4XS2A

Irak4-inhibitor co-structure
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
297
structure length
283
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Discovery and hit-to-lead optimization of 2,6-diaminopyrimidine inhibitors of interleukin-1 receptor-associated kinase 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 283
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xs2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xs2A01
3QTIA 1P4FA 2ITOA 4YO4A 4L00A 4LGDA 4RQVA 1H08A 3H30A 4FC0A 5CSXA 4AACA 2Y4IB 4R6VA 1H24A 4F09A 4CNHA 2FUMA 2CNQA 4D0WA 5E1SA 4JBOA 5FTOA 2WO6A 1P14A 2IVTA 4CSVA 5AWMA 2C6KA 4RVMA 3BLHA 4QTBA 2JKKA 3FWQA 4YMJA 4RFMA 4D2PA 5LVPA 4YJPA 1B6CB 4E73A 4MXCA 4R7IA 3NSZA 2VTLA 3GI3A 3GVUA 4QPMA 2GNLA 3K2LA 1H00A 4RJ7A 4WUAA 4H05A 2WMQA 2C30A 2HZ4A 4I4FA 2WTIA 3RPYA 2BMCA 4GU6A 1JKLA 1MQ4A 3CIKA 3FXZA 3SV0A 3BHYA 3U51A 4O7WA 3ZLSA 1M2RA 5H9BA 5FEQA 5EI2A 1R1WA 4J99A 5D10A 5EI6A 5HVJA 3E7VA 3POOA 5HG9A 2V7OA 4R3CA 3HP5A 4Y5QA 4HCUA 3TKUA 2QD9A 3PPJA 3DBQA 2OXDA 3UVQA 3P7BA 2WMUA 4Y85A 4C4IA 3R8PA 3FKOA 3R1SA 3S00A 3AQVA 3KKVA 3R21A 4KSPA 4LQMA 2CCIA 3DJ6A 3EJ1A 3RK5A 2Z7RA 4D55A 1ZMVA 4YO6A 3W2SA 4QPAA 3BYOA 1YDRE 1ZRZA 3ET7A 4QP1A 1YVJA 2J6MA 4FTLA 4IWOA 4MXXA 3S2PA 3VC4A 2PMOX 2YDIA 4XG9A 3HAVA 2YJRA 3E63A 2WOTA 3TZ7A 4V05A 4TKSA 4EZ3A 1S9IA 3TZ8A 5L6PA 3QALE 2QOFA 2B0QA 5CU2A 1Q24A 3LXKA 4JLCA 4OAUC 3I6UA 5GZ8A 3S0OA 3NNWA 3F2NA 4FIGA 2XEZA 5DFPA 4A9TA 3FZPA 4IAKA 5CYIA 4YHTA 3PXYA 3RM7A 4BI1A 5LMBA 3TNIA 4E4LA 4EOIA 4YPSA 1OIUA 1CM8A 5GIOE 1W8CA 5IQDA 5FGKA 4BKYA 3CS9A 3COMA 1U54A 2CPKE 3PIYA 5AV2A 5I3RA 3UMXA 1T45A 3TG1A 3Q4TA 4EHGA 4EJ7A 3JUHA 3ZOSA 3EB0A 4GMYA 4KKEA 2IG7A 4E3CA 5IQHA 5AP7A 3HL7A 3QTQA 4G9CA 3MH3A 4KUJA 4GFGA 4L43A 3MH1A 4QYFA 1OUYA 4MNEB 2JAMA 3BELA 5KX8A 1W98A 4FICA 5AP1A 1R0PA 3TCPA 4DFUA 5HNIX 3KVWA 4HVGA 4AA4A 1M2PA 3QGYA 4HCVA 4IM0A 5IG1A 4KSQA 4GRBA 4RPVA 4Q9ZA 4QOXA 4DFZE 3DTCA 5L2IA 2HZ0A 4JQ7A 2GQSA 3AC5A 4NEUA 2J4ZA 4UV0A 4ASEA 2CJMA 3EQHA 3L8PA 3C0IA 5HU9A 3RVGA 4ZTMA 2PMNX 2RKUA 3U6IA 3P79A 4N57A 3BWJA 3AGLA 3RINA 5L2WA 1KE7A 4HVSA 4CD0A 4BDHA 4YJUA 4X6RA 1OL2A 4S32A 1P4OA 2H9VA 3LJ2A 4QP4A 4IZYA 1JKKA 2XIKA 3DPKA 1DAWA 2B9IA 1H26A 3C0GA 2VTRA 4GJ2A 5DEWA 5HBHA 3UYSA 1JBPE 3CQUA 4BY9E 3PUPA 4O0SA 4E5AX 1K9AA 3QQGA 4ZY5A 1WBPA 2O65A 3DFCB 3C5IA 2KTYA 4KBKA 5DYJA 4X2GA 4EKKA 5AFVA 3HZTA 2HY0A 1YXTA 3II5A 2I7QA 4EH5A 4O0RA 2WQEA 3IW6A 3UYTA 3HMIA 3NX8A 5F1ZA 3I7CA 4WKQA 4I0RA 3F7ZA 1Y8GA 3ZFYA 4U43A 4NIFA 2IZTA 2VU3A 1JAMA 5JFXA 3R83A 3KL8A 2VTHA 2VTTA 4QMLA 3VBWA 3HA8A 4FL2A 4G17A 3V8TA 3B8QA 4CEGA 3C1XA 3A7GA 5KKRC 2PVNA 3G0EA 3F6XA 4LMNA 3QZGA 2DQ7X 4DGOA 4TL0A 5J1VA 2JDRA 2XBAA 1ZYSA 2YAAA 3HMPA 4N6ZA 2GHLA 3GCQA 4BKZA 4C3RA 5HTCA 3U87A 2PVMA 4PL5A 2WEVA 3CLYA 3R1YA 1G3NA 1NVQA 2YLFA 3QAME 2FVDA 3IOKA 2OFVA 4IWDA 4MHAA 4FKLA 3BQRA 4QMWA 3WIKA 4H3BA 5I9UA 3HUBA 4V01A 1M2QA 2YDJA 5KNJA 2B52A 2ITUA 3W32A 4APCA 5HZNA 5HG7A 3GXLA 4FNXA 5ETCA 3THBA 4FKTA 4FIIA 3DBEA 2CCHA 2PUUA 3U4UA 2GFCA 3SDJA 2G9XA 4IX3A 3VS7A 3S4QA 5I9YA 3EQBA 2WHBA 3CE3A 3VRZA 3PRFA 3FMEA 4MF0A 1IR3A 1GZKA 4RJ6A 4D2SA 3E5AA 4WD5A 1IASA 1VEBA 3HECA 4LI5A 3ZLYA 4EYMA 3AC1A 3GCPA 3RZBA 3BI6A 3H0YA 2Z60A 1PKDA 2OG8A 2X2KA 3LXPA 2QOHA 3PY0A 4M68A 1YI3A 2FSTX 3ZC5A 4AAAA 3FLSA 3FZ1A 4DGLC 3R9HA 3DAJA 4AT3A 3TXOA 5AR3A 4RA5A 2BTRA 2R3OA 1FINA 4FTQA 1WBTA 2UW4A 1LUFA 3NYVA 4AU8A 3E62A 4J8MA 2QOIA 4DEEA 3QRUA 4YLJA 3RPSA 4DEGA 1BX6A 1XKKA 3ORLA 4YNOA 3WYYA 3DTWA 1K3AA 3C4FA 5LMAA 4C3PA 3LMHA 5JKGA 4LRJA 2DUVA 4TW9A 3ETAA 3ERKA 5D1JA 2I1MA 3PJ2A 1Y91A 4BTKA 5K9IA 4GUEA 1MP8A 1VJYA 2YM7A 4RWIA 4TNDA 