2G2IA

A src-like inactive conformation in the abl tyrosine kinase domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
271
Chain Sequence
SPNYDKWEMERTDITMKHKLGGGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abl Tyrosine Kinase
publication title A SRC-like inactive conformation in the abl tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 271
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2g2iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2g2iA01
3GU7A 3UG1A 1WBNA 2BHEA 1OIRA 2ITNA 4RLLA 2XK3A 4HVIA 4A4LA 4EC8A 3UO5A 3IW7A 3ZO2A 4EH8A 3EH9A 3NNUA 3AGMA 2XJ1A 2PHKA 5IUIA 3GGFA 3TZMA 4E1ZA 3M11A 3PFQA 2PZYA 1FQ1B 3LCKA 3IOKA 3C0HA 3H30A 3QTQA 4OW8A 3RZFA 3EFKA 3FZOA 5IZFA 4E5WA 3FSKA 3WOWA 2DQ7X 4H05A 3MTFA 3O71A 4TWNA 4ID7A 1ZZ2A 2WMVA 4FTRA 5LWNA 4Q5HA 4IMYA 2RGPA 2XUUA 4PDSA 1XH8A 1YXSA 1OZ1A 4A07A 2W9FB 5FDPA 4ZSEA 2GHMA 1E1XA 1H1WA 2QOQA 2OXDA 3KC3A 4XV1A 5CEMA 4AZSA 5J9LA 4ZSLA 3NNXA 3ZLXA 5DEYA 5AUYA 2WQMA 5E8WA 2JKKA 3UNJA 4Z7HA 4EJ7A 4RIYA 4E8AA 4BRXA 2C0TA 1M52A 3CD3A 3R21A 3MVHA 2W5BA 2P0CA 5E8SA 4XH6A 5CNNA 3LFFA 3RCDA 4AU8A 4D1XA 4IZ5A 2WMUA 4XG8A 4FTOA 3NS9A 2GQSA 3RWPA 2VNYA 4LRMA 4AF3A 3A7JA 3TNQB 4V0GA 1DAWA 4GT5A 4DG2E 3RALA 4XRJA 3U51A 3E7VA 3TT0A 3O23A 1TQIA 4FIFA 2VTMA 5DN3A 3VW6A 4IZ7A 4ANLA 4D9UA 1J7UA 1BI7A 2BPMA 3TIZA 4APCA 3FPMA 5TF9A 3FQSA 3MB7A 4NW6A 3GCVA 3DOGA 1CSNA 2ZMCA 4NM0A 5KCVA 4UYAA 1WMKA 2C1AA 3OOMA 1UWJA 3UG2A 1FVTA 3DV3A 2WTVA 4HNIA 1ZYDA 2BILB 4S2ZA 1YOLA 3DDQA 5JRSA 3AC5A 4IWDA 5K4JA 4O7RA 1I44A 3MGYA 4S33A 3GBZA 1Z9XA 3COMA 4OT6A 4FV3A 4C3FA 4GKHA 5I3RA 3U6HA 1U59A 2OG8A 3FKNA 3KRRA 3VUIA 4JRVA 1R3CA 2BR1A 3MV5A 4UBAA 3DTWA 5DFPA 4OTIA 2ONLC 2C5NA 2PU8A 3KULB 3TDWA 2PVNA 3DXQA 1SMHA 3QTSA 3UIBA 4IQ6A 2RKUA 3FUPA 3LCDA 4K33A 3ZRKA 4O0UA 2QO2A 1J1BA 5CYIA 1W98A 3D5XA 3Q4CA 3OWPA 2WMSA 3PVUA 4XG6A 3DFCB 3O17A 3LIJA 3UOLA 4M7IA 4U45A 2YCQA 1K3AA 4JIAA 2YM4A 2P55A 5CVGA 1Y6AA 4QMPA 4OGRA 1YDTE 3II5A 4PF4A 5L6OA 1YRPA 5J1VA 3NUUA 3QTRA 3R8UA 3POZA 3E88A 3JUHA 3WE8A 1GZOA 2G2FA 3MS9A 4O96A 4QP6A 2R7BA 3DAKA 5I9XA 3VF8A 3N4VA 1R0EA 2J4ZA 3OTUA 3CS9A 1DI8A 4KNBA 4Y83A 3CXWA 3FMMA 4LOPA 1Q97A 2W0JA 3D9VA 5AP4A 3KCFA 1O9UA 4M0ZA 5IUHA 5EFQA 2WNTA 2QOBA 5CEKA 2J0JA 3FXXA 4FKLA 5J95A 3S0OA 1UNGA 4O82A 2O0UA 3HDMA 4E4XA 4ASDA 1CKIA 3GOPA 3BCEA 2ITPA 2XYNA 5EHOA 3AT2A 3FI3A 4TWOA 3DLZA 3VBYA 5HE2A 4RG0A 3OXZA 3MFUA 2HWPA 2YACA 4I4EA 3LCTA 3QD4A 4F1TA 5CT0A 4EKLA 2XP2A 3HVCA 1PRYA 1FVRA 4I1ZA 3EN6A 3BPRA 3HUCA 1AQ1A 3KN5A 4AW0A 3UC4A 4WRSA 3SD0A 4DBNA 4X2JA 4O7VA 3QRTA 1ZXEA 4FSMA 2Z7SA 1RW8A 5DHJA 3MY5A 1H0WA 4XBUA 2XYUA 5CEOA 4L7SA 4XV2A 4E5AX 3WIGA 2QKRA 3CD8A 4IVBA 4S34A 4IC8A 4BIEA 4HNFA 4IJ9A 4D2VA 4GVJA 4YPDA 3NR9A 2OH0E 2R5TA 3F5UA 2IO6A 2HXQA 1PYXA 3C5UA 4FMQA 5C1QB 4C38A 2PUPA 1ZOEA 3L8SA 4KABA 2UZOA 2W1EA 4RZVA 3C5IA 4FG9A 5A46A 1KUTA 5IA5A 4O83A 4QMTA 3I5ZA 1RQQA 1XHAA 2YHVA 1BUHA 4XP3A 1R78A 4HJOA 4HPUE 3UPZA 2HCKA 4O0RA 5HLNA 3LCOA 3MBLA 1NVRA 4CLJA 4H58A 3E5AA 3HMPA 4IC7A 3SA0A 2BRHA 2VNWA 3P7BA 2Z60A 4U42A 2NRUA 4TNBA 4BDBA 5J9ZA 3SW7A 3JR1A 3V8TA 4O21A 4FEWA 4FNWA 2YM3A 3CQUA 1Q8WA 4O1OA 2VWBA 3IG7A 4D0WA 5K3YA 4CYIA 4DEBA 4UEUA 3PA5A 2WXVA 1KE5A 4O6LA 3V8WA 3QUDA 4DFZE 5LJJA 3S3IA 1P14A 3D94A 3FMLA 2FSOX 2FSLX 2I0HA 2GS6A 3NUYA 3OY1A 5BUEA 4HGLA 3MJ2A 4WT6A 2YN8A 5HESA 5GIOE 4YSMA 3Q52A 3TNWA 2IW6A 1GZ8A 4QT1A 1OVEA 4AFEA 3AC3A 4KIOA 3E8DA 4NIFA 4M8TA 4QQTA 5GJFA 4DTAA 2AYPA 2R3LA 4HYSA 4IAYA 5ANKA 2YIWA 3BWFA 3RNIA 3HA8A 3BX5A 5B0XA 4YJPA 2XK6A 2XF0A 2PPQA 4U79A 3ZU7A 3LMHA 3RK7A 2VTPA 4DHFA 4EHZA 1UU7A 4FV0A 4JDKA 5FTQA 5CU2A 3PA3A 3LAUA 4O7YA 3MTLA 4F0FA 2JIUA 4KKGA 4O7ZA 4YC6A 3W18A 3ET7A 2X4ZA 3QQHA 4LRKA 3EQIA 4JR7A 5CS6A 4ZXTA 4B7TA 3I7CA 1GIHA 5H9BA 3P0MA 4MBIA 5CSVA 3I4BA 2QURA 3NX8A 4ZLYA 3O51A 4CV9A 3DJ5A 1MQBA 2BDFA 2BUJA 2I0EA 4TYHA 3ZLWA 4YGAA 4JQEA 4K77A 3DPKA 4PUZA 3HAVA 3F6XA 1PXMA 3FXWA 5DMZA 4MCVA 3UQFA 2UV2A 1BMKA 4CCUA 3SLSA 4HCVA 4RQVA 3U4WA 3OUNB 4KAOA 5EDRA 5HLPA 4IVCA 3K5UA 4C4HA 4F4PA 5EOLA 4QMQA 3F88A 4GFGA 1LPUA 4RWLA 1Y57A 3QKKA 4GJ3A 1J7LA 4WBBB 2B7AA 2VRXA 1Q3DA 4G1WA 5I3OA 2OJ9A 3GU6A 4N0SA 1YDSE 2GSFA 3W2QA 3R9NA 1FMOE 1H08A 4QTCA 5FBNC 2E9NA 2OJIA 5A4TA 5JQ5A 4O27B 4F6SA 3LLAA 4EBWA 5LXMA 3TZ7A 3CY3A 3DAEA 5HIDA 4KS8A 3BLRA 3Q04A 3IDBA 2J5FA 3R9OA 5ANJA 2GS2A 4PX6A 1A06A 2VWUA 5DR6A 3VS5A 3GU5A 1KSWA 1STCE 2C69A 5EDQA 3R9RA 2PVMA 3I5NA 4DEGA 3D7TB 4JDIA 4P90A 4DH7A 4O6EA 5LQFA 3R8VA 3ROCA 3A7GA 3PPZA 4Y73A 2YWPA 2H6DA 4PDOA 5ANGA 1W83A 2W7XA 4U9AA 4FTMA 3MYGA 4RRVA 3LXPA 3NCZA 5DRDA 4OTFA 2UW0A 4CZTA 4ZK5A 1ZMVA 3QUEA 4R8QA 1WCCA 4WIHA 3QCQA 2C6OA 5CU6A 5TE0A 5AWMA 5DOSA 2F2UA 2JDRA 4EYJA 1XKKA 3AC8A 4KIPA 4ASEA 2GTNA 5BVWA 4D4VA 2I6LA 3DDPA 2E9OA 4GYGA 5JFWA 3BELA 2R3KA 2GNFA 1WBPA 2V55A 2C5VA 5EKOA 5ETAA 3R8ZA 4J71A 3R7GA 4ANMA 5E8XA 4ZS0A 5AV3A 4BI2A 2UZEA 4YSJA 4J99A 5KMIA 4NJDA 2H9VA 5GZ9A 5C4LA 4I5HA 2XIKA 3QL8A 3F2NA 3QA8A 4CKIA 2PVHA 3PP0A 3QLFA 4QMVA 3AQVA 4E6AA 3AG9A 4KINA 5H8GA 4E73A 3LZBA 3G15A 5CXZA 