 1E9HA 3Q9XA 1WVYA 3FZ1A 3VS4A 3CY3A 4X2JA 3FC1X 4ANLA 5CEPA 2JKMA 3Q9WA 2WQBA 3VHKA 3PIXA 1G3NA 2FO0A 4HZSA 2PYWA 3BYMA 1IRKA 4OAUC 3KXNA 5JQ5A 3QXPA 2R7BA 4IQ6A 3IDBA 2YLEA 4IAYA 4WBOA 3FZSA 2YIXA 4RIXB 4X6RA 4JX7A 4RRVA 4W8DA 3RP9A 4CFXA 3OWLA 5FTGA 4DLJA 5C1QB 2C5NA 4ORKA 4L3LA 1T46A 2RFDA 1H4LA 4WBBB 1CKPA 2B1PA 5E1EA 3DK7A 2QD9A 3T9IA 4PDYA 2HAKA 2CN8A 2GDOA 2WMSA 4G6LA 1BL7A 5CAQA 5LQFA 2BHHA 1Q24A 4FTTA 4FTKA 3G0FA 1UNGA 1YWRA 4PPBA 5CAOA 2B9HA 3FMJA 4V0GA 2VTSA 3FWQA 2CGWA 1BL6A 4ITJA 4B8LA 4L67A 2YAKA 2FSOX 4QMMA 5C27A 5E1SA 4E4LA 3E93A 3MTFA 5HCZA 4AZTA 4MBJA 2VNWA 5D7VA 3GNIB 4UMUA 3VQUA 4O7LA 5IU2A 3C0IA 3UPZA 4G3EA 4BI0A 2A19B 3OWKA 3V5QA 5JGAA 3QCSA 3N51A 3D94A 1PXPA 5FDXA 3V5TA 4TKSA 4GFOA 3R73A 2BZJA 3PXFA 1OKYA 3TXOA 3G6GA 2EB2A 4O0VA 4W4WA 2PVRA 5L2QA 2ITXA 3ITZA 4BHNA 3AMYA 3Q9ZA 4QQCA 3GCPA 1YXUA 4I1ZA 4XG2A 3LKMA 3S2PA 4YJTA 2B52A 1RJBA 4AT4A 4F7JA 3W2SA 4GJ2A 4BCGA 2R3HA 3F5XA 4AGCA 3PA5A 4OT6A 3FKNA 4BTMA 3OCSA 3P86A 2QLQA 4RWKA 4Q9SA 3W18A 4ZY4A 2C6EA 3Q6UA 3AGMA 3VC4A 2GTMA 4G16A 4M0YA 3QU0A 4MX9A 3VAPA 4MWIA 3F66A 1KV1A 4W9WA 1VZOA 4EKKA 2ZVAA 3GQLA 2QU6A 1O6KA 3QUPA 5DFPA 3KA0A 4EJ7A 3SXRA 5AP7A 4RIWA 4CKRA 1Q4LA 3MVJA 4RX7A 3TV7A 3SKCA 4UY9A 3QHRA 4C3FA 3DBFA 3O2MA 4RLLA 4CLJA 2W96B 1WBSA 4QQ5A 3UG2A 3OY3A 4ZSEA 2XKDA 3CTQA 5B2MA 2ZJWA 2FSLX 2Y9QA 4O84A 2BZKB 4O0UA 4KNBA 1JKKA 5CALA 3WF9A 3LQ8A 2R4BA 3WF6A 3OCGA 4GK2A 3AC2A 4DG2E 3R22A 2IW8A 3LCSA 1JVPP 3IOKA 3R02A 4NM7A 2XRUA 4NIFA 1OL6A 3NNUA 1NW1A 1NVRA 4XOYA 3FSKA 4K6ZA 5DN3A 4NM0A 2W1IA 4Q9ZA 2XYNA 4KS7A 4A7CA 4DH5A 5E90A 4AW0A 3BELA 3KEXA 4PDSA 2HIWA 2QCSA 2YM3A 3KRLA 4IVCA 2VWXA 3FMMA 5JZNA 3Q5ZA 5KMKA 1SVGA 1XH8A 2CKEA 3I5NA 3D5WA 1OPLA 3HDMA 3W1FA 2OSCA 3QD3A 4JRNA 3BQRA 4AA4A 3VS5A 4EZ5A 3IPHA 5A4QA 3ATTA 3Q4CA 2HWPA 2OWBA 2RFEA 1W98A 3R7VA 3PUPA 5BVFA 2XJ1A 5HNIX 3HMIA 4O22A 4AOIA 2X4FA 3PTGA 3CPBA 3QLFA 3EN7A 2PVKA 3CD3A 3RPOA 3ZRLA 2ONLC 3PY1A 5AFVA 2G1TA 3S3IA 3OFMA 5HX6A 2PVHA 5IQGA 4X3JA 3RK7A 4QP1A 1URWA 3NEWA 2UW4A 3WZEA 2WEVA 1PMEA 4MKCA 5DRBA 4KUJA 3OXZA 4XCUA 3DAKA 4S33A 4I41A 2WU6A 3FMLA 2YAAA 4P7EA 4BCOA 2F7EE 2FGIA 4ZIMA 2C3KA 3PRFA 4JRVA 5EYKA 4RVMA 4ZEGA 5HG8A 3P4KA 5DR6A 4B7TA 2XBAA 2F2CB 4D4YA 5IEYA 4CGAA 4Y72A 4HNIA 4JBPA 4QMYA 5ETAA 1XH4A 2PVLA 1M2PA 5CSWA 3DXQA 3HLLA 5IQIA 5EDPA 5L6WL 4Z16A 4FUXA 4AW5A 4TYEA 2HY81 3KXHA 4YTHA 4BVUA 2CCIA 5C8KA 2BKKA 3IOPA 4GCJA 1WVXA 3I79A 4GK4A 4LV5A 1XHAA 3OUNB 1OIUA 4MXCA 4YZCA 2YWPA 2E9PA 5CU6A 3TG1A 5IH5A 2XP2A 4W4YA 2B54A 5LWNA 3IS5A 4RSSA 3QZGA 5FP5A 3R2YA 4RZWA 3KRXA 2JDVA 5FDPA 4FSUA 2C68A 3DY7A 5AX3A 4EH9A 3CJFA 2WMWA 5BMMA 3WBLA 5CF8A 4GU6A 1OIRA 3OUKA 3MJ1A 4DFXE 4FKRA 4PQNA 4BGHA 4DH3A 4DN5A 4YZ9A 3MVLA 1VYWA 4W9XA 1XWSA 2YERA 4C62A 4GT4A 2IZRA 1QPJA 1UNLA 4YURA 4KB8A 2OJ9A 3LJ2A 1FVRA 3NW6A 1NVSA 1Q8TA 3UGCA 3LLAA 4OT5A 2BRBA 3RNIA 1F5QA 4GIHA 3K3JA 2BVAA 3FV8A 5JRQA 2B9JA 4C35A 2FYSA 4I4FA 2VAGA 1PXIA 4V05A 4MHAA 2QG5A 3ZLSA 3ZONA 4FIFA 1ND4A 4HPTE 2OLCA 4RWLA 2X2KA 3KF7A 3O8UA 5T6KA 4BRXA 5AAEA 3V8WA 2BRMA 4DT8A 3LM0A 3CSVA 3F6XA 2Q0BA 5AV0A 1NXKA 4LYNA 4D2SA 1U59A 2R3KA 3A60A 5CI7A 4EUTA 3SXSA 3EHAA 4WNPA 4HGLA 4CFVA 4FSWA 4RA4A 5IQDA 1H1QA 2ZDUA 2YWVA 5AA9A 4RJ5A 4AW2A 4A9UA 1YRPA 1K2PA 2C1BA 3RGFA 3V5JA 3DZOA 3A62A 3WZJA 2JBOA 1IA9A 5GIOE 5DPVA 3A7HA 4IE9A 2F4JA 4BCQA 1YHVA 4O21A 3KC3A 3R9HA 3LFEA 5T68A 1Y91A 5AIKA 2OXDA 3KGAA 4UWYA 1B38A 1PXOA 4A4LA 4DGLC 2J6MA 4WG4A 4ZTQA 4DH1A 2QQ7A 3H0YA 3QQHA 1P4OA 4JJRA 3PP1A 1HOWA 4ZTRA 3F3VA 2Y6OA 5E8YA 3RTPA 3Q5IA 3GCUA 2UZUE 3KF4A 3QWJA 4QRCA 3D15A 4OTDA 3VUDA 5KKRB 4GYGA 4ANBA 3JVSA 4F0IA 4USFA 5LXMA 4FGRA 4DFNA 5HIBA 