4JIAA 1OL1A 1OBDA 2W0JA 3R7IA 2WXVA 4FSQA 2Q0BA 3G9LX 4YBJA 3LFCA 4OR5A 2ZV8A 5IDNA 5AR7A 4M12A 1FVTA 4FZDB 4UMPA 3WI6A 2OJGA 5CTPA 3PSBA 1OMWA 4BDCA 4GFMA 3LXLA 4S33A 2GU8A 1P5EA 5E8YA 4EZ5A 3NZ0A 4X2KA 1TKIA 5KE0A 4FNZA 4JRVA 2SRCA 2GNJA 4DTBA 2Y0AA 4YTHA 4LRMA 1KV2A 3HVCA 4FKSA 3UPXA 3DKOA 4DEIA 3OTVA 3IG7A 4JNWA 5KCVA 1MRYA 3QZFA 3RWQA 5EQPA 4ZEGA 4G5JA 2UZEA 2W5AA 4J97A 3G9NA 3WZEA 1Y6BA 2OH4A 2CN5A 3SW7A 3R0TA 3CD3A 2OGVA 3C4WA 3JY9A 2B55A 3SRVB 3BPRA 3QTRA 4ZSEA 4RX5A 1GNGA 3QA0A 2ZDTA 3QQJA 1OM1A 2W4OA 3DBFA 1J1CA 2YIRA 4O6LA 2YWPA 3D15A 1OZ1A 1QPCA 2C3KA 2W9ZB 4DH7A 3QKLA 4OBOA 2P3GX 3OEZA 2R9SA 4JVGA 4W9XA 3KFAA 2QU6A 4X3JA 5AUWA 2VO3A 4FV0A 2XJ2A 5CU3A 2XK7A 4CCUA 4NM7A 3PIZA 4F9YA 4QMQA 4O91A 1IAJA 4FKOA 4AXAA 3G6HA 3OT3A 4USEA 3HEGA 1J7UA 1R39A 5FEDA 4PWNA 4EOSA 3RPRA 2YITA 1PMVA 3PPKA 1JLUE 4IIRA 4KINA 4KRCA 4LUEA 3S95A 5HKMA 4D28A 2ITPA 1Y8YA 1TQMA 3MPAA 4WUNA 3EKKA 3LFDA 3QX4A 4F7JA 2ZDUA 5FQDC 3BZ3A 3BLQA 5HE1A 1DS5A 2F4JA 1XH5A 3PVUA 5EG3A 2QC6A 4II5A 2XIYA 3TV6A 5BUIA 4XEYA 2QOCA 2Z7LA 3F5PA 4UMRA 3FXWA 3EFJA 1REKA 5A14A 1HCLA 3KULA 3MH0A 4IJPA 2XK6A 3GU8A 2AC3A 4IX6A 3VW6A 2OZAB 4RJ4A 2XNBA 4EBVA 3NS9A 2VTQA 4FYOA 2ETKA 1XH4A 4GCJA 4BDGA 4EOLA 4F7NA 2QR7A 4BC6A 3E8NA 2Z7QA 2GS7A 4AZVA 2GTMA 3UG1A 2X7GA 4BGGA 4OLIA 1BLXA 3D7TA 4P2KA 3ZHPC 3KK8A 1JOWB 3AT2A 4L3PA 2QURA 5AAGA 1BI7A 4AN9A 4ZMFA 1JPAA 3TUCA 3MYGA 4YZDA 5M51A 2OICA 3IK3A 4ZIMA 5J5TA 2QO2A 3ZDIA 4O7NA 1CKJA 2WQMA 1PYEA 3G2FA 4DTKA 4FSZA 1CKIA 4FT5A 2VV9A 4D4YA 4RJ5A 3ORKA 4FZ6A 2VO0A 5CAOA 3FZOA 4I3ZA 4RC4A 4CLJA 5M4CA 4IC7A 3UZRA 5AIRA 1JKSA 4APPA 5CU0A 1GIIA 4AX8A 1W0XC 3RHXA 4ZSGA 4HZSA 4X21A 4BCFA 2I6LA 4IADA 3BBTB 3O50A 3F5GA 5HE3A 1QCFA 4NWMA 5AMNA 4JAJA 3DU8A 2WMSA 3M11A 4XP2A 5DR9A 1CSNA 5HCZA 2XA4A 3WILA 4PNKA 2B7AA 2W1FA 4NFNA 4BL1A 2X8DA 4CQGA 2CSNA 4L68A 5IISA 3OG7A 4C8BA 5A9UA 2BRHA 5K5XA 3R02A 1V0OA 3P1AA 3QYZA 2Z7SA 4PF4A 5HG5A 3PA5A 2C1BA 3MVHA 4ZXTA 3KXZA 1GAGA 2QNJA 2CKEA 2PVHA 3D5WA 3DB8A 3EN6A 4HYHA 4F7LA 3FQSA 3CKXA 5LMKC 2F2CB 2E9OA 3RAHA 4AGDA 4AZSA 2I0EA 5M4UA 3ATTA 3L9MA 4FIFA 5ANIA 4DN5A 1UU9A 2PZPA 1RJBA 3T3VA 3DJ5A 3OFMA 4UY9A 3WF5A 2ITTA 4F0GA 3OWPA 2PTKA 2WB8A 4WHZA 3KK9A 2XK3A 4DG3E 4EOQA 4R3RA 3WE4A 1QMZA 5DG5A 4CT2A 4PMTA 5B0XA 4DEBA 2PU8A 1M7QA 2IW6A 2VTPA 3HV4A 2ERKA 5DHJA 5AP0A 4KIPA 3RCDA 3ZBFA 4ACCA 3KXXA 4G2FA 4L53A 4BCOA 3RWPA 3VBXA 4EUTA 3E87A 1MQBA 2JKOA 4RX9A 3LHJA 3VW8A 4YU2A 4QMXA 1SVGA 1DM2A 1QPEA 3LM5A 3T8OA 3KA0A 3U8WA 4QMZA 3ZEWA 3C9WA 3GCUA 4EH4A 5A46A 1ZARA 3H9OA 4C7TA 2XK4A 5DRDA 4FYNA 4M69A 4FNWA 4K2RA 5IZFA 5CWZA 3RKBA 4O81A 4EOJA 4XJ0A 2BROA 3PZHA 1Q4LA 1SM2A 4C33A 4UN0C 4BDAA 1YHVA 3KF7A 4Q9SA 5CALA 2OJIA 3GQIA 4ZMEA 2BUJA 3R01A 2IJMA 3I5NA 4WO5A 4ANSA 3EQFA 5L6WL 2QQ7A 2YDKA 4NFMA 3Q6UA 3LFAA 3VNTA 5BYLA 4YSMA 4JXFA 3F61A 4MD9E 4QTAA 3NLBA 2C3JA 3HKOA 4RGJA 5ICPA 3JVSA 2ZJWA 4IXPA 4C02A 5A6OA 2UZNA 5F20A 1GZOA 3L8XA 4F9AA 2UW0A 4OTGA 3TACA 4O7ZA 3OC1A 4JG8A 3ZM4A 2OI4X 3T9IA 5CEPA 3UZTA 4M0ZA 2J90A 4PDOA 4D4VA 2XNEA 3V8SA 4IX4A 4MF1A 1ZY4A 2BHHA 4F4PA 5BMSA 3MBLA 4C58A 4IDVA 3U9CA 1OL6A 2J5FA 4BFMA 4RBLA 3AC4A 5C03A 5EFQA 3SW4A 2UZOA 1KE6A 2VWXA 1OIYA 2OF4A 1Q8ZA 3NUNA 2WFYA 5AP6A 3V8WA 4ALUA 2J2IB 3KXMA 1FMKA 4CFUA 5HCXA 4U8ZA 4YLLA 2DWBA 4ZLZA 5IUHA 2VTAA 3QQUA 3H0ZA 3BKBA 4MBLA 3VS5A 3CP9A 4RIWB 4AUAA 4FTIA 3SA0A 5AUTA 3HV5A 3NUPA 2W1GA 2VTMA 5HIBA 3ZZWA 3GOKA 2ZB0A 4DFXE 4Z9LA 5HQ0A 2GMXA 2UVZA 3OS3A 4U40A 5LCKA 5FDPA 5CSWA 2WTKB 3E93A 1OKZA 5CAVA 4EH2A 1YWRA 3CTJA 2E9VA 4Q2AA 1O6LA 1B38A 2A1AB 4ANNA 3CGFA 2R3HA 3PP1A 5LVMA 1NY3A 3ACKA 3FI8A 5HESA 4KIKA 2YWVA 3VS3A 3GENA 3DZOA 2HENA 3O8UA 