5EW3A

Human vascular endothelial growth factor receptor 2 (kdr) kinase domain in complex with aal993
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
274
Chain Sequence
PYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title A Novel Potent Oral Series of VEGFR2 Inhibitors Abrogate Tumor Growth by Inhibiting Angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 274
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ew3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ew3A01
1R3CA 3FZSA 3I7BA 2X4ZA 4D2VA 4D4SA 3GT8A 4U44A 2YM4A 4HCUA 4AZEA 5EOBA 4OTRA 5M51A 3PWDA 5CNNA 2F7ZE 1IRKA 5IUIA 3RK7A 3UE4A 4O81A 3VC4A 2J90A 4AA0A 4FNWA 4XP2A 1URCA 3S4QA 2F2CB 4UYNA 1G8SA 2QOHA 2BZKB 2VTOA 3EN4A 1XH9A 3E8EA 3ENMA 4MWHA 4NFMA 5AAEA 1J7UA 3ZC6A 2X9EA 2HW7A 4LRJA 4OGRA 1OKZA 3CIKA 3DLZA 4NTSA 5LVOA 2WOTA 4D4VA 4BCPA 5LVNA 3KF7A 3NAYA 4CCUA 4TWPA 1M2PA 2VTPA 3NVMB 2ZVAA 2BHHA 4O2ZA 4R3RA 4QMXA 4F7NA 5LOHA 4QYYA 4TYIA 3AT4A 2BAJA 3PA3A 4DFXE 4DG2E 4GK2A 4NYEA 2QO2A 3CP9A 1OL5A 3D2KA 4CQEA 5IQIA 3ZBXA 4ALUA 4YC8A 5EDPA 4MH7A 3FBVA 4RZWA 4BHZA 2W17A 3BBTB 4H39A 4TWNA 3HLLA 2W5BA 4L53A 5E4HA 4FK6A 2JKKA 3JY0A 1SM2A 1YQJA 3R7GA 2X1NA 3B2WA 3BQRA 4XBRA 4CMUA 4E4LA 5ICPA 4AZTA 3HMNA 4RC2A 3UNJA 2C1BA 2QOBA 3HYHA 5JRSA 3GCSA 3ZZWA 4WHZA 3QZHA 4JG6A 1EH4A 3GENA 3SA0A 3IDBA 3PG3A 2CLXA 3RHXA 3B2TA 2ZB0A 4ZTMA 4R7BA 1U54B 4ZSAA 2XVDA 2CN8A 3E5AA 4K6ZA 2CDZA 2H8HA 1GOLA 2B9JA 2HXQA 4DGGA 5IKWA 5A46A 3Q4CA 5CXHA 5FEQA 2DS1A 4NJ3A 4C4FA 5D10A 5CSVA 1YHVA 1BL7A 2CPKE 3FL4A 5H8BA 4HGEA 1QMZA 1XH6A 4MXYA 5CVFA 2V7AA 2VWBA 5CEOA 3ZDUA 5BYZA 3OCSA 2WTKB 2VAGA 1Q3WA 4QTCA 4DEEA 4ZTSA 2JKQA 2Z60A 2CCHA 2GQGA 4FSZA 4EORA 1Y8YA 2B9FA 3UPZA 3CD8A 1I09A 1Q61A 2WTCA 3DFAA 3L1SA 3E8NA 3L9NA 2Z8CA 3PVWA 4G1WA 4R6VA 3VUMA 4ZLZA 3KXZA 4OAVB 2AUHA 4TNDA 5HE2A 3ZUVA 1OBGA 3R7YA 4IWPA 4OT6A 5KMLA 4ZZNA 3EJ1A 5EI8A 2VO0A 4RLKA 4D2WA 3DJ6A 5AM6A 3PA5A 4QMZA 3R2YA 4LGHA 4AGDA 5HG7A 4FI1A 5IEYA 4I6HA 1JPAA 5FM2A 4C59A 2R64A 5ANDA 4PDPA 5DMZA 4C62A 5KMJA 3VW8A 1ZYLA 1ZYSA 3W2RA 2VTQA 3QQUA 2PY3A 3UBDA 1VZOA 4ZY5A 4YNEA 4RLLA 3C7QA 3P7BA 4BIDA 5KMMA 3QD3A 2HZ0A 3ZRKA 4AN3A 2PE2A 2YAKA 2R3OA 2F7XE 3CY2A 3KMUA 4DHFA 4E6CA 4EKLA 3AQVA 3RHKA 4JAIA 3CQWA 4FV0A 4FUXA 4EK3A 3DK6A 2OIQA 2RG6A 4A7CA 4RX8A 4IJ9A 3TDVA 4GVAA 4E1ZA 2BR1A 2C6DA 5HLNA 5JH6A 4FKUA 1K2PA 2YDJA 4QPAA 4W4XA 3VUDA 4CD0A 2GQSA 3QHRA 3MH3A 4FT3A 1STCE 5HNGA 4ALVA 5CEIA 2W1HA 3LJ2A 4JDJA 1XH5A 2DUVA 2WXVA 4W4WA 3LM0A 5H2UA 2UZWE 3G51A 3RWQA 1M2RA 3PJCA 2HIWA 3HP5A 4TPTA 4AGUA 3LE6A 4MXXA 3EN7A 5I9WA 1H26A 4XG4A 4RA4A 3DBEA 3KXGA 3MIYA 3TIZA 5EQEA 5CALA 3NNUA 4ASEA 1IASA 1YDTE 3COKA 3FQEA 1YI4A 3SLSA 1G5SA 3FAAA 2WNTA 4HJOA 4I23A 4MEDA 1UKIA 5FD2A 4EWQA 1JNKA 2JITA 4EK6A 5CEKA 5K0XA 4EOOA 2R3FA 2XIZA 3BE2A 3EL7A 4UMTA 2P3GX 5ANOA 1Q41A 1WBPA 4FSQA 4WKQA 4ACDA 3QTXA 3IQ7A 4IB3A 2UZOA 3EQHA 4KB8A 2O5KA 4USEA 5AIRA 1SYKA 4EBWA 4F64A 3S00A 4AA4A 4PMPA 1YWVA 2VO3A 3ERKA 4YU2A 2IZUA 3BCEA 3CGFA 3W2CA 4EUTA 3O7LD 3VS6A 5AX9A 5CF8A 2F7EE 5AADA 5LJJA 2PYWA 3HDMA 3IONA 3P9JA 3OF0A 5EHLA 3LZBA 3LMHA 3VVHA 4XV2A 3AC1A 3MPTA 5T3QA 3KCKA 4U81A 3EYHA 5I9XA 4GK3A 4XG2A 3PY3A 3R2BA 3WIKA 2CNVA 2P55A 3F3ZA 3KXXA 1GZNA 3PRIA 4EBVA 3EWHA 5HORA 1OECA 5HKMA 3WYXA 3PSDA 1J3HA 3ZO1A 1ZZ2A 4PPCA 5E8WA 3OUNB 4NW5A 1ZYJA 4Z7HA 4JVGA 4I0RA 3NYVA 4V04A 5FLFA 4C3RA 4C8BA 4XP3A 2YERA 3W2SA 5HD4A 2HZNA 4NIFB 2B0QA 4PPAA 2QU5A 3OY1A 5F95A 3IOPA 4U43A 4YURA 3OVVA 4QP9A 4O7WA 2H6DA 4F1TA 4PUZA 2HYYA 2XJ0A 2W99B 2X39A 5CT7A 3T9IA 5LCJA 3R21A 4DFNA 3PFQA 4TYJA 4EC9A 4J98A 4DBXA 4FTAA 1NT2A 3NW5A 3BV3A 4I21A 4JQ8A 3R7VA 3A8XA 4FSMA 3UMXA 4WSQA 4TYHB 2QOOA 3QKKA 4JX7A 2X6DA 4NT4A 4O38A 4AG8A 5KMIA 4ZSEA 4ZTLA 1PMUA 4RFYA 5BUEA 3QAME 5AWMA 3F88A 4BWPA 4R5YA 2QKRA 4BCOA 3NPCA 1LP4A 3AD4A 4K0YA 4M0ZA 2XIXA 4UMUA 2B1PA 2GHMA 2ZYBA 4LV5A 2W5AA 3ZLXA 4O7VA 1MRUA 3FDNA 4GEOA 2JLDA 3ZO3A 4U6RA 2BZJA 4N6YA 2BRBA 2Y6MA 1UNHA 3LAUA 4KSQA 4QYFA 1ZMWA 2YCRA 4GUBA 2PUUA 2PVKA 2Y0AA 4OTPA 2KULA 5FTOA 5CAQA 3TN8A 2IW9A 3FYKX 3ORPA 3E93A 4RIXB 2PE1A 2OF2A 4UN0C 3IGOA 1ZXEA 5CU0A 4K11A 2CGVA 2A2AA 1XH8A 1VEBA 4FTRA 2WU6A 4L3JA 4WOVA 2G2FA 5TT7A 5KX8A 3N4TA 4C38A 3KN6A 4TNBA 4W4YA 3ZSHA 5KMNA 4LI5A 4OTQA 2XNNA 4TZRA 4R8QA 4DH8A 2C68A 3CJGA 5C8MA 3FSFA 3OCGA 3R1YA 2QKWB 3R1SA 1AGWA 3Q5IA 4DH5A 3OTUA 4PMSA 4U97A 4D58A 2NPQA 3OHTA 4IWDA 3ZONA 4F6SA 4D0WA 5IA5A 4FKRA 4CKIA 2P2HA 2P33A 4L68A 5F20A 1IAHA 4BDDA 2YIYA 3BWJA 2RFEA 3JXWA 4NZWB 2UZNA 3A7FA 4O0XA 3AC3A 2C6LA 3C0IA 2JIUA 3F5UA 1HOWA 4RIWA 4M14A 1DAYA 5ACKA 4QMYA 4AT4A 4EH3A 4QP1A 4PTGA 4FTCA 3GI3A 4AFJA 2A19B 2CCIA 4E8AA 4YSMA 4NCTA 3OMVA 4F7LA 5HEZA 2HAKA 4A9RA 5HQ0A 3CD3A 3MFUA 3KA0A 4FEUA 3S3IA 4F0IA 5E8SA 2GSFA 3HAVA 4FKQA 3PP1A 4X3FA 5M4IA 1OBDA 5FQDC 4BDJA 4DFLA 2B53A 3W18A 2ZOQA 2VWUA 5AR4A 3JS2A 5CENA 4B6LA 4ANBA 3R8LA 3TG1A 4IADA 4RBLA 4NH1A 3Q96A 3D7TB 4HZSA 4AUAA 3LW0A 3TTJA 1A9UA 2I40A 3FHRA 3QLFA 5ANJA 3VRYA 1TQMA 4K18A 5K5XA 3CTQA 5M09A 3BYVA 5AV1A 3ZC5A 1LUFA 2QQ7A 3A8WA 4S33A 3KB7A 4C4GA 