4IX5A 2GNFA 4FT0A 3DPKA 5ANGA 1OUYA 2W0JA 4DH7A 4PMSA 5JT2A 3ORNA 1FPUA 1Q8ZA 2JDSA 4S32A 4ANSA 2VO7A 5AP0A 2UZDA 3RBWA 4B9DA 1MUOA 5D12A 5DIAA 5DVRA 5I9ZA 3GCVA 3MFTA 1ZOHA 3RAHA 3EFKA 2AUHA 3QHWA 2JBPA 4IVAA 5HZNA 4N6ZA 4EC9A 3VUGA 3COIA 4ZJVA 1W83A 4IX4A 4AZWA 3VBVA 2W4KA 4AF3A 2EXCX 4FV2A 4PTCA 3POOA 3DB8A 3DBDA 4I6BA 3QUEA 4QP7A 1QPEA 4MBIA 4IZYA 1GIHA 3H9FA 3DBCA 5AR3A 4AZVA 2J0MB 5ANOA 2CPKE 2UVYA 3T3UA 3DDQA 5DR2A 3ZSHA 4IMYA 2XIZA 2WTIA 3L9MA 4CMUA 4AGUA 4CQEA 2VZ6A 3PVGA 2UZTA 3BIZA 3MW1A 4O27B 4I6HA 5HTIA 3SA0A 4YGAA 4AW1A 3L9NA 3P78A 2R64A 5AJQA 4D4VA 2J0KA 2IZTA 3MIAA 3TACA 2J0JA 4M68A 5CXHA 1SVEA 4P5ZA 5D7AA 2Z60A 4BKZA 2EWAA 3OW4A 4BDFA 1BKXA 4WNKA 5AIRA 3TUDA 4KBCA 4OUCA 5I9WA 2OFVA 3CKXA 5EOLA 3TZMA 1PMUA 2C5VA 4M69A 4B99A 2XEYA 4E20A 4BBFA 3FQSA 3Q4TA 5L2WA 3KXZA 4UBAA 1M7QA 3FI3A 4M67A 3RCJA 3TV4A 1PXJA 3V5WA 5BVDA 2WMTA 2P4IA 5F94A 3QRTA 4YTIA 5LMAA 4A9RA 1WMKA 2C6OA 3JVRA 5A4EA 3DFCB 4JI9A 2W7XA 4KKEA 2YM7A 3RPVA 4O82A 4R3PA 3ENMA 5I3RA 4CFUA 4UX9A 4E5AX 4CSVA 3F7WA 4HCTA 4U42A 4GW8A 5I3OA 4X6QC 3VQHA 3IDPA 3D5VA 3GU4A 4GK3A 4R78A 4AAAA 4KRCA 4I21A 4JAJA 3E62A 4IB1A 1BLXA 3H30A 4L7FA 3R63A 4MK0A 4TTHB 4AS0A 2ZM3A 5HG7A 3O0GA 4O96A 3UYSA 5KCVA 3G9LX 4AOJA 2B53A 3MJ2A 1IG1A 2OK1A 3PXZA 4ALVA 3RI1A 5HTBA 2PK9A 3HA8A 4XV2A 2OXXA 3ROCA 3SAYA 3NUNA 4LMNA 1YOJA 4UZDA 4WSQA 1UWJA 5LCKA 4G31A 2H9VA 1LEWA 3NRMA 1ZY4A 3GU7A 3HA6A 4ACGA 2OJGA 4YJPA 3A8XA 1PF8A 4C4GA 3FC2A 2HENA 5CU0A 1J91A 4FIIA 1OITA 3ZM9A 4OBOA 1XO2B 3ALOA 2XRWA 4TWPA 3RWPA 4O7TA 3G2FA 5IISA 2JDOA 4LGGA 3ZDIA 4QP6A 1IASA 4GG7A 4TN6A 4IDTA 2JGZA 3THBA 2C5YA 4U7ZA 1DM2A 2OF2A 2HYYA 3KU2A 3WI6A 4PMMA 4DEEA 5J1VA 3SVVA 2Z7RA 4E6AA 2F7XE 3VRZA 3HYHA 1GZ8A 2XK6A 2BRGA 1OZ1A 5EM7A 4EORA 2ZV9A 4BC6A 3RHKA 4JOAA 5AV4A 5D9HA 4ASXA 5DH3A 5FWKK 4BI2A 3ZFXA 2RFNA 3BHYA 4F09A 2BZIB 2YACA 5GJDA 2PHKA 2O63A 5CU2A 3C0GA 4IM0A 2RFSA 4FKVA 4OTIA 4GKHA 3HMPA 3R8UA 4OTPA 1SYKA 1OL1A 2CGVA 3D14A 3DFAA 4EOPA 4N70A 4O0SA 5HBEA 4IXPA 5CZHA 5EQPA 3NMUF 5LMBA 4TNDA 5JEBA 5I5ZA 4UZHA 3NAYA 5DR9A 3Q32A 2XNEA 2UV2A 4I94A 3U87A 3ZMMA 3Q4ZA 4I4EA 3C7QA 1RW8A 4WNMA 5J95A 5BVOA 2C6MA 4ACCA 5HE0A 1P4FA 2XBJA 5CTPA 1UKHA 3MYGA 3MPAA 4GH2A 4Q5HA 3PSBA 3UO6A 4FTMA 3UNJA 3N4VA 2VGOA 2OW3A 2WB8A 3BLHA 2WTKB 2BHEA 4F4PA 5HESA 5IPJA 3WE4A 2GNHA 3VBTA 3ZRKA 2W1ZA 4YJOA 3VBXA 1OBGA 2WTJA 2GS7A 3E8CA 4O86A 3CQEA 3CE3A 3U51A 1JSVA 1QMZA 5CQUA 4BICA 4D5KA 4QMQA 2A4LA 2JEDA 3GFWA 4FNZA 3AD5A 3ZO4A 3TZ7A 2C5OA 2PL0A 4XJ0A 1H28A 4F7SA 3FLNC 4V0GB 3D7TA 4NTTA 1ZMUA 4BL1A 4QMWA 1VR2A 3FHRA 4DINA 2C0OA 2BZHB 3CCNA 5DMZA 4YR8A 2A2AA 3CPCA 3GC8A 4D1XA 3QTRA 3HV4A 4F9BA 4IANA 4HCUA 3V04A 3ZRMA 4BYJA 2X0GA 3SLSA 2Z8CA 4RWIA 3QALE 5HHWA 4YHFA 4A9SA 4ZSGA 5HCXA 5TT7A 4FZ6A 5B2KA 2QOBA 3EL7A 4E26A 4IWDA 3EQRA 1PKDA 5M4CA 5JKGA 3MFSA 3VW6A 2BIYA 2PVYA 2R0UA 2X39A 1P14A 4LL5A 3LMGA 3PVUA 4FKGA 2GS2A 4J96A 3WIKA 4BDCA 4E4XA 3FSFA 1SVHA 3G51A 3NZ0A 3CIKA 4ERKA 4KKHA 2Z2WA 4EC8A 4H1JA 4E93A 1H0VA 2BDWA 5LJJA 4RJ7A 2YZLA 2NO3A 2R3QA 3NUPA 4NCTC 4IVDA 2AC3A 3GVUA 4MVFA 4UWBA 1FBNA 3KN6A 4TL0A 3AC4A 3VUIA 5CF5A 4GS6A 2AYPA 5J7BA 1Y57A 3ORTA 3NGAA 3U4UA 4OTHA 3ORXA 4FZ7A 4QOXA 5J9LA 3EQIA 1OI9A 2PMOX 4IM2A 3U9NA 2QURA 1OIQA 4WRGA 4C4FA 4TNBA 4D2TA 1Z57A 2V7OA 2OXYA 4QYFA 1GZOA 3TWJA 5ANJA 2CGUA 5EM6A 4NW5A 4XNEA 3EFJA 2BFYA 4HVSA 3DA6A 3QUDA 5EK7A 4BTKA 4NW6A 2DQ7X 4J98A 4MNEA 4I0RA 1ZAOA 2NPQA 3LFAA 1YOMA 2C3IB 2JAMA 3KN5A 4MF0A 4GIIA 3RCDA 3GGFA 2CJMA 1XBCA 2QOCA 2ZYBA 3EQGA 4FTQA 4NIFB 3AQVA 2JKQA 3UVRA 5C8NA 3R7GA 3TTIA 3QC9A 5AWMA 3PP0A 3U55A 2UZWE 4AP7A 2ETKA 1XH7A 3EKKA 4G5PA 3SRVB 4NWMA 1U54A 4O0TA 3CGFA 