4FV2A 3UIBA 1G8AA 2XH5A 4EH7A 3MDYA 1H4LA 5KZIA 4YR8A 3ORXA 3GCSA 5K0KA 5FTQA 2WNTA 4F70A 4RIYB 1ZOHA 2EU9A 1M14A 5CI7A 4YJNA 1WBVA 3RAKA 4KIQA 5JRQA 1I09A 3EIDA 4YC3A 2KULA 3MIYA 3I60A 2XIRA 4N70A 4QMNA 3LJ1A 3H4JA 2VX0A 2W1HA 2ZYBA 3ACJA 3L9PA 4JT3A 3R8VA 2OLCA 3W10A 3P86A 4PL3A 3OXZA 2JDSA 4GT5A 2PE1A 3Q52A 4WBOA 4G16A 3FMHA 4ZAUA 4IAAA 3SLSA 5KMKA 2YM4A 2QO7A 2F7EE 4PTCA 4DCAA 4F64A 2OXYA 2WAJA 1AGWA 3HLLA 2Y4PA 4MNEA 4RFYA 2BAJA 2ITYA 3ENMA 2VNWA 3PSDA 4QTCA 4CKIA 1UNGA 1A06A 4HGLA 4EORA 4C3FA 4EH3A 3U9NA 4FEXA 1YXUA 2UW8A 4HGTA 3SKCA 3IPHA 4GW8A 3HDMA 3QQFA 3BGPA 4Y73A 1VYWA 3Q4UA 3DNDA 1H1SA 4BZOA 4GK3A 4FK3A 5CVHA 3HV3A 5FXQA 3WF6A 2Q0NA 4O38A 2V62A 3E8CA 3TZMA 3HX4A 3FQHA 3R8MA 4E6CA 4IAYA 5JMSA 4PTEA 3DXQA 2F7XE 2JDTA 1H8FA 3LXNA 4TYHB 4NL0A 5KBQA 5DWRA 3ODZX 3KRRA 5HGIA 2VTIA 3MPMA 4O0UA 5BNJA 2JIUA 3HDNA 5DEYA 3N9XA 2C69A 4EOKA 3NAXA 4PDPA 3FC2A 5EM8A 2YCQA 4F9CA 5FM3A 2IZSA 4ZOGA 3L9LA 5CXHA 4CT1A 4X3FB 3KVXA 2AUHA 4KS8A 4AE6A 5CF8A 4QMYA 3W2PA 5AADA 4GKIA 4O0VA 3PJ1A 4IH8A 4MAOA 1YHWA 2YJSA 3HGKA 3LFEA 4FKGA 4RWKA 1YOMA 3D7ZA 4FTKA 2BRNA 3HP2A 4FSNA 5J5SA 4QMOA 2BPMA 3CPBA 3WE8A 4UB7A 3E3PA 5FM2A 4NM0A 3P7AA 4QNAA 3UPZA 4FV5A 5KMLA 3UO6A 4EEVA 3TUBA 3V5TA 4AN3A 1RDQE 4TWOA 2R0UA 3JR1A 1OKYA 3ORPA 5GZAA 4ANOA 4JI9A 4FIHA 4G3CA 4BDEA 1KE5A 4AZTA 3QLFA 3EYGA 3IDCA 4GYGA 2P2IA 1O9UA 5LVLA 3ZU7A 4AZFA 3Q9YA 2CDZA 4F99A 3I4BA 3CGOA 3V04A 4UWYA 3ZS5A 1REJA 3A7HA 3Q32A 4UBAA 5HLNA 3U4WA 3NVKI 3EN5A 4XLIA 1Q41A 5H8BA 2GDOA 4J53A 1J91A 5IA0A 3GT8A 4Q5EA 4RX7A 4GT4A 4IM3A 5EM6A 4BZNA 4FV1A 3L9NA 1X8BA 3LE6A 4S2ZA 4YJVA 4B8MA 2YM6A 4JL9A 1EH4A 3IS5A 3VF9A 4BBEA 2V22A 5BVDA 3KMMA 4UXQA 3UC4A 2YEXA 5IQGA 2X7OA 2ITWA 3NMUF 3F2AA 2OW3A 3EQPA 3R22A 2PVJA 2YACA 5EM5A 3KRWA 2PVLA 3QTWA 2XCHA 3CBLA 3MVMA 4DFNA 5K3YA 1NT2A 5JSMA 1WAKA 3BHUA 3LCSA 5HTIA 5AM6A 1ZYJA 2J51A 2HOGA 2O8YA 4I22A 3L1SA 4TNBA 4QMTA 5EI8A 5I9ZA 1BMKA 4FGRA 2P33A 3C7QA 4YZ9A 4USFA 1WBNA 3RZFA 1PXNA 2XF0A 3GBZA 3SXRA 4IAIA 3UC3A 5AAEA 5JFVA 2OIBA 3KEXA 4I4EA 3UE4A 3UMWA 2QVSE 4F0FA 2WMRA 2C6LA 4QO9A 4QP6A 3BV3A 2ETRA 4M8TA 4NKSA 4UEUA 4MQ1A 3WIGA 4QTEA 3LOKA 4FV6A 4NM3A 4CFFA 4YJTA 3RALA 4MEDA 4E1ZA 5IH4A 2YIXA 4ITIA 4IVDA 2C1AA 1KE9A 3DCVA 4BRXA 3W2QA 5M4IA 2X9EA 4AFJA 3FLYA 3C51A 3VUKA 3EL8A 4IX5A 5KMOA 4UWBA 2GNFA 2Y7JA 3M42A 4K77A 5I3OA 5I9VA 3UQFA 4PX6A 3MS9A 1GZNA 4BCHA 3TTJA 2X4FA 3LVPA 4H1MA 4FV3A 3MY5A 1OI9A 4ZK5A 1OUKA 4DH1A 3KMWA 5HNGA 4DAWA 3UBDA 3LPBA 2C6OA 3ZRMA 3DLSA 5BVWA 5K0XA 5L8KA 5DPVA 4DA5A 4MVFA 4FG9A 3GU4A 2ZMDA 5I0BA 2VTJA 3MIAA 2ITQA 4C34A 3NGAA 5IEVA 3O7LD 3RPOA 3COKA 4O7LA 3RAWA 3DZQA 1Q62A 3TZ9A 1H25A 1OITA 4UWCA 3WZUA 5GINE 2XNOA 3C50A 4F1MA 3VUGA 4CFVA 2YM3A 2VWWA 4PV0A 4K33A 4ZTQA 4M7IA 4FMQA 4FZAB 5EKOA 4D2RA 3LCTA 4HPUE 3NW6A 3LFQA 2P55A 2YCSA 3ITZA 5D41A 3NYOA 2FSLX 3FPQA 5B7VA 4ACGA 4C4FA 4D2VA 4BCGA 2YABA 3ZSGA 2CLQA 3O7LB 4RIXA 2G1TA 3IGOA 3KRJA 3CCNA 4I21A 3ROCA 3HMOA 4EQMA 2W05A 5L2TA 2BDJA 3ORNA 2GNIA 2VTOA 4I5PA 4UALA 3RMFA 5FG8A 3ZUUA 4GFOA 2JLDA 2Y9QA 3FLNC 2NRYA 3MFRA 5DT4A 3LM0A 5CNOA 1ND4A 3DNEA 5IPJA 3BWFA 5JK3A 2W1DA 4BWKA 4BYJA 1PW2A 3BQCA 3R9OA 2JC6A 5C8KA 1SVEA 1J3HA 5C01A 4NKAA 5GIPE 4U3ZA 1HCKA 2VRXA 1IAHA 3V6SA 5LVOA 1L3RE 3VQUA 2UV2A 2UW3A 4C2WA 4AA0A 3EZVA 4PUZA 2QODA 4KKGA 4BBFA 3ZLWA 4FTNA 1PXPA 4B8LA 3NEWA 3P08A 5HVYA 3NVMB 2CGXA 2VWZA 4RLKA 1TVOA 3L8SA 4QP7A 2BZIB 3MY1A 3MI9A 2AC5A 3PJ3A 5AP5A 4E4NA 4EH9A 2RFSA 3GC8A 3SOCA 4ZTNA 4O1OA 4NK9A 1Q5KA 2PMIA 2ZV2A 4XH6A 4P5ZA 3VF8A 1VZOA 4IEBA 4GIHA 1YRPA 2OZAA 3GNIB 4P90A 5F95A 4NYEA 3K3IA 1PMNA 4QQCA 5TT7A 5AUVA 4BF2A 3GFWA 3TJDA 1F5QA 3RP9A 2BAKA 3R63A 4LOPA 5M06A 