2F4JA 3D0EA 3C1XA 3NGAA 5CVHA 3DNDA 3HECA 4FZDB 4L42A 4QTAA 4DINA 2PPQA 3CKWA 3LLAA 1UV5A 3FMDA 4NM0A 3DDQA 4BDCA 4I6QA 2QG7A 4RWIA 2YLFA 4MK0A 1VJYA 4IC7A 3QCSA 4O1PA 3WZKA 1Q99A 3ZSIA 1H07A 5J1VA 3BYSA 2R3KA 2W1FA 4MXOA 4AN2A 1NW1A 4O7TA 2JEDA 1ZZLA 4IBMA 2YA9A 2IZTA 3GUBA 4FTJA 2UVYA 3QUEA 4I24A 4Z3VA 2PVLA 4Q9SA 2YISA 1JKKA 4R1VA 3P08A 1U4DA 4FEQA 1KWPA 2JAVA 2P2IA 4ZLOA 3NEWA 3AG9A 5C1QB 5IA4A 5C8KA 4FIGA 4K8AA 3NDMA 3NCZA 1CM8A 3FHIA 2ZV8A 2OZAA 3F61A 4FTOA 3RCDA 3WARA 5M08A 4MD8E 1Q8ZA 1B38A 3DBQA 2GTMA 1JKLA 1SVEA 4USDA 3L8SA 5JEBA 4KABA 4EYMA 4EK4A 1MQBA 4QQJA 3PY1A 5J1WA 1T46A 4YTCA 3F69A 5JRQA 2GHLA 2JBOA 5L2QA 4QQTA 4A06A 2YLEA 3QTZA 4NSTA 3TL8A 4YZMA 5BNJA 4YTIA 4ZJJA 3LMGA 2W96B 5HIDA 1PF8A 4BBEA 2GS2A 3RPVA 4CT2A 3PXQA 2B55A 2J7TA 5HBEA 5AM7A 3COHA 3W8LA 2YFXA 5FEDA 4KRDA 2XBAA 4RC4A 1UU7A 1CKPA 4NKAA 3LFDA 3WF7A 4LM5A 4G31A 3WI6A 4JDIA 2B54A 3AC5A 4BI0A 4QPMA 5HLWA 3F2NA 3BGZA 1WBTA 4FTTA 4RA5A 5HNBA 5KBQA 4M8TA 3Q4TA 3Q6UA 1OUKA 5GHVA 3QRUA 3KVXA 2VTIA 3QLGA 2FSMX 4FYOA 4XH6A 3UP7A 4LV8A 2BIYA 2BZHB 4IJPA 2G2IA 3TZMA 4A4XA 4D4RA 2JFLA 5IQEA 1O6LA 2UZEA 5IEVA 3FMLA 3ZDIA 4RT7A 5BPYA 1PRYA 4IAAA 5L2WA 4S32A 5CQWA 4CRSA 3EKNA 2EXEA 2PU8A 5JN2A 3HP2A 3VBTA 5D41A 3RNYA 3FKNA 3ALOA 3LFEA 4D1XA 4KD1A 5ITAA 3G33A 4EHGA 3MFRA 2HWOA 3CJFA 3DV3A 2A0CX 2FSLX 3EQGA 4E7WA 3UQGA 2E9PA 1L8TA 5CU3A 1PW2A 5IMEA 5CAPA 3H10A 2ONLA 1ZAOA 2J2IB 1O6KA 3Q9ZA 1I44A 3R1QA 2QOKA 4XLIA 4ZZMA 2WQNA 3C13A 4YZ9A 4FVRA 4W9WA 4RJ5A 4YTFA 3LCKA 3MVLA 1TVOA 3I60A 2I1MA 3FY2A 3IDPA 4CG8A 4F1MA 2QOIA 2I0YA 2EB3A 3F5GA 5I4NA 3VAPA 4CXAA 4YLJA 1KE5A 5LVLA 4CFMA 1KUTA 5L3AA 4LOOA 4DCAA 1OL1A 2VTJA 4RJ3A 2X2MA 4WSYA 4BRXA 4GU9A 3CGOA 3MVHA 4FGRA 3BYUA 4YPSA 5T6KA 4EQCA 4X21A 3IO7A 5CS6A 2HXLA 3QGWA 4HVGA 5K9IA 5A4LA 3KC3A 3GC7A 3QQKA 3Q2MA 1FINA 2PSQA 3VJNA 2ETRA 4F9AA 3VQHA 4TTHB 5CANA 3PUPA 1FQ1B 3QKMA 3R71A 3NUUA 4IFGA 1SMHA 5F9EA 3WE8A 4D28A 4HVIA 1KSWA 4KIKA 1M7QA 3E3PA 4BCFA 4FG9A 3VS4A 4APPA 1XH7A 4I6BA 4I5MA 3QX2A 3R83A 2PUPA 1ZRZA 2QC6A 1DI8A 3DJ5A 3GC8A 5KO1A 1G8AA 2VNYA 2I0VA 5CZHA 2VNWA 4JR3A 4WNOA 4BZDA 3FMNA 3V04A 2C5VA 2YCQA 3QTWA 1H1SA 3E64A 2VU3A 3QRIA 3CTHA 4BWKA 4FL3A 5CU6A 1J7IA 2O8YA 3HMOA 3LVPA 3GOKA 3VS5A 2W1CA 4G9RA 4J1RA 4YC6A 5TR6A 3F3WA 3WZJA 3KEXA 3C4XA 4L3PA 4OLIA 5CYIA 1ZOGA 3EQDA 3KN5A 5BMSA 5HU9A 5CU2A 2BILB 1KE6A 2B9IA 2XRWA 4X2NA 3RAKA 4CVAA 4AQCA 1DS5A 3VULA 5K4JA 3O0GA 4QQCA 2QVSE 4MAOA 2GHGA 2W1DA 4BICA 4BGQA 1H8FA 2I6LA 2RKUA 2VRXA 1APME 5IQCA 3GVUA 3ZCLA 4QMLA 4YHTA 5IDNA 5L2SA 3OOMA 4CT1A 2GFSA 3MPMA 3Q3BA 3ORXA 5E8YA 4JL9A 4N4SA 3QD4A 5CSHA 5AR3A 5EYDA 4BDGA 2GS7A 3QKLA 4TT7A 5DPVA 4Y83A 5AP6A 2XZSA 4AX8A 4EC8A 3PZHA 3VHEA 4O7YA 3CLYA 2R3HA 4NCTC 5L8KA 4FIJA 5GINE 3HGKA 2J50A 4GKIA 4LGGA 5C4LA 3CXWA 5M4CA 4XOZA 4E5WA 5HX8A 3EFKA 5IA2A 1XJDA 2XIYA 5IU2A 4KA3A 1PXMA 3HRBA 3LFAA 4FKOA 4X3FC 5JFXA 4DFYA 1XWSA 5LVPA 3HV3A 3MGYA 3UC3A 4PP7A 2WMWA 2CGWA 4NU1A 5LARA 1LEWA 5IPJA 2YDKA 3L9LA 5GZ8A 2QO9A 5E8XA 3W16A 5IISA 3P86A 4R3PA 4GT5A 2OJ9A 4AOTA 1RE8A 3OC1A 4IX4A 3PSBA 4KIQA 2I0EA 2VTLA 3O50A 4O82A 4CZUA 1H1QA 1MQ4A 2CHLA 4FTIA 3RP9A 1JBPE 4OUCA 2XEZA 3V8TA 2C5NA 2OICA 1PXNA 3DKCA 3R7OA 4HPUE 5EG3A 2E9UA 5L4QA 4M3QA 2ZM4A 4I93A 4G5JA 4PF4A 1NVRA 2W0JA 4XV3A 1ZY4A 1IA9A 5FDPA 1GIIA 2C3LA 4GK4A 2OJJA 5HLPA 4BGGA 4F08A 5EDQA 4NM7A 3VBXA 4U79A 5L2TA 4AFEA 3EHAA 1GZOA 4MF1A 4XOYA 5IH4A 2R9SA 2ETKA 3V8WA 4MXZA 4IW0A 3DK7A 3FL5A 4JLCA 5A4EA 2JIIA 5J87A 3ORTA 4HYHA 4PDSA 3MJ1A 4DT8A 2BRHA 2CN5A 4ZSJA 4GFOA 2JC6A 4FNZA 3OT8A 3QQHA 4RIXA 1ZMVA 2R3NA 4F99A 3L8VA 2YCFA 2VGPA 2OFVA 4AW1A 5JMSA 5IQFA 4H1JA 2J0MB 3CQEA 3TZ7A 4A9TA 3PLAE 4C34A 4IZ7A 2GNJA 5TKDA 3JVRA 3BEAA 3FV8A 3V6SA 2UW4A 2G1TA 4ITJA 5M57A 1ND4A 4FGBA 2Y7JA 3PPZA 4GUEA 5CQUA 4YMJA 2FUMA 4XEYA 3NW6A 4AZSA 4WG5A 1Q5KA 2REIA 3FPQA 4LFIA 2R3LA 4BDKA 1OKYA 2CKOA 2BALA 2CJMA 5FP6A 1CTPE 1E9HA 4FSYA 3AC4A 4RIWB 3UO6A 3ALNA 3EQIA 2J6MA 4H1MA 3IGGA 4WA9A 4YLLA 2UW3A 3F9NA 4L6QA 1MRYA 1Q8TA 1URWA 3GU5A 5DLSA 4XP0A 3K54A 3ZBFA 3AT2A 4CLJA 1KV2A 4Y46A 2RG5A 4BR3A 2GCDA 4ACGA 2KTYA 3EKKA 4FKPA 2C5XA 3C5IA 3NNWA 4QP2A 3CEKA 4X3FB 5DG5A 4NEUA 3Q52A 4HOKA 5KUPA 1PMEA 3B8QA 1ATPE 2ZM1A 4CTCA 3BHVA 3FZOA 4O7SA 2QU6A 4O7LA 5EQYA 3RK5A 3KXNA 5BVNA 4FOBA 4Q2AA 4DF3A 4U45A 3WZDA 4WNKA 2Z7RA 1HCKA 5IQHA 5IZFA 4OTGA 3THBA 1F3MC 4ZS4A 3VW6A 3WYYA 4CFNA 3QTQA 1SVHA 3D7TA 5A6OA 3NW7A 2HOGA 1NXKA 4CEGA 1W83A 2ZV9A 3QXOA 4O0TA 4FG7A 3VO3A 4X3JA 1W0XC 3BRBA 1KV1A 4DGMA 3MPAA 2BDJA 2ONLC 4IFCA 4EZ3A 4ZOGA 4IIRA 4L45A 3P78A 5DEYA 4MXAA 1XQZA 4G3GA 4NL0A 3OZ6A 2A4LA 2YM7A 4EHVA 4C36A 3G6GA 2BTRA 3UG1A 3WIGA 3EQRA 4QRCA 1H27A 3HA8A 4HGLA 4C37A 1CSNA 2J0KA 4ZJVA 5M55A 5AUWA 4NTTA 2GDOA 2VWZA 3FQHA 4F6UA 3NNXA 4G6OA 4RJ6A 1OB3A 4EL9A 2OZAB 3OUKA 3POOA 3TJCA 4C2WA 4JBQA 5C26A 1PKDA 2OLCA 1YRPA 2YM6A 3NUNA 4TKSA 1CDKA 5CSXA 4FA2A 4FTQA 3IK3A 3I0OA 3HV7A 4F6WA 2WEIA 2Y9QA 1WBSA 5DT0A 4LOQA 3UODA 2BRMA 4MVFA 4ANQA 5HBHA 5J79A 5CNOA 4E4MA 4APCA 1H1PA 3SVVA 4WUNA 1JSVA 4NM5A 4QYGA 2YM8A 4P90A 5D9HA 2XM8A 