2YIQA 2HW6A 4JRNA 3DTCA 3FZRA 1FMKA 3ATSA 4I6BA 1XH6A 3L8XA 4FV4A 1K9AA 2ITYA 3LW0A 3ZBFA 3QAME 5T3QA 1R1WA 3BHUA 4IZYA 4O0WA 1A9UA 3CPBA 3F9NA 4I6HA 3C9WA 3HECA 4EH3A 4WSQA 3Q9XA 2PZIA 4C4GA 3H3CA 4AAAA 2HW7A 2J0LA 3CKWA 1SNUA 2EB3A 4XUFA 2ITTA 4DINA 4C4FA 3FL5A 3DK6A 3ORXA 3EMGA 2B9IA 2OIQA 5JH6A 2X2KA 2C5OA 4FBXA 4RVMA 4XEYA 4UMPA 3VAPA 4JQ7A 3BYVA 3T8OA 3OBGA 3R01A 4GMYA 3N51A 4UN0C 5GJDA 3WF5A 2WU7A 3C0IA 5BYZA 3ZC6A 2UVXA 4I20A 4O0XA 3QZIA 5AP7A 2ERZE 4H1JA 4RJ4A 4FI1A 2UW6A 3ZUVA 2YIXA 4AQCA 2GNIA 3QGYA 3IPHA 4PTGA 2IG7A 3KVXA 4MNEB 5T68A 4FIJA 2HYYA 4DCEA 3DXNA 4A9RA 5IQDA 4BCJA 4GSBA 2X2LA 4JI9A 1WFCA 4QP9A 5D11A 4BCKA 4DC2A 4PNKA 5HD4A 3KMWA 2WIHA 4G5PA 4IACA 3VS4A 5HVYA 2NP8A 4YUQA 3UOJA 4C35A 2QOCA 1ZOGA 4K0YA 5LVMA 3GC0A 1M17A 1XJDA 3WF8A 1LR4A 3AMYA 3BIZA 3MFTA 5GNKA 5KMLA 2YAAA 3UNKA 4R6VA 2BFXA 3LM0A 1GY3A 5KZ0A 5M44A 4MNFA 4E4NA 4O1PA 1U4DA 3EQPA 5A4LA 5M53A 1KV1A 4BHNA 5F9EA 4IANA 3R7IA 4AZEA 2I0VA 2X8IA 1JNKA 4TRLA 5CVHA 5CAQA 1YQJA 4QOXA 1UV5A 2RFNA 4RWJA 4DH1A 4EOSA 1IA9A 3I60A 4I0SA 2E9PA 3QA0A 4NSTA 4AN9A 3EFWA 2PMIA 4TY1A 4D4SA 5BYYA 3MY0A 2FB8A 4W4VA 3H0YA 3L8VA 3SXRA 5C8NA 3HNGA 4DGMA 2ZAZA 4IX4A 4QMZA 3CPCA 3EN5A 4F0IA 5AFVA 2XNBA 2HY81 2JKOA 1ZRZA 1OKVA 3QTZA 4M84A 3E8EA 4MX9A 4TTHB 4XV9A 3R8MA 3TV7A 3WZUA 4YTCA 4RSSA 4M12A 5TOZA 3QQLA 1A48A 4O38A 3U87A 3VJOA 5LMKC 3FC1X 2BAKA 2XEYA 4FKOA 5HIEA 5CT7A 1YHWA 4QMNA 4QMMA 2YLEA 5JFSA 5M08A 3LQ3A 5CASA 4ANQA 5CEQA 4RJ8A 5ANOA 4IHPA 3F66A 3Q2JA 3AT4A 4KKHA 3NAXA 5LVOA 2O3PA 5EH0A 4AOTA 1LEZA 3Q3BA 4E93A 3SXFA 2LGCA 3CIKA 4PMSA 4RPVA 4DGGA 4QMLA 4XBRA 3WE4A 2IVUA 4QMUA 2VO0A 3D7TA 4BVUA 2QOOA 1IRKA 4D1SA 3D15A 1SZMA 2BRGA 4V05A 3SDJA 2AC5A 2O63A 4BZOA 5HI2A 1YHSA 2UZUE 5HNBA 5AR8A 2C30A 3E7OA 3NUAA 1NW1A 3MFSA 5KMMA 2WMQA 4FOBA 5KKRC 4J95A 4W9XA 4FA2A 4B6LA 4UB7A 1HOWA 4MYGA 5C27A 3UO6A 2Y9QA 3QC4A 5CALA 3W2PA 3RCJA 2ACXA 4F6UA 2GCDA 4KBKA 3Q32A 5CSWA 3UE4A 5AV4A 3R71A 4P5QA 4W4XA 5HGIA 3UMWA 4UMTA 4BIBA 3RPRA 4QMOA 4FKTA 3POOA 1S9JA 3D5VA 5DBXA 2X81A 1IAJA 1BYGA 5AUUA 5M51A 4M15A 2HXLA 4DFUA 3CEKA 3GC7A 3I6WA 4RIWB 3MN3A 1M2QA 3LXKA 4I23A 5CSHA 4EOIA 1U54B 3NW7A 3P86A 2XCHA 3CY2A 4JAIA 3IDPA 1IA8A 3GI3A 1M2PA 4NJ3A 4FT0A 3MH0A 3UPXA 2C3LA 3QRKA 4NCTA 4ACMA 3FMJA 2XBJA 4X3FA 3CTJA 4A9UA 1LEWA 4M3QA 4BN1A 4ZJIA 1SVHA 4BGGA 4GUEA 3F3VA 4RX9A 3NWWA 4ARKA 4AWIA 4EQMA 2ZJWA 2OFVA 3HYHA 4QP3A 3VWAA 5L2SA 3HAMA 1NVSA 3IGOA 4WUNA 3S95A 3A62A 1WVXA 3D14A 1OB3A 4PWNA 2UZWE 4MK0A 2BHHA 4YR8A 3VUMA 1ZYJA 5AEPA 2W5HA 5AV1A 2OF4A 2ZDUA 3ALOA 3UQGA 4FK6A 5DPVA 2WTKC 4G3GA 4LL5A 4EUUA 4E4LA 2CGXA 5DH3A 2PY3A 1VYWA 1PF8A 3DGKA 3LFCA 2WQBA 3U55A 1H28A 3F3TA 4HVHA 4ZAUA 5I9VA 4BKZA 3DKCA 5AP2A 1PMUA 2HOGA 3GC9A 2CDZA 4YC8A 1KOBA 4ENYA 3Q6UA 4QMXA 1NT2A 2XKFA 2VTHA 4P5ZA 2BKZA 4EOLA 5A54A 4IH8A 3ZXZA 4WG3A 3DS6A 4AZVA 4O22A 4C4EA 5HCXA 4MXCA 2XNEA 4RFYA 4CRSA 5JFVA 3FL4A 5J7BA 5IA4A 3BU5A 4K1BA 3TTJA 4AGDA 3PG1A 4FKJA 4X2KA 3WARA 4R7BA 3EFJA 5AMNA 4CSVA 1ZAOA 4XV3A 2B4SB 1G3NA 4CZYB 4M13A 3PDTA 5F1ZA 4QPMA 4GV1A 4RVLA 4OAVB 5HKMA 4OBPA 3UQCA 3BWJA 4FSTA 5EKNA 4RIXB 2QO9A 4AT4A 5L2QA 2A2AA 3DFAA 3MVMA 4W4YA 5H8BA 2HAKA 3FMNA 4ZTHA 1P5EA 3CJFA 1PXIA 3PJ2A 3RMFA 1X8BA 2XM8A 3R0TA 3VS3A 3Q5IA 1QPEA 1URWA 3DNEA 2WTJA 4AT5A 3QUPA 2JEDA 3W2SA 3DKFA 4QNYA 1RE8A 5DR2A 3ZSHA 4ALVA 4EONA 2A27A 4KKEA 1J91A 3FQHA 3K3JA 5HVKA 2JGZA 4O7NA 4ZY5A 4FIHA 4O2PA 1FVVA 4MAOA 3OCGA 4FTCA 4F1MA 4NW5A 4JLCA 2OW3A 3GENA 3NW6A 2VTQA 2GMXA 3MA6A 2P4IA 2BIKB 4K8AA 2F9GA 4LG4A 4ONAA 5KUPA 1MRUA 5CZHA 1H1QA 4Z16A 1QL6A 4KB8A 4E6QA 3SC1A 3MH1A 3DKGA 4J1RA 4NEUA 2XS0A 3W2RA 2OFUA 5CF6A 3A4OX 4RX8A 4FTTA 4AGWA 5HO7A 3GP0A 1Y8GA 1E9HA 4GYIA 3ZC5A 2BRMA 4FKRA 2Y6MA 4Y95A 2WELA 3MVLA 2B53A 2I1MA 4IVDA 3ZO3A 5AUXA 4O86A 3U6IA 3TUBA 2V7OA 2B55A 4TNDA 3IQ7A 2VO6A 3UZTA 3UVRA 2JDSA 3LFDA 1MRYA 2VTNA 3NIZA 2FSMX 4IJPA 2XKDA 1G8AA 1IAHA 2QOKA 4YJOA 3UVQA 2VZ6A 1Q5KA 5LCJA 4R5SA 4R78A 2XA4A 4OR5A 3V5QA 4QD6A 1Q8UA 4I21A 3O7LD 2C1BA 2BTSA 4OLIA 4WKQA 4B9DA 2B1PA 4EHVA 2XNPA 5KBQA 2W96B 4I6FA 5L3AA 3OBJA 4R1YA 3VBVA 4DN5A 4EORA 4EHGA 2VWIA 4Q5EA 3W10A 2CN8A 4DT8A 2OSCA 3PXKA 2WTDA 1MRVA 3G2FA 2UW7A 3UMXA 1JSVA 4OTDA 2GPHA 4JBVA 4CV8A 3Q2MA 5AP0A 3ORPA 4D2RA 2YCRA 1GOLA 2JIIA 3C1XA 3ZXTA 3ORIA 4TT7A 4BGHA 3WF6A 5CF8A 5IH4A 2YA9A 1UU9A 3IK3A 2VV9A 3E92A 3F69A 4KRCA 1M14A 3FZPA 4KSPA 4IAFA 3VRYA 4YU2A 3CTHA 3F3UA 3E93A 4KBCA 5AR4A 1ZMUA 4TN6A 4L9IA 3R7EA 4E3CA 4GVAA 3F5XA 4G9CA 1IASA 3R28A 3C4ZA 3GB2A 2Y8OA 2WOUA 2QLQA 2QOFA 3BHTA 3AD5A 5HE0A 4DBXA 3QYWA 5EW3A 5BVFA 3VS0A 1O6KA 3FQEA 3QFVA 5KZIA 2I0YA 3UP7A 4FEUA 3KRWA 1UU3A 5IQHA 2PE1A 4EK5A 4ZMFA 2X1NA 4D4RA 1YWVA 5HE3A 4NTSA 4M69B 2HY0A 3HZTA 4IWQA 1Q61A 3VBWA 4C4JA 2B52A 2PULA 4FUYA 4LI5A 4OBOA 5M06A 2X39A 3KL8A 4AZWA 3SG9A 4B8LA 3KRLA 5KKRB 4YO4A 4A9YA 2XZSA 4BI1A 3OXTA 4I0RA 1QPCA 3SOCA 3EN4A 2R7IA 3REPA 5CWZA 4ZJVA 1CKPA 1YKRA 2W9ZB 4GT3A 4FGRA 3O8PA 4U3ZA 3ZEPA 5IQFA 2G1TA 3QQKA 2YDIA 4FSZA 5HG8A 1PXKA 2ZB0A 3PRIA 2HIWA 3EQCA 4IADA 3ULIA 4CKJA 1G8SA 4NYEA 