4IIRA 2QC6A 4CFFA 2ITTA 3FI2A 4CRLA 4L68A 2REIA 2QR7A 3PJCA 5HE3A 1F3MC 4EK5A 2QNJA 3R71A 1H1WA 4IADA 1R0PA 3VULA 3R9RA 4C4HA 2OF4A 4BDAA 3P0MA 4EUUA 3IW4A 3Q96A 2OJFE 3R9DA 3WZKA 2IJMA 4O2ZA 4ZTSA 5AV3A 4NFMA 2UZVA 4ASDA 5J7HA 5KNJA 4RIOA 1FGKA 4IAAA 5I9VA 2QOIA 3ZUUA 3E64A 2Z7QA 2GHGA 4ANOA 4KABA 3QTZA 2YM6A 3R8PA 5J5SA 4R1YA 4OTRA 3PIYA 2VTPA 4RLKA 3ANQA 4X0MA 2YA9A 3K2LA 5J79A 5EQEA 4F9WA 3I5ZA 3LW0A 4Y85A 2CDZA 4NU1A 2QVSE 4J53A 3ATSA 3HUBA 3F3TA 5A6OA 4M14A 4EH4A 4GEOA 4X2GA 1YKRA 4BDBA 5JFXA 3PXYA 4F70A 2CGXA 2R3MA 3TN8A 4D2WA 1B39A 5EDQA 4XRJA 5FEQA 1VYZA 5HKMA 4AA5A 4E73A 3PLAE 3WARA 4FR4A 4ZSAA 5AP4A 3BV3A 1YXSA 5EYMA 3UQGA 4M66A 2OH4A 3Q52A 1UU7A 4DH8A 4G5JA 1TVOA 1Y8YA 2QO9A 5CEKA 5DNRA 4EHGA 4QO9A 2FA2A 4ZXTA 1ZYJA 3OT3A 2X8IA 3VHEA 1X8BA 4YSMA 3GUBA 3NYOA 2BUJA 4U40A 2IZUA 3VS0A 5CVHA 2PPQA 3QRKA 4EYJA 3CXWA 4BGQA 3RKBA 4H3BA 2C6IA 5M4IA 3UQCA 2W06A 5CSPA 4FV4A 1IAHA 3PSDA 3IQ7A 3QX2A 4LOQA 5CWZA 3ZTXA 4BI1A 2DS1A 4BWPA 5CF4A 4CG8A 2YDKA 3DAJA 3TV6A 4F7NA 2ITNA 4NT4A 4HVDA 3EKNA 3G9NA 2RKUA 2GNJA 3KRJA 4IC8A 3DBQA 3HMNA 3AT4A 4RA5A 3FY2A 1I09A 4AU8A 5HO8A 4C59A 2CKQA 2J0IA 3NPCA 4IW0A 5CY3A 4CD0A 3TUBA 4K8AA 1PXLA 1QL6A 2BDJA 2OFUA 2PE1A 2E9NA 3CP9A 3O8TA 4EK3A 3R8ZA 5G1XA 1GZKA 3PVWA 3W2PA 3UC3A 3O50A 1YHSA 4J8NA 2NRUA 4L42A 2VWIA 5AV2A 3EH9A 1PW2A 4QTDA 4RIYA 4TYJA 2I0VA 4BCNA 5CEMA 3ALNA 1YXTA 1Q62A 4OR5A 4FEWA 3D0EA 5K3YA 4M7IA 5CENA 2Y4IC 4UB7A 2PVFA 5BVNA 1GIJA 2ZM4A 2ITWA 2WMBA 2A27A 5AM6A 3W33A 2PZRA 2R0IA 3F82A 4R77A 4WUAA 5AX9A 1PXNA 5AR2A 3ZSIA 2P2IA 3M42A 1E1VA 3G0EA 1OUKA 5AP2A 4ZLYA 4FNWA 3NYXA 4O81A 3MY5A 4TT7A 3CD8A 1K3AA 3LM5A 2UW7A 4MD9E 4YZBA 3H0ZA 3R83A 4DA5A 3QTQA 4Y5HA 3ZUVA 4DG3E 1HCKA 2O0UA 3CY2A 4PNIA 1IEPA 4M13A 3DU8A 5DG5A 2R7IA 1W7HA 4RJ4A 2WNTA 4UYAA 5EH0A 4NJDA 1QPDA 4J8MA 4KD1A 5FP6A 4DBNA 5BPYA 5B0XA 3U9CA 4WD5A 3R1SA 2GSFA 3ZUTA 4ZSLA 5KHXA 3HP2A 2WMAA 3ZHPC 4RBLA 4DGMA 2QOHA 2VTQA 3AT3A 3LQ5A 2W5BA 4BCKA 2VUWA 4FL3A 3UO5A 2C5XA 4JQ8A 5FLFA 4I5MA 4QMZA 4N57A 2WGJA 3Q60A 4PRJA 3R04A 2J51A 3TKUA 4FL2A 4C58A 3KK8A 1QCFA 4GYIA 2GS6A 1UV5A 2YJRA 3A2CA 3DXNA 5KZIA 4AN2A 4K33A 5IH6A 3UIXA 3TDWA 3K5VA 1GZNA 3COKA 3RWQA 4F1MA 5FEDA 4O7SA 4ZMEA 1OL2A 1XBBA 4PDOA 4R6VA 3MB6A 1FOTA 4BZDA 3O17A 4FIJA 4GKIA 2WTWA 4JQ7A 2QO7A 4ZTNA 2ITOA 4KRDA 4JBOA 3L9PA 5KE0A 5HVKA 2WTVA 4JS8A 3ID6C 3HDNA 4QMXA 3MPMA 5BVEA 3AXWA 3GFEA 4FI1A 4RT7A 4EEVA 5HU9A 3BHHA 3IW8A 4QMSA 3B8QA 1YXVA 4FTLA 4IJ9A 5L2SA 2YHVA 4M69B 2QOQA 1WAKA 3AG9A 4JNWA 4FNXA 3UBDA 2VTMA 1W8CA 3ACJA 4F65A 4PX6A 1J1CA 2ITPA 4KKGA 4FV1A 3SW4A 3VS1A 3IW6A 2VO0A 3OZ6A 1WBVA 5CEIA 3C5IA 2W1GA 3E3BX 4XLVA 2XK9A 3FYJX 3NNVA 3TNWA 3A7IA 4FEQA 4I5HA 3SHEA 3DKOA 3MDYA 3ZLXA 4ZAUA 5CT7A 3FMEA 2XM9A 4L3JA 4QTAA 4LFIA 1U4DA 2JIIA 3MY1A 5HOAA 5JFSA 3R1YA 3QA0A 3NUYA 4EHVA 5KBQA 4QT1A 2WEIA 4FZDB 3S0OA 4KINA 4UN0C 2YJSA 1JAMA 2VTRA 2HXLA 4QYHA 3TZ8A 4FE2A 3AD4A 4H58A 3FLYA 3QQFA 3R01A 1H01A 1K9AA 1PHKA 2B7AA 2ERKA 2UW9A 1UKIA 2J2IB 5EW3A 1B6CB 5JGDA 3FDNA 3IKAA 4FKLA 5IEVA 2VWVA 3FBVA 3R28A 5H3QA 4B4LA 2HZ0A 2IVTA 3VNTA 4BGGA 1J7LA 2YZAA 3C1XA 4U97A 3QD2B 5E8SA 5ETIA 1H8FA 4DYMA 3GBZA 3KULA 4QQTA 4RC4A 5FRIA 4AOTA 4LQMA 4FT3A 3QD0A 2ZB0A 5E8XA 3FPMA 2V5QA 4YNOA 4AT3A 2VX0A 3V5LA 3MI9A 3VO3A 4U79A 5CT0A 2DYLA 2OU7A 2QKWB 3IK3A 3O96A 4D2VA 4G3CA 3R2BA 2J5EA 4QTCA 2B9FA 1DI8A 1ZLTA 4ZS4A 2IVVA 5CAPA 5CEQA 3ULZA 1FVTA 3R30A 4EOIA 1OGUA 4FTOA 2EXEA 3QLGA 4GU9A 5DT3A 4C2VA 4FV8A 5L8LA 1LR4A 3MV5A 1H27A 2QOOA 2OJIA 2BDFA 3OP5A 4UXLA 3OEFX 4B0GA 3CQWA 2KULA 1H1PA 3NIZA 3ULIA 4QP2A 3VF8A 5CVFA 4D0XA 2RIOA 1KWPA 3SDJA 2V62A 4YPDA 4F99A 2ACXA 5JQ8A 4AXAA 2JD5A 