4MBLA 3DAKA 3E87A 3VBQA 1R78A 2R3IA 4DE4A 1YW2A 2ZMDA 2W4KA 3NUAA 3C50A 3TUDA 3HL7A 1S9IA 3OWPA 3PXRA 2YACA 2XJ2A 5EI2A 5JZNA 4S30A 5DR6A 4F70A 2UV2A 4E3CA 4O27B 4H58A 3ZH8A 1VYZA 3QTRA 3V5QA 5AUZA 3NX8A 3KK8A 2BDWA 5AA9A 4D55A 3G0EA 3MH1A 1Q8WA 4L01A 3RKBA 1BL6A 2WMRA 4Y85A 1PKGA 3MV5A 4E4XA 3H4JA 1H00A 1UNLA 2UW6A 1UA2A 2X81A 2JIVA 4LGDA 5AP7A 3ZSGA 4B7TA 2X2KA 3F5PA 2WMAA 3R8ZA 5EW8A 2GFCA 2QG5A 5KNJA 2H9VA 2JDOA 5E1SA 1YI6A 4MD9E 1XR1A 3WZUA 2C3JA 2VUWA 4YO6A 5J9LA 3W1FA 2YN8A 3DB6A 4UWCA 5FGKA 4RJ7A 5DNRA 4ARKA 1WBWA 4C4EA 2WIHA 4M97A 5KHXA 5AUTA 3DS6A 3LPBA 2JD5A 1TKIA 2WTJA 3EQBA 4G6LA 3FI8A 4O21A 4DTAA 2VTHA 4FIIA 5E7RA 5AJQA 5BVWA 4YNOA 4NUSA 3O8PA 3SG8A 1IR3A 2R3GA 3A62A 1E1VA 4P5ZA 3OCBA 3V6RA 4DA5A 3MH0A 3V3VA 2DQ7X 5JGAA 3TUCA 3LXLA 3OWJA 4IB0A 5DWRA 1R0EA 3R8UA 3FEGA 3BYOA 3FE3A 5B2LA 2A27A 2C69A 3FLQA 2WMXA 3H9FA 4BTFA 4OT5A 1GAGA 2VWVA 3EQFA 4D2SA 4YJQA 4ZZOA 2CNQA 3W32A 4L7SA 3H0YA 1OL6A 4HW7A 2QNJA 2ZDTA 1DM2A 2IO6A 4QT1A 4C4HA 1PXPA 4MNEA 5J5TA 4R78A 2VTAA 2X8IA 4KNBA 4V01A 4UZDA 3KRRA 5FTQA 1ZOEA 3QXPA 4BCJA 4E6QA 2AC3A 3S95A 2XKEA 3FXZA 2W9ZB 3ACKA 1W8CA 4CZTA 3SD0A 5K5NA 4FEXA 2V7OA 3ZFYA 4UYAA 1WVYA 5JQ5A 5IG1A 3HVCA 4EK8A 4F9CA 2EXCX 3DFCB 5M06A 3LCSA 5EI6A 1DI9A 4RSSA 4DEHA 2BRGA 4KIKB 5BYYA 5AP4A 3GU8A 1JSUA 5HO7A 2C0IA 4FTNA 4FEVA 4GCJA 3U9CA 1OGUA 4G3DA 4W9XA 4HVDA 3D5XA 5L8JA 2BTSA 2FGIA 4QMWA 4BYJA 4IDVA 4ANNA 3Q9YA 1W82A 4TRLA 5ETFA 2C1AA 3C4CA 2VTRA 4IX6A 4P7EA 2GNFA 4YJVA 5HI2A 5TE0A 3C4WA 3QCQA 4MHAA 4OTWA 5HVKA 4G34A 4DFUA 4QO9A 4BYIA 2VTSA 2VN9A 2X7OA 5J95A 4M84A 2IW8A 1W84A 3HUBA 4YR8A 4CLIA 4IEBA 4XX9A 1GZKA 1WFCA 2VV9A 3BU3A 2JKMA 3IECA 4BVUA 3F7WA 3FY0A 2WQOA 1H0VA 3FZRA 4JNWA 4RWKA 3SHEA 3UIUA 3TEIA 3R8MA 1PXIA 1YOMA 3M2WA 5DN3A 3MB6A 4PMMA 3TNIA 1F5QA 3A4PA 3JUHA 3M42A 4IXPA 4GFGA 4LUEA 4JRVA 4QP8A 3DQWA 4RIOA 5AV4A 3BV2A 5HX6A 4MQ2A 3L8XA 2GU8A 3QCYA 4IMYA 3F7ZA 4JG7A 4M7IA 4AGWA 4C33A 3NIZA 5EQPA 4XRLA 3TDWA 3COIA 4XHKB 1QPDA 3F2AA 4B8LA 2QHMA 5M4FA 3HV6A 2QOQA 4J52A 4ZTRA 3W2QA 2F49A 2XH5A 4F65A 3DT1A 2W7XA 4AZFA 4BBMA 5FXRA 2IG7A 5IQBA 5CAVA 3ORZA 4JJRA 1WBNA 3ZRMA 2PULA 3KULB 4JIKA 3ITZA 4IDTA 5CEQA 3HZTA 3ODYX 4EJNA 3QTIA 2WQBA 5ANIA 2WMVA 3UO5A 3BGPA 3Q04A 1ZARA 3BLRA 5E8UA 4BB4A 4BCQA 2VWIA 5K4IA 4RC3A 3P7AA 2HK5A 4JIAA 3P0MA 4RVLA 5EM6A 4JAJA 3FWQA 5J8IA 4LQMA 4BL1A 2ZDUA 5FRIA 2UZLA 2YABA 4E26A 4YBJA 5J9YA 4LRKA 4B9DA 4UZHA 4BDFA 5DYJA 4IAZA 4GIIA 1WMKA 1NY3A 3OT3A 4RFMA 4ZS0A 5AR7A 4S2ZA 5LMKA 4BKYA 3LKMA 1OL7A 4PWNA 2AYPA 5EHOA 5IF1A 5AFVA 4LRMA 4MF0A 3ZXTA 2PVMA 4GG7A 5D7AA 5HIEA 3D5VA 2BKKA 2IVSA 2XP2A 2UZBA 4II5A 4C35A 4E93A 3KRWA 1WVXA 2X7GA 2RGPA 1VR2A 5LCKA 2BZIB 3RAWA 2IPXA 3BKBA 3GBZA 3KKVA 1H4LA 1U5RA 3F3VA 4BTKA 2UZVA 4S31A 3EQCA 4C0TA 2GNLA 2W1EA 3U4WA 1A06A 2BKZA 4I0TA 4GVJA 2C6TA 2R0IA 4HYSA 5CXZA 3MY0A 4PNKA 3D4QA 4TYGA 4GRBA 5LMAA 3NUPA 3HUCA 4EI4A 1H01A 1S9JA 4ZY4A 3LFNA 2A1AB 3VNTA 5AR5A 4BWXA 3ZRLA 3CS9A 4U7ZA 2B9HA 2C6OA 3F6XA 1PXOA 1WZYA 3C4EA 3AXWA 5HGIA 2XNBA 3IDCA 3I1AA 4IX5A 4P4CA 4RPVA 3W2OA 4AP7A 2X0GA 3KRLA 4AT3A 1H0WA 4RMZA 4YJPA 3M11A 5IA0A 2CNUA 3UZTA 3LXKA 4R1YA 1YXUA 5LWNA 2XRUA 1GJOA 2ZB1A 1XHAA 4EH7A 3R8VA 5J9ZA 2FVDA 4FT9A 1IG1A 2H34A 1AD5A 3E88A 4FIFA 3C51A 4JI9A 4WRSA 4O22A 3SOCA 4U0IA 2O2UA 4EH4A 3LLTA 4FKSA 1DAWA 3W10A 4HGTA 3F3UA 4FKVA 3R7IA 3RPRA 4YPDA 5A14A 3OW4A 3ZLYA 4G6NA 3QQGA 3U6IA 3GFWA 3PYYA 5D1JA 2EXMA 4U9AA 1QPEA 1YVJA 3LFCA 5AP5A 3TIYA 4DLJA 3A99A 1M14A 2HELA 2C3IB 3R02A 4G2FA 2UVXA 4F9YA 1XKKA 3EB0A 5E92A 4MWIA 3WILA 4MCVA 4IAFA 1OKWA 1PMVA 2OSCA 4I41A 2OBJA 4PPBA 3SXFA 4ALWA 4KUJA 2YM5A 1F0QA 2EWAA 4WD5A 4L44A 2XYUA 3ANRA 4FICA 4AZWA 3CR0A 2G9XA 3UOLA 2HWPA 5AV0A 5CAUA 4GKHA 3SGCA 2BFYA 3CPCA 3FQSA 4XMOA 5HE3A 4UX9A 3R04A 4A07A 5HG5A 4BCKA 1P4OA 1ZMUA 3P1AA 3UO4A 4BZOA 5CWZA 3WBLA 5DOSA 3U51A 4C4IA 4O83A 2ZV2A 2UUEA 2IVUA 4L00A 4YJTA 4JQEA 5H8EA 5HHWA 4X0MA 5HZNA 3I6UA 5CY3A 5EKOA 5IDPA 1YDSE 4WNMA 1IAJA 2OU7A 4DGNA 1FGIA 5JQ8A 4RQKA 3MESA 3RBWA 5EYKA 2CKQA 3K5UA 4L67A 5AUUA 3VQUA 3PJ1A 3PZEA 4Y5QA 5GJFA 2XK7A 3VBYA 1FGKA 5CF6A 1OUYA 4IAKA 1SNXA 3AC8A 3ELJA 3FZPA 3L8PA 3ZUUA 4WRGA 4HCTA 4RJ4A 3DQXA 3Q5ZA 4RG0A 2WTVA 4DITA 4E73A 1OZ1A 2XK9A 4JOAA 3IPHA 4FTLA 4RVTA 2BHEA 4OBPA 2IWIA 3TV7A 2VTNA 4UALA 2IVVA 3G6HA 4GJ3A 3PXFA 5K3YA 5KKRC 1REJA 5M56A 4GJ2A 2DYLA 3KK9A 3DNEA 3VF9A 1P4FA 4QMNA 2WB8A 1G3NA 3AMBA 4WG3A 4EJ7A 3T8OA 2F2UA 5C8NA 2W06A 4J71A 3KFAA 4IE9A 4FV6A 1GZ8A 4W8DA 2PUIA 4EOSA 2YITA 3NRMA 4UXLA 5KBRA 2X8EA 4A4LA 5L6PA 4Q9ZA 3VN9A 3BGQA 2OO8X 4IAYA 4I94A 4XG7A 4O0RA 4L46A 3QGYA 5EH0A 2ITNA 4JXFA 3VBVA 2FSTX 1YOLA 2EVAA 3RTPA 4FZFB 5CI6A 3R9OA 3ZFXA 1O9UA 4UWBA 3AOXA 4DEAA 2JAMA 2PMIA 4QYHA 2BPMA 4BTMA 4J8NA 4U40A 5AR2A 1UKHA 1OITA 2RFDA 5C27A 4R7HA 5JZJA 3ZXZA 3NMUF 2WMUA 2W4OA 5DHJA 3KF4A 3C9WA 4IWOA 3Q4ZA 1R1WA 4P2KA 3UP2A 4OAUC 3UOHA 5KMOA 1CKIA 3FI3A 3I6WA 4QTBA 4QYEA 3UNZA 3ETAA 4LL5A 4XG8A 4ZY6A 3TI1A 2NP8A 5AAFA 2XA4A 1YXXA 4AACA 4UMRA 4RX5A 3ZOSA 2XNMA 2WIPA 2XYNA 3LQ5A 4QOXA 3I7CA 3QHWA 4BDIA 3AMYA 3OXIA 