3RPYA 3ODZX 5EW9A 3UZPA 4AE9A 2XKCA 4NKAA 5DIAA 3PVBA 2WTCA 4G6OA 5DLSA 3KRJA 3LKMA 2OBJA 3TNHA 3DNDA 2QR7A 2GFCA 3QZHA 2QO7A 4GJ2A 4WG5A 3HMMA 3Q9YA 3P79A 3PZHA 3DA6A 5AIRA 3KB7A 2YM8A 3T9IA 4U6RA 5CAVA 4BCHA 2XH5A 3PUPA 3BBTB 2YLFA 3GCSA 4CFWA 3DQXA 2A4LA 2C6TA 3DCVA 1YXVA 2R3GA 3TXOA 3WYYA 3HL7A 5JN2A 2QC6A 3NYOA 5BMMA 1GZNA 4YZDA 1KV2A 1Q8TA 3WF7A 2JKQA 5KHWA 2CN5A 1P4FA 2ETKA 2XVDA 4FZ7A 3LVPA 4EWQA 4F7NA 4RGJA 3N4UA 3MSSA 2ZM1A 3RJCA 4YHJA 4L52A 4JXFA 2VWWA 3PA4A 4DFXE 2C5YA 3K5VA 4FV7A 3PG3A 2A1AB 5DNRA 4WG4A 5HVJA 3VS2A 5BVOA 4J98A 4EK8A 1V0PA 4UY9A 5HNIX 4DTBA 4YJSA 3UYTA 1ZLTA 2WTKB 2W06A 5AM7A 2R3QA 3E63A 4O91A 3TZ8A 4BKYA 4O7LA 4MXOA 4IFCA 1XH4A 4IDTA 4F6WA 2XNOA 3PPKA 4WOVA 4AACA 3WZEA 2WQOA 3HV3A 2JDTA 4UXQA 1JOWB 2BDJA 4I0TA 5A3XA 4EH4A 4EH5A 5EI8A 4J7BA 5JK3A 5LWMA 3HDNA 3VS7A 5JGDA 2Z02A 2C47A 2W1HA 5AM6A 4ZY6A 2JKMA 3DXPA 1OITA 3HRBA 3ZM9A 4KUJA 3TACA 3U9CA 4OUCA 2PVRA 5DEWA 3OEZA 4RWIA 5IF1A 3T3VA 2Z8CA 4J96A 4ERWA 5EHLA 3QTIA 2OF2A 4D9TA 4KSQA 4JL9A 4FSYA 1KE8A 2VWXA 2FA2A 3GCQA 4IAAA 1H24A 5L6WL 3V3VA 2ZV8A 1SVGA 4TYGA 3BE2A 4DEEA 5D41A 5M57A 3SKCA 3SW4A 1OL7A 4FV2A 2OKRA 4YZNA 4HW7A 4CKRA 3MY1A 3MH3A 3W55A 3COIA 4PL5A 4FKPA 3UNZA 3CSVA 3F2AA 2R2PA 3KXZA 4QP8A 5D10A 3PXZA 2VO3A 3SRVA 2EUFB 4C59A 1OL5A 4RX7A 2F4JA 3G9NA 4EC9A 3KF4A 3VBTA 2CKEA 5HBHA 2FUMA 3KU2A 4AZTA 3FV8A 1REKA 2RIOA 1YWRA 5IQCA 5JKGA 3HX4A 4YP8A 5HG5A 2NO3A 1JWHA 4ANSA 4L53A 4F7SA 1GAGA 5AAEA 4QP2A 3F2RA 1XH5A 5CAUA 2EXEA 3MW1A 4U40A 3F61A 1VEBA 2HZ4A 2WMAA 3MIYA 3LMGA 2JFMA 2P3GX 2XK4A 4UXLA 1Q24A 3GCUA 2BTRA 1OIYA 3I0OA 3TUCA 3RTPA 1WBSA 3IDCA 3R22A 3R30A 1J3HA 1ZMWA 4X6QC 4ZTNA 4K11A 1JKLA 3VIDA 2J2IB 2PMLX 3QQUA 4CXAA 2PWLA 2CNUA 4BB4A 5CU0A 2UVYA 4FT7A 2R4BA 4N70A 1U46A 2WTIA 1PKDA 3FLSA 3W8QA 3QU0A 2ZV7A 4H36A 5EYMA 3PY0A 2Y6OA 4DEHA 4K2RA 3R1YA 4D5KA 5AUTA 1WZYA 3I7BA 5K4IA 5HZNA 5IQEA 4L42A 2YIRA 4M69A 1WBTA 4R1VA 5BUIA 4CQGA 2CHLA 3FHRA 4PP7A 3BEGA 1JAMA 4DE4A 2IW8A 2UZNA 4M67A 5IEYA 3EYGA 3BU3A 2X7GA 1ZYLA 4DITA 2E2BA 4FKQA 2JDVA 4R3RA 2OWBA 5BQ0A 5FTGA 3QRIA 5FG8A 3R63A 1ZWSA 3WZKA 5JRQA 3PJ3A 2NRYA 4NKSA 3DQWA 3FAAA 4FUXA 5CQWA 1WBOA 4NT4A 5HICA 4FKIA 5BNJA 2OO8X 4BDEA 3G33A 5ICPA 3QKLA 3V5WA 1OKWA 3ZFYA 3CP9A 3GFWA 4FYNA 3UVPA 4PPCA 3VBQA 4MWIA 3F82A 3UP2A 2PZPA 2VWZA 3QX4A 3KULA 3VHKA 5JGAA 4QYHA 4EZ3A 4FF8A 4ASXA 5C8KA 3HGKA 4FTUA 2XRUA 4QP4A 3DLSA 3R00A 4QQCA 3FMDA 2IJMA 4TYIA 3NLBA 3PIXA 4MXAA 3DU8A 3NRMA 4QRCA 2BVAA 2G2HA 4DG0E 4W8EA 1H07A 4IWOA 4YTFA 3ZDUA 2UVZA 4BDJA 2ZV2A 2V0DA 2VTRA 2OGVA 3FZTA 3HKOA 3QF9A 4IM0A 4LGHA 2Y4IC 3VC4A 4BDHA 2OJJA 3I79A 2KULA 5G1XA 4QTEA 4D2TA 1OBGA 5LMBA 1KE6A 4PDYA 3Q9ZA 2X8EA 3UO4A 1ZARA 2YM5A 4IE9A 4BIDA 3OCSA 5D9HA 4D4YA 2FYSA 4CFVA 1YXUA 5CANA 5FXRA 4ZMEA 3BKBA 3PPJA 2I7QA 3TWJA 4EKKA 3FLYA 3HV6A 1MQ4A 4X0MA 2CSNA 1UVRA 4FEVA 3LXLA 4BCNA 3MJ1A 2YM6A 2WU6A 1H01A 3TI1A 1JKSA 4LMNA 3SX9A 4FL3A 4RFMA 2PVJA 4WHZA 4FZFB 3RINA 3FY2A 2GNHA 5E8TA 4KWPA 2YDKA 5EQYA 4MQ1A 3EQBA 4JG7A 4YJRA 2GS7A 2F7EE 3TM0A 3U54A 2H96A 4P4CA 4F70A 2REIA 1KE9A 1PXLA 3FY0A 4FZ6A 4FVRA 4MD8E 4QYFA 5TT7A 1F5QA 3THBA 4MXYA 2CGVA 4UX9A 2X2MA 3R2YA 3NUPA 4U81A 3DK7A 3LLTA 1XH7A 4QPSA 5KE0A 4AW2A 4BDAA 4YHTA 3OWJA 3FBVA 4ZJJA 4L43A 2R3PA 3E8CA 3RPSA 4IB5A 5FP6A 2Q0NA 4IAIA 2CNVA 2VN9A 3KN6A 5E8VA 5ANIA 3VS6A 2QD9A 4XP2A 5J9YA 4XOYA 4QP7A 1BL7A 3VUKA 4IFGA 3QTUA 5EM7A 4CMTA 3E3BX 1BI8A 1Q41A 1YDRE 2WMRA 4I5PA 4IAKA 3MH2A 4BZDA 3Q53A 1TQMA 4NFNA 2A19B 4PL4A 1Y8YA 1S9IA 4QPAA 2WD1A 2FH9A 2WQEA 5IMEA 1H1PA 3Q4UA 3FXZA 1Q8ZA 2JAMA 4BC6A 4R3CA 4RVTA 4G6LA 4O2ZA 3RM7A 1QMZA 3PY1A 4MF1A 5CTPA 3NPCA 2E9VA 1CM8A 3GNIB 2GQGA 3Q6WA 2EB2A 3A8WA 4GG5A 4H3BA 4S32A 5CEIA 5HU9A 5FM2A 1Y91A 5HG9A 3RI1A 4EBVA 3K3IA 2SRCA 5T6KA 1OUYA 2PSQA 4LOOA 3SVVA 5DGZA 2ESMA 4Q2AA 2XB7A 1F0QA 4QMSA 4ZSJA 2R3JA 3R1QA 3ETAA 3P4KA 3BYSA 3SV0A 2VO7A 2ETMA 3EQDA 3ORTA 3BGQA 5IDPA 2PUIA 4KS7A 3OCBA 5C8MA 2ITVA 4M97A 1REJA 3W1FA 4PPAA 2JD5A 4CG8A 5GINE 3E64A 4AFJA 4BDCA 4HCUA 1G5SA 3GUBA 3C51A 2JITA 1PKGA 2FVDA 5EOBA 3C4XA 3VBXA 2CKPA 2YISA 3VUDA 4WO5A 4BYIA 2OJGA 3EQGA 2O2UA 4LV8A 3OF0A 5BMSA 3NVMB 5HBEA 4G2FA 5DR9A 3FZ1A 4H39A 5E91A 3K54A 5E7RA 4PPBA 3ZDIA 4YURA 4II5A 3UTOA 4O81A 5J1WA 4O0YA 1KWPA 5E90A 5IQIA 3QALE 2CCHA 1ZYCA 3FLNC 1UA2A 3EL8A 4HYUA 4L3PA 5BPYA 5L6PA 4O7SA 3TJDA 5I9YA 1RDQE 1QCFA 1H8FA 3O50A 3KRXA 3UJGA 4PQNA 5AP5A 3EKNA 3IONA 3W2OA 4MVFA 3FLZA 4WSYA 5CLPA 3DJ7A 3NZ0A 4BR3A 2W4OA 4J8MA 4NWMA 5GIPE 2A0CX 1JLUE 1JKTA 3HRFA 3BQCA 2WMXA 5K5NA 4IM3A 3O2MA 3UODA 3C4EA 4V04A 4E4MA 4U5JA 5AAGA 1OIUA 3BGPA 3OW4A 3KCKA 3V5JA 5M56A 4CQEA 3LPBA 3E8NA 4TW9A 3RBWA 3R7VA 4AW5A 4B4LA 3BU6A 5DWRA 2ITUA 3UIMA 3PXQA 1NY3A 3PXYA 4JOAA 3F5GA 5FWKK 4PV0A 2DS1A 4PMTA 3QTXA 4O7TA 2H8HA 3ORZA 4C37A 2YABA 4KIQA 4EHEA 4DF3A 1OECA 3KXHA 2VX1A 4F9CA 4I5CA 2BMCA 4E26A 3ODYX 3NNVA 4QYGA 2IZSA 4QMWA 1OI9A 5JEBA 3V6SA 4IDVA 3S00A 3V04A 5TKDA 4BICA 3BGZA 4YMJA 2VUWA 3QXOA 5F95A 3ORMA 3MWUA 2W1GA 4C8BA 5I9WA 2QOLA 3PWYA 4JBQA 5BVEA 3QWJA 4DG3E 4OTRA 3HMOA 4DEAA 