1Q61A 2H34A 4G3EA 2HCKA 4U80A 2ITNA 5DE2A 3NCGA 5AA8A 1XH9A 3G33A 1KWPA 3QRIA 5TOZA 2PK9A 1A9UA 1PJKA 5CZHA 2JEDA 2XMYA 4K8AA 4V0GB 2QLQA 3ATSA 3ORIA 1YWVA 3ZO3A 3NUSA 4C4JA 3FMDA 2BTSA 2UVXA 1W84A 3OY3A 2HYYA 2JDOA 4CYIA 1FGKA 2BAQA 3UNJA 2ACXA 5HE0A 3WF7A 3PG3A 2YAKA 4AT5A 4FUYA 4XG3A 4FKJA 4R3PA 3ZEPA 3LMIA 2BDFA 3BHHA 2O2UA 3JVRA 4IMYA 2BIKB 4LL5A 4MCVA 1H1QA 4XCUA 2J0IA 5AJQA 4D4RA 3AMBA 4I93A 5JEBA 3A60A 3OWJA 1NW1A 3SAYA 3EN9A 2VN9A 1GZ8A 4N6YA 3IO7A 4NJDA 4TYJA 5J9ZA 3R04A 4XV9A 4X2NA 2Z8CA 4DT9A 3B8RA 3K5VA 4EC9A 5E92A 4FV4A 4CKRA 3P9JA 4OW8A 3HNGA 2BDWA 3JY0A 4J52A 2CKQA 1JSUA 4BTMA 2VAGA 2R64A 4TXCA 5KBRA 4U81A 1UNLA 4GUBA 3MVLA 2UZLA 2BKZA 3R2YA 4FSYA 1HOWA 4LV5A 1H01A 2JIVA 3DK3A 1UA2A 4BCIA 4DGMA 5AX3A 4XMOA 4CZUA 3RK9A 4CFXA 1OVEA 5JGDA 4CG9A 3QCXA 3NW5A 2H96A 3FHIA 2BRBA 3CR0A 3LFNA 3OW4A 5DOSA 4AOIA 4YUQA 3BLRA 3FL4A 1FMOE 4E20A 4HVDA 4KBAA 5ACKA 5BUEA 4RVTA 4IFGA 2C6IA 4WRSA 3R7OA 2QOQA 3WF9A 3A4PA 3D9VA 4IWQA 4BDDA 4DT8A 3UP2A 5BMMA 3ZLXA 1QPJA 5G1XA 4K9YA 4IB0A 4K0YA 3ZCLA 5HX6A 2PPQA 3O23A 5CVFA 3UOKA 5ACBC 4PRJA 3PYYA 4ACDA 3FYJX 3FUPA 2H8HA 3FHRA 3MSSA 2XNPA 3PSCA 2WMVA 3RI1A 3M2WA 3V5PA 5IQBA 4L7FA 2WOUA 3CKWA 4LGHA 2R3MA 2X39A 5IMEA 4O0TA 4AOTA 1P2AA 5M08A 2PHKA 5M09A 4DBXA 3QC4A 3SQQA 1T46A 3OVVA 3DXPA 3HUCA 4BDIA 4BN1A 2QLUA 4JOAA 3UTOA 4IDTA 4I1ZA 1F3MC 4FV9A 4NCTC 5J8IA 2WTVA 4AE9A 4LL0A 2DS1A 1JKTA 2W1EA 4DYMA 2OU7A 1G8SA 3MESA 2YISA 1QL6A 5CVGA 3IKAA 1OL7A 4FR4A 4XP3A 5FRIA 5JZNA 4R78A 3BBWA 4RLLA 4QRCA 4A07A 3WF8A 3F88A 3O2MA 4LV8A 4A4OA 1YDSE 3PA4A 4KB8A 3TKIA 4EYJA 5A4EA 2PWLA 2OFUA 3QQLA 2BRMA 1OL5A 3GCVA 2QOOA 2QO9A 3FAAA 3PXRA 3H3CA 3TN8A 3FI2A 3DLZA 5EDQA 3MN3A 4FTTA 3OCSA 4JG6A 2NO3A 4FF8A 3F3WA 4KNBA 5BYZA 1ZZ2A 3MTFA 3CXWA 3NRMA 4IB1A 4E6DA 4OT6A 5HIDA 1FVVA 1ERKA 1W82A 4E4XA 4D2TA 5M07A 1NA7A 5CENA 4AW2A 5HVKA 2NNWB 3W8LA 4YURA 3F66A 2YZAA 1U5RA 3KGAA 3QZHA 5D11A 3NAYA 4UXLA 4PMPA 1OECA 5LWNA 4IVBA 3W55A 3VQHA 4BIDA 1TQPA 4IZ7A 3H10A 3Q9ZA 4AWIA 2R7BA 5ANOA 3CTHA 4U97A 4EJNA 3IW7A 3EQDA 5JQ5A 2W17A 2EUFB 5CX9A 3GU6A 2QKWB 5T3QA 4C4EA 3NNVA 2F49A 4E6QA 5EHYA 3AOXA 3VS2A 3FPMA 3C4CA 2QR8A 2X8EA 4N0SA 3KRLA 2ZMCA 1CMKE 2XKEA 5IUGA 3VVHA 4X6QC 4ANLA 4BTJA 4BCJA 2I40A 3P0MA 4ANMA 4Z16A 3UOHA 2R3IA 3G51A 1Z5MA 4C4HA 3H9RA 4D1SA 5L2SA 3QKKA 3D5VA 2P0CA 3WARA 5CAQA 3AMAA 3EFLA 4CTCA 4H1JA 5CAPA 2WTJA 2I0VA 4NM5A 4RJ8A 3DBDA 1OPJA 1CDKA 2XJ0A 3KB7A 5EYCA 5FP5A 2A2AA 4L7SA 2V55A 2BALA 3FZSA 4YGAA 4BHZA 3FLQA 1GJOA 2X2LA 3QZIA 1M52A 3KN6A 3OT8A 3TT0A 4XG6A 3SOAA 2GS6A 2H6DA 2Y4IC 2YA9A 4KAOA 2C5XA 5EYDA 2WD1A 5CF6A 1ZYLA 4AF3A 5E8WA 3KY2A 5K5NA 4NSTA 2YFXA 1BL6A 1H07A 2O63A 5E8VA 1LEWA 1BL7A 3MW1A 4TN6A 1PRYA 2XYUA 5JZJA 5CSHA 3E64A 3U6JA 5IQIA 1U54B 3BIZA 3QCSA 4GYIA 3UZPA 4HYUA 3DGKA 4MD7E 1U5QA 2IN6A 3HMNA 5KHWA 4YLKA 1URWA 3V5QA 4R1YA 3UP7A 1PMEA 4I6BA 2RFEA 2WQOA 3QKMA 1WCCA 4NW6A 4BBMA 4CFWA 3G0FA 3W16A 2HW7A 3ZONA 5ANJA 4FSMA 1KSWA 5AV0A 5HCYA 1MRVA 2XM9A 4J1RA 5J1WA 1F0QA 3KCFA 4A4LA 2WMAA 2BR1A 3PA3A 4BKJA 2YCFA 4G5PA 2EB3A 4DF3A 3LCKA 1NVSA 3ZO1A 1LR4A 5I9XA 1YOJA 4XS2A 4CQEA 4MXOA 2PVFA 2VWYA 3QTUA 2GNGA 5JRSA 4OBPA 4BGHA 4BGQA 5EH0A 2FA2A 3H9FA 3SX9A 4RWLA 3ULZA 3W2CA 1XJDA 5HOAA 5CXZA 4Y83A 5B2MA 1U59A 1XO2B 5A54A 4YNEA 3R8UA 4BIEA 4M13A 2UZWE 3EN7A 3QXOA 5FP6A 4YTFA 2R3GA 2R3QA 1XWSA 1ZYCA 3DKFA 1IA8A 4XG7A 4BDKA 4FT0A 4B99A 4BZDA 5JFSA 4WIHA 4MXYA 4J71A 4NCTA 4G1WA 5E8XA 3PVGA 2R4BA 3O17A 4JR7A 4BCPA 2WTCA 1Q8TA 3PE1A 3Q60A 2CKOA 4GKHA 1GOLA 4AQCA 3DDQA 4MXAA 4AOJA 4X3FA 4KD1A 5T68A 2QOLA 3F3UA 4IACA 5C26A 4IANA 2R7IA 4JBVA 2BIYA 3VHKA 4L67A 2VWUA 3DK6A 3V5LA 5FLFA 5L2QA 1Q3DA 4ZTLA 