3BBWA 4FKIA 3O51A 2ITUA 4RJ8A 5E7RA 3PPKA 5E91A 4IBMA 5DEYA 2A1AB 3KMUA 4FVPA 2GNLA 4MXXA 3LOKA 2X7GA 3FE3A 2PVMA 4IFGA 4LGDA 3VS6A 4BDGA 3U6JA 3GC0A 1JKLA 1OL7A 3ERKA 2JDRA 4RQKA 1YQJA 4YJVA 3GU8A 2C6DA 3VWAA 4JDIA 4JR3A 4U3YA 2JKKA 5E92A 2OZAA 4DFYA 5A54A 3RNYA 2JFLA 2ZAZA 5DGZA 1FMOE 3T3VA 2JIVA 4G3GA 2H96A 1Y8GA 2WQNA 4S2ZA 4X21A 2HZ4A 4OTQA 4RX8A 5KHWA 3V5PA 2W99B 5FXSA 4NKSA 5D1JA 4FSYA 4HVGA 2XEZA 4DCEA 4YBKA 4EYMA 2YIWA 3KRRA 3W16A 2J90A 4CZTA 4CCBA 3HEGA 4PY1A 3UPXA 4UWCA 1PMNA 2OI4X 1ERKA 3PE2A 2GFCA 4PL4A 4PPCA 4QP3A 4HGTA 2OG8A 5LOHA 1V0OA 5HICA 3D7TB 5IQFA 2A0CX 3BLRA 2IW6A 2HK5A 4EOOA 3H9OA 2UVXA 4TZRA 1KUTA 2XNNA 1NVQA 4F9CA 4DFLA 4FZFB 2JAVA 2B9IA 3DTCA 4X3FA 3WOWA 3CJGA 2H8HA 2WMRA 4AT5A 5BVWA 3RINA 4FIEA 3CQUA 2UUEA 4U43A 4XG6A 4MF1A 4WNOA 4WRSA 4UMRA 1OPJA 4ZOGA 3W8QA 4EI4A 5JFVA 2UVZA 4F08A 3LLTA 1JWHA 1PJKA 1WBOA 3I81A 2XIXA 4D0WA 2PUUA 2YM4A 2C6KA 4QMNA 4UXQA 1G8AA 2O3PA 3S00A 3GT8A 1KV2A 4YO4A 1CMKE 3GEQA 4HPUE 4J52A 4FVQA 4BKYA 1M52A 2ITZA 2RL5A 3ZEPA 4D1SA 5CXZA 5FM2A 4F0FA 2OIQA 3IONA 3MB7A 1ZZLA 3SGCA 4MXAA 2WKMA 2G9XA 3A61A 2IO6A 1Q8UA 1UVRA 3EZVA 3G90X 2BAQA 3P9JA 4D28A 4I6FA 3CS9A 5HNBA 3PFQA 4YU2A 3ZLWA 3MA6A 2G2IA 1YW2A 4FYNA 4LUDA 3RHXA 5IA0A 5TR6A 3PJ3A 4YJUA 3F2RA 4AGWA 3DCVA 5D41A 4U44A 3UIMA 5CS6A 4GRBA 4O6EA 3AGLA 4WUNA 3QTWA 2WELA 3UNKA 2PUIA 3NYNA 3W32A 4RIXA 2W9FB 3FLSA 1WBPA 4XHKB 4MNEB 4LRMA 1XJDA 4EZ7A 3PJ2A 4MD8E 5FEEA 3V8SA 3VRYA 4DEHA 4O7ZA 3MBLA 4IWPA 2F2UA 1BI7A 2PVNA 3FAAA 3ORKA 5HVYA 4EOKA 4RVTA 4Y46A 3C50A 5AP3A 3UP2A 4BY9E 4NM5A 3TNQB 3WF8A 5HE2A 5AMNA 4FKOA 3DJ7A 3MH3A 4JBQA 3UC4A 4CMTA 2B55A 3H10A 3BGZA 1G8SA 2XKFA 4RQVA 5EDRA 5I9UA 3ENHA 4H3PA 4EWHA 1M14A 4NFNA 3IW7A 5J8IA 3ACKA 2YLFA 4KAOA 4OTFA 3ZH8A 1FMKA 3TKIA 2XZSA 2CNQA 4M97A 4N0SA 4WO5A 2J9MA 3W2OA 4XMOA 4FF8A 1TQMA 3FXZA 4GV1A 1GJOA 2C47A 4C57A 5IUHA 2W05A 4JIKA 5AUTA 2CN5A 4DEGA 3W2CA 3NAXA 3W10A 3FI8A 5AA8A 3OT8A 5BYLA 5DRDA 4APPA 4WIHA 4AA0A 1XH9A 4F1OA 5HGIA 4XG4A 3JXWA 3MH1A 2G2FA 1YI3A 2E2BA 2ZMDA 3BE9A 2NRYA 3KL8A 1IR3A 4HYIA 2OZOA 2PUNA 4CXAA 4L00A 3RPYA 2WO6A 2JFMA 5T3QA 1KE8A 2PY3A 4C61A 3HRFA 2BKZA 4I5CA 5HIDA 3N4UA 1Z9XA 1IA8A 5DHJA 5IDNA 5F20A 1SM2A 3AT2A 5DEWA 1MP8A 3N9XA 3MY0A 1YDRE 2R3JA 3C4XA 4XG8A 3TEIA 4DTAA 2I0HA 5HO7A 2VWWA 1WBTA 1XR1A 4X2NA 3IW5A 4C7TA 5J9ZA 3NUSA 2X8DA 3BLQA 3OOMA 3BU5A 3VUTA 4B8MA 4EK8A 2VTIA 2IVSA 4ASEA 4G34A 4D5HA 4BYIA 2BRNA 1V0PA 3BKBA 2XK7A 3M2WA 4CT2A 4ZMFA 5M55A 3QKMA 4DEIA 1ZMVA 2R3FA 3OC1A 3QZFA 2ETRA 2XNPA 1T45A 3VVHA 2YM5A 3TIYA 5EKNA 5L2IA 4XV3A 3RVGA 4E5BA 3IECA 5F1ZA 2X9EA 5FD2A 4ZY5A 3LCOA 3UQFA 3VN9A 4NL0A 2BPMA 3NCZA 4DTKA 1FINA 4EWQA 2C30A 4CFNA 4K0YA 4EK4A 3MVMA 5L8KA 1JKSA 5LVOA 5JN2A 4GSBA 4K11A 5FTQA 3CKWA 3SD0A 1W82A 2BRHA 4PTGA 2F9GA 5M44A 2YCRA 3ZOSA 5IZFA 5HI2A 4FZAB 3DTWA 4KIQA 4WSYA 5M57A 2HXQA 4YLJA 4O0YA 2PSQA 3LCDA 2WOUA 3BRBA 3WIGA 4EH5A 3FZTA 4I6QA 4CNHA 4EBVA 2GPHA 3OCTA 2DUVA 4R7HA 5EM8A 5B2LA 3DJ6A 4DGGA 2XK3A 1YOLA 2GNGA 3IO7A 5IUGA 2Y7JA 4O1OA 4JXFA 4FEUA 3OS3A 4E4NA 2VO3A 5TOZA 1AD5A 3V8TA 4U9AA 2OBJA 3E5AA 4U81A 3RK9A 4J1RA 4MQ2A 4ACDA 4O2PA 4CZUA 5M07A 5IEXA 4L01A 4W8EA 2Z02A 3ZU7A 4BBMA 1OPKA 2R2PA 5EG3A 5TO8A 3ORIA 3Q04A 4HZRA 1KE6A 1DI9A 4JDHA 4RWJA 4EHEA 4FMQA 4CV9A 4QD6A 5K4IA 3DQWA 4I20A 4AQCA 5LARA 4MAOA 2PMIA 2JKOA 2R5TA 3E87A 5AV1A 4FSTA 2RSVA 3EQBA 4RIYB 5DOSA 4CYIA 2CMWA 2O2UA 3VUHA 1O9UA 3RM6A 3WILA 2XKCA 4A06A 4IC7A 3RPRA 4KIOA 4XYFA 4ZTMA 5ANEA 1P2AA 3KVWA 4NZWB 5K9IA 2HWOA 4U3ZA 3RJCA 4IACA 3C51A 3Q4UA 2I0YA 3NW7A 2XNBA 2OO8X 4KA3A 2NP8A 4DGOA 3E88A 2BMCA 2QHNA 4EOLA 5EHYA 3PRIA 4MXOA 3TL8A 1JLUE 2HZNA 4CKIA 5EHLA 