3ZM4A 5FDXA 2VX3A 3QC9A 3JPVA 3QQGA 4AN2A 2NNWB 3KY2A 4NTTA 1Y6BA 4G3EA 4IEBA 5CZIA 2VGPA 2IW9A 2CLXA 2CKOA 4F7LA 3R02A 4Z7GA 4YZMA 5AR3A 2BALA 4A9SA 4ZTQA 2Y0AA 2ZMDA 4GFOA 4LGDA 3UOKA 3G0EA 3IW5A 3L9NA 4USFA 2J50A 4HGSA 4C61A 4C58A 5CENA 2ONLA 4W4WA 4DYMA 5E9EA 5DT4A 2CLQA 3ZMMA 4TYEA 3A8XA 2CCIA 3PJCA 4DFNA 2IVTA 1HCKA 2GFSA 2BAJA 5HBJA 4XOZA 1F3MC 5BUJA 2ITZA 1GNGA 4FKWA 4YLJA 3SQQA 3UC3A 4F7JA 1SM2A 4JBOA 3OT3A 2XNGA 4UALA 5HCYA 4DEDA 3OFMA 5EW8A 1M7QA 3TV4A 4AS0A 3QD0A 2WHBA 2JBOA 5B2MA 4F64A 5AUVA 4YZ9A 5H2UA 5A14A 3CBLA 5A9UA 3M42A 3K2LA 3D5UA 3AC1A 1DAYA 3OZ6A 2VU3A 4FG7A 2Y4IB 3FI8A 5ETCA 2P33A 5JGBA 3NYVA 4B0GA 5C4KA 4BBEA 4KBAA 4WRGA 3RAHA 3R9HA 3P9JA 3OY3A 2R0IA 3V8SA 4BHZA 5DT0A 4HVGA 1OPKA 3RM6A 4EH6A 1W84A 5KHXA 3A7FA 3QRJA 4ERKA 3EHAA 5M4IA 2B9HA 2C4GA 2C6EA 2EWAA 4RIYB 4LOQA 3BYMA 2R3OA 4MXZA 1LP4A 3MDYA 1YXTA 4P2KA 4J52A 3HMNA 3RK9A 4QNAA 4DT9A 3MFRA 4GIIA 2GHGA 4GS6A 2UW8A 1YXXA 4QYYA 4GL9A 4FTKA 2IZRA 2VTAA 4U41A 4U7ZA 4V0GB 5EI2A 4BTKA 3ZYAA 2RL5A 5AADA 4EEVA 4USEA 3KK8A 4FL1A 1PXOA 1ZY4A 4KD1A 3GQIA 2PE2A 4JBPA 4C3PA 5AR5A 3QZFA 4PDPA 1PXNA 3KFAA 2XMYA 4ITIA 4EYMA 3MB6A 3P7CA 5CY3A 4ZP5A 3AD6A 1YI4A 5I4NA 3BLHA 5IEVA 2X7FA 3ZO4A 2WMTA 4HPTE 3DAJA 1OUKA 4HVDA 3ULZA 4CLIA 5BYLA 3U4UA 3V6RA 3VUGA 5I9ZA 2OU7A 3BV3A 4RLKA 1W7HA 4I6QA 2W1IA 1Q4LA 4MNEA 5AX3A 2QG7A 3Q4ZA 2EU9A 2JC6A 1XWSA 4ORKA 1YI6A 3M1SA 3RGFA 4F09A 4O0VA 3FSFA 3I81A 4YJNA 4AT3A 4F9WA 5EI6A 4YBKA 4JDHA 2Z7LA 4KIKB 4DLJA 5IPJA 4NUSA 4MWHA 1EH4A 3FPQA 3QCYA 5CNOA 4BBFA 4DGNA 5IQBA 2PK9A 2BZKB 3G6HA 1XBBA 4E5BA 5AR2A 4R77A 2WMBA 3QXPA 3ZRLA 3G90X 4RC2A 5CI6A 1B39A 5F20A 5D7VA 3R8LA 5FEEA 4WNOA 4CFXA 3F3ZA 5B7VA 2G01A 1MUOA 1ZY5A 3AMAA 1URCA 4A7CA 3UOHA 3LFNA 2XIZA 1R0PA 4L3JA 4LGGA 4J97A 3HP5A 2C3JA 2ITXA 1UNLA 2BZHB 2WFYA 3SAYA 3EZRA 4EZ7A 2Z7RA 2Q83A 1WAKA 3T3UA 5DE2A 3S2PA 4D2SA 4WUAA 2QR8A 4U0IA 4MH7A 1VZOA 2W5AA 3MPTA 5L8JA 3JXWA 4ACCA 2BKKA 3PY3A 3LQ5A 2GNJA 1OGUA 2X9FA 3WF9A 5M4CA 4D55A 3AMBA 4EWHA 2IPXA 5GZ8A 5HO8A 4HGEA 4EOQA 2X4FA 5L8KA 5IMXA 1KOAA 3GCPA 3IW8A 3NW5A 3L9MA 5C03A 4AA0A 4BY9E 2WTWA 2P2HA 1H1RA 4K9YA 1Q3WA 4BF2A 5FQDC 3NMUF 3G6GA 4GH2A 2OJFE 3IECA 2PE0A 4BWXA 4I3ZA 2CGUA 4ZZNA 3L8PA 4OBQA 5E8YA 2UZLA 1H27A 4FTJA 4Y46A 2LAVA 4ACGA 4BWKA 2PZ5A 3BHYA 4RJ3A 3RAWA 4F0GA 3DZQA 5CI7A 4G3DA 4FVPA 2CGWA 4OTQA 2X8DA 2VD5A 4YJQA 3D4QA 3FLWA 2G15A 4K18A 4AG8A 4ALWA 3AXWA 4I24A 3QYZA 4XG2A 3ZZWA 2BRNA 3EB0A 4RA4A 2QOIA 5CVFA 3VS1A 4CFNA 2QHNA 3GFEA 3QQFA 4YC3A 1PXPA 2FSTX 5HEZA 3F3WA 5LVLA 5HQ0A 3LFSA 3NUXA 3EL7A 3KMUA 3QKMA 3NIEA 4ENXA 5HTBA 5AP3A 4I92A 1T46A 2W4JA 5JSMA 1TQPA 3M2WA 4XG9A 3TNIA 2OXXA 3FDNA 3IOPA 2PYWA 4TKSA 3D2IA 4IX5A 4TXCA 3KXNA 3QCSA 5TR6A 3UZRA 3FWQA 1GIJA 1M7NA 1W8CA 3GU8A 4L67A 3FC2A 4X2FA 3LJ2A 5E4HA 5DT3A 4D2PA 4ZTMA 4L44A 2B54A 5IUGA 1DI9A 3EIDA 3FI2A 2R64A 4CZUA 4RQKA 4YZCA 3O8TA 3O8UA 3SOAA 3GOKA 2UZTA 4RIOA 3ZCLA 1V0BA 1U5QA 4WBOA 1J7IA 4XRLA 4A9TA 1AGWA 2AC3A 3BBWA 2XIYA 2BZIB 4RIWA 1OL1A 4Y5HA 4I4FA 5IQGA 2G9XA 2EXMA 4RBLA 1XQZA 1U54A 5HIBA 4U8ZA 4C2WA 2VTJA 3N4TA 2WMWA 3OW3A 5AJQA 3JYAA 2HENA 3PLSA 4CMOA 3S4QA 3JVSA 3NAYA 1BX6A 3ID6C 3ROYA 2W1ZA 4APPA 3IS5A 4XYFA 1QPDA 3L1SA 2KTYA 3RAIA 4OAUC 2BRBA 2Z7QA 2QOHA 5D7AA 2VWYA 4FL2A 1JPAA 2XEZA 4DCAA 2HK5A 2VTTA 5AIKA 3DB6A 3G51A 4ANBA 3B2WA 3CLYA 1AD5A 5HE1A 5CX9A 2BZJA 4NIFB 2OZOA 4QTDA 3EZVA 4DTKA 5HOAA 2ERKA 5F94A 4FSWA 1H0VA 3C7QA 3VVHA 4ZEGA 1CMKE 3V5PA 4C2VA 1VJYA 1YI3A 3ZSIA 2BAQA 4JG8A 2XJ0A 2J0KA 3S1HA 4E6DA 2XNMA 5M4FA 4CD0A 4AGCA 4YO6A 2XBAA 1H00A 1ZZLA 3GC8A 3NSZA 2JLDA 4FR4A 2PTKA 4HYHA 4TZRA 3DBCA 2EVAA 3QLGA 4MBLA 4FYOA 5IG1A 1OPJA 3AD4A 3OHTA 5KMOA 2WZJA 3P1AA 4JQ8A 2OICA 4F63A 5HG7A 3R7YA 2OH4A 2YFXA 4FNZA 4GT4A 4IB1A 4LYNA 3RNYA 5EM8A 1PYEA 2QCSA 2XK7A 4BCMA 5LVPA 3TUDA 4P7EA 3ZUTA 4FV6A 4I93A 2HZ0A 5HU3A 4TYHB 3FE3A 3GU4A 3KK9A 3QRUA 3ATTA 1FINA 3H9OA 4EL9A 2FO0A 4JX7A 3MVJA 4ZTSA 2C3KA 3TN8A 4BZNA 4EQCA 1OPLA 4YNEA 5EDPA 3U8WA 4D28A 3I6UA 4KIKA 4YNOA 4FKSA 4DAWA 4RIXA 3TKUA 5AUWA 4GK3A 5KX8A 3NEWA 2PUNA 3VHEA 3OROA 2GNGA 2W4KA 4JVGA 3WIKA 3QWKA 4L46A 4YJTA 3RKBA 3UYSA 4UWBA 2CPKE 3KXMA 3R1SA 4S31A 4CNHA 1T45A 2G2IA 4DFYA 1L8TA 3EJ1A 4L6QA 2QLUA 5HTCA 4ZY4A 5FRIA 4ACDA 4E7WA 4DA5A 4W8DA 4BDFA 2XNNA 2VTOA 4PY1A 5HTIA 3CQEA 5A4QA 3LFAA 4KA3A 3D7ZA 5EYCA 3OD6X 5I0BA 3COKA 3H4JA 4NCTC 3JS2A 3BQRA 2VTLA 3DBQA 4FKGA 3PWDA 3KXGA 4GIHA 4UYNA 4X3FC 1OMWA 4QO9A 3MESA 4XJ0A 2UW9A 2ZVAA 4MTAA 2BCJA 4GUBA 4X2NA 3LJ1A 3MPAA 4G17A 3PVWA 4L3LA 4M14A 2AUHA 3L9LA 3QHWA 4OT5A 3TJCA 3DZOA 3C0GA 4R3PA 4XLIA 3P08A 1APME 3Q9WA 1NA7A 3G9LX 1ERKA 4YJUA 3ZLSA 4DFLA 4H3PA 4RJ6A 3VQUA 4IBMA 2O65A 3CKXA 3OT8A 3W16A 4D1ZA 3ZFMA 4MD9E 4DGOA 1YHVA 2WGJA 3OXIA 1JVPP 5M09A 3AC4A 2DYLA 5ETFA 5ETIA 3EQFA 1OKZA 3ZHPC 4BCOA 3AOXA 4FZDB 4TWPA 4ZSAA 2F2CB 1H26A 4BCPA 1Z57A 4QTBA 2BFYA 3A2CA 5FEDA 2OXYA 4FGBA 3PE1A 2X6DA 4X2GA 1Z5MA 3W33A 2GNLA 4O0TA 5E1SA 5L2TA 5CSXA 4GFMA 3NGAA 4WNMA 4FIEA 4YTHA 4XG3A 4EK4A 1Q62A 4TWCA 4DH3A 3NYXA 2PMOX 4RVKA 4FTQA 4FG8A 4BTMA 2WAJA 