3R00A 4DBNA 4HVHA 4DH3A 4G3EA 4U5JA 3VUKA 2WQMA 3ROCA 3NLBA 4YJSA 5AIKA 5AUXA 3A7IA 3LFSA 2UW7A 2R7BA 2J5FA 3E62A 4WG4A 4AXAA 1WBVA 3OEFX 4D1SA 5CF5A 3BLQA 3TZ9A 4B0GA 4FKWA 5CVGA 2XK6A 2Q0NA 4XYFA 2BCJA 2GS6A 3DAEA 3HDNA 3HRCA 3ORMA 4MNEB 4N70A 4P5QA 5IUGA 5JFVA 3V5PA 4R77A 1YHSA 4S34A 3I79A 2O63A 2Q0BA 4FOCA 3ROYA 4F09A 3I0QA 2FYSA 4FV2A 4O0UA 1H28A 4U3YA 5CI7A 1IEPA 3M1SA 4UV0A 3BBWA 1PY5A 2B7AA 3G9LX 1JKTA 1ERKA 3Q6WA 2VX1A 2BFXA 2X4FA 2R4BA 5HCYA 5D11A 5K0KA 3UTOA 4AW5A 4ZTQA 1SZMA 2QD9A 3U55A 2XNEA 3N51A 2OK1A 4O0VA 5KKRB 3IW5A 3UQCA 2J9MA 4U42A 3TNHA 3ULIA 2QONA 3G5DA 4ENYA 3I81A 3PXYA 3QX4A 5EK7A 3F5XA 4V05A 1UNGA 1FVTA 2BRNA 2Z7SA 3VUHA 3MI9A 3CSVA 4GU6A 1YDRE 2ERZE 2OJGA 4PMTA 4I6FA 5JT2A 5E9EA 4MYGA 5D7VA 4ASXA 4TXCA 3A4OX 1LEZA 5DEWA 3NSZA 5KCVA 3QU0A 3QYWA 4AAAA 4BF2A 5HTBA 4D1ZA 4CCBA 3ZEWA 5EKNA 3RM6A 4BCHA 1Z5MA 3PWYA 2GNHA 3FC2A 3QALE 4JX3A 2BROA 3RCJA 3N4VA 4FKGA 4KINA 5HTIA 2X8DA 4B4LA 5HO8A 5AEPA 3ORIA 3RI1A 3G90X 3HKOA 3O96A 3W2PA 4AWIA 3DCVA 4BCMA 2OIBA 4EHZA 5E8VA 3MS9A 3OWLA 5IUHA 2FSOX 3QQLA 4CKJA 4IB5A 3MW1A 4N6ZA 1LPUA 3DTCA 3RVGA 3BIZA 4JBVA 4NW6A 4X2FA 5HOAA 4A4OA 5IA3A 3BQCA 1PXJA 3UIMA 2V62A 5FTGA 3MFTA 2UW9A 4EOIA 2PMLX 1OIUA 1OM1A 4V0GB 5ANKA 4AE6A 5KE0A 4IZ5A 5A3XA 3FMHA 2QCSA 2YIRA 3OOGA 4EYJA 2O65A 1CKJA 2UZTA 1H25A 2LAVA 1CMKE 3NUSA 2LGCA 4EOPA 4BDEA 3OFMA 3PE2A 2Y4IC 3HX4A 3ZEPA 3OCTA 3R9NA 4CV9A 2IJMA 3PVBA 4BKZA 1A48A 3KULA 4I5CA 2Y6OA 4NM3A 5C01A 4GMYA 4IZYA 4RIYA 1XBAA 3CTJA 4YZCA 3RM7A 4XUFA 2OJIA 3K5VA 3TCPA 4C3PA 3UOJA 5EYCA 1RDQE 5AP1A 3QTUA 1H24A 4LUDA 5F94A 4RX9A 2FH9A 4HPTE 3B8RA 3Q2JA 1NVSA 1IA8A 3DKGA 3A60A 2F57A 3Q4UA 1WCCA 3NZ0A 5I9UA 4M69A 2WHBA 4D2RA 3JPVA 3UVRA 3NVKI 3R6XA 3I5ZA 3QWKA 5HCXA 3OXTA 4OBQA 4ZP5A 2RFSA 5AA8A 2Z7LA 5DI1A 1SVGA 3HMIA 3TKIA 2RSVA 4G16A 3RK9A 3S1HA 5BYLA 5IQAA 2FO0A 2C6IA 3AC2A 4H36A 4ZK5A 3QF9A 5DA3A 4FTKA 2C0TA 4O1OA 1QPCA 3GQLA 4GS6A 2AC5A 5L6WL 3UNKA 3UIBA 5M44A 2I7QA 1QL6A 4FL2A 3AGMA 1U5QA 2XNPA 4I4EA 1Z57A 1ZLTA 1O6YA 5DT4A 5HVYA 3ORLA 4OR5A 2PHKA 3UDBA 3TKUA 2OXYA 3FI4A 3TZ8A 4O2PA 1JAMA 4DG0E 2HENA 3OEZA 4I4FA 5GZ9A 4IWQA 2J5EA 4TL0A 4BN1A 5FEEA 5AX3A 2X6EA 1K9AA 4B99A 4JR7A 2XKFA 3KRJA 3P5KA 5LVMA 3UQFA 2J4ZA 3IG7A 3KMMA 3MY1A 3FLYA 4YTHA 4A9UA 1BX6A 2PVNA 4BKJA 4EZ5A 1V0OA 4DTKA 3SRVA 4CFUA 4I3ZA 5FBOA 1JWHA 5E91A 2CKPA 4YUQA 2XCKA 5CSPA 5CTPA 4QD6A 3UYTA 4FC0A 5ANGA 3ZS5A 4L3LA 3F66A 4Z7GA 3KRXA 2XIKA 4TYEA 2PVFA 3PRFA 4G5PA 4O96A 2HY81 5CASA 4YHFA 4HYUA 4ZTHA 3SXRA 5DFPA 5I9VA 5GZAA 3T9TA 2XCHA 3H30A 4FSNA 3SG9A 4HYIA 3FLSA 3GCVA 4CSVA 4EQMA 3RMFA 4LOPA 1FMKA 5EHYA 4RJ8A 1PXLA 4IX3A 2X7FA 3QUPA 5CAOA 2B52A 3MIAA 3UGCA 1KOAA 4I5PA 1OI9A 3R9HA 3LOKA 1QCFA 2WMBA 3LCTA 4KRCA 4ZAUA 3I4BA 4KSPA 4AZVA 2Y4IB 1BMKA 1SNUA 3QUDA 4IM2A 4G9CA 5I5ZA 1UU3A 3LIJA 4FODA 4IC8A 3D7ZA 3EMGA 3MH2A 4EH8A 4ZMEA 4KKHA 4QP6A 4L52A 5CLPA 3UJGA 3VS2A 3G0FA 4FIHA 4R3CA 4YZBA 1OIRA 3G15A 4E5BA 5KZIA 4C58A 3ATTA 1J1CA 3WF9A 5G1XA 1UU8A 4M15A 3CC6A 4PP9A 3F82A 3NUXA 4ZIMA 3VRZA 4X6RA 4QMUA 3KY2A 5A4CA 2E9VA 1UWHA 3OXZA 3MBLA 3KL8A 3DXQA 4E4NA 4ZTNA 4G3FA 3EZVA 3GXLA 1FPUA 1WAKA 3LFBA 5HD7A 4J95A 4ANLA 3DZQA 4ZSGA 1PXKA 4EEVA 3VS7A 3K3IA 4RWLA 2G15A 5CZIA 5JK3A 1PYXA 4ITHA 2XS0A 4F4PA 5KHWA 3GU6A 3NNVA 5IQGA 3TNPC 4KKGA 5ACBC 3DU8A 4WNPA 4J7BA 4MBJA 4ZXTA 2OI4X 3QZIA 3QRTA 4IH8A 4M12A 1L3RE 4MNFA 5AP0A 5DR2A 5BUJA 1V0BA 4U3ZA 2J0IA 4L7FA 3KMWA 4OBOA 3HA6A 3EYGA 3K2LA 5EFQA 5C03A 2C30A 5AUVA 3PPJA 2IZRA 1KOBA 2JDVA 3BE9A 4XG6A 2WMSA 5EM8A 4EOLA 4CTBA 2QODA 5HE0A 4EKKA 5I3RA 3GC9A 4DFBA 5KZ0A 5CX9A 4D5HA 4ERKA 3ATSA 4LL0A 4HCVA 4MTAA 3EFWA 2C6MA 5E8ZA 1W98A 4BDHA 1Y57A 3F3TA 2QOFA 1KE7A 4ZSLA 1YWNA 3PA4A 3WF8A 2PZIA 1NVQA 3CPBA 3QL8A 5ETIA 3H9RA 4FK3A 5FP5A 2PVYA 2YZLA 2WU7A 2OH4A 4FV7A 3ORNA 4N57A 3G9NA 3T3VA 3NCGA 5A54A 3HV4A 3MVMA 3QQJA 5DVRA 3TKHA 3KCFA 3PXKA 4KBCA 2BUJA 4EOKA 2HY0A 2ERKA 3DKOA 3S2PA 3MA3A 3FKLA 3FLNC 2XIRA 5A4QA 3IOKA 5HESA 4XG3A 3MN3A 2OJFE 3ZU7A 1OPLA 5LMKC 3HEGA 3QD0A 4YBKA 5GJGA 3VS1A 3H9OA 4WIHA 4WBOA 3V5LA 3WZEA 4DAWA 3PSCA 2ZAZA 5AV2A 3TV4A 3OS3A 2OH0E 2NRUA 4YHJA 4FKTA 4XLVA 2QOCA 3FUPA 4QMMA 3ZYAA 3TJDA 4D5KA 3IW8A 5HTCA 4M66A 2W1IA 3TACA 5ANEA 3LJ1A 5A6NA 2XMYA 3HMPA 4I0SA 3BYMA 2UW8A 4I20A 3QZFA 1J91A 5EYMA 4EOJA 3LJ0A 4UMPA 5DRBA 1PMNA 5CEPA 5BVFA 1ZYCA 5BVOA 2W5HA 3O51A 3QBNA 4F7SA 5JSMA 2ITUA 4FVPA 3R7EA 2W1ZA 4CG9A 2XJ1A 4M67A 2GNGA 5EM5A 5HG9A 3DGKA 5EW9A 1YHWA 4H3QA 3OG7A 3R01A 3GC0A 3ZM4A 4A9YA 4Y73A 2R5TA 4QNYA 4ZJIA 4A9SA 3VUTA 3DJ7A 2QI8A 3TT0A 2P4IA 1Y6BA 4FVQA 4G17A 5E1EA 2OGVA 2YIXA 4C3FA 2PMOX 3LXPA 2ESMA 4RVMA 3OTVA 4UWYA 1Z9XA 4UY9A 5B2KA 3UVPA 4ANOA 5M4UA 2YJSA 4FT0A 3DY7A 4FKLA 4FMQA 3IW7A 5IH5A 2RFNA 2EB2A 2OXDA 1M2QA 3EFJA 4CYIA 3O71A 3ZLWA 5CSWA 4BFMA 3GOPA 5GNKA 1OMWA 2ZV7A 3QRKA 3CCNA 1KE8A 2CMWA 2WEVA 1RW8A 4FSUA 4CFFA 5DT3A 3EQPA 2WTIA 5CT0A 3CKXA 3MTFA 4FSRA 3E63A 3PPKA 3AMAA 3BU6A 2WQEA 4IQ6A 4PTCA 4U8ZA 3RALA 5LMBA 3FC1X 5L2IA 1H08A 4MBIA 4FEWA 5BX0A 5IEXA 2YM3A 3TTIA 4ASDA 3WE4A 4LMUA 5AAGA 4I92A 1JOWB 4RRVA 