5IQEA 4FTRA 4I94A 4JS8A 4O2PA 5CZIA 4FKRA 2UZDA 4TYEA 2G15A 2R3LA 3PPZA 4EHEA 4ZSLA 4ZZOA 4EH6A 3OUNB 5EHOA 5LVNA 4X7QA 4AGWA 4O7SA 4O86A 4ID7A 3T9TA 3IW4A 1XH7A 4B6LA 4A7CA 5ANKA 4I0SA 2J0LA 3BE9A 4EWHA 4ZTHA 3ZBXA 5HBEA 3ORZA 5CEQA 4OTHA 4PL4A 3HRFA 2HY81 2C68A 3CD8A 3D0EA 4G6OA 5DLSA 4O6EA 2XNNA 3OUKA 2HW6A 3Q3BA 4C38A 3F7WA 4FVPA 4BYIA 5FTGA 3SGCA 4XV1A 3VBQA 2W1ZA 1UU7A 4U9AA 4WNPA 5A4CA 3P23A 4I92A 3BYMA 1ATPE 4G6NA 4EONA 1ZY5A 2P4IA 3WZDA 3KMUA 4XRLA 4EK8A 3NUAA 3QD4A 4J96A 5HO8A 2WMBA 3UO4A 3Q5IA 5IH5A 1VYZA 5DT0A 3LFSA 5E4HA 3BCEA 5AAFA 1DAYA 4R77A 3TIZA 3C5UA 2WGJA 5L6OA 5EW8A 3I6WA 4FIJA 2R5TA 3P5KA 4IVCA 2HK5A 4F0IA 4CG8A 4XX9A 3A8WA 1ZOEA 2R3NA 4Y46A 5HBJA 5BX0A 4FT9A 2YZLA 4LMUA 3V6RA 2CMWA 4K11A 4DH5A 2QHNA 4R7BA 3FZRA 4M66A 4CXAA 4YTCA 4C36A 2PZYA 2RG5A 3DA6A 3I5ZA 2YIYA 4FKQA 4GVAA 4FEVA 4ZY4A 4J7BA 2UZTA 2XB7A 3Q04A 1Q99A 3E8EA 3NYNA 4NTTA 4RWJA 3D2KA 1DI8A 3F5UA 3AD5A 3FLWA 1LPUA 3HV7A 2EXCX 1YHSA 4XP0A 3W1FA 2VTNA 3OF0A 4QP2A 1U46A 1PKGA 5E1EA 2Z2WA 3SVVA 2EXEA 2B9FA 2RF9A 2C47A 4FG8A 3IECA 5M4FA 1XBCA 3DFAA 3MTLA 4L44A 3CJGA 4FOBA 4GG5A 1L8TA 3LFFA 1Z9XA 2QCSA 3HA6A 4Z7HA 3QXPA 4YPDA 3A4OX 1OPLA 2VX3A 2W96B 5C4LA 3CY3A 3VUMA 2IO6A 1XR1A 2UW9A 3CY2A 3L8VA 4ANBA 2IW9A 1SZMA 4WBBB 5IF1A 5ANGA 4BCNA 3TNWA 3LIJA 3PRIA 3R1NA 3DXNA 3N4VA 1U4DA 2ZM1A 4FGBA 4FTAA 5CQUA 4ZP5A 2JGZA 4P4CA 5LXMA 4BCKA 1OKWA 2XIXA 3PVWA 4MD8E 4D2WA 3COIA 5KMNA 4C61A 1UWJA 3VIDA 3DDPA 4IQ6A 4DEHA 5DH3A 5M44A 2C6DA 2OIDA 1R0EA 3MB6A 4C0TA 4CTBA 3VUHA 2R0IA 5FUTA 2WQNA 4YZCA 2ZVAA 2NRUA 5AUYA 3VJNA 4FL1A 4R7HA 4EZ7A 4EWQA 1M17A 3OW3A 3IOPA 4U41A 1XHAA 4F6UA 4BB4A 3QF9A 2XKFA 1JSTA 1JVPP 2R2PA 4F65A 3GC0A 4GH2A 4I6HA 4U79A 4D58A 2QU5A 3VO3A 3MFSA 3QTZA 2VO7A 5CU6A 2QKRA 4DLIA 4M84A 3EZRA 3TM0A 2PZ5A 4PQNA 5DMZA 5M56A 3G15A 4EK5A 3QHRA 3FMMA 3EQGA 3R73A 4JJRA 3QU0A 3OCGA 3RCJA 3OOGA 3V5JA 3VS1A 3R1QA 4AZEA 3ID6C 4RC3A 5IA3A 4FKPA 4C35A 4RVKA 2EVAA 3EMGA 2X6DA 2CKPA 4O7VA 3VWAA 2FSMX 2JFLA 2X1NA 2IZUA 3RJCA 5KKRB 4A9RA 2PYWA 3UODA 5FXRA 3BYSA 4W8DA 5CSVA 4F7SA 3DAKA 1FQ1B 1WBOA 2RFNA 4JAIA 2ZV9A 3C13A 4ZS0A 3QQHA 2CGUA 3FKNA 3QRJA 4J95A 4XUFA 4DEAA 2PVYA 3DBCA 3HYHA 5JGAA 5L4QA 3ZSHA 3LMGA 5I5ZA 3NCZA 1H0VA 3CC6A 4IM2A 4DBNA 3N4UA 3VULA 4CRLA 2ZM4A 3VUTA 1UKHA 4YTIA 3N4TA 2GQRA 2PUNA 1XBAA 2XS0A 3FDNA 3Q2MA 4WNOA 2FYSA 2NPQA 5D7AA 1R78A 4KRDA 1PXIA 2GS2A 3R7EA 2IW8A 5A6NA 2W7XA 2XRUA 2BFXA 4JDJA 3MV5A 3OXIA 3QC9A 2BZJA 2GTNA 5DI1A 4L01A 5I4NA 3O96A 4ASXA 3QUPA 4EOOA 5C8MA 4P7EA 5E8TA 4BTFA 3FMKA 3ALNA 1YQJA 3GGFA 3Q6WA 4MTAA 4A4XA 2XVDA 4DGGA 2ITVA 2ESMA 5AM7A 3B2WA 3OBJA 2E9PA 4U42A 3UG2A 4KBCA 5FWKK 3P78A 4UZHA 3A7FA 4PNIA 3R9DA 2OBJA 1FVRA 3I0QA 4FT7A 2BHEA 4JIKA 5CS6A 3EKNA 1RE8A 3GP0A 2WMWA 4QQ5A 5E8UA 5GHVA 3TTIA 4NUSA 5BVKA 3RPVA 3OHTA 2O0UA 4DEDA 4O83A 2EXMA 4KS7A 5IEXA 1K2PA 1PF8A 4EK4A 3PFQA 3LLAA 2C6MA 4OGRA 3GB2A 3QWJA 4C59A 3LAUA 3CEKA 2X8IA 1KE8A 4UMTA 4Z3VA 2PVRA 5DA3A 3MVJA 3VJOA 4FTOA 4TYIA 4G3DA 4IJ9A 5CEMA 4BWPA 1KUTA 2HWOA 3QRKA 3R9NA 4ITJA 2XNMA 4PPAA 2UZVA 5M53A 2HXQA 4GS6A 4IB3A 4WA9A 3R6XA 5IMXA 2RGPA 3P7CA 3FYKX 4R1VA 2QHMA 5JT2A 2IWIA 3IW5A 2CGVA 4IBMA 4YC6A 4FKVA 5H8EA 4ZZMA 2UW6A 4ERKA 4CCBA 3VUIA 2ZAZA 4GSBA 4U3YA 3COHA 4YJSA 1H0WA 3PDTA 4CMTA 2R3PA 5HHWA 4FTCA 3OP5A 5D7VA 2GSFA 4L46A 3UJGA 2UW7A 3LQ8A 5GZ9A 3ANRA 4DFLA 3CPCA 2YM5A 4M15A 1TQIA 4QNYA 3KU2A 4BI2A 5ITAA 3R00A 4RMZA 5TF9A 3RNIA 4DHFA 5E8SA 1OIQA 2V0DA 5HTBA 2C3LA 3TL8A 3FKLA 4DH3A 5AP3A 5DR6A 2WZJA 5HLPA 5CAUA 3EFKA 4JR3A 4M69B 5IUIA 3ZSIA 4B7TA 5AUUA 3BGZA 3GU5A 3NUUA 3VUDA 4DG0E 4L3JA 3GC9A 2B9JA 4FBXA 2X7FA 3E8DA 2FB8A 4L45A 5CT0A 3MA6A 2QOBA 1J1BA 4CKJA 