3UGCA 4FC0A 2X6EA 3A99A 3ERKA 4FSUA 4GG7A 4Z3VA 1PMNA 5CEPA 1OL6A 4L45A 3DBFA 2UZDA 4JS8A 5HX6A 3CCNA 4BCIA 3DBEA 3ORLA 2YEXA 4FVQA 3QHRA 4FT5A 3F7ZA 3NUSA 4UMQA 4YZBA 5E8UA 5BVKA 3FYJX 3DBDA 5TO8A 1YVJA 5IA3A 4OTHA 3V5LA 3HV5A 2C6IA 5IH5A 4PRJA 4ZS4A 4AE6A 3R6XA 4GU6A 3TIYA 2ZDTA 2CMWA 3FMEA 3LXNA 4LMUA 5BVNA 5LMKA 3UDBA 3OS3A 3LQ8A 3IO7A 4JR3A 5FXQA 2H34A 4D2WA 2FGIA 3IW4A 1GJOA 5LMAA 4DGLC 5JT2A 3KEXA 2R9SA 2C6KA 3ORNA 3QD3A 4FNXA 4F1OA 5J79A 3RP9A 3BYOA 4WNKA 5M07A 3RK5A 4XCUA 5DG5A 2WEIA 4F99A 3KQ7A 3PE2A 2O5KA 1YW2A 4L7FA 4CT1A 4HZRA 1WVWA 2BIYA 1CDKA 3MA3A 5ACKA 1CTPE 2PVKA 3ZTXA 5JZJA 4FSQA 2R3IA 3CGOA 2ZM4A 2YIYA 3OTVA 3SG8A 4WD5A 2OI4X 4JJRA 5D1JA 3PJ1A 5FGKA 2VGOA 5ACBC 4N6ZA 2ITOA 3RPVA 4CRLA 5E8ZA 4U97A 3FHIA 4WNPA 4MBJA 5FUTA 1DM2A 2XJ2A 2WKMA 2B0QA 4A06A 1BL6A 2IVSA 1WBWA 3I1AA 4FSRA 4LQMA 1PJKA 5FP5A 4UMRA 4IX3A 4L00A 3KXXA 4AW1A 4OTGA 4AX8A 2JFLA 4FTIA 5IDNA 3P5KA 3SXSA 3EKKA 3ZUUA 3W8LA 2R0UA 3EN7A 4FV8A 5FXSA 4NM7A 2J6MA 4Y85A 4RWKA 5LOHA 4FOCA 4ITHA 2ZYBA 2CNQA 4UZHA 4BDKA 2QQ7A 4BDGA 5L2WA 3C50A 5HLWA 3C4CA 2YCSA 1B6CB 3Q96A 1XBAA 2IN6A 3B2TA 4EUTA 5CF4A 3KKVA 2C6DA 5B2KA 4FICA 4G3CA 3OCTA 3VUHA 2WB8A 4XP0A 4I41A 4EOMA 4IW0A 2C68A 2ZM3A 4JT3A 3F7WA 5D12A 1SVEA 5IKWA 4C3RA 5AR7A 5A6NA 3CJGA 1KE7A 3E62A 4AOJA 4XNEA 2X0GA 4CFFA 4PP9A 3BE9A 3QX2A 4ZIMA 5LVNA 3ITZA 1XBCA 2W1CA 4HOKA 3R9DA 4HCTA 5I9UA 2UZBA 4MEDA 5A4CA 2B9JA 4AA5A 3VRZA 4AXAA 3WYXA 4EK6A 1W82A 1UKHA 2R3NA 3DKOA 4FNYA 4D0XA 1SYKA 3ZH8A 4QQ5A 2P2IA 3BV2A 5EM5A 4ZTLA 3TDVA 4CGAA 3NYNA 5J7HA 2OIDA 3CE3A 1GZKA 2PZRA 3ELJA 3OUKA 3EWHA 1O6LA 4UZDA 5KMJA 3OWLA 5J8IA 2Z2WA 5J87A 3WZJA 5E92A 5BVDA 4EH9A 1CKJA 5DYJA 1PMEA 4E20A 5EYDA 4YPSA 4EOOA 4BTJA 3GVUA 2ETRA 4XG4A 4UV0A 3V51A 4F08A 5KNJA 2VTIA 4IB3A 4FSNA 3PXFA 3EFLA 4IM2A 5G6VA 4AA4A 4BDIA 1ND4A 1OM1A 3FKOA 4ZLOA 4HYIA 2V62A 2WO6A 4DFBA 3DB8A 3KREA 2J9MA 2C3IB 3IKAA 5EM6A 1UKIA 3H0ZA 4ZZMA 2OZAB 3NUNA 2PVYA 2WEVA 4C62A 4F9AA 2YERA 5KO1A 2DWBA 3H9FA 4JAJA 4G3FA 4BI0A 1PY5A 1V0OA 5AAFA 3EQHA 2XK9A 3KA0A 4FTLA 4XX9A 3ZEWA 4PTCA 3PIYA 2J0MB 5CU4A 5KMNA 1UWHA 3L9PA 4S30A 3MPMA 3TTIA 3JY9A 4FTAA 4F9BA 1VR2A 4LFIA 5DVRA 4V01A 3R1NA 3LJ0A 3HLLA 4FZAB 4CTBA 5K0XA 3VF9A 3BHHA 2IVVA 3WILA 3CGFA 2OK1A 4GW8A 3HV4A 3DJ6A 4XHKB 4GRBA 3P7AA 3LMIA 2I40A 2O64A 2PVFA 3UIXA 2HZNA 3N9XA 3VQHA 3B8QA 4NZWB 4R7HA 5A6OA 1JQHA 4QYEA 2RFSA 2RG5A 3BRBA 4KRDA 4FODA 3Q5ZA 4GK2A 4BFMA 4EH2A 1R39A 3RAKA 2E9UA 5A4EA 2XIXA 3D0EA 4C4IA 2YDJA 2IWIA 2EXCX 2OIBA 4G16A 4FIIA 1QPJA 3R04A 3FI4A 2GHLA 4X3FB 3IGGA 4A4XA 4ACHA 4LM5A 4LRJA 3BLQA 4OTPA 5C26A 2BROA 4ANOA 2F7XE 3BEAA 4NK9A 4U3YA 3RHXA 1BKXA 1P4OA 2DUVA 3GQLA 4FEQA 2O8YA 2QHMA 4ZLZA 4FE2A 2Q0BA 5AA8A 3NNWA 2W99B 2WQNA 4PMMA 3FZSA 4G34A 3ZONA 3BYUA 5AV0A 3HP2A 2WPAA 4F9YA 4M66A 4WA9A 3AGLA 1B38A 1LUFA 4MKCA 5FBOA 4DLIA 4EOKA 2YZAA 3ACJA 3OG7A 5CU3A 3ZOSA 3EYHA 1UU8A 3RVGA 5AP6A 5L2IA 4BCQA 3PZEA 4BBMA 2RG6A 1UNHA 3VNTA 2R3FA 4CFUA 4N6YA 3CTQA 3U6JA 4JIKA 3D83A 4PNIA 4YJVA 5CSPA 4FEXA 3DT1A 3W32A 4ITJA 4FV9A 3MI9A 3FJQE 3VO3A 5IH6A 3C4WA 3QCXA 5HD7A 3SGCA 3WZDA 4YLLA 4U44A 3FMKA 1U5RA 4L01A 3ZO1A 4B99A 4E6CA 3HMIA 2HELA 3ZSGA 4C34A 3ZRMA 3PRFA 1FOTA 2XCKA 5AA9A 4FKUA 3V5TA 5ANDA 3PSBA 4MQ2A 3LCSA 5AP1A 4LV5A 4J53A 4X21A 2WOTA 5H8EA 2B9FA 3IW6A 4ANNA 5GHVA 4O84A 2YJSA 3PTGA 3TG1A 5LARA 3D2KA 2RFEA 4C7TA 3PLAE 4L68A 4HZSA 1TVOA 4FX3A 4NM3A 5I5ZA 5J5SA 3DY7A 4AZFA 5IEXA 1FPUA 2C0OA 2QODA 3H10A 3FEGA 4BKJA 3AT3A 4I22A 5EQPA 2QONA 1O6YA 2F57A 4BCGA 1HCLA 3P78A 4EOJA 4RJ7A 3QQJA 4YLKA 4LUDA 4C0TA 5KMKA 3PSDA 4O7WA 4GKIA 4GU9A 5CAPA 5L4QA 1H1SA 2QKWB 3EN9A 3PIZA 4FTNA 2CKQA 1ATPE 5F4NA 4NL0A 1VYZA 3ENHA 2W17A 3FLQA 4G6NA 4XMOA 1ZYSA 4PMPA 5HORA 4YTIA 4U43A 3LOKA 3QGWA 1NXKA 2XM9A 5AUZA 4FKVA 5CXHA 4BTFA 3HV7A 2JDOA 4HGTA 4NH1A 4ZSGA 5C9CA 5CF5A 1YOMA 1IR3A 3C13A 5HNGA 4AUAA 1SNXA 2ZB1A 4OTWA 5FTOA 2F7ZE 3RPOA 3ANQA 2UW5A 4M68A 1PXJA 4EK3A 1OIQA 2RSVA 3LM5A 3BI6A 4IWPA 4Z55A 4AOIA 5JMSA 5M4UA 5JQ8A 5JZNA 3QD2B 3QZGA 1J1CA 5GJGA 4TL0A 1XO2B 2J90A 5M55A 3TZ9A 1JKKA 3LE6A 2NPQA 3ZZEA 4RFZA 4F65A 1K2PA 2PL0A 4LUEA 2V5QA 2J7TA 2VWVA 5FD2A 4NFMA 5ITAA 2HZIA 5IA2A 2IZUA 3Q60A 3QTWA 3VUTA 4NM5A 1WBVA 4GCJA 2QVSE 1NVQA 2OZAA 3R83A 2RFDA 2V22A 4EH7A 4W9WA 3D5WA 1FGKA 2UZVA 3TNPC 3KMMA 2JBPA 5DA3A 2J51A 1P2AA 4TPTA 4CYJA 5HCZA 1WVYA 2UW4A 4CT2A 1JSTA 3TL8A 4B8MA 2YWVA 2W1DA 2X9EA 3CC6A 2ITQA 2V7AA 1YWNA 2YCFA 4RJ5A 2QU6A 3PJ8A 4YBJA 3R8PA 3UBDA 1BLXA 4IX6A 2JIVA 3RWQA 4X3JA 1M2RA 4IB0A 4FK3A 3WBLA 1XR1A 2J5EA 3LFBA 4C33A 1L3RE 1DS5A 4PL3A 3ZLYA 3NDMA 4CTCA 3ZS5A 4JDJA 5IA1A 2RF9A 1YOJA 3HA6A 3OP5A 3RHKA 2W05A 4IVAA 1TKIA 4QP1A 3SHEA 3T9TA 4AP7A 1IG1A 4EQUA 4MHAA 4RC4A 3GXLA 3A7IA 4I94A 4CFMA 2YZLA 1ZOHA 5DI1A 4Q9SA 2YITA 4USDA 3VJNA 1FBNA 2GTMA 4GK4A 4EOPA 4ZOGA 4MD7E 4ZZOA 3Q4TA 5LCKA 3CR0A 4RX5A 3HEGA 1IEPA 3ENMA 1JBPE 3U9NA 3E3PA 3FYKX 2C6MA 3RZBA 4C57A 4FT3A 1E1VA 3KVWA 4JG6A 3ALNA 3FMHA 5BX0A 3C4FA 4G5JA 4M0YA 4XS2A 4Y5QA 4MXXA 4Y72A 4UWYA 3R73A 4EZ5A 3JY0A 5K0KA 4R7IA 4J8NA 3OMVA 2ITWA 