3E8DA 2QLUA 3A61A 3V5TA 3UG2A 4IVAA 4GYIA 2V5QA 1MP8A 4C7TA 3RNIA 5DIAA 4ZLYA 1BI7A 1ZY5A 4IVBA 3GB2A 3DZOA 1FVRA 4AU8A 2FA2A 1AQ1A 4HVSA 1PHKA 3BHTA 2PVJA 4C61A 4HZRA 4DGLC 2VX0A 2UZDA 4N0SA 5DRDA 4XS2A 4RGJA 1OPJA 4Z55A 5GJDA 4EUUA 3FMMA 2ITQA 3E8CA 3PVGA 4KBKA 3SV0A 3VUGA 1B39A 4ANMA 2XBJA 5CU4A 3EN6A 3C4ZA 3SKCA 3FLZA 1ZWSA 2H96A 5DBXA 3P79A 3FSKA 2O0UA 2HCKA 4D2TA 2VTTA 4X7QA 4C4JA 2VWYA 4V0GA 2J51A 2ZM3A 1BKXA 2JDSA 1BUHA 2XKDA 2WELA 4R5SA 5H9BA 1V1KA 3FLWA 4FV5A 3R9DA 4DEGA 4Y5HA 4RX7A 4MKCA 2V22A 3COMA 3P7CA 3O8UA 3OP5A 1Q4LA 2Q83A 1FBNA 3JY9A 2WAJA 4RIYB 3U9NA 3QA8A 3BX5A 4CMOA 3MSSA 3PTGA 4NKSA 5LQFA 2E2BA 3OBJA 4K2RA 2CKEA 3A2CA 3GU4A 3BPRA 3N4UA 3FYJX 2PVHA 3O8TA 3RZBA 3MVJA 3V5JA 4WUAA 4K1BA 4CRLA 4EQUA 3R7UA 4M69B 4AOJA 4JBOA 5L6OA 3AT3A 4XG9A 3MA6A 4PV0A 5LXMA 2VZ6A 3P4KA 3RAIA 3ENHA 2C6KA 2R3RA 3Q32A 3HV5A 3QQFA 3CBLA 4BTJA 4PY1A 3TUBA 1TQIA 2J0LA 2OXXA 3IS5A 4RZVA 2Z02A 2IN6A 3O7LB 2ITYA 4O0YA 5IMXA 5HCZA 3EH9A 5FG8A 1JVPP 4Q5EA 4EH2A 4AGCA 3QC4A 4O7RA 2EU9A 3I5NA 4GFMA 1V0PA 4GSBA 4EH6A 4YO4A 2UVZA 3FZ1A 3LHJA 4IZAA 4FE2A 4RVKA 4D9TA 1J1BA 2BAQA 1OKVA 4O0SA 2PTKA 5TOZA 3TNQB 3DB8A 4WBBB 4PDOA 4BI2A 4G3CA 5LWMA 4BDAA 4RWJA 3FMKA 2R2PA 3D5WA 4DH7A 2X9FA 2IVTA 2OKRA 3A7JA 3EZRA 2OWBA 4NWMA 3PJ8A 3R8PA 5TF9A 4ZEGA 5I9YA 4C2VA 3R0TA 4FV8A 1UVRA 4IM0A 4ONAA 3SRVB 3BHHA 3DBFA 3UPXA 2BVAA 4LG4A 4F7JA 3REPA 4BZNA 3W55A 3BI6A 3SC1A 4FNYA 4NK9A 5HVJA 4QTEA 4DN5A 5BQ0A 5BVDA 2JDRA 1WVWA 3PJ3A 1UWJA 4FV4A 2XNOA 4BGHA 2YIWA 4IB1A 4IANA 2HZIA 4FTUA 4ITIA 5M07A 3F2RA 2JGZA 4PTEA 3L9MA 3CY3A 1ZYDA 1Q8UA 3UVQA 3S0OA 3KXHA 3IW6A 1Q8YA 1REKA 2ZJWA 5F1ZA 4TY1A 5EM7A 1ZOHA 5ETAA 3SX9A 3RPYA 3MJ2A 4DEDA 5I9ZA 3U6JA 5AUYA 4GYGA 3VHKA 5IH6A 5BMMA 3AD6A 3GQIA 3MB7A 4LYNA 4BBFA 4U80A 4Y8DA 2WGJA 1GIJA 3SOAA 3LMIA 2WO6A 4CV8A 4YZNA 4FG8A 2VTMA 1R39A 4FTMA 5KMKA 2YDIA 4JBPA 4JT3A 2CSNA 2OG8A 4K77A 3TM0A 2PZYA 2PVRA 5FWKK 4USFA 2JKOA 3VS3A 4YJOA 5D12A 4BDBA 5AV3A 2YZAA 4OTDA 5HO6A 3RGFA 1YWRA 4FSTA 4F63A 3C4FA 3PJ2A 4J8MA 4BY9E 2ACXA 4YGAA 2YJRA 4GT3A 4ACMA 1PJKA 5B7VA 4EOMA 1BI8A 1K3AA 1YKRA 3D2IA 3LFQA 3O23A 3VIDA 3E7VA 3VWAA 3C0GA 3OW3A 4I22A 3MWUA 4YC3A 2GMXA 4I5HA 4QQ5A 3DAJA 4EOQA 3NR9A 3SDJA 2XKCA 1FMOE 5EOLA 4DEBA 3U54A 4DFZE 3GCQA 2WTWA 3HRFA 4I1ZA 3A7HA 3D94A 4RQVA 3EIDA 4AT5A 4Y72A 4FUYA 2JFMA 5F4NA 3GCPA 4QP3A 5E90A 4D0XA 4JRNA 2XM9A 2XK4A 4K9YA 1RJBA 3HNGA 2C5OA 2WTDA 4XV1A 3SXSA 4XRJA 3VUIA 4ACCA 3II5A 4AW2A 3DOGA 4CFVA 4KS8A 4O91A 4LMNA 3FXWA 4CYJA 3RPSA 2ITVA 3NAXA 3V5WA 4D2PA 3UIXA 1XBCA 4F9WA 2WKMA 4PL4A 5AP3A 4R7IA 3QFVA 2WMQA 4TWCA 3NIEA 3R1NA 5AMNA 4EH5A 4RFZA 3V01A 4L8MA 4DCEA 3NUYA 2JBPA 5J7HA 2F9GA 3WF6A 5E8TA 3FXXA 1FOTA 4WT6A 1H1RA 3NYNA 2ITZA 1YXSA 5G6VA 2ITOA 2CGUA 4CKRA 4OTFA 3PP0A 3UC4A 4E6DA 2WD1A 4IAIA 3KU2A 3OBGA 2QLQA 3TXOA 5J7BA 5AR8A 4D4YA 2OW3A 3DXPA 1HCLA 4DYMA 3QA0A 5JKGA 4E20A 4FKJA 3BZ3A 4HNIA 3RWPA 3LCDA 4W8EA 3MFSA 1YI3A 4F1OA 3RJCA 1W7HA 3PE1A 2UW5A 1P14A 3BEGA 1M52A 2PE0A 2R7IA 5GIPE 2SRCA 1MRVA 4GH2A 4JS8A 2EUFB 4KIPA 3D5UA 3VF8A 2R3QA 2YEXA 3BHYA 4XV9A 5DE2A 3POZA 4DGOA 2J0JA 3P23A 5FXSA 4EH9A 4FYNA 2VGOA 3ZO2A 4EWHA 4FZAB 4O0WA 4WO5A 2C6EA 2XUUA 3O17A 4XJ0A 3KREA 3C5UA 1Y6AA 3R30A 3PIYA 4F0FA 1J7LA 4O86A 3WF5A 2OZOA 4FIEA 4QNAA 1U54A 3OWKA 1JSTA 4C02A 3QRJA 2XK3A 2C0OA 3CQUA 3KGAA 3DLSA 4L9IA 4QP7A 5FM3A 4M0YA 1JLUE 4H3BA 3LCOA 4O6LA 3BHUA 4PX6A 3AD5A 4QMQA 4EK5A 3SW7A 4KS7A 2Y8OA 2NRYA 1YXVA 3FI2A 3N9XA 3D83A 4MX9A 4ID7A 2ETMA 4QMOA 3Q9WA 4PRJA 3FPMA 4X6QC 3DTWA 4H3PA 4ERWA 3SQQA 3QZGA 3ID6C 4IACA 2HZ4A 1OIYA 2R3JA 4CQGA 3ZO4A 4GT4A 4PQNA 4JG8A 3Q53A 1JQHA 2ITTA 3MTLA 4Z9LA 5C9CA 5HIBA 4QMPA 4FT7A 3LXNA 3OY3A 2B4SB 2G01A 4O6EA 3V51A 3GCUA 3BU5A 4L43A 4U41A 3R28A 3U8WA 3IW4A 3EL8A 1QPJA 1YOJA 4DC2A 4YJRA 3NYXA 5JGDA 4AW0A 3HMMA 1KE9A 4KIOA 2IW6A 2XK8A 2W1GA 3ZHPC 4QPSA 4PNIA 4EHEA 2WOUA 4AA5A 2PZRA 3G2FA 2W4JA 3PG1A 4M68A 4MD7E 2PZPA 3ZM9A 1Y8GA 3RAHA 5JFSA 4DTBA 2V0DA 5HE1A 4B8MA 5CEMA 2WFYA 3Q9XA 3LFFA 5B2MA 2GNIA 2R3PA 4MQ1A 3UMWA 2R0UA 2GTNA 4OTIA 2G2HA 3W33A 4QMSA 3FZTA 4YP8A 5J5SA 4MXCA 4CFXA 3AGLA 4GW8A 4BIBA 4AN9A 5IA1A 4W4VA 3UZPA 2O64A 5GIOE 2OIDA 2PUNA 3ET7A 3PLSA 3H3CA 4GG5A 5BVKA 4Z16A 4YJNA 2PL0A 4FV9A 5HU3A 3GEQA 1OVEA 1WBOA 5DGZA 4ACHA 4TW9A 2BDFA 3IKAA 4Q5HA 3TWJA 4UB7A 4TWOA 4QMVA 3MDYA 2RIOA 3DK3A 5H8GA 3ULZA 1XH4A 4E5AX 1Y91A 4GV1A 2PZ5A 1P2AA 3EOCA 4Y95A 3U6HA 1R0PA 4QMTA 1B6CB 4EZ7A 2W05A 5TO8A 2C5YA 2XNGA 4KBAA 3FMEA 3TNWA 2C4GA 4UXQA 3DXNA 3Q60A 5A9UA 5FBNC 2I0HA 2JDTA 4TN6A 3R9RA 2IZSA 3GFEA 2XB7A 1NA7A 3E3BX 2O3PA 4HNFA 5BUIA 3O2MA 5FXQA 4BC6A 3OROA 4O7NA 3R73A 3GGFA 1GY3A 1FVVA 3WOWA 2PMNX 3K3JA 5DH3A 4IVDA 2YIQA 3PIZA 2P0CA 5JFWA 3NS9A 2CLQA 4FL1A 1X8BA 3JYAA 3OD6X 4OW8A 3RPOA 3ZFMA 5A4TA 2GQRA 3UYSA 1PYEA 4F9BA 4UBAA 4ZMFA 3MYGA 3QYZA 1E1XA 2QHNA 4YLKA 4FV1A 2QURA 4NJDA 5BVEA 3ZZEA 4XBUA 4BI1A 1XO2B 4YSJA 5T68A 3UOKA 4ENXA 1YXTA 3DKFA 3KQ7A 1Q3DA 4UMQA 3T3UA 3GP0A 5HICA 3V8SA 2CGXA 3DA6A 4H05A 3RINA 1VYWA 3BLHA 1M17A 3U4UA 1H1WA 4KKEA 4QTDA 2Z7QA 2QR7A 4NFNA 4X2GA 