1Z5MA 2OKRA 5LVPA 2WFYA 2XNMA 3UYTA 4I93A 2OGVA 2YISA 5LCJA 3RAKA 1LEZA 4IAKA 4TYHA 4Z9LA 2R3OA 3KMWA 1M2RA 2WXVA 4LOOA 1CDKA 1U5QA 2XS0A 4DEDA 4GMYA 2Q83A 3DKGA 1ZWSA 1ZARA 5CNOA 4L52A 4AN3A 5KMLA 3ELJA 2CHLA 3L1SA 5TKDA 4ERWA 3C4ZA 4U41A 5E8VA 3MSSA 3LZBA 3QRJA 3LQ3A 1G5SA 4WA9A 4FKUA 4M8TA 4PL3A 2VTTA 4MTAA 4CFWA 5HX8A 3LVPA 3H3CA 4XRLA 3AC5A 3D2IA 4YJRA 2FSTX 5GHVA 4JG8A 4IB0A 3ZYAA 4XG3A 4II5A 2W4OA 3D5XA 3DAEA 5B7VA 3PG3A 3AMBA 3OG7A 3Q2JA 2EB3A 3UOKA 2V55A 4ZS0A 1MRUA 2UW5A 3HV3A 3VBYA 3S95A 5KX8A 3C0HA 4M84A 1H26A 1A06A 2ZMCA 5GJFA 3CEKA 4BDKA 5KUPA 4PTEA 4YJQA 4BDDA 4A4OA 4RMZA 5AM7A 3UE4A 4ZK5A 3Q6WA 3R6XA 4RIWB 5AUXA 2WZJA 3FI4A 2BIKB 3LHJA 4O0WA 5CF6A 2PULA 4XG7A 4L3PA 4YJSA 3EQFA 5HLPA 2VTJA 2IVUA 2Y4IB 4E6QA 4Y8DA 4DHFA 5IF1A 4OAVB 4QPAA 5FGKA 4BCPA 3PWYA 4QQJA 3A4OX 4FEVA 1JSTA 5FXQA 2EVAA 2UW8A 3DGKA 1HCLA 1YHWA 2FSMX 1REKA 3TKHA 4FTNA
chains in the Genus database with same CATH superfamily
3QYZA 1R0EA 2J7TA 2WHBA 3PXKA 4R5YA 5D10A 2GFSA 1BUHA 5I9YA 5GZ8A 2YCSA 3EOCA 4YLKA 5IQCA 1GAGA 4RPVA 4FG9A 3AKKA 4UMTA 1YDSE 4WG5A 3GC9A 2WOTA 3GXLA 4I24A 1REJA 4USDA 2EU9A 4CVAA 4LI5A 3BU6A 4ALWA 4R1VA 2CLQA 4AZFA 2YEXA 3QTUA 4HOKA 2BCJA 1PKGA 4BFMA 4NKAA 4EH8A 1QPCA 3CTJA 1KE9A 3CLYA 5LMKA 5CLPA 5M53A 1ZYSA 4CEGA 3ZEWA 3QQKA 4JX3A 5BVKA 3KULB 3ZXZA 3HL7A 4XG9A 3JR1A 5D11A 1GNGA 3KCFA 2XIRA 4E7WA 3JY0A 4FKQA 2QU5A 2XMYA 4V01A 1LP4A 4KIKA 4QP8A 3E63A 4BWXA 3UNZA 3PPZA 1F0QA 4L7SA 3R1NA 2WQEA 5AR7A 4BZNA 4ANNA 2W9ZB 2WMVA 4QP9A 4E3CA 1S9IA 3AC3A 4FSZA 4N4SA 4ASZA 1DS5A 2I6LA 3EQDA 4JLCA 3ZO1A 4DFUA 2ITQA 2PTKA 3KKVA 5C9CA 3DJ5A 1RE8A 3V01A 5AR4A 3UMXA 2CNUA 2IWIA 2W4JA 4GFGA 3LFSA 4WHZA 1O6LA 1YWVA 5I4NA 3WZDA 3D5UA 3UOJA 4JL9A 3BQCA 3ROYA 3FYKX 3C4FA 5HLWA 4RX9A 5IA3A 4QYGA 3FQEA 2ITYA 2X81A 1H0WA 3BI6A 3MVHA 3DKFA 3AD6A 1W84A 5EI2A 4ARKA 3ZBFA 2FH9A 3E8EA 4QDVA 3HZTA 3PIZA 2VV9A 1JNKA 4NK9A 5AP1A 4QYYA 4C34A 5IA1A 2OZAB 1H1RA 2VGPA 5AADA 4YZNA 3HV7A 5ETFA 5KMOA 4YPSA 4BF2A 2X7FA 4D1ZA 5A4LA 4FSNA 2AQXA 5DBXA 5EYDA 4UEUA 4YC6A 3VJNA 2UW6A 4FA2A 4JG7A 3LXNA 4TYIA 4U6RA 3QL8A 4IZ5A 5C03A 4EOJA 4UYNA 3AC8A 1ZOEA 3QKKA 3VIDA 1OB3A 2WIPA 3PXRA 5HCYA 4CYJA 4C2WA 3OXIA 1MRYA 2H34A 3BU3A 2QR8A 4J99A 4F1TA 1TQIA 5DI1A 3VJOA 2V7AA 2XCKA 4JAIA 4AE9A 4C38A 4AG8A 4QPMA 4K77A 4ZTHA 2P0CA 4TYGA 4Z7HA 5JMSA 5I0BA 1Q8WA 4XX9A 3LJ1A 5HD7A 2WPAA 3K54A 4RJ6A 5CEOA 2J50A 3G33A 3P23A 5K0KA 2HZIA 4CTCA 4GT5A 3MFRA 4DITA 3HECA 5ICPA 3PY0A 3LFQA 1CTPE 3NS9A 3F69A 4J7BA 3LFCA 2YIYA 2XCHA 4OTWA 1R3CA 2OIBA 3S1HA 1R39A 1SNXA 3OOGA 4LOPA 3QF9A 4DHIB 2YDIA 5CSXA 4BDIA 4BWKA 4H05A 3ODZX 4JIAA 3W0RA 4D4SA 3O5AA 4J97A 2C3LA 3P7CA 1J3HA 3C4WA 3HNGA 4HYHA 4ANMA 5CANA 3EYHA 2Z7SA 3LXPA 4UMPA 5CAVA 4I3ZA 4YLLA 3QQGA 5H9BA 4BKJA 4IEBA 4R3CA 3UIBA 3PPJA 4H3QA 4ZLZA 5EOBA 2IEWA 4FKWA 3RALA 4O6LA 4IZAA 5GINE 2VD5A 1M2QA 4PPAA 4PP9A 5L6PA 1DAWA 2QO2A 2GTNA 3C4CA 4D9UA 1PYEA 3BEGA 5E8ZA 4EOQA 5KMJA 3C4EA 3FZOA 5L8JA 3TTJA 3EQHA 3F2AA 4LV8A 3HAVA 4F64A 3FMNA 1JOWB 2WQMA 3M1SA 3MIYA 3NUXA 2IW9A 3RAIA 5M06A 1ZMWA 4F6UA 3ANRA 4RC2A 3R21A 2GHMA 4L45A 3PSCA 4EONA 4I0SA 1LPUA 4O4BB 5FUTA 4CMOA 3JUHA 3MA3A 3MS9A 4PP7A 4G9RA 4O0XA 3PYYA 4BCHA 2C0TA 4XOZA 1VLRA 4G3DA 3HP5A 5L2TA 4M0ZA 3UZRA 4O7NA 1E1XA 4QDEA 4BIBA 4I92A 4C37A 1SMHA 3O71A 1XMLA 5AAGA 3ZDUA 1BYGA 3CC6A 3EN5A 2JC6A 4FSRA 3NSZA 5EI8A 2OJJA 3HV5A 2P3GX 3MPTA 5FBOA 4ITHA 4NEUA 5G6VA 4F6SA 4EH7A 2BTRA 2HY0A 4FICA 4G17A 3R9OA 5A6NA 2XK8A 4Y83A 4XEYA 1Q3WA 3LFNA 4AX8A 4IFCA 4RJ3A 5LWMA 4QTEA 4I23A 4KBKA 3F3UA 4FBXA 3CGOA 4C36A 1YI6A 1ZRZA 3QYWA 2C69A 2VU3A 4GUEA 2BILB 4Z7GA 3PDTA 4FK3A 4K2RA 3EQCA 2F7ZE 1KOBA 