3CQWA 4H1MA 3PVGA 5EHYA 2C0IA 4A4OA 1W0XC 4CG9A 4C36A 4EJNA 4CEGA 4UWCA 3TKHA 2XIRA 4H3QA 3TEIA 5J5TA 3ANRA 3HRCA 3PYYA 5AX9A 2Y7JA 4IZAA 4L8MA 2ZV9A 3A4PA 5FLFA 4BYJA 3GEQA 1Q99A 2W1FA 4D58A 1OBDA 3OEFX 4DH5A 5HHWA 4ZTRA 4D5HA 3TCPA 3OC1A 3B8RA 4DH8A 3DK3A 5HX8A 3GT8A 2Y4PA 4Y8DA 3OOGA 3OVVA 4R5YA 4C02A 4QMYA 4N57A 3LFQA 5IQAA 4XLVA 3NVKI 4FV5A 2QNJA 4IIRA 1JSUA 4BDDA 1I09A 3R7UA 4X7QA 4AN3A 2VTSA 3EOCA 3LHJA 5IA0A 3ACKA 3F5PA 4K6ZA 4QQJA 3QBNA 5B2LA 3TKIA 3KGAA 5IISA 2QG5A 3E87A 2ZOQA 3W2CA 2UW3A 3V01A 3A7HA 4RT7A 3ORKA 3MIAA 4PTEA 4LL0A 5FEQA 4U80A 4RMZA 4FV1A 3FKLA 5CAOA 3H9RA 3G5DA 5EK7A 1H4LA 3TV6A 5GZAA 3O7LB 3WI6A 4CMUA 2PMNX 4ASZA 2YM7A 4RZWA 4BWPA 4AGUA 5L8LA 1RJBA 4CCBA 3PSCA 4NU1A 1MP8A 5K5XA 3HUBA 4Z9LA 2QI8A 1V1KA 4G9RA 2PUUA 3EQRA 3JVRA 4G31A 4UMUA 5JFXA 4JX3A 3UIUA 3ZFXA 3O0GA 4RC3A 4EI4A 1Q8YA 3R7OA 4CVAA 3VULA 4HVSA 5EQEA 5HO6A 3A60A 5FM3A 2CJMA 4IXPA 3G0FA 3I0QA 3VW8A 1FGIA 4MF0A 3ZBXA 3R2BA 2XRWA 2XKEA 1PHKA 1H25A 2F49A 3KF7A 3O96A 3BZ3A 5AV2A 2GQRA 2XK8A 5KBRA 4BGQA 3P23A 5K9IA 2GU8A 2X7OA 4FT9A 1GIIA 1OKYA 3PXRA 4FIGA 3PP1A 2OLCA 4I5MA 4TYJA 2J0IA 4O0SA 4IAZA 2PVLA 1OL2A 3COHA 2GDOA 1PW2A 2R3RA 4XG7A 2BDWA 5DRBA 4BCFA 2QU5A 3OWKA 2VAGA 3LFEA 4JNWA 2C6LA 4BL1A 2HWOA 1XH9A 5E1EA 2YJRA 5EG3A 4DEIA 2UUEA 5IU2A 2WIPA 3VN9A 2R3MA 2C5XA 4ALUA 4X6RA 5C01A 3AC2A 2IZTA 4QTAA 4YHFA 5H3QA 1PMVA 4GEOA 2YAKA 5EYKA 5CQUA 2JAVA 3BHVA 3NCGA 2VX0A 4RA5A 4Q9ZA 3SRVB 2R3HA 4N4SA 3A61A 5ANEA
chains in the Genus database with same CATH superfamily
3GU7A 3UG1A 1WBNA 2BHEA 1OIRA 2ITNA 4RLLA 2XK3A 4HVIA 2XARA 4A4LA 4EC8A 3UO5A 3IW7A 3ZO2A 4EH8A 3EH9A 3NNUA 3AGMA 2XJ1A 2PHKA 5IUIA 3GGFA 3TZMA 4E1ZA 3M11A 3PFQA 2PZYA 1FQ1B 3LCKA 3IOKA 3C0HA 3H30A 3QTQA 4OW8A 3RZFA 3EFKA 3FZOA 5IZFA 4E5WA 3FSKA 3WOWA 2DQ7X 4H05A 3MTFA 3O71A 4TWNA 4ID7A 1ZZ2A 2WMVA 4FTRA 5LWNA 4Q5HA 4IMYA 2RGPA 2XUUA 4PDSA 1XH8A 1YXSA 1OZ1A 4A07A 2W9FB 5FDPA 4ZSEA 2GHMA 1E1XA 1H1WA 2QOQA 2OXDA 3KC3A 4XV1A 5CEMA 4AZSA 5J9LA 4ZSLA 3NNXA 3ZLXA 5DEYA 5AUYA 2WQMA 5E8WA 2JKKA 3UNJA 4Z7HA 4EJ7A 5BV3A 4RIYA 4E8AA 4BRXA 1ST0A 2C0TA 1M52A 3CD3A 3R21A 3MVHA 2W5BA 2P0CA 5E8SA 4XH6A 5CNNA 3LFFA 3RCDA 4AU8A 4D1XA 4IZ5A 2IEWA 2WMUA 4FTOA 3NS9A 4XG8A 3RWPA 2GQSA 2VNYA 4LRMA 4AF3A 3A7JA 3TNQB 4V0GA 1DAWA 4GT5A 4DG2E 3RALA 4XRJA 3U51A 3E7VA 3TT0A 3O23A 1TQIA 4FIFA 2VTMA 5DN3A 3VW6A 4IZ7A 4ANLA 4D9UA 1J7UA 1BI7A 2BPMA 3TIZA 4APCA 3FPMA 5TF9A 3FQSA 3MB7A 4NW6A 3GCVA 3DOGA 1CSNA 2ZMCA 4NM0A 5KCVA 4UYAA 1WMKA 2C1AA 3OOMA 1UWJA 3UG2A 1FVTA 3DV3A 2WTVA 4HNIA 1ZYDA 2BILB 4S2ZA 1YOLA 3DDQA 5JRSA 3AC5A 4IWDA 5K4JA 4O7RA 1I44A 3MGYA 4S33A 3GBZA 1Z9XA 3COMA 4OT6A 4FV3A 4C3FA 4GKHA 3BLAA 5I3RA 3U6HA 1U59A 2OG8A 3FKNA 3KRRA 3VUIA 4JRVA 1R3CA 2BR1A 3MV5A 4UBAA 3DTWA 5DFPA 4OTIA 2ONLC 2C5NA 2PU8A 3KULB 3TDWA 2PVNA 3DXQA 1SMHA 3QTSA 3UIBA 4IQ6A 2RKUA 3FUPA 3LCDA 4K33A 4QDVA 3ZRKA 4O0UA 2QO2A 1J1BA 5CYIA 1W98A 3D5XA 3Q4CA 3OWPA 2WMSA 3PVUA 4XG6A 3DFCB 3O17A 3LIJA 3UOLA 3PUFC 4M7IA 4U45A 2YCQA 1K3AA 4JIAA 2YM4A 2P55A 5CVGA 1Y6AA 4QMPA 4OGRA 1YDTE 3II5A 4PF4A 5L6OA 1YRPA 5J1VA 3NUUA 3QTRA 3R8UA 3POZA 3E88A 3JUHA 3WE8A 1GZOA 2G2FA 3MS9A 4O96A 4QP6A 2R7BA 3DAKA 5I9XA 3VF8A 3N4VA 1R0EA 2J4ZA 3OTUA 3CS9A 1DI8A 4KNBA 4Y83A 3CXWA 3FMMA 4LOPA 1Q97A 2W0JA 3D9VA 5AP4A 3KCFA 1O9UA 4M0ZA 5IUHA 5EFQA 2WNTA 2A98A 2QOBA 5CEKA 2J0JA 3FXXA 4FKLA 5J95A 3S0OA 1UNGA 4O82A 2O0UA 3HDMA 4E4XA 4ASDA 1CKIA 3GOPA 3BCEA 2ITPA 2XYNA 5EHOA 3AT2A 3FI3A 4TWOA 3DLZA 3VBYA 5HE2A 4RG0A 3OXZA 3MFUA 2HWPA 2YACA 4I4EA 3LCTA 3QD4A 4F1TA 5CT0A 4EKLA 2XP2A 3HVCA 1PRYA 1FVRA 4I1ZA 3EN6A 3BPRA 3HUCA 1AQ1A 3KN5A 4AW0A 3UC4A 4WRSA 3SD0A 4DBNA 4X2JA 4O7VA 3QRTA 1ZXEA 4FSMA 2Z7SA 1RW8A 5DHJA 3MY5A 1H0WA 4XBUA 2XYUA 5CEOA 4L7SA 4XV2A 4E5AX 3WIGA 2QKRA 3CD8A 4IVBA 4S34A 4IC8A 4BIEA 4HNFA 4IJ9A 4D2VA 4GVJA 4YPDA 3NR9A 2OH0E 2R5TA 3F5UA 2IO6A 2HXQA 1PYXA 3C5UA 4FMQA 5C1QB 4C38A 2PUPA 1ZOEA 3L8SA 4KABA 2UZOA 2W1EA 4RZVA 3C5IA 4FG9A 5A46A 1KUTA 5IA5A 4O83A 4QMTA 3I5ZA 1RQQA 1XHAA 2YHVA 1BUHA 4XP3A 1R78A 4HJOA 4HPUE 3UPZA 2HCKA 4O0RA 5HLNA 3LCOA 3MBLA 1NVRA 4CLJA 4H58A 3E5AA 3HMPA 4IC7A 3SA0A 2BRHA 2VNWA 3P7BA 2Z60A 4U42A 2NRUA 4TNBA 4BDBA 5J9ZA 3SW7A 3JR1A 3V8TA 4O21A 3P5JC 4FNWA 4FEWA 2YM3A 3CQUA 1Q8WA 4O1OA 2VWBA 3IG7A 4D0WA 5K3YA 4CYIA 4DEBA 4UEUA 3PA5A 2WXVA 1KE5A 4O6LA 3V8WA 3QUDA 4DFZE 5LJJA 3S3IA 1P14A 3D94A 3FMLA 2FSOX 2FSLX 2I0HA 2GS6A 3NUYA 3OY1A 5BUEA 4HGLA 3MJ2A 4WT6A 2YN8A 5HESA 4F78A 4YSMA 3Q52A 3TNWA 2IW6A 5GIOE 1GZ8A 4QT1A 1OVEA 4AFEA 3AC3A 4KIOA 3E8DA 4NIFA 4M8TA 4QQTA 5GJFA 4DTAA 2AYPA 2R3LA 3UDSA 4HYSA 4IAYA 5ANKA 2YIWA 3BWFA 3RNIA 3HA8A 3BX5A 5B0XA 4YJPA 2XK6A 2XF0A 2PPQA 4U79A 3ZU7A 3LMHA 3RK7A 2VTPA 4DHFA 4EHZA 1UU7A 4FV0A 4JDKA 5FTQA 5CU2A 3PA3A 3LAUA 4O7YA 3MTLA 4F0FA 2JIUA 4KKGA 4O7ZA 4YC6A 3W18A 3ET7A 2X4ZA 3QQHA 4LRKA 3EQIA 4JR7A 5CS6A 4ZXTA 4B7TA 3I7CA 1GIHA 5H9BA 3P0MA 4MBIA 5CSVA 3I4BA 2QURA 3NX8A 4O4FA 3O51A 4CV9A 4ZLYA 4DHJA 3DJ5A 1MQBA 2BDFA 2BUJA 2I0EA 4TYHA 3ZLWA 4YGAA 4JQEA 4K77A 3DPKA 4PUZA 3HAVA 3F6XA 