5M53A 4JDKA 2YWVA 3L9PA 3D15A 1RQQA 4O84A 2NNWB 4NIFA 1P5EA 4DEIA 2QO7A 4BIEA 1OPKA 2VD5A 3FKOA 4EONA 2RL5A 2ZMCA 1Q24A 3QD2B 2BMCA 3QTSA 3HAMA 1OIQA 4FV3A 3W8QA 4ANSA 2FB8A 4BCIA 4E6AA 5FUTA 3PY0A 3UZRA 4CMTA 4IHPA 3GU7A 4JQ7A 4DT9A 1TQPA 2C47A 4O7ZA 2VO6A 5I0BA 2ITXA 4FNXA 3TV6A 3ZTXA 3ODZX 4UEUA 2ITPA 1BLXA 3U87A 4TYHA 5EDRA 2QR8A 4BHNA 2VX3A 3PXZA 3ACJA 3DBDA 3DPKA 3QCXA 3ORKA 4DLIA 1BYGA 1U59A 3D9VA 4IM3A 3FMJA 5FDXA 2NO3A 3VS0A 5L8LA 3FJQE 2ITWA 4PL5A 3R63A 4XCUA 4XNEA 4BCNA 3BELA 4J99A 5IQDA 2YHVA 2WZJA 5HG8A 3PDTA 3MY5A 3SAYA 1T45A 4PDYA 4IVCA 1MUOA 4FF8A 1XBBA 2VWXA 4X2JA 3NWWA 3SW4A 4X2KA 2OFUA 3ANQA 3PIXA 3LM5A 2X2LA 1GIHA 4JDHA 2Y4PA 3LQ3A 5AP2A 2RF9A 4FSWA 2Z2WA 1OL2A 4FBXA 1M7NA 3D14A 4YJUA 2HW6A 3A7GA 3NYOA 4M13A 4CFWA 5C4KA 4KAOA 5DR9A 2GPHA 2OF4A 4CGAA 4J53A 5B0XA 4FZ7A 2BIKB 4J96A 3C0HA 4KWPA 2W9FB 4C57A 2XEYA 2VO7A 4AF3A 2YWPA 3VJOA 4J97A 3E92A 2WPAA 2UZUE 1U46A 3ZLSA 4D9UA 5EW3A 5HNIX 2WMTA 4AS0A 3PVUA 3ZUTA 4F0GA 3EFLA 3QC9A 2QOLA 2DWBA 4PL3A 1JKSA 5H3QA 4FR4A 4K33A 4QP4A 5JGBA 4FT5A 1LR4A 3CE3A 4BCGA 2YAAA 3VBWA 2BAKA 2R3MA 3JR1A 3GNIB 3JVSA 3EN9A 4GIHA 2PWLA 4GL9A 4HGSA 2YCSA 2E9NA 3BWFA 4ASZA 4FKIA 1UU9A 1Q97A 3LQ8A 3ZMMA 5CF4A 3H0ZA 3QWJA 2E9OA 4YZDA 5HBJA 3E7OA 2VWWA 2WTKC 3DDPA 3EN5A 4AE9A 4CNHA 4CZYB 4DG3E 2UW0A 2V55A 4DH1A 1GNGA 1Q62A 2PK9A 4FZ6A 5ETCA 5I3OA 3RZFA 3R22A 2C3KA 3KXMA 4OTHA 3KVWA 3DBCA 4AOIA 4FX3A 4ORKA 2XF0A
chains in the Genus database with same CATH superfamily
1R3CA 3FZSA 3I7BA 2X4ZA 4D2VA 4D4SA 3GT8A 4U44A 2YM4A 4HCUA 4AZEA 5EOBA 4OTRA 3BL7A 4O4CA 5M51A 3PWDA 5CNNA 2F7ZE 1IRKA 5IUIA 3RK7A 3UE4A 4O81A 3VC4A 2J90A 4AA0A 4FNWA 4XP2A 1URCA 3S4QA 2F2CB 4UYNA 1G8SA 2QOHA 2BZKB 2VTOA 3EN4A 1XH9A 3E8EA 3ENMA 4MWHA 4NFMA 5AAEA 1J7UA 3ZC6A 2X9EA 2HW7A 4LRJA 4OGRA 1OKZA 3CIKA 3DLZA 4NTSA 5LVOA 2WOTA 4D4VA 4BCPA 5LVNA 3KF7A 3NAYA 4CCUA 4TWPA 1M2PA 2VTPA 3NVMB 2ZVAA 2BHHA 4O2ZA 4R3RA 4QMXA 4F7NA 5LOHA 4QYYA 4TYIA 3AT4A 2BAJA 3PA3A 4DFXE 4DG2E 4GK2A 4NYEA 2QO2A 3CP9A 1OL5A 3D2KA 4CQEA 5IQIA 3ZBXA 4ALUA 4YC8A 5EDPA 4MH7A 3FBVA 4RZWA 4BHZA 2W17A 3BBTB 4H39A 4QDVA 4TWNA 3HLLA 2W5BA 4L53A 5E4HA 4FK6A 2JKKA 3JY0A 1SM2A 1YQJA 3R7GA 2X1NA 4QEBA 3B2WA 3BQRA 4XBRA 4CMUA 4E4LA 5ICPA 4AZTA 3HMNA 4RC2A 3UNJA 2C1BA 2QOBA 2X0QA 3HYHA 3GCSA 5JRSA 3ZZWA 4WHZA 3QZHA 4JG6A 1EH4A 3GENA 3SA0A 2X0PA 3IDBA 3PG3A 2CLXA 3RHXA 3B2TA 2ZB0A 4ZTMA 4R7BA 1U54B 4ZSAA 2XVDA 2CN8A 3E5AA 4K6ZA 2CDZA 2H8HA 1GOLA 2B9JA 2HXQA 4DGGA 5IKWA 5A46A 3Q4CA 5CXHA 5FEQA 2DS1A 4NJ3A 4C4FA 5D10A 5CSVA 1YHVA 1BL7A 2CPKE 3FL4A 5H8BA 4HGEA 1QMZA 1XH6A 4MXYA 5CVFA 2V7AA 2VWBA 5CEOA 3ZDUA 5BYZA 3OCSA 2WTKB 2VAGA 1Q3WA 4QTCA 4DEEA 4ZTSA 2JKQA 2Z60A 2CCHA 2GQGA 4FSZA 4EORA 1Y8YA 2B9FA 3UPZA 3CD8A 1I09A 1Q61A 2WTCA 3DFAA 3L1SA 3E8NA 3L9NA 2Z8CA 3PVWA 4G1WA 4R6VA 3VUMA 4ZLZA 3KXZA 4OAVB 2AUHA 4TNDA 5HE2A 3ZUVA 1OBGA 3R7YA 4IWPA 4OT6A 5KMLA 4ZZNA 3EJ1A 5EI8A 2VO0A 4RLKA 4D2WA 3DJ6A 5AM6A 3PA5A 4QMZA 3R2YA 4LGHA 4AGDA 5HG7A 4FI1A 5IEYA 4I6HA 1JPAA 5FM2A 4C59A 2R64A 5ANDA 4PDPA 5DMZA 4C62A 5KMJA 3VW8A 1ZYLA 1ZYSA 3W2RA 2VTQA 3QQUA 2PY3A 3UBDA 1VZOA 4ZY5A 4YNEA 4RLLA 3C7QA 3P7BA 4BIDA 5KMMA 3QD3A 2HZ0A 3ZRKA 4AN3A 2PE2A 2YAKA 2R3OA 2F7XE 3CY2A 3KMUA 4DHFA 4E6CA 4EKLA 3AQVA 3RHKA 4JAIA 3CQWA 4FV0A 4FUXA 4EK3A 3DK6A 3ML1A 2OIQA 2RG6A 4A7CA 4RX8A 4IJ9A 3TDVA 4GVAA 4E1ZA 2BR1A 2C6DA 5HLNA 5JH6A 4FKUA 1K2PA 2YDJA 4QPAA 4W4XA 3VUDA 4CD0A 2GQSA 3QHRA 3MH3A 4FT3A 1STCE 5HNGA 4ALVA 5CEIA 2W1HA 3LJ2A 4JDJA 1XH5A 2DUVA 2WXVA 4W4WA 3LM0A 5H2UA 2UZWE 3G51A 3RWQA 1M2RA 3PJCA 2HIWA 3HP5A 4TPTA 4AGUA 3LE6A 4MXXA 3EN7A 5I9WA 1ST4A 1H26A 4XG4A 4RA4A 3DBEA 3KXGA 3MIYA 3TIZA 5EQEA 5CALA 3NNUA 4ASEA 1IASA 1YDTE 3COKA 3FQEA 1YI4A 3SLSA 1G5SA 3FAAA 2WNTA 4HJOA 4I23A 4MEDA 1UKIA 5FD2A 4EWQA 1JNKA 2JITA 4EK6A 5CEKA 5K0XA 4EOOA 2R3FA 2XIZA 3BE2A 3EL7A 4UMTA 2P3GX 5ANOA 1Q41A 1WBPA 4FSQA 4WKQA 4ACDA 3QTXA 3IQ7A 4IB3A 2UZOA 3EQHA 4KB8A 2O5KA 4USEA 5AIRA 1SYKA 4EBWA 4F64A 3S00A 4AA4A 4PMPA 1YWVA 2VO3A 3ERKA 4YU2A 2IZUA 3BCEA 3CGFA 3W2CA 4EUTA 3O7LD 3VS6A 5AX9A 5CF8A 2F7EE 5AADA 5LJJA 2PYWA 3HDMA 3IONA 3P9JA 3OF0A 5EHLA 3LZBA 3LMHA 3VVHA 4XV2A 3AC1A 3MPTA 5T3QA 2IF8A 3KCKA 4U81A 3EYHA 5I9XA 4GK3A 4XG2A 3PY3A 3R2BA 3WIKA 2CNVA 2P55A 3F3ZA 1TZDA 3KXXA 1GZNA 3PRIA 4EBVA 4JMQA 3EWHA 5HORA 1OECA 5HKMA 3WYXA 3PSDA 1J3HA 3ZO1A 1ZZ2A 4PPCA 5E8WA 3OUNB 4NW5A 1ZYJA 4Z7HA 4JVGA 4I0RA 3NYVA 4V04A 5FLFA 4C3RA 4C8BA 4XP3A 2YERA 3W2SA 5HD4A 2HZNA 4NIFB 2B0QA 4PPAA 2QU5A 3OY1A 5F95A 3IOPA 4U43A 4YURA 3OVVA 4QP9A 4O7WA 2H6DA 4F1TA 4PUZA 2HYYA 2XJ0A 2W99B 2X39A 5CT7A 3T9IA 5LCJA 3R21A 4DFNA 3PFQA 4TYJA 4I6LA 4EC9A 4J98A 4DBXA 4FTAA 1NT2A 3NW5A 3BV3A 4I21A 4JQ8A 3R7VA 3A8XA 4FSMA 3UMXA 4WSQA 4TYHB 2QOOA 3QKKA 4JX7A 2X6DA 4NT4A 4O38A 4AG8A 5KMIA 4ZSEA 4BJJA 4ZTLA 1PMUA 4RFYA 5BUEA 3QAME 5AWMA 3F88A 4BWPA 4R5YA 2QKRA 4BCOA 3NPCA 1LP4A 3AD4A 4K0YA 4M0ZA 2XIXA 4UMUA 2B1PA 2GHMA 2ZYBA 4LV5A 2W5AA 3ZLXA 2NYAA 4O7VA 1MRUA 3FDNA 4GEOA 2JLDA 3ZO3A 4U6RA 2BZJA 4N6YA 2BRBA 2Y6MA 1UNHA 3LAUA 4KSQA 4QYFA 1ZMWA 