2BZKB 4EOMA 1Y57A 4L52A 1AD5A 4HNFA 3I0OA 3PVBA 4DFYA 4QT1A 4JDKA 3SD0A 5JH6A 3GEQA 4ZY6A 4DGNA 4IB5A 4PDSA 3TDVA 4HW7A 4PPBA 5LQFA 1LEZA 2GCDA 4QYGA 4F6WA 4C57A 5LCJA 1S9JA 3NDMA 5CQWA 4NH1A 5AV1A 2Z02A 4WOVA 4X0MA 4FSUA 2PVKA 2VX1A 2J50A 3F5XA 4MQ2A 1XQZA 3D14A 4MBIA 4QD6A 2ZV7A 4LGGA 5EW9A 4AS0A 4O21A 2C5NA 4FT3A 4U0IA 1ZOGA 3AC3A 5LARA 2EWAA 2G2FA 4C62A 2P2HA 2QG7A 4GK2A 2J0MB 3VBYA 5H2UA 4UYNA 1PXOA 2PUPA 3DY7A 5ETIA 4HVHA 5JQ8A 3PJ8A 1JSVA 5BVNA 3NWWA 1ZZLA 3EL7A 4O22A 2W5BA 1JQHA 1WFCA 4E5BA 1E9HA 4RX8A 3ZRKA 2VD5A 4UMUA 5HD4A 3W18A 3I81A 2J9MA 3EN4A 3QX2A 4WNKA 5JN2A 4RFZA 4I6QA 2UZUE 3BU5A 1UU3A 1PYXA 2A0CX 2J5EA 4PP7A 1PXJA 1PMUA 2A4LA 3O51A 3BV2A 4JDIA 4KWPA 2IZRA 3LW0A 5AP4A 4EI4A 4HYIA 3G6GA 3S3IA 5HORA 4QP9A 3ZO4A 4RZWA 5AV4A 2GQGA 3FBVA 2J0KA 3OMVA 3QWKA 4YZMA 5C8NA 1B39A 4HOKA 3NR9A 2EB2A 4M14A 4CLIA 2WMTA 3SRVA 4KIKB 5HNBA 4WNMA 1R3CA 3PTGA 4J8NA 5EOLA 4AGCA 3AC2A 4XG8A 3R7YA 2WU7A 4KKHA 3OY1A 4RA4A 1ZXEA 3NUXA 3R71A 5LWMA 4JDHA 4I24A 4UMQA 3UIMA 3E88A 3EFWA 3RGFA 4AA5A 1Q3WA 3DB6A 5D9HA 2RL5A 4JX7A 4RC2A 3ZUTA 3D5XA 3DQWA 5H8GA 4FA2A 1PHKA 5CU4A 5EM7A 4FVRA 4IZ5A 4TYGA 5B2KA 3ZZEA 4UYAA 2OF2A 5ANEA 5M55A 4A9SA 5KO1A 4PMMA 2W1CA 3F82A 4O27B 4E5WA 4R8QA 5CLPA 4FX3A 4DC2A 2E9NA 4M3QA 1A48A 3O71A 1GY3A 4W4YA 4EC8A 3QBNA 4O7RA 4TY1A 3C4ZA 4QYEA 4DH8A 3PIXA 2GHMA 4LYNA 5TO8A 5LJJA 3FY0A 4NTSA 4IE9A 3IQ7A 4L3LA 4XLVA 4Y8DA 5J7HA 3SG9A 4OTDA 5CASA 3GC7A 4YHJA 3QTXA 4J98A 5AA9A 4RIOA 4QQJA 3U55A 2JKQA 2JIIA 3FQEA 4WRGA 5DT3A 3MJ1A 3TNQB 5J87A 4FOCA 4D4SA 4ERWA 5C9CA 5A4QA 3FEGA 5AR5A 4LOQA 3QUEA 4CVAA 4GJ3A 4AW1A 3NUYA 4QP3A 4E6AA 4EHVA 2BZHB 5IH6A 3IONA 3EYHA 5DRBA 2WTKC 2VGOA 3SG8A 3QYWA 4I5CA 2YERA 3LJ0A 4NW5A 4AFEA 3QHWA 5BQ0A 4ANQA 3FLZA 3A62A 3FXXA 2B1PA 2WPAA 5T6KA 1CTPE 3K54A 5EOBA 2PE2A 1Z57A 5J9LA 2VUWA 2G01A 3I1AA 1W7HA 2PZRA 1NVRA 3F3VA 4AT4A 3QFVA 2WIPA 4TWNA 2OJFE 3R7GA 2F7ZE 1V0PA 2R3KA 3MFTA 4V04A 2IVUA 3TWJA 1YXVA 4E93A 1APME 2NP8A 1GIHA 4S34A 3EQIA 4U6RA 2C0OA 4PTGA 1WMKA 4BHNA 4TT7A 4Q5HA 1V0BA 4JQEA 5FD2A 5KMIA 1V1KA 1SVHA 3KQ7A 4GIIA 5DN3A 2C4GA 4PY1A 4F1OA 3OXTA 3HRBA 5ANDA 4HPTE 4E7WA 3QA8A 2GHGA 3EQCA 4XV2A 1DI9A 2DYLA 5A3XA 5A4LA 3W2OA 2QG5A 3QRTA 4XOZA 3ZFXA 3CTQA 3QLGA 4ACMA 4F9WA 2J0JA 4NJ3A 2C6TA 2X0GA 5AV3A 2W4JA 3RK7A 3AT4A 4EH8A 4H3PA 5BPYA 4ALWA 4O7TA 3PLAE 4M0YA 4DINA 4H3QA 4GV1A 3RHKA 5GJFA 2X2MA 4F63A 3BEAA 1UNHA 3OROA 5K4JA 1H1WA 4FSRA 4D9TA 2JITA 4BICA 2XP2A 5FEEA 5IA4A 2ZM3A 3DOGA 2C0TA 3AD6A 4WG5A 2PUIA 2O64A 5KMMA 5CEKA 2BVAA 2AYPA 4FTUA 4ZTSA 3JPVA 4H39A 2B53A 5J7BA 2CNVA 2C5VA 2X81A 4DFBA 1ZYDA 2C3IB 3G5DA 3KC3A 1JWHA 4OTRA 4QMPA 5FBNC 4ZJJA 4BWXA 2HIWA 5G6VA 1BI8A 3HV6A 3TNHA 4AW0A 2OO8X 3IDBA 4CRSA 3Q2JA 3ZM9A 3NNUA 4I5HA 5ETFA 3ORTA 2Y6OA 3TIYA 4FG7A 4FUXA 2OJJA 3O8PA 4IC8A 4JX3A 3FSKA 4ITHA 4X3FC 3FMNA 5GJDA 3GOPA 5CEIA 3WOWA 2G2HA 5F9EA 5AX9A 5EYKA 5KHXA 3OCTA 4JG7A 2HELA 3ORMA 5AUZA 3GU7A 4TRLA 4BR3A 3TJCA 4WT6A 3CQEA 3W2RA 5IA1A 1ZAOA 4OUCA 4DCEA 4Y5HA 3C4XA 4IAZA 3FI4A 3TEIA 2FGIA 4F08A 3QTSA 3DKGA 3UDBA 3POZA 2OZOA 3BYVA 1Q8UA 2O3PA 3LZBA 4FKWA 4GK4A 2UZBA 3QL8A 3FMLA 2ITZA 2BFYA 4OTFA 4F6SA 5E90A 1H28A 5ETAA 4D1XA 5HX8A 3D5UA 3OEFX 4C2VA 4FEUA 2FO0A 4L6QA 4OTQA 1SMHA 3UOLA 4ACHA 4ZZNA 3ZO2A 4OBQA 2XUUA 4RQKA 2YIQA 4BVUA 4AG8A 4W9WA 4ENYA 2Y8OA 2CGWA 1ZLTA 4ASZA 2V5QA 4I20A 4FV7A 3RBWA 3OBGA 2JAVA 4TPTA 3IDPA 1XH8A 2IVVA 2PE0A 3DV3A 1NXKA 3E7OA 4EHZA 2HXLA 2IVSA 3MA3A 3QGWA 4I41A 4RIWA 1PXMA 3R8LA 4D9UA 2WQBA 4UZDA 3F3ZA 3VS6A 2HWPA 3F3TA 4LRKA 4O0YA 3SXSA 2JDVA 4OAVB 1AQ1A 5AUXA 2OXXA 3K3JA 5EQEA 5AR2A 3K5UA 4YZNA 3CSVA 3LQ3A 4MNFA 5DBXA 1H27A 5GNKA 5BVFA 1OB3A 2OK1A 