1PXMA 3FXWA 5DMZA 4MCVA 3UQFA 3W0OA 2UV2A 1BMKA 4CCUA 3SLSA 4HCVA 4RQVA 3U4WA 3OUNB 4KAOA 5EDRA 5HLPA 4IVCA 3K5UA 4C4HA 4F4PA 5EOLA 4QMQA 3F88A 4GFGA 1LPUA 4RWLA 1Y57A 3QKKA 4GJ3A 1J7LA 4WBBB 2B7AA 2VRXA 1Q3DA 4G1WA 5I3OA 2OJ9A 3GU6A 4N0SA 1YDSE 2GSFA 3AKLA 3W2QA 3R9NA 1FMOE 1H08A 4QTCA 5FBNC 2E9NA 2OJIA 5A4TA 5JQ5A 4O27B 4F6SA 3LLAA 4EBWA 5LXMA 3TZ7A 3CY3A 3KIOC 3DAEA 5HIDA 3TMOA 4KS8A 3BLRA 3Q04A 3IDBA 2J5FA 3R9OA 5ANJA 2GS2A 4PX6A 1A06A 2VWUA 5DR6A 3VS5A 3GU5A 1KSWA 1STCE 2C69A 5EDQA 3R9RA 2PVMA 3I5NA 4DEGA 3D7TB 4JDIA 4P90A 4DH7A 4O6EA 5LQFA 3R8VA 3ROCA 3A7GA 3PPZA 4Y73A 2YWPA 2H6DA 4PDOA 5ANGA 1W83A 2W7XA 4U9AA 4FTMA 3MYGA 4RRVA 3LXPA 3NCZA 5DRDA 4OTFA 2UW0A 4CZTA 4ZK5A 1ZMVA 3QUEA 4R8QA 1WCCA 4WIHA 3QCQA 2C6OA 5CU6A 5TE0A 5AWMA 5DOSA 2F2UA 2JDRA 4EYJA 1XKKA 3AC8A 4KIPA 4ASEA 2GTNA 5BVWA 4D4VA 2I6LA 3DDPA 2E9OA 4GYGA 5JFWA 3BELA 2R3KA 2GNFA 1WBPA 2V55A 2C5VA 5EKOA 5ETAA 3R8ZA 4J71A 3R7GA 4ANMA 5E8XA 4ZS0A 5AV3A 4BI2A 2UZEA 4YSJA 4J99A 5KMIA 4NJDA 2H9VA 5GZ9A 5C4LA 4I5HA 2XIKA 3QL8A 3F2NA 3QA8A 4CKIA 2PVHA 3PP0A 3QLFA 4QMVA 3AQVA 4E6AA 3AG9A 4KINA 5H8GA 4E73A 3LZBA 3G15A 5CXZA 2YIQA 2HW6A 4JRNA 3DTCA 3FZRA 1FMKA 3ATSA 4I6BA 1XH6A 3L8XA 4FV4A 1K9AA 2ITYA 3TYKA 3LW0A 3ZBFA 3QAME 5T3QA 1R1WA 3BHUA 4IZYA 4O0WA 1A9UA 3CPBA 3F9NA 4I6HA 3C9WA 3HECA 4EH3A 4WSQA 4JMQA 3Q9XA 2PZIA 4C4GA 3H3CA 4AAAA 2HW7A 2J0LA 3CKWA 1SNUA 2EB3A 4XUFA 2ITTA 4DINA 4C4FA 3FL5A 3DK6A 3ORXA 3EMGA 2B9IA 2OIQA 5JH6A 2X2KA 2C5OA 4FBXA 4RVMA 4XEYA 4UMPA 3VAPA 4JQ7A 3BYVA 3T8OA 3OBGA 3R01A 4GMYA 3N51A 4UN0C 5GJDA 3WF5A 2WU7A 3C0IA 2XAOA 5BYZA 3ZC6A 2UVXA 4I20A 4O0XA 3QZIA 5AP7A 2ERZE 4H1JA 4FRFA 4RJ4A 4FI1A 2UW6A 3ZUVA 2YIXA 4AQCA 2GNIA 3QGYA 3IPHA 4PTGA 2IG7A 3KVXA 1W2DA 4MNEB 4FIJA 2HYYA 5T68A 4DCEA 3DXNA 4A9RA 5IQDA 4BCJA 4GSBA 2X2LA 4JI9A 1WFCA 4QP9A 5D11A 4BCKA 4DC2A 4PNKA 5HD4A 3KMWA 2WIHA 3ML1A 4G5PA 4IACA 3VS4A 5HVYA 2NP8A 4YUQA 3UOJA 4C35A 2QOCA 1ZOGA 4K0YA 5LVMA 3GC0A 1M17A 1XJDA 3WF8A 1LR4A 3AMYA 3BIZA 3MFTA 5GNKA 5KMLA 2YAAA 3UNKA 4R6VA 2BFXA 3LM0A 1GY3A 5KZ0A 5M44A 4MNFA 4E4NA 4O1PA 1U4DA 3EQPA 5A4LA 5M53A 1KV1A 2IF8A 4BHNA 5F9EA 4IANA 3R7IA 4AZEA 2I0VA 2X8IA 1JNKA 4TRLA 5CVHA 5CAQA 1YQJA 4QOXA 1UV5A 2RFNA 4RWJA 4DH1A 4EOSA 1IA9A 3I60A 4I0SA 2E9PA 3QA0A 4NSTA 4AN9A 3EFWA 2PMIA 4TY1A 4D4SA 5BYYA 3MY0A 2FB8A 4W4VA 3H0YA 3L8VA 3SXRA 5C8NA 3HNGA 4DGMA 2ZAZA 4IX4A 4QMZA 1TFFA 3CPCA 3EN5A 4F0IA 5AFVA 2XNBA 2HY81 2JKOA 1ZRZA 1OKVA 3QTZA 4M84A 3E8EA 4MX9A 4TTHB 4XV9A 3R8MA 3TV7A 3WZUA 4YTCA 4RSSA 4M12A 5TOZA 3QQLA 1A48A 4O38A 3U87A 3VJOA 5LMKC 3FC1X 2BAKA 2XEYA 4FKOA 5HIEA 5CT7A 1YHWA 4QMNA 4QMMA 2YLEA 5JFSA 3W0QA 5M08A 3LQ3A 5CASA 4ANQA 5CEQA 4RJ8A 5ANOA 4IHPA 3F66A 3Q2JA 3AT4A 4KKHA 3NAXA 5LVOA 2O3PA 5EH0A 4AOTA 1LEZA 3Q3BA 4E93A 3SXFA 2LGCA 3CIKA 4PMSA 4RPVA 4DGGA 4QMLA 4XBRA 3WE4A 2IVUA 4QMUA 2VO0A 3D7TA 4BVUA 2QOOA 1IRKA 4D1SA 3D15A 1SZMA 2BRGA 4V05A 3SDJA 2AC5A 2O63A 4BZOA 5HI2A 1YHSA 2UZUE 5HNBA 5AR8A 2C30A 3E7OA 3NUAA 1NW1A 3MFSA 5KMMA 2WMQA 4FOBA 5KKRC 4J95A 4W9XA 4FA2A 4B6LA 4UB7A 1HOWA 4MYGA 1TZDA 5C27A 3UO6A 2Y9QA 3QC4A 5CALA 3W2PA 3RCJA 2ACXA 4F6UA 2GCDA 4KBKA 3Q32A 5CSWA 3UE4A 5AV4A 3R71A 4P5QA 4W4XA 5HGIA 3UMWA 4UMTA 4BIBA 3RPRA 4QMOA 4FKTA 3POOA 1S9JA 3D5VA 5DBXA 2X81A 1IAJA 1BYGA 5AUUA 5M51A 4M15A 2HXLA 4DFUA 3CEKA 3GC7A 3I6WA 4RIWB 3MN3A 1M2QA 3LXKA 4I23A 5CSHA 4EOIA 1U54B 3NW7A 3P86A 2XCHA 3CY2A 4JAIA 3IDPA 1IA8A 3GI3A 1M2PA 4NJ3A 4FT0A 3MH0A 3UPXA 2C3LA 3BL7A 3QRKA 4NCTA 4ACMA 3FMJA 2XBJA 4X3FA 3CTJA 4A9UA 1LEWA 4M3QA 4BN1A 4ZJIA 1SVHA 4BGGA 4GUEA 3F3VA 4RX9A 3NWWA 4ARKA 4AWIA 4EQMA 2ZJWA 2OFVA 3HYHA 4QP3A 3VWAA 5L2SA 3HAMA 1NVSA 3IGOA 4WUNA 3S95A 3A62A 1WVXA 3D14A 1OB3A 4PWNA 2UZWE 4MK0A 2BHHA 4YR8A 3VUMA 1ZYJA 5AEPA 2W5HA 5AV1A 2OF4A 2ZDUA 3ALOA 3UQGA 4FK6A 5DPVA 2WTKC 4G3GA 4LL5A 4EUUA 4E4LA 2CGXA 5DH3A 2PY3A 1VYWA 1PF8A 3DGKA 3LFCA 2WQBA 3U55A 1H28A 3F3TA 4HVHA 4ZAUA 5I9VA 4BKZA 3DKCA 5AP2A 1PMUA 2HOGA 3GC9A 2CDZA 4YC8A 1KOBA 4ENYA 3Q6UA 4QMXA 1NT2A 2XKFA 2VTHA 4P5ZA 2BKZA 4EOLA 5A54A 4IH8A 3ZXZA 3W0NA 4WG3A 3DS6A 4AZVA 4O22A 4C4EA 5HCXA 4MXCA 2XNEA 4RFYA 4CRSA 5JFVA 3FL4A 5J7BA 5IA4A 3BU5A 4K1BA 3TTJA 4AGDA 3PG1A 4FKJA 4X2KA 3WARA 4R7BA 3EFJA 5AMNA 4CSVA 1ZAOA 4XV3A 2B4SB 1G3NA 4CZYB 4M13A 3PDTA 5F1ZA 4QPMA 4GV1A 4RVLA 4OAVB 5HKMA 4OBPA 3UQCA 3BWJA 4FSTA 5EKNA 4RIXB 2QO9A 4AT4A 5L2QA 2A2AA 3DFAA 3MVMA 4W4YA 5H8BA 2HAKA 3FMNA 4ZTHA 1P5EA 3CJFA 1PXIA 3PJ2A 3RMFA 1X8BA 2XM8A 3R0TA 3VS3A 3Q5IA 1QPEA 1URWA 3DNEA 2WTJA 4AT5A 3QUPA 2JEDA 3W2SA 3DKFA 4QNYA 1RE8A 5DR2A 3ZSHA 4ALVA 4O4CA 4EONA 2A27A 4KKEA 1J91A 3FQHA 3K3JA 5HVKA 2JGZA 4O7NA 4ZY5A 4FIHA 4O2PA 1FVVA 4MAOA 3OCGA 4FTCA 4F1MA 4NW5A 4JLCA 2OW3A 3GENA 3NW6A 2VTQA 2GMXA 3MA6A 2P4IA 2BIKB 4K8AA 2F9GA 4LG4A 4ONAA 5KUPA 1MRUA 5CZHA 1H1QA 4Z16A 1QL6A 4KB8A 4E6QA 3SC1A 3MH1A 3DKGA 4J1RA 4NEUA 2XS0A 3W2RA 2OFUA 5CF6A 3A4OX 4RX8A 4FTTA 4AGWA 5HO7A 3GP0A 1Y8GA 1E9HA 4GYIA 3ZC5A 2BRMA 4FKRA 2Y6MA 4Y95A 2WELA 3MVLA 2B53A 2I1MA 4IVDA 3ZO3A 5AUXA 4O86A 3U6IA 3TUBA 2V7OA 2B55A 4TNDA 