2YCRA 4GUBA 2PUUA 2PVKA 2Y0AA 4OTPA 2KULA 5FTOA 1OGYA 5CAQA 3TN8A 2IW9A 3FYKX 3ORPA 3E93A 4RIXB 2PE1A 2OF2A 4UN0C 3IGOA 1ZXEA 5CU0A 4K11A 2CGVA 2A2AA 1XH8A 1VEBA 4FTRA 2WU6A 4L3JA 4WOVA 2G2FA 5TT7A 5KX8A 3N4TA 4C38A 3KN6A 4TNBA 4W4YA 3ZSHA 5KMNA 4LI5A 4OTQA 2XNNA 4TZRA 4R8QA 4DH8A 2C68A 3CJGA 5C8MA 3FSFA 3OCGA 3R1YA 2QKWB 3R1SA 1AGWA 3Q5IA 4DH5A 3OTUA 4PMSA 4U97A 4D58A 2NPQA 3OHTA 4IWDA 3ZONA 4F6SA 4D0WA 5IA5A 4FKRA 4CKIA 2P2HA 2P33A 4L68A 5F20A 1IAHA 4BDDA 2YIYA 3BWJA 2RFEA 3JXWA 4NZWB 2UZNA 3A7FA 4O0XA 3AC3A 2C6LA 3C0IA 2JIUA 3F5UA 1HOWA 4RIWA 4M14A 1DAYA 5ACKA 4QMYA 4AT4A 4EH3A 4QP1A 4PTGA 4FTCA 3GI3A 4AFJA 2A19B 2CCIA 4E8AA 4YSMA 4NCTA 3OMVA 4F7LA 5HEZA 2HAKA 4A9RA 5HQ0A 2IEWA 3CD3A 3MFUA 3KA0A 4FEUA 3S3IA 4F0IA 5E8SA 2GSFA 3HAVA 4FKQA 3PP1A 4X3FA 5M4IA 1OBDA 5FQDC 4BDJA 4DFLA 2B53A 3W18A 2ZOQA 2VWUA 5AR4A 3JS2A 5CENA 4B6LA 4ANBA 3R8LA 3TG1A 4IADA 4RBLA 4NH1A 3Q96A 3D7TB 4HZSA 4AUAA 3LW0A 3TTJA 1A9UA 2I40A 3FHRA 3QLFA 5ANJA 3VRYA 1TQMA 4K18A 5K5XA 3CTQA 5M09A 3BYVA 5AV1A 3ZC5A 1LUFA 2QQ7A 3A8WA 4S33A 3KB7A 4C4GA 2F4JA 3D0EA 3C1XA 3NGAA 5CVHA 3DNDA 3HECA 4FZDB 4L42A 4QTAA 4DINA 2PPQA 3CKWA 3LLAA 1UV5A 3FMDA 4NM0A 3W0RA 3DDQA 4BDCA 4I6QA 2QG7A 4RWIA 2YLFA 4MK0A 1VJYA 4IC7A 3QCSA 4O1PA 3WZKA 1Q99A 3ZSIA 1H07A 5J1VA 3BYSA 2R3KA 2W1FA 4MXOA 4AN2A 1NW1A 4O7TA 2JEDA 1ZZLA 4IBMA 2YA9A 2IZTA 3GUBA 4FTJA 2UVYA 3QUEA 4I24A 4Z3VA 2PVLA 4Q9SA 2YISA 1JKKA 4R1VA 3P08A 1U4DA 4FEQA 1KWPA 2JAVA 2P2IA 4ZLOA 3NEWA 3AG9A 5C1QB 5IA4A 5C8KA 4FIGA 4K8AA 3NDMA 3NCZA 1CM8A 3FHIA 2ZV8A 2OZAA 3F61A 4FTOA 3RCDA 3WARA 5M08A 3KIOC 4MD8E 1Q8ZA 1B38A 3DBQA 2GTMA 1JKLA 1SVEA 4USDA 3L8SA 5JEBA 4KABA 4EYMA 4EK4A 1W2FA 1MQBA 4QQJA 3PY1A 5J1WA 1T46A 4YTCA 3F69A 5JRQA 2GHLA 2JBOA 5L2QA 4QQTA 4A06A 2YLEA 3QTZA 4NSTA 3TL8A 4YZMA 5BNJA 4YTIA 4ZJJA 3LMGA 2W96B 5HIDA 1PF8A 4BBEA 2GS2A 3RPVA 4CT2A 3PXQA 2B55A 2J7TA 5HBEA 5AM7A 3COHA 3W8LA 2YFXA 5FEDA 4KRDA 2XBAA 4RC4A 1UU7A 1CKPA 4NKAA 3LFDA 3WF7A 4LM5A 4G31A 3WI6A 4JDIA 4DHIB 2B54A 3AC5A 4BI0A 4QPMA 5HLWA 3F2NA 2ZFYA 3BGZA 1WBTA 3BLAA 4FTTA 4RA5A 5HNBA 5KBQA 4M8TA 3Q4TA 3Q6UA 1OUKA 5GHVA 3QRUA 3KVXA 2VTIA 3QLGA 2FSMX 4FYOA 4XH6A 3UP7A 4LV8A 2BIYA 2BZHB 4IJPA 2G2IA 3TZMA 4A4XA 4D4RA 2JFLA 5IQEA 1O6LA 2UZEA 5IEVA 3FMLA 3ZDIA 4RT7A 5BPYA 1PRYA 4IAAA 5L2WA 4S32A 5CQWA 4CRSA 3EKNA 2EXEA 2PU8A 5JN2A 3HP2A 3VBTA 5D41A 3RNYA 3FKNA 3ALOA 3LFEA 4D1XA 4KD1A 5ITAA 3G33A 4EHGA 3MFRA 2HWOA 3CJFA 3DV3A 2A0CX 2FSLX 3EQGA 4E7WA 3UQGA 2E9PA 1L8TA 5CU3A 1PW2A 5IMEA 5CAPA 3H10A 2ONLA 1ZAOA 2J2IB 1O6KA 3Q9ZA 1I44A 3R1QA 2QOKA 4XLIA 4ZZMA 2WQNA 3AKLA 3C13A 4YZ9A 4FVRA 4W9WA 4RJ5A 4YTFA 3LCKA 3MVLA 1TVOA 3I60A 2I1MA 3FY2A 3IDPA 4CG8A 4F1MA 2QOIA 2I0YA 2EB3A 3F5GA 5I4NA 3VAPA 4CXAA 4YLJA 1KE5A 5LVLA 4CFMA 1KUTA 5L3AA 4LOOA 4DCAA 1OL1A 2VTJA 4RJ3A 2X2MA 4WSYA 4BRXA 4GU9A 3CGOA 3MVHA 4FGRA 3BYUA 4YPSA 5T6KA 4EQCA 4X21A 3IO7A 5CS6A 2HXLA 3QGWA 4HVGA 5K9IA 5A4LA 3KC3A 3GC7A 3QQKA 3Q2MA 1FINA 2PSQA 3VJNA 2ETRA 4F9AA 3VQHA 4TTHB 5CANA 3PUPA 1FQ1B 3QKMA 3R71A 3NUUA 4IFGA 1SMHA 5F9EA 3WE8A 4D28A 4HVIA 1KSWA 4KIKA 1M7QA 3E3PA 4BCFA 4FG9A 3VS4A 4APPA 1XH7A 4I6BA 4I5MA 3QX2A 3R83A 2PUPA 1ZRZA 2QC6A 1DI8A 3DJ5A 3GC8A 5KO1A 1G8AA 2VNYA 2I0VA 5CZHA 2VNWA 4JR3A 4WNOA 4BZDA 3FMNA 3V04A 2C5VA 2YCQA 3QTWA 1H1SA 3E64A 2VU3A 3QRIA 3CTHA 4BWKA 4FL3A 5CU6A 1J7IA 2O8YA 3HMOA 3LVPA 3GOKA 3VS5A 2W1CA 4G9RA 4J1RA 4YC6A 5TR6A 3F3WA 3WZJA 1TFFA 3KEXA 3C4XA 4L3PA 4OLIA 5CYIA 1ZOGA 3EQDA 3KN5A 5BMSA 5HU9A 5CU2A 2BILB 1KE6A 2B9IA 2XRWA 4X2NA 3RAKA 4CVAA 4AQCA 1DS5A 3VULA 5K4JA 3O0GA 4QQCA 2QVSE 4MAOA 2GHGA 2W1DA 4BICA 4BGQA 1H8FA 2I6LA 2RKUA 2VRXA 1APME 5IQCA 3GVUA 3ZCLA 4QMLA 4YHTA 5IDNA 5L2SA 3OOMA 4CT1A 2GFSA 3MPMA 3Q3BA 3ORXA 5E8YA 4JL9A 4N4SA 3QD4A 5CSHA 5AR3A 5EYDA 4BDGA 2GS7A 3QKLA 4TT7A 2X0OA 4Y83A 5DPVA 2XZSA 5AP6A 4AX8A 4EC8A 3PZHA 3VHEA 4O7YA 3CLYA 2R3HA 4NCTC 5L8KA 4FIJA 5GINE 3HGKA 2J50A 4GKIA 4LGGA 5C4LA 3CXWA 5M4CA 4XOZA 4E5WA 5HX8A 3EFKA 5IA2A 1XJDA 2XIYA 5IU2A 4KA3A 1PXMA 3HRBA 3LFAA 4FKOA 4X3FC 5JFXA 4DFYA 1XWSA 5LVPA 1W2CA 3HV3A 3MGYA 3UC3A 4PP7A 4DHZA 2WMWA 2CGWA 4NU1A 5LARA 1LEWA 5IPJA 2YDKA 3L9LA 5GZ8A 2QO9A 5E8XA 3W16A 5IISA 3P86A 4R3PA 4GT5A 2OJ9A 4AOTA 1RE8A 3OC1A 4IX4A 3PSBA 4KIQA 4BJJB 2I0EA 2VTLA 3O50A 4O82A 4CZUA 1H1QA 1MQ4A 2CHLA 4FTIA 3RP9A 1JBPE 4OUCA 2XEZA 3V8TA 2C5NA 2OICA 1PXNA 3DKCA 3R7OA 4HPUE 5EG3A 2E9UA 3BL9A 5L4QA 4M3QA 2ZM4A 4I93A 4G5JA 4PF4A 1NVRA 2W0JA 4XV3A 1ZY4A 1IA9A 5FDPA 1GIIA 2C3LA 4GK4A 2OJJA 5HLPA 4BGGA 4F08A 5EDQA 4NM7A 3VBXA 4U79A 5L2TA 4AFEA 3EHAA 1GZOA 4MF1A 4XOYA 5IH4A 2R9SA 2ETKA 3V8WA 4MXZA 4IW0A 3DK7A 3FL5A 4JLCA 5A4EA 2JIIA 5J87A 3ORTA 4HYHA 4PDSA 3MJ1A 4DT8A 2BRHA 2CN5A 4ZSJA 4GFOA 2JC6A 4FNZA 3OT8A 3QQHA 4RIXA 1ZMVA 2R3NA 4F99A 3L8VA 2YCFA 2VGPA 2OFVA 4AW1A 5JMSA 5IQFA 4H1JA 2J0MB 3CQEA 3TZ7A 4A9TA 3PLAE 4C34A 4IZ7A 2GNJA 5TKDA 3JVRA 3BEAA 3FV8A 3V6SA 2UW4A 2G1TA 4ITJA 5M57A 1ND4A 4FGBA 2Y7JA 3PPZA 4GUEA 5CQUA 4YMJA 2FUMA 4XEYA 3NW6A 4AZSA 4WG5A 1Q5KA 2REIA 3FPQA 4LFIA 2R3LA 4BDKA 1OKYA 2CKOA 2BALA 2CJMA 5FP6A 