4FV8A 4HNIA 4HYSA 4BDJA 3PG1A 4EUUA 2LAVA 5B2LA 1FGIA 4G9RA 2YLEA 5E91A 3NPCA 4WSQA 5CANA 4FZ7A 4RZVA 4QMSA 3GUBA 2C0IA 2HZIA 3A61A 4W4WA 4CFNA 3D83A 5IEYA 4RIYA 4AZWA 5HG8A 1YI4A 1YDTE 4OT5A 4DE4A 1VR2A 3PLSA 5L8JA 5HEZA 2C6EA 3O8TA 4EK6A 5C27A 4CYJA 2YM8A 4RRVA 4RIXB 1YOLA 2RFDA 4LUDA 4ZSJA 2G2IA 4OTWA 3T3UA 4E4MA 2WMXA 2W99B 3MFUA 4HJOA 1YKRA 5KUPA 5C4KA 1OGUA 2VTSA 4LFIA 4HCTA 4LG4A 3WYXA 3E92A 3OWLA 3P4KA 5EKNA 3UVPA 2R3FA 3ODYX 3PE2A 4K1BA 4I0TA 3EWHA 1ZMWA 3FI3A 3FL5A 3PP0A 4W4VA 3FSFA 2UVYA 4XYFA 5EYMA 4FSWA 2XM8A 5TE0A 5M57A 1UKIA 5H3QA 2C5YA 4BIBA 1ZWSA 2I0HA 2WU6A 1Y6AA 3CJFA 4D5KA 2JD5A 4RT7A 4PP9A 4F9BA 3UOJA 1H1PA 1FOTA 2QONA 5IA5A 3GQLA 5TR6A 4PPCA 4FEQA 3VS4A 3PWYA 3PZEA 3FZTA 4O84A 2XCKA 4BCQA 3R30A 3KRXA 5HICA 2YCRA 5E8ZA 2GNHA 1ZMUA 3BU3A 1GIJA 5A4TA 3LQ5A 2PZIA 4IVAA 4X2FA 1PXLA 4TWPA 2ONLC 1O6KA 1WBSA 3Q5ZA 4QYHA 3ZRLA 2XKDA 4TYHA 3R7UA 4ZJVA 4U45A 1XH6A 4BI0A 4O7YA 4ZLOA 2ZOQA 3OOMA 3Q96A 1Q8WA 5EQYA 4ORKA 3W33A 3UO5A 2YIWA 1RQQA 4L42A 5DR2A 4TZRA 4CMUA 4Z55A 4XNEA 3HMMA 5HD7A 3PXKA 5KZ0A 5HLWA 2WTDA 1IEPA 5F94A 4CMOA 4M67A 3REPA 5HU3A 3I79A 4JQ8A 2CN8A 4QMVA 4AN2A 4D5HA 4HGEA 4XRJA 2ITXA 1LP4A 2OIQA 3FE3A 4FKIA 4L9IA 3ZYAA 4RG0A 4JBQA 4NIFB 3ZFMA 3Q53A 4TWCA 4AW5A 4ARKA 3ZH8A 3EOCA 4CZTA 3UGCA 1O6YA 1PXKA 4NU1A 5BVEA 5EDRA 2YN8A 4D1ZA 3V51A 3BYUA 3RTPA 5DNRA 3S1HA 4YBKA 3EHAA 3I7BA 2XIZA 1UWHA 2V7AA 2XKCA 3JYAA 3AG9A 3NIZA 4R5YA 1G5SA 2PY3A 5FXSA 4EBWA 3R8ZA 3O0GA 4FEWA 2HAKA 1URCA 3WBLA 5L3AA 1FPUA 4ZS4A 2XK8A 2REIA 4FNYA 4K18A 5BVOA 3R28A 4IZAA 1I44A 3JS2A 4CFMA 2YHVA 3OCBA 4IWPA 3V5WA 5HI2A 4ZLYA 3KREA 2X4ZA 1YI6A 3MH2A 3OZ6A 3KN5A 4ALVA 4NT4A 1IRKA 4P5QA 2VZ6A 1J7IA 3AXWA 1CKPA 5TKDA 4TTHB 3A99A 2W5HA 4L8MA 4KABA 4ASDA 1SNUA 3FJQE 2A19B 3SHEA 5L8LA 3PXFA 1MRUA 2VWIA 5I9WA 2OKRA 1WBWA 2WEIA 4ZSAA 4GT3A 5JGBA 5IU2A 3Q4ZA 4OTIA 4U44A 4CV9A 3QCYA 4G3FA 4QYYA 5CF5A 3ENHA 4YSJA 5J79A 1YXXA 2WELA 3CQWA 5E9EA 1FBNA 3TKHA 5HE2A 3C0HA 2F57A 4DITA 2BILB 3EQRA 2IPXA 3TV4A 4RSSA 4W4XA 4HVIA 4I5MA 3N51A 5AIKA 4UX9A 5AEPA 3RM6A 3D2IA 4FE2A 1YXSA 3OTUA 3DQXA 3A7IA 4MWHA 2JBOA 4JRNA 3UNZA 4IFCA 4N4SA 3HRCA 4RVLA 4E26A 4Z7GA 3ANQA 2XBJA 2FH9A 4Y72A 1E1XA 3HAMA 4O0WA 3FMJA 2QI8A 2RG6A 5K4IA 5AP2A 4F1TA 3UIUA 2I0YA 2A27A 5HIEA 1UVRA 3AT3A 2E2BA 3PY3A 3FY2A 5FBOA 3VN9A 4ENXA 4O96A 4CZYB 3Q9XA 2J7TA 5IQFA 3LCOA 3MWUA 4G34A 5BUJA 4B9DA 5DVRA 2BKKA 4ZTRA 5AR8A 3WZKA 4FI1A 3BX5A 4C37A 4YHFA 4BDBA 3EH9A 2XRWA 2W4KA 4D0XA 4EQCA 5BYYA 4WSYA 1WZYA 2GPHA 2VGPA 3VRYA 5HO6A 5IQCA 3GFEA 2RIOA 1SYKA 3VAPA 2BCJA 2JKMA 3LCDA 2ONLA 5E7RA 3RNYA 4IW0A 5F4NA 4XOYA 4C4GA 3ZXTA 1BYGA 1BUHA 3VBTA 4O1PA 2ERZE 4PMSA 4QMUA 3Q9WA 3A7JA 2OWBA 2C5OA 3G90X 3R2BA 1OBGA 4FL3A 4XBRA 1UV5A 5CSPA 4FTJA 1KOAA 3TNPC 3DT1A 3ZTXA 5IKWA 1Q8YA 2XZSA 4WG3A 5J9YA 3NYXA 4S31A 4W8EA 2OSCA 4MK0A 3KXNA 4X2JA 4EKLA 1OIRA 3R9RA 4PDYA 1BKXA 3MGYA 2OH0E 2OJ9A 2UUEA 1QPDA 3KCKA 3BGQA 1W83A 1WVYA 3BRBA 4XG4A 1WVXA 3UVRA 3AGMA 4GL9A 4A06A 4MKCA 3ULIA 4YJOA 4BDFA 4R5SA 5CI6A 4G6LA 2PULA 4HZRA 5FDXA 3F69A 4EK3A 4A9UA 2LGCA 4MXZA 2BRGA 3U6HA 3IW8A 4FODA 4XV3A 4QMMA 4QP8A 4USDA 4YJRA 5IQAA 5CEOA 3ZUVA 3PXQA 2VO6A 2R3JA 3QD2B 5GJGA 5CY3A 1KV1A 2WTWA 4G31A 5HO7A 5LOHA 4O0XA 3D94A 5EDPA 4RJ3A 2F9GA 4YZBA 1J7LA 4YJQA 4FIEA 4KIOA 4OTPA 5KMJA 4LM5A 1IG1A 3TV7A 4M97A 3F2RA 4MWIA 4YP8A 5LMKA 4MYGA 3KULB 4EL9A 3U54A 3SC1A 4H58A 2W1IA 5AR4A 3LFBA 3DAEA 3MJ2A 3NW7A 3RAIA 3R7VA 4GG7A 3ZMMA 3W8QA 3BU6A 3FV8A 1KOBA 3A2CA 1M7NA 2WIHA 2XK9A 4G3GA 4I23A 4O2ZA 4FZFB 4MH7A 2W9FB 4IAFA 3V01A 3D7TB 3ZDUA 4GVJA 5D12A 3DJ7A 4V0GA 3JXWA 4CV8A 3MPTA 3QCQA 4QPSA 3VS0A 1YWNA 2RSVA 4A9YA 3KXGA 3VBVA 4IHPA 3V3VA 4E8AA 5CNNA 3ZXZA 4XG2A 2W06A 3BHTA 3PJCA 3KXHA 3UQGA 2JFMA 2Y6MA 2B4SB 3ELJA 2R3RA 3SXFA 4AP7A 4O82A 4ONAA 4QQTA 3OD6X 1OPKA 4FKUA 4I6FA 3C4EA 3FC1X 5CF4A 4HGSA 2VWBA 5EK7A 3Q4CA 2ZB1A 2VNYA 3PY1A 2XYNA 3QD0A 3QQKA 4BCMA 4K6ZA 2FSOX 2XEYA 2VWVA 4FTMA 3NNXA 1SNXA 3BHVA 3NIEA 2O5KA 4B0GA 1Q97A 4JBPA 1H1RA 3IGGA 5IA2A 2CNUA 4U5JA 4AGUA 4CGAA 4LOOA 1UU8A 2CHLA 2X9FA 3BEGA 2PL0A 3B2TA 3DKCA 4B4LA 3TUDA 3KF4A 3MY0A 3UNKA 3PXZA 2QOKA 4S30A 5IDPA 5C1QB 5EW3A 4NZWB 3LLTA 3ROYA 3AMYA 3WZJA 1IA9A 2XNGA 3D4QA 3M1SA 1YW2A 3MB7A 1PY5A 4WG4A 4Y95A 2CLXA 4XHKB 2Q83A 3UIXA 4DG2E 1JNKA 2X6EA 5DGZA 3PWDA 4FVQA 2F2UA 2WKMA 4DLJA 2GFSA 3E3BX 2HZNA 2XJ1A 3DS6A 4EOPA 1OKVA 3LKMA 1XBBA 1WVWA 3F9NA 4U7ZA 3ZC6A 4QTDA 3TI1A 1STCE 3QD3A 2E9UA 3DK7A 4MX9A 2JBPA 3AD4A 4GEOA 5DIAA 3A8XA 1RW8A 5EHLA 4GU9A 2B9HA 5JFWA 4ZJIA 3VHEA 3TDWA 2PSQA 5CT7A 2B54A 4FSTA 4MBJA 1MUOA 2UW5A 3QUDA 2ETMA 3OWKA 3UQCA 4YC8A 3ALOA 1E1VA 4XBUA 3BE2A 4H36A 4DTAA 4FK6A 4EQUA 3AC8A 2PMLX 4KA3A 5J95A
chains in the Genus database with same CATH superfamily
3QTIA 1P4FA 2ITOA 4YO4A 4L00A 4LGDA 4RQVA 1H08A 3H30A 4FC0A 5CSXA 4AACA 2Y4IB 4R6VA 1H24A 4F09A 4CNHA 2FUMA 2CNQA 4D0WA 5E1SA 4JBOA 5FTOA 2WO6A 1P14A 2IVTA 4CSVA 5AWMA 2C6KA 4RVMA 3BLHA 4QTBA 2JKKA 3FWQA 4YMJA 4RFMA 4D2PA 5LVPA 2AEGA 4YJPA 1B6CB 4E73A 4MXCA 4R7IA 3NSZA 2VTLA 3GI3A 3GVUA 4QPMA 2GNLA 3K2LA 1H00A 4RJ7A 4WUAA 4H05A 2WMQA 2C30A 2HZ4A 4DHJA 4I4FA 2WTIA 3RPYA 2BMCA 4GU6A 1JKLA 1MQ4A 3CIKA 3FXZA 3SV0A 3BHYA 3U51A 2XARA 4O7WA 3ZLSA 1M2RA 5H9BA 5FEQA 5EI2A 1R1WA 4J99A 5D10A 5EI6A 5HVJA 3E7VA 3POOA 5HG9A 2V7OA 4R3CA 3HP5A 4Y5QA 4HCUA 3TKUA 2QD9A 3PPJA 3DBQA 2OXDA 3UVQA 3P7BA 2WMUA 4Y85A 4C4IA 4MUQA 3R8PA 3FKOA 3R1SA 3S00A 3AQVA 3KKVA 3R21A 4KSPA 4LQMA 2CCIA 3DJ6A 3EJ1A 3RK5A 2Z7RA 4D55A 1ZMVA 4YO6A 3W2SA 4QPAA 3BYOA 1YDRE 1ZRZA 3ET7A 4QP1A 1YVJA 2J6MA 4FTLA 4IWOA 4MXXA 3S2PA 3VC4A 2PMOX 2YDIA 4XG9A 3HAVA 2YJRA 3E63A 2WOTA 3TZ7A 4V05A 4TKSA 4EZ3A 1S9IA 3TZ8A 5L6PA 3QALE 2QOFA 2B0QA 5CU2A 1Q24A 3LXKA 4JLCA 4OAUC 3I6UA 5GZ8A 3S0OA 3NNWA 3F2NA 4FIGA 2XEZA 5DFPA 4A9TA 3FZPA 4IAKA 5CYIA 4YHTA 3PXYA 3RM7A 4BI1A 5LMBA 3TNIA 4E4LA 4EOIA 4YPSA 1OIUA 1CM8A 5GIOE 1W8CA 5IQDA 5FGKA 4BKYA 3CS9A 3COMA 1U54A 2CPKE 3PIYA 5AV2A 5I3RA 3UMXA 1T45A 3TG1A 3Q4TA 4EHGA 4DHZA 3JUHA 3ZOSA 4EJ7A 3EB0A 4GMYA 4KKEA 2IG7A 4E3CA 5IQHA 5AP7A 3HL7A 3QTQA 4G9CA 3MH3A 4KUJA 4GFGA 4L43A 3MH1A 4QYFA 1OUYA 4MNEB 2JAMA 3BELA 5KX8A 1W98A 4FICA 5AP1A 1R0PA 3TCPA 4DFUA 5HNIX 3KVWA 4HVGA 4AA4A 1M2PA 3QGYA 4HCVA 4IM0A 5IG1A 4KSQA 4GRBA 4RPVA 4Q9ZA 4QOXA 4DFZE 3DTCA 5L2IA 2HZ0A 4JQ7A 2GQSA 3AC5A 4NEUA 2J4ZA 4UV0A 4ASEA 2CJMA 3EQHA 3L8PA 3C0IA 5HU9A 3RVGA 4ZTMA 2PMNX 2RKUA 3U6IA 3P79A 4N57A 3BWJA 3AGLA 3RINA 5L2WA 1KE7A 4HVSA 4CD0A 4BDHA 4YJUA 4X6RA 1OL2A 4S32A 1P4OA 2H9VA 3LJ2A 4QP4A 4IZYA 1JKKA 2XIKA 3DPKA 1DAWA 2B9IA 1H26A 3C0GA 2VTRA 4GJ2A 5DEWA 5HBHA 3UYSA 1JBPE 3CQUA 4BY9E 3PUPA 4O0SA 4E5AX 1K9AA 3QQGA 4ZY5A 1WBPA 2O65A 3DFCB 3C5IA 2KTYA 4KBKA 5DYJA 4X2GA 4EKKA 5AFVA 3HZTA 2HY0A 1YXTA 3II5A 2I7QA 4EH5A 4O0RA 2WQEA 3IW6A 3UYTA 3HMIA 3NX8A 5F1ZA 3I7CA 4WKQA 4I0RA 3F7ZA 1Y8GA 3ZFYA 4U43A 4NIFA 2IZTA 2VU3A 1JAMA 5JFXA 3R83A 3KL8A 2VTHA 2VTTA 4QMLA 3VBWA 3HA8A 4FL2A 4G17A 3V8TA 3B8QA 4CEGA 3C1XA 3A7GA 5KKRC 2PVNA 3G0EA 3F6XA 4LMNA 3QZGA 2DQ7X 4DGOA 4TL0A 5J1VA 2JDRA 2XBAA 1ZYSA 2YAAA 3HMPA 4N6ZA 2GHLA 3GCQA 4BKZA 4C3RA 5HTCA 3U87A 2PVMA 4PL5A 2WEVA 3CLYA 3R1YA 1G3NA 1NVQA 2YLFA 3QAME 2FVDA 3W0NA 3IOKA 2OFVA 4IWDA 4MHAA 4FKLA 3BQRA 4QMWA 3WIKA 4H3BA 5I9UA 3HUBA 4V01A 1M2QA 2YDJA 5KNJA 2B52A 2ITUA 3W32A 4APCA 5HZNA 5HG7A 3GXLA 4FNXA 5ETCA 3THBA 4FKTA 4FIIA 3DBEA 2CCHA 2PUUA 