3IQ7A 2VO6A 3UZTA 3UVRA 1W2CA 2JDSA 3LFDA 1MRYA 2VTNA 3NIZA 2FSMX 4IJPA 2XKDA 1G8AA 1IAHA 2QOKA 4YJOA 3UVQA 2VZ6A 1Q5KA 5LCJA 4R5SA 4R78A 2XA4A 4OR5A 3V5QA 4QD6A 1Q8UA 4I21A 3O7LD 2C1BA 2BTSA 4OLIA 4WKQA 4B9DA 2B1PA 4EHVA 2XNPA 5KBQA 2W96B 4I6FA 5L3AA 3OBJA 4R1YA 3VBVA 4DN5A 4EORA 4EHGA 2VWIA 4Q5EA 3W10A 2CN8A 4MUQA 4DT8A 2OSCA 3PXKA 2WTDA 1MRVA 3G2FA 2UW7A 3UMXA 1JSVA 4OTDA 2GPHA 4JBVA 4CV8A 3Q2MA 5AP0A 3ORPA 4D2RA 2YCRA 1GOLA 2JIIA 3C1XA 3ZXTA 3ORIA 4TT7A 4BGHA 3WF6A 5CF8A 5IH4A 2YA9A 1UU9A 3IK3A 2VV9A 3E92A 3F69A 4KRCA 1M14A 3PFYA 3FZPA 4KSPA 4IAFA 3VRYA 4YU2A 3CTHA 3F3UA 3E93A 4KBCA 5AR4A 1ZMUA 4TN6A 4L9IA 3R7EA 4E3CA 4GVAA 3F5XA 4G9CA 1IASA 3R28A 3C4ZA 3GB2A 2Y8OA 2WOUA 2QLQA 2QOFA 3BHTA 3AD5A 5HE0A 4DBXA 3QYWA 5EW3A 5BVFA 3VS0A 1O6KA 3FQEA 3QFVA 5KZIA 2I0YA 3UP7A 4FEUA 3KRWA 1UU3A 5IQHA 2PE1A 4EK5A 4ZMFA 2X1NA 4D4RA 1YWVA 5HE3A 4NTSA 4M69B 2HY0A 3HZTA 4IWQA 1Q61A 3VBWA 4C4JA 2B52A 2PULA 4FUYA 4LI5A 4OBOA 5M06A 2X39A 3KL8A 4AZWA 3SG9A 4B8LA 3KRLA 5KKRB 4YO4A 4A9YA 2XZSA 4BI1A 3OXTA 4I0RA 1QPCA 3SOCA 3EN4A 2R7IA 3REPA 5CWZA 4ZJVA 1CKPA 1YKRA 2W9ZB 4GT3A 4FGRA 3O8PA 4U3ZA 3ZEPA 5IQFA 2G1TA 3QQKA 2YDIA 4FSZA 5HG8A 1PXKA 2ZB0A 3PRIA 2HIWA 3EQCA 4IADA 3ULIA 4CKJA 1G8SA 4NYEA 3RPYA 3ODZX 5EW9A 3UZPA 4AE9A 2XKCA 4NKAA 5DIAA 3PVBA 2WTCA 4G6OA 5DLSA 3KRJA 1ST4A 2OBJA 3TNHA 3LKMA 3DNDA 2QR7A 4BJJB 2GFCA 3QZHA 2QO7A 4GJ2A 4WG5A 3HMMA 3Q9YA 3P79A 3PZHA 3DA6A 5AIRA 3KB7A 2YM8A 3T9IA 4U6RA 5CAVA 4BCHA 2XH5A 3PUPA 1W2FA 2YLFA 3BBTB 3GCSA 4CFWA 3DQXA 2A4LA 2C6TA 3DCVA 4DHZA 1YXVA 2R3GA 2AQXA 3TXOA 3WYYA 3HL7A 5JN2A 2QC6A 3NYOA 5BMMA 1GZNA 4YZDA 1KV2A 1Q8TA 3WF7A 2JKQA 5KHWA 2CN5A 1P4FA 2ETKA 2XVDA 4FZ7A 3LVPA 4EWQA 4F7NA 4RGJA 3N4UA 3MSSA 2ZM1A 3RJCA 4YHJA 4L52A 4JXFA 2VWWA 3PA4A 4DFXE 2C5YA 3K5VA 4FV7A 4FJVA 3PG3A 2A1AB 5DNRA 4WG4A 5HVJA 3VS2A 5BVOA 4J98A 4EK8A 1V0PA 4UY9A 5HNIX 4DTBA 4YJSA 3UYTA 1ZLTA 2WTKB 2W06A 5AM7A 2R3QA 3E63A 4O91A 3TZ8A 4BKYA 4O7LA 4MXOA 4IFCA 1XH4A 4IDTA 4F6WA 2XNOA 3PPKA 4WOVA 4AACA 3WZEA 2WQOA 3HV3A 2JDTA 4UXQA 1JOWB 2BDJA 4I0TA 5A3XA 4EH4A 4EH5A 5EI8A 4J7BA 5JK3A 5LWMA 4AXFA 3HDNA 3VS7A 5JGDA 2Z02A 2C47A 2W1HA 5AM6A 4ZY6A 2JKMA 3DXPA 1OITA 3HRBA 3ZM9A 4KUJA 3TACA 3U9CA 2XALA 4OUCA 2PVRA 5DEWA 3OEZA 4RWIA 5IF1A 3T3VA 2Z8CA 4J96A 4ERWA 5EHLA 3QTIA 2OF2A 4D9TA 4KSQA 4JL9A 4FSYA 1KE8A 2VWXA 2FA2A 3GCQA 4IAAA 1H24A 5L6WL 3V3VA 2ZV8A 1SVGA 4TYGA 3BE2A 4DEEA 5D41A 5M57A 3SKCA 3SW4A 1OL7A 4FV2A 2OKRA 4YZNA 4HW7A 4CKRA 3MY1A 3MH3A 3W55A 3COIA 4PL5A 4FKPA 3UNZA 3CSVA 3F2AA 2R2PA 3KXZA 4QP8A 5D10A 3PXZA 2VO3A 3SRVA 2EUFB 4C59A 1OL5A 4RX7A 2F4JA 3G9NA 4EC9A 3KF4A 3VBTA 2CKEA 5HBHA 2FUMA 3KU2A 4AZTA 3FV8A 1REKA 2RIOA 1YWRA 5IQCA 5JKGA 3HX4A 4YP8A 5HG5A 2NO3A 1JWHA 4ANSA 4L53A 4F7SA 1GAGA 5AAEA 4QP2A 3F2RA 1XH5A 5CAUA 2EXEA 3MW1A 4U40A 3F61A 1VEBA 2HZ4A 2WMAA 3MIYA 3LMGA 2JFMA 2P3GX 2XK4A 4UXLA 1Q24A 3GCUA 2BTRA 1OIYA 3I0OA 3TUCA 3RTPA 4DDIA 1WBSA 3IDCA 3R22A 3R30A 1J3HA 1ZMWA 4X6QC 4ZTNA 4K11A 1JKLA 3VIDA 2J2IB 2PMLX 3QQUA 4CXAA 2PWLA 2CNUA 4BB4A 5CU0A 2UVYA 4FT7A 2R4BA 4N70A 1U46A 2WTIA 1PKDA 3FLSA 3W8QA 3QU0A 2ZV7A 4H36A 5EYMA 3PY0A 2Y6OA 4DEHA 4K2RA 3R1YA 4D5KA 5AUTA 1WZYA 3I7BA 5K4IA 5HZNA 5IQEA 4L42A 2YIRA 4M69A 1WBTA 4R1VA 5BUIA 4O4DA 4CQGA 2CHLA 3FHRA 4PP7A 3BEGA 1JAMA 4DE4A 2IW8A 2UZNA 4M67A 5IEYA 3EYGA 3BU3A 2X7GA 1ZYLA 4DITA 2E2BA 4FKQA 2JDVA 4R3RA 2OWBA 5BQ0A 4QEBA 3QRIA 5FG8A 5FTGA 3R63A 1ZWSA 3WZKA 5JRQA 3PJ3A 2NRYA 4NKSA 3DQWA 3FAAA 4FUXA 5CQWA 1WBOA 4NT4A 5HICA 4FKIA 5BNJA 2OO8X 4BDEA 3G33A 5ICPA 3QKLA 3V5WA 1OKWA 3ZFYA 3CP9A 3GFWA 4FYNA 3UVPA 4PPCA 3VBQA 4MWIA 3F82A 3UP2A 2PZPA 2VWZA 3QX4A 3KULA 3VHKA 5JGAA 4QYHA 4EZ3A 4FF8A 4ASXA 4BJJA 5C8KA 3HGKA 4FTUA 2XRUA 4QP4A 3DLSA 3R00A 4QQCA 3FMDA 2IJMA 4TYIA 3NLBA 3PIXA 4MXAA 3DU8A 3NRMA 4QRCA 2BVAA 2G2HA 4DG0E 4AAYA 4W8EA 1H07A 4IWOA 4YTFA 3ZDUA 2UVZA 4BDJA 2ZV2A 2V0DA 2VTRA 2OGVA 3FZTA 3HKOA 3QF9A 4IM0A 4LGHA 2Y4IC 3VC4A 4BDHA 2OJJA 3I79A 2KULA 5G1XA 4QTEA 4D2TA 1OBGA 5LMBA 1KE6A 4PDYA 3Q9ZA 2X8EA 3UO4A 1ZARA 2YM5A 3UDZA 4IE9A 4BIDA 3OCSA 5D9HA 4D4YA 2FYSA 4CFVA 1YXUA 5CANA 5FXRA 4ZMEA 3BKBA 3PPJA 2I7QA 3TWJA 4EKKA 3FLYA 3HV6A 1MQ4A 4X0MA 2CSNA 1UVRA 4FEVA 3LXLA 4BCNA 3MJ1A 2YM6A 2WU6A 1H01A 3TI1A 1JKSA 4LMNA 3SX9A 4FL3A 4RFMA 2PVJA 4WHZA 4FZFB 3RINA 3FY2A 2GNHA 5E8TA 4KWPA 2YDKA 5EQYA 4MQ1A 3EQBA 4JG7A 4YJRA 2GS7A 2F7EE 3TM0A 3U54A 2H96A 4P4CA 4F70A 2REIA 1KE9A 1PXLA 3FY0A 4FZ6A 4FVRA 4MD8E 4QYFA 5TT7A 1F5QA 3THBA 4MXYA 2CGVA 4UX9A 2X2MA 3R2YA 3NUPA 4U81A 3DK7A 3LLTA 1XH7A 4QPSA 5KE0A 4AW2A 4BDAA 4YHTA 3OWJA 3FBVA 4ZJJA 4L43A 2R3PA 3E8CA 3RPSA 4IB5A 5FP6A 2Q0NA 4IAIA 2CNVA 2VN9A 3KN6A 5E8VA 5ANIA 3VS6A 2QD9A 4XP2A 5J9YA 4XOYA 4QP7A 1BL7A 3VUKA 4IFGA 3QTUA 5EM7A 4CMTA 3E3BX 1BI8A 1Q41A 1YDRE 2WMRA 4I5PA 4IAKA 3MH2A 4BZDA 3Q53A 1VLRA 1TQMA 4NFNA 2A19B 4PL4A 1Y8YA 1S9IA 4QPAA 2WD1A 2FH9A 2WQEA 5IMEA 2X0PA 1H1PA 3Q4UA 3FXZA 1Q8ZA 2JAMA 4BC6A 4R3CA 4RVTA 4G6LA 4O2ZA 3RM7A 1QMZA 3PY1A 4MF1A 5CTPA 3NPCA 2E9VA 1CM8A 3GNIB 2GQGA 3Q6WA 2EB2A 3A8WA 4GG5A 4H3BA