1CTPE 1E9HA 4FSYA 3AC4A 4RIWB 3UO6A 3ALNA 3EQIA 2J6MA 4H1MA 3IGGA 4WA9A 4YLLA 2UW3A 3F9NA 4L6QA 1MRYA 1Q8TA 1URWA 3GU5A 5DLSA 4XP0A 3K54A 3ZBFA 3AT2A 4CLJA 1KV2A 4Y46A 2RG5A 4BR3A 2GCDA 4ACGA 2KTYA 3EKKA 4FKPA 2C5XA 3C5IA 3NNWA 4QP2A 3CEKA 4X3FB 5DG5A 4NEUA 3Q52A 4HOKA 5KUPA 1PMEA 3B8QA 1ATPE 2ZM1A 4CTCA 3BHVA 3FZOA 4O7SA 2QU6A 4O7LA 5EQYA 3RK5A 3KXNA 5BVNA 4FOBA 4Q2AA 4DF3A 4U45A 3WZDA 4WNKA 2Z7RA 1HCKA 5IQHA 5IZFA 4OTGA 3THBA 1F3MC 4ZS4A 3VW6A 3WYYA 4CFNA 3QTQA 1SVHA 3D7TA 5A6OA 3NW7A 2HOGA 1NXKA 4CEGA 1W83A 2ZV9A 3QXOA 4O0TA 4FG7A 3VO3A 4X3JA 1W0XC 3BRBA 1KV1A 4DGMA 3MPAA 2BDJA 2ONLC 4IFCA 4EZ3A 4ZOGA 4IIRA 4L45A 3P78A 5DEYA 4MXAA 1XQZA 4G3GA 4NL0A 3OZ6A 2A4LA 2YM7A 4EHVA 4C36A 3G6GA 2BTRA 3UG1A 3WIGA 3EQRA 4QRCA 1H27A 3HA8A 4HGLA 4C37A 1CSNA 2J0KA 4ZJVA 5M55A 5AUWA 4NTTA 2GDOA 2VWZA 3FQHA 4F6UA 3NNXA 4G6OA 4RJ6A 1OB3A 4EL9A 2OZAB 3OUKA 3POOA 3TJCA 4C2WA 4O4FA 4JBQA 5C26A 1PKDA 2OLCA 1YRPA 2YM6A 3NUNA 4TKSA 1CDKA 5CSXA 4FA2A 4FTQA 3IK3A 3I0OA 3HV7A 4F6WA 2WEIA 2Y9QA 1WBSA 5DT0A 4LOQA 3UODA 2BRMA 4MVFA 4ANQA 5HBHA 5J79A 4O4BB 5CNOA 4E4MA 4APCA 1H1PA 3SVVA 4WUNA 1JSVA 4NM5A 4QYGA 2YM8A 4P90A 5D9HA 2XM8A 4MBLA 3DAKA 3E87A 3VBQA 1R78A 2R3IA 4DE4A 1YW2A 2ZMDA 2W4KA 3NUAA 3C50A 3TUDA 3HL7A 1S9IA 3OWPA 3PXRA 2YACA 2XJ2A 5EI2A 5JZNA 4S30A 5DR6A 4F70A 2UV2A 4E3CA 4O27B 4H58A 3ZH8A 1VYZA 3QTRA 3V5QA 5AUZA 3NX8A 3KK8A 2XAMA 2BDWA 5AA9A 4D55A 3G0EA 3MH1A 1Q8WA 4L01A 3RKBA 1BL6A 2WMRA 4Y85A 1PKGA 3MV5A 4E4XA 3H4JA 1H00A 1UNLA 2UW6A 1UA2A 2X81A 2JIVA 4LGDA 5AP7A 3ZSGA 4B7TA 2X2KA 3F5PA 2WMAA 3R8ZA 5EW8A 2GFCA 2QG5A 5KNJA 2H9VA 2JDOA 5E1SA 1YI6A 4MD9E 1XR1A 3WZUA 2C3JA 2VUWA 4YO6A 5J9LA 3W1FA 2YN8A 3DB6A 4UWCA 5FGKA 4RJ7A 5DNRA 4ARKA 1WBWA 4C4EA 2WIHA 4M97A 5KHXA 5AUTA 3DS6A 3LPBA 2JD5A 1TKIA 2WTJA 3EQBA 4G6LA 3FI8A 4O21A 4DTAA 2VTHA 4FIIA 5E7RA 5AJQA 5BVWA 4YNOA 4NUSA 3O8PA 3SG8A 1IR3A 2R3GA 3A62A 1E1VA 4P5ZA 3OCBA 3V6RA 4DA5A 3MH0A 3V3VA 2DQ7X 5JGAA 3TUCA 3LXLA 3OWJA 4IB0A 5DWRA 1R0EA 3R8UA 3FEGA 3BYOA 3FE3A 5B2LA 2A27A 2C69A 3FLQA 2WMXA 3H9FA 4BTFA 4OT5A 1GAGA 2VWVA 3EQFA 4D2SA 4YJQA 4ZZOA 2CNQA 3W32A 4L7SA 3H0YA 1OL6A 4HW7A 2QNJA 2ZDTA 1DM2A 2IO6A 4QT1A 4C4HA 1PXPA 4MNEA 5J5TA 4R78A 2VTAA 2X8IA 4KNBA 4V01A 4UZDA 3KRRA 5FTQA 1ZOEA 3QXPA 4BCJA 4E6QA 4MUQA 2AC3A 3S95A 2XKEA 3FXZA 2W9ZB 3ACKA 1W8CA 4CZTA 3SD0A 5K5NA 4FEXA 2V7OA 3ZFYA 4UYAA 1WVYA 5JQ5A 5IG1A 3HVCA 4EK8A 4F9CA 2EXCX 3DFCB 5M06A 3LCSA 5EI6A 1DI9A 4RSSA 4DEHA 2BRGA 4KIKB 5BYYA 5AP4A 3GU8A 1JSUA 5HO7A 2C0IA 4FTNA 4FEVA 4GCJA 3U9CA 1OGUA 4G3DA 4W9XA 4HVDA 3D5XA 5L8JA 2BTSA 2FGIA 4QMWA 4BYJA 4IDVA 4ANNA 3Q9YA 1W82A 4TRLA 5ETFA 2C1AA 3C4CA 2VTRA 4IX6A 4P7EA 2GNFA 4YJVA 5HI2A 5TE0A 3C4WA 3QCQA 4MHAA 4OTWA 5HVKA 4G34A 4DFUA 4QO9A 4BYIA 2VTSA 2VN9A 2X7OA 5J95A 4M84A 2IW8A 1W84A 3HUBA 4YR8A 4CLIA 4IEBA 4XX9A 1GZKA 1WFCA 2VV9A 3BU3A 3TYKA 2JKMA 3IECA 4BVUA 3F7WA 3FY0A 2WQOA 1H0VA 3FZRA 4JNWA 4RWKA 3SHEA 3UIUA 3TEIA 3R8MA 1PXIA 1YOMA 3M2WA 5DN3A 3MB6A 4PMMA 3TNIA 1F5QA 3A4PA 3JUHA 3M42A 4IXPA 4GFGA 4LUEA 4JRVA 4QP8A 3DQWA 4RIOA 5AV4A 3BV2A 5HX6A 4MQ2A 3L8XA 2GU8A 3QCYA 4IMYA 3F7ZA 4JG7A 4M7IA 4AGWA 4C33A 3NIZA 5EQPA 4XRLA 3TDWA 3COIA 4XHKB 1QPDA 3F2AA 4B8LA 2QHMA 5M4FA 3HV6A 2QOQA 4J52A 4ZTRA 3W2QA 2F49A 2XH5A 4F65A 3DT1A 2W7XA 4AZFA 4BBMA 5FXRA 2IG7A 5IQBA 5CAVA 3ORZA 4JJRA 1WBNA 3ZRMA 2PULA 3KULB 4JIKA 3ITZA 4IDTA 5CEQA 3HZTA 3ODYX 4EJNA 3QTIA 2XALA 2WQBA 5ANIA 2WMVA 3UO5A 3BGPA 3Q04A 1ZARA 3BLRA 5E8UA 4BB4A 4BCQA 2VWIA 5K4IA 4RC3A 3P7AA 2HK5A 4JIAA 3P0MA 4RVLA 5EM6A 4JAJA 3FWQA 5J8IA 4LQMA 4BL1A 2ZDUA 5FRIA 2UZLA 2YABA 4E26A 4YBJA 5J9YA 4LRKA 4B9DA 4UZHA 4BDFA 5DYJA 4IAZA 4GIIA 1WMKA 1NY3A 3OT3A 4RFMA 1W2DA 4ZS0A 5AR7A 4S2ZA 5LMKA 4BKYA 3LKMA 1OL7A 4PWNA 2AYPA 5EHOA 5IF1A 5AFVA 4LRMA 4MF0A 3ZXTA 2PVMA 4GG7A 5D7AA 5HIEA 3D5VA 2BKKA 2IVSA 2XP2A 2UZBA 4II5A 4C35A 4E93A 3KRWA 1WVXA 2X7GA 2RGPA 1VR2A 5LCKA 2BZIB 3RAWA 2IPXA 3BKBA 3GBZA 3KKVA 1H4LA 1U5RA 3F3VA 4BTKA 2UZVA 4S31A 4DHJA 3EQCA 4C0TA 2GNLA 2W1EA 3U4WA 1A06A 2BKZA 4I0TA 4GVJA 2C6TA 2R0IA 4HYSA 5CXZA 3MY0A 4PNKA 3D4QA 4TYGA 4GRBA 5LMAA 3NUPA 3HUCA 4EI4A 1H01A 1S9JA 4ZY4A 3LFNA 2A1AB 3VNTA 5AR5A 4BWXA 3ZRLA 3CS9A 4U7ZA 2B9HA 2C6OA 3F6XA 1PXOA 1WZYA 3C4EA 3AXWA 5HGIA 2XNBA 3IDCA 3I1AA 4IX5A 4P4CA 4RPVA 3W2OA 4AP7A 2X0GA 3KRLA 4AT3A 1H0WA 4RMZA 4YJPA 3M11A 5IA0A 2CNUA 3UZTA 3LXKA 4R1YA 1YXUA 5LWNA 2XRUA 1GJOA 2ZB1A 1XHAA 4EH7A 3R8VA 5J9ZA 2FVDA 4FT9A 1IG1A 2H34A 1AD5A 3E88A 4FIFA 3C51A 4JI9A 4WRSA 4O22A 3SOCA 4U0IA 2O2UA 4EH4A 3LLTA 4FKSA 1DAWA 3W10A 4HGTA 3F3UA 4FKVA 3R7IA 3RPRA 4YPDA 5A14A 3OW4A 3ZLYA 4G6NA 3QQGA 3U6IA 3GFWA 3PYYA 5D1JA 2EXMA 4U9AA 1QPEA 1YVJA 3LFCA 5AP5A 3TIYA 4DLJA 3A99A 1M14A 2HELA 2C3IB 3R02A 4G2FA 2UVXA 4F9YA 1XKKA 2A98A 3EB0A 5E92A 4MWIA 3WILA 4MCVA 4IAFA 1OKWA 1PMVA 2OSCA 4I41A 2OBJA 4PPBA 3SXFA 4ALWA 4KUJA 2YM5A 1F0QA 2EWAA 4WD5A 4L44A 2XYUA 3ANRA 4FICA 4AZWA 2G9XA 3CR0A 3UOLA 2HWPA 5AV0A 5CAUA 4GKHA 3SGCA 2BFYA 3CPCA 3FQSA 4XMOA 5HE3A 4UX9A 3R04A 4A07A 5HG5A 4BCKA 1P4OA 1ZMUA 3P1AA 3UO4A 4BZOA 5CWZA 3WBLA