5KMNA 3I7BA 1H08A 5IA4A 5HBHA 4MWHA 2O8YA 2VWUA 2R3RA 4TPTA 4FJVA 2PWLA 2VWYA 2UZOA 2I1MA 4PNKA 2RG6A 3CR0A 4LRKA 1FGIA 4CCUA 4BDEA 2VTOA 2YCFA 4K18A 1H1SA 4KBAA 4LM5A 3IGGA 5EHOA 1GOLA 5ACKA 2PMLX 1Q99A 3UDZA 3ZZWA 2XB7A 3NUUA 2HCKA 3HRCA 3DV3A 3OMVA 5JGBA 4ZJIA 5ANKA 4FTCA 4WG3A 1JSUA 3FL4A 3JYAA 4XP2A 4KIPA 3FMKA 3E8NA 4L6QA 4YTCA 3ZC5A 3PFYA 2XA4A 4BR3A 3ZC6A 4XLIA 4ONAA 3LFDA 1ZYDA 3FHIA 3QTIA 1AGWA 4S30A 4Q2AA 4TRLA 5IG1A 4EQUA 5IMEA 3WF7A 5ITAA 1PRYA 4KSPA 3VS7A 1YXXA 3FJQE 4MNFA 4BB4A 1IAJA 4GVAA 4FV5A 4MD7E 4OBQA 3FMHA 3PJ1A 3W55A 5M4FA 4Y73A 3P08A 3R8LA 2OIDA 4DAWA 1OECA 5ACBC 4U8ZA 4XS2A 3JY9A 3PZEA 3R8MA 3V6SA 1W2FA 2ZV2A 1A48A 4FV9A 3UOLA 2DWBA 1R78A 3F9NA 3VBQA 5CVGA 2YM8A 3DLSA 2HOGA 4S31A 5F9EA 4QYEA 4X2FA 2ZDTA 2VTAA 3EN4A 4IAIA 5DE2A 4AACA 3TIZA 4FC0A 4XBRA 5GIPE 4FV7A 4JDJA 4LG4A 3KRWA 3MFUA 3KVXA 5DA3A 1OKZA 1ST0A 4HNFA 3SV0A 5C4LA 3DNDA 4Q5EA 3GOPA 4HGSA 4BDJA 1UA2A 3FXXA 5HG9A 5BMSA 4QMLA 3EFLA 3GP0A 1BI8A 3UDBA 1Q41A 3W8LA 3NW5A 4CLIA 5K5NA 3EB0A 1JPAA 5HVJA 4WOVA 5AUWA 4CQGA 3HRBA 4MQ1A 3MESA 5M08A 5BX0A 4YTFA 2VRXA 4PWNA 4X2KA 4X3FC 3AMAA 2J0LA 4M15A 1WFCA 1VJYA 1UU8A 3SRVA 3V6RA 2WTDA 1XBAA 2O5KA 4GUBA 4MXYA 4FG8A 4XBUA 4FIHA 2W5HA 2W1FA 4MEDA 4EH3A 4AGDA 3WE8A 2VNYA 3LAUA 3PE1A 3O7LB 4K1BA 3LCKA 2P2HA 2FVDA 5A4CA 4DC2A 3QZIA 3DKCA 4PDPA 4DBXA 3QWKA 3K3IA 1Q61A 4YMJA 1WVWA 3GQIA 3QA8A 3P7AA 5TF9A 4IAZA 4FOBA 5IKWA 3TT0A 4DE4A 1SZMA 4FTUA 5IUIA 3V51A 2YN8A 2WD1A 5KMMA 3AOXA 3HKOA 4A9YA 1UWHA 3POZA 4HVHA 1S9JA 3HMOA 4ENXA 5HG5A 1DAYA 1KSWA 3G6HA 3LFBA 3PA4A 4C33A 3U4WA 2PE0A 3BWJA 3L8XA 4EOMA 4F6WA 5J9YA 1L8TA 4YC3A 3QQUA 4FYOA 4PMTA 4QTBA 4ZTLA 4ACMA 4H39A 4P90A 4ENYA 2WMXA 4J71A 2WTCA 5JK3A 1JQHA 4P2KA 3KXGA 4D2PA 3DNEA 4BDHA 4GT3A 5FTOA 3PXQA 5GNKA 4FUYA 4BTFA 3OD6X 4FV6A 4L44A 5DT4A 5AP5A 5BYYA 2XANA 3TJDA 2ZM1A 4XP3A 5KZ0A 2AC5A 3EJ1A 4FTJA 3MN3A 4R5SA 2UW0A 3NYVA 3NX8A 3Q2MA 4Z3VA 3SG9A 3QQJA 4D55A 1CSNA 3PUFC 3KXXA 4PL5A 4DT9A 2R3PA 3FQHA 3FLZA 3OWJA 2R3IA 3QD4A 2VX3A 2HW6A 4MYGA 2XIYA 5L3AA 4FKTA 2X7OA 5K5XA 2CSNA 3EMGA 3R1QA 4M12A 4O1PA 3TCPA 4F0GA 4OLIA 3U6IA 2QOLA 1OKVA 4E8AA 3C9WA 1NA7A 4RFZA 4MXZA 2I40A 5CZIA 3GCSA 4P4CA 3R7OA 4XV1A 3FL5A 3UZTA 3ODYX 4FT9A 4BTJA 3EWHA 4FSMA 1CM8A 3NFFB 3K5UA 4EH6A 4DFBA 2JIUA 3DB6A 4Y5QA 1Q3DA 5E8TA 4G9CA 3V3VA 4C4IA 2PMNX 4NTSA 3OTVA 2WQOA 4Z55A 2GU8A 4FOCA 3ZM4A 1URCA 2ERZE 3C5UA 3CTHA 4KWPA 5F4NA 4FG7A 5M56A 3EFWA 4E6CA 1SNUA 4LL0A 2ONLA 4I0TA 4FGBA 4YNEA 1Y6AA 2BTSA 3KMMA 2X4ZA 1VEBA 1H24A 2VTHA 5HU3A 1FQ1B 4FSQA 3F61A 2WU7A 3OBJA 3QKLA 3BGPA 3OHTA 3SX9A 1PY5A 4NUSA 3KY2A 2BR1A 2IN6A 3QGWA 5BUEA 3G15A 3UVPA 4FODA 2QI8A 3KXMA 5E4HA 2F49A 1MRVA 3EYGA 3DS6A 4E1ZA 4APCA 3R9NA 2B0QA 3DLZA 3W2QA 1NY3A 5I9XA 4RC3A 3RAWA 5HIEA 4A07A 3QAME 1Q8YA 1APME 3DZQA 4PUZA 3TMOA 4ZJJA 4AZEA 3SQQA 5BQ0A 1XH5A 4CV8A 3DK3A 3OF0A 4L9IA 5A3XA 2YCQA 2W1HA 3D9VA 2VO6A 2FB8A 4LMUA 2WIHA 4HGEA 3II5A 2XKEA 4UALA 4EL9A 2QOFA 5CYIA 3IG7A 3FLQA 4FX3A 3UP7A 3TNPC 3ORMA 4IDVA 1M7NA 3QBNA 4DF3A 1PYXA 5C4KA 1ZY5A 2UZNA 2Y8OA 1STCE 4IM3A 4HW7A 3LFFA 5EKOA 3O8PA 4F78A 2X2MA 3EQPA 3NIEA 3U6HA 2GNIA 2VWZA 2XNOA 3GENA 4QMOA 2PZ5A 5H2UA 3BZ3A 3QX4A 4GJ3A 3QQLA 3BYVA 3E7OA 4W4VA 4CT1A 3BBTB 5KMIA 2C3JA 3H4JA 1RDQE 2VWBA 2I0EA 3QC4A 1U54B 1H07A 1WCCA 1G8JA 2C4GA 3IGOA 3SOCA 4D2RA 2LGCA 4RGJA 3VUKA 3KCKA 4EQMA 2Y0AA 3B2WA 4RZVA 4G2FA 3TNHA 2VX1A 1XKKA 1EH4A 4NJ3A 5J87A 4K9YA 5KBRA 4BIEA 1ZYCA 4EHZA 4FKSA 5AR8A 1FVVA 3FZRA 4DHZA 3R7EA 5IA2A 4IB5A 3BL9A 1U46A 5C01A 3TNIA 4A4XA 1UU9A 3D2KA 3LCTA 2E9UA 5IQHA 2YABA 1U5RA 4FV3A 4KIKB 3FXWA 4L46A 3EN6A 3KQ7A 3JS2A 2XJ0A 4C4EA 3NNWA 4X7QA 5HLNA 5IDPA 1KE7A 2O65A 1Q5KA 4JBVA 1TQPA 4C0TA 1WBWA 2YIQA 3MH2A 3RPSA 3QRIA 3QGYA 3NCGA 4ZSJA 1MQ4A 2QHMA 5IA5A 2ZFYA 4UV0A 3Q53A 4JR7A 4CRSA 4EOSA 2I7QA 4GG5A 2R3GA 5DT0A 3I7CA 5EM5A 2BALA 4WKQA 4DEAA 2CNVA 2ZV8A 2X1NA 3BPRA 1PXKA 2P33A 4NM3A 4L53A 5K4JA 3FMDA 3O7LD 4CG9A 4F63A 4O7WA 2JITA 5FXRA 2XNGA 1R1WA 3BV2A 1YWNA 5CSHA 3OW3A 3D83A 4TYHB 5CI6A 5HE1A 2W17A 5AUZA 3GU6A 4KS8A 5M4UA 3C13A 5LVNA 4IWQA 2QKRA 3LPBA 2P55A 4ZZNA 1ZZ2A 3NLBA 3TI1A 3NUAA 4OTGA 5HTCA 4G6NA 4R8QA 3I60A 5ETCA 3COMA 4JT3A 4Y95A 2JDTA 4FV0A 2CLXA 2QLUA 1KE5A 2FUMA 4LUEA 4QNYA 4C02A 5DLSA 5EW9A 2XYUA 4QPSA 5IMXA 3DOGA 3LXLA 4AFEA 3I0QA 2GQSA 5H8GA 3EL8A 2ZOQA 1M17A 3NWWA 5CASA 4LGHA 1ATPE 4QMVA 5JRSA 5H8BA 5JZJA 3FKLA 4BCFA 4FKPA 2BAKA 3NDMA 3W0OA 3RMFA 3BHUA 4U80A 2BFXA 3ZO2A 4E6DA 5BYZA 1BMKA 2IPXA 3ORPA 2YDJA 2W1CA 4GL9A 3KK9A 4TY1A 3P1AA 3RZFA 2ITVA 4BIDA 4USEA 3EIDA 4IHPA 3WF5A 4IVBA 3SC1A 3RK5A 5JH6A 3MH0A 4IJPA 3P5KA 3NR9A 4IWOA 3BE2A 4U5JA 4AN9A 4DEBA 3PG1A 3LE6A 1H25A 4MH7A 1J1BA 3QFVA 4XUFA 5FM3A 4CFMA 4DGNA 4E5WA 1Q97A 3GI3A 3W2RA 1UNHA 1AQ1A 2W5AA 3BYSA 2X8EA 2LAVA 3UZPA 3VUMA 2V22A 3GU5A 2ZB1A 3OXTA 4FNYA 4V04A 5HO6A 5GJGA 3BEAA 4OW8A 3MWUA 2SRCA 4IAFA 5JSMA 3UIUA 2C0IA 3A99A 3KREA 1OGYA 2YFXA 3OBGA 2CKOA 4I22A 3GCQA 4IZ7A 4MBLA 5BUJA 4O83A 3F3ZA 3UTOA 2E9VA 2PZPA 2IG7A 2YIRA 3M11A 1OM1A 3L8PA 3LMHA 4D4RA 4G1WA 4RVLA 2RGPA 5A9UA 2ZV7A 5CSVA 3E3PA 2JLDA 3A7FA 3KB7A 1JBPE 4BCIA 2UZLA 3ETAA 3PA3A 3BCEA 4FL1A 3UG1A 1H00A 4FIGA 2GHLA 3VS2A 3D7ZA 2ESMA 3PJ8A 3UVQA 4TWOA 4DCAA 4QMPA 3MGYA 3H9RA 3T8OA 2PUPA 4O91A 4MCVA 4O7VA 4DG0E 5KKRC 4TWCA 4E4MA 3EN9A 2BROA 3GOKA 2Q0NA 2Z7LA 4GVJA 4EH2A 3U8WA 3ZZEA 2XIKA 3HUCA 1CKJA 4OBPA 5AUVA 4JG6A 4AUAA 4FK6A 4FTAA 2XJ2A 3OY1A 2Y6MA 4AWIA 5M51A 2XF0A 3VF9A 3TDVA 5LMKC 5CNNA 4IH8A 1ZXEA 1V1KA 3S4QA 4ZZOA 4O0RA 3NNXA 3TJCA 3BHVA 3DBEA 4FTIA 4YBJA 2WMUA 5C26A 4HCVA 4D58A 1ZOGA 3P79A 1GIIA 5FQDC 3R7YA 3ZS5A 3ZSGA 1XQZA 4D9TA 4EBWA 4U0IA 3WZUA 3HX4A 4YHTA 1L3RE 3JPVA 5CU3A 1TKIA 3F2NA 5ANDA 3O23A 4ZLOA 5AR5A 5H8EA 5A14A 4DFZE 3ET7A 4FVRA 4EZ3A 4HVIA 5L6OA 4RX5A 3ZLYA 3DQXA 4W4XA 4QMUA 4YP8A 3VS3A 5AUUA 3OCBA 3TM0A 4YZDA 4BZOA 5CX9A 4C8BA 2WMQA 1OKWA 3F3WA 3FKOA 5BUIA 3A8WA 3OVVA 2XK4A 2WAJA 2X6DA 3FUPA 3OROA 1ZYLA 4UMQA 5DYJA 4AXCA 1YVJA 5E9EA 2EUFB 4C3RA 3OWPA 3UO4A 3Q3BA 4HYSA 4O4EA 4R3RA 4TW9A 5AAFA 4CZYB 2X2LA 3UOHA 4FKJA 3VBWA 5AEPA 5A4TA 3NVKI 3ZXTA 1OMWA 5HEZA 3REPA 2NNWB 3NVMB 3HAMA 3FEGA 4AZSA 3A7JA 4FEXA 4O7RA 3BHTA 4HJOA 4EJNA 1J7UA 4R7IA 4L43A 3L8VA 3LXKA 5TE0A 4B6LA 4C4JA 3UODA 3U54A 1OL5A 1JKTA 4MUQA 3B8RA 3AC1A 2VTNA 3BYUA 3I6WA 1Y6BA 2GQGA 3FY0A 4JDKA 4EK6A 3P5JC 4G6OA 3ZBXA 2EXMA 2E9OA 2RF9A 3EZRA 3HMMA 3T9TA 4EQCA 5IQBA 3A4PA 5DWRA 4ZY6A 2XM8A 3R00A 5IQEA 4XH6A 2PZIA 2BAJA 3F5GA 4ZZMA 3QCQA 4RFYA 4IX3A 1PXMA 2C6LA 3R7IA 3G5DA 4BCMA 1I44A 1O6YA 4TWNA 3FZPA 2B4SB 3SW7A 1YDTE 2J5FA 5ANIA 1PMVA 2H6DA 4U45A 3VW8A 4YUQA 2GCDA 2UZEA 2YITA 2PU8A 3ORZA 5L4QA 3TUCA 4DTBA 3ZFYA 3I0OA 3ZFMA 2OH0E 3L8SA 4EKLA 4H1MA 2R3LA 4I5PA 3BGQA 3F5PA 4M3QA 2ETMA 4BBEA 1NT2A 4BN1A 3LJ0A 3LMIA 3TZ9A 3E8DA 3I6UA 4FT7A 4A9TA 2RG5A 4L8MA 4JQEA 3WYYA 4WT6A 5CU4A 2W1EA 3B2TA 5CQWA 3QTSA 3I1AA 4YJNA 4LRJA 3HVCA 5CAUA 4YC8A 2W1DA 2XUUA 4TXCA 4C3PA 2G01A 4RVKA 4IX6A 4BCJA 4PF4A 3R0TA 2C1AA 1OBDA 4NYEA 1OIYA 2QG7A 1XH6A 5BNJA 3QTXA 4DLIA 3F7ZA 4QMTA 2PZYA 3RM7A 5LVMA 1W0XC 2IF8A 4NCTA 4XP0A 2VN9A 4QNAA 4RFMA 2VTLA 3FPQA 2C6TA 5FG8A 4PMPA 3CBLA 3L9LA 5IH4A 4GFMA 2UZBA 3HV6A 3QXOA 3DT1A 3OTUA 4F9AA 3ORLA 2XH5A 5EFQA 2QOKA 2F57A 3SOAA 2GQRA 3HGKA 4AFJA 3P7BA 3R7UA 3UMWA 5HORA 1WBNA 3QCXA 4ZP5A 4O38A 3BYOA 4FT5A 4H36A 4RG0A 5E8UA 5KO1A 2IZSA 3QRUA 3E92A 4ACHA 2WTKC 4YZMA 5AP6A 1P5EA 1V0BA 1XMMA 2G2HA 3SG8A 2QODA 3GB2A 1RQQA 5M09A 2X6EA 3FLWA 5K0XA 5EW8A 3D4QA 5FBNC 5J1WA 4R7BA 3DK6A 3PVBA 2OICA 3I4BA 3LIJA 3KFAA 4HYUA 2CKPA 1CKIA 3A7GA 5AUYA 5LVLA 2QONA 3QCYA 4F9YA 4ANQA 3PY3A 3N4TA 4OGRA 4G3FA 4X3FB 3IDCA 1MQBA 4P5QA 4FTRA 4J95A 5HQ0A 3OEZA 3UJGA 4YHJA 3QZHA 3GC7A 2G15A 4N6YA 5HNGA 2HW7A 3Q9YA 4XV9A 3BWFA 5IQAA 2X9FA 2KTYA 2GMXA 2J4ZA 5GZ9A 4YSJA 3PZHA 3DXPA 2CCHA 1WZYA 5JFWA 3E7VA 3RZBA 2X0QA 2R3NA 4PV0A 3SXFA 3WYXA 2Y4PA 3F88A 4NSTA 4CTBA 5EQYA 4AE6A 2HELA 2O64A 5HD4A 1BX6A 2XVDA 3DDPA 5J5TA 1OVEA 2PE2A 1KOAA 2R9SA 3BX5A 4KSQA 4NH1A 3PWDA 3ZO3A 4BHZA 5F95A 3ZCLA 5E8WA 3MTLA 4CKJA 5GZAA 1UU3A 5A46A 4QP4A 4JVGA 3R8VA 4LV7A 4YO6A 3F5UA 2PVJA 5EI6A 3PLSA 1J7IA 4S34A 1LUFA 4IB3A 5EYCA 2V0DA 4ALUA 4ITIA 1GY3A 4ID7A 1YI4A 5C8MA 3COHA 1A9UA 2UW3A 4F7LA 5HBJA 1E9HA 3Q9XA 1WVYA 3FZ1A 3VS4A 3CY3A 4X2JA 3FC1X 4ANLA 5CEPA 2JKMA 3Q9WA 2WQBA 3VHKA 3PIXA 1G3NA 2FO0A 4HZSA 2PYWA 3BYMA 1IRKA 4OAUC 3KXNA 5JQ5A 3QXPA 2R7BA 4IQ6A 3IDBA 2YLEA 4IAYA 4WBOA 3FZSA 2YIXA 4RIXB 4X6RA 4JX7A 4RRVA 4W8DA 3RP9A 4CFXA 3OWLA 5FTGA 4DLJA 5C1QB 2C5NA 4ORKA 4L3LA 1T46A 2RFDA 1H4LA 4WBBB 1CKPA 2B1PA 5E1EA 3DK7A 2QD9A 3T9IA 4PDYA 2HAKA 2CN8A 2GDOA 2WMSA 4G6LA 1BL7A 5CAQA 5LQFA 2BHHA 1Q24A 4FTTA 4FTKA 3G0FA 1UNGA 1YWRA 4PPBA 5CAOA 2B9HA 3FMJA 4V0GA 2VTSA 3FWQA 2CGWA 1BL6A 4ITJA 4B8LA 4L67A 2YAKA 2FSOX 4QMMA 5C27A 5E1SA 4E4LA 3E93A 3MTFA 5HCZA 4AZTA 4MBJA 3W0PA 2VNWA 5D7VA 3GNIB 4UMUA 3VQUA 4O7LA 5IU2A 3C0IA 3UPZA 4G3EA 4BI0A 2A19B 3OWKA 3V5QA 5JGAA 3QCSA 3N51A 3D94A 1PXPA 5FDXA 3V5TA 4TKSA 4GFOA 3R73A 2BZJA 3PXFA 1OKYA 3TXOA 3G6GA 2EB2A 4O0VA 4W4WA 2PVRA 5L2QA 2ITXA 3ITZA 4BHNA 3AMYA 3Q9ZA 4QQCA 3GCPA 1YXUA 4I1ZA 4XG2A 3LKMA 3S2PA 4YJTA 2B52A 1RJBA 4AT4A 4F7JA 3W2SA 4GJ2A 4BCGA 2R3HA 3F5XA 4AGCA 3PA5A 4OT6A 3FKNA 4BTMA 3OCSA 3P86A 2QLQA 4RWKA 4Q9SA 3W18A 4ZY4A 2C6EA 3Q6UA 3AGMA 3VC4A 2GTMA 4G16A 4M0YA 3QU0A 4MX9A 4JMQA 3VAPA 4MWIA 3F66A 1KV1A 4W9WA 1VZOA 4EKKA 2ZVAA 3GQLA 2QU6A 1O6KA 3QUPA 5DFPA 3KA0A 4EJ7A 3SXRA 5AP7A 4RIWA 4CKRA 1Q4LA 3MVJA 4RX7A 3TV7A 3SKCA 4UY9A 3QHRA 4C3FA 3DBFA 3O2MA 4RLLA 4CLJA 2W96B 1WBSA 4QQ5A 3UG2A 3OY3A 4ZSEA 2XKDA 3CTQA 5B2MA 2ZJWA 2FSLX 2Y9QA 4O84A 2BZKB 4O0UA 4KNBA 1JKKA 5CALA 3WF9A 3LQ8A 2R4BA 3WF6A 3OCGA 4GK2A 3AC2A 4DG2E 3R22A 2IW8A 3LCSA 1JVPP 3IOKA 3R02A 4NM7A 2XRUA 4NIFA 1OL6A 2X0OA 3NNUA 1NVRA 4XOYA 1NW1A 3FSKA 4K6ZA 5DN3A 4NM0A 2W1IA 4Q9ZA 2XYNA 4KS7A 4A7CA 4DH5A 5E90A 4AW0A 3BELA 3KEXA 4PDSA 2HIWA 2QCSA 2YM3A 3KRLA 4IVCA 2VWXA 3FMMA 5JZNA 3Q5ZA 5KMKA 1SVGA 1XH8A 2CKEA 3I5NA 3D5WA 1OPLA 3HDMA 3W1FA 2OSCA 3QD3A 4JRNA 3BQRA 4AA4A 3VS5A 4EZ5A 3IPHA 5A4QA 3ATTA 3Q4CA 2HWPA 2OWBA 2RFEA 1W98A 3R7VA 3W0NA 3PUPA 5BVFA 2XJ1A 5HNIX 3HMIA 4O22A 4AOIA 2X4FA 3PTGA 3CPBA 3QLFA 3EN7A 2PVKA 3CD3A 3RPOA 3ZRLA 2ONLC 3PY1A 5AFVA 2G1TA 3S3IA 3OFMA 5HX6A 2PVHA 5IQGA 4X3JA 3RK7A 4QP1A 1URWA 3NEWA 4O4DA 2UW4A 3WZEA 2WEVA 1PMEA 4MKCA 5DRBA 4KUJA 3OXZA 4XCUA 3DAKA 4S33A 4I41A 2WU6A 3FMLA 2YAAA 4P7EA 4BCOA 2F7EE 2FGIA 4ZIMA 2C3KA 3PRFA 4JRVA 5EYKA 4RVMA 4ZEGA 5HG8A 3P4KA 5DR6A 4B7TA 2XBAA 2F2CB 4D4YA 5IEYA 4CGAA 4Y72A 4HNIA 4JBPA 4QMYA 5ETAA 1XH4A 2PVLA 1M2PA 5CSWA 3DXQA 3HLLA 5IQIA 4AXEA 5EDPA 5L6WL 4Z16A 4FUXA 4AW5A 4TYEA 2HY81 3KXHA 4YTHA 4BVUA 2CCIA 5C8KA 2BKKA 3IOPA 4GCJA 1WVXA 3I79A 4GK4A 4LV5A 1XHAA 3OUNB 1OIUA 4MXCA 4YZCA 2YWPA 2E9PA 5CU6A 3TG1A 5IH5A 2XP2A 4W4YA 2B54A 5LWNA 3IS5A 4RSSA 3QZGA 5FP5A 3R2YA 4RZWA 3KRXA 2JDVA 5FDPA 4FSUA 2C68A 3DY7A 5AX3A 4EH9A 3CJFA 2WMWA 5BMMA 3WBLA 5CF8A 4GU6A 1OIRA 3OUKA 3MJ1A 4DFXE 4FKRA 4PQNA 4BGHA 4DH3A 4DN5A 4YZ9A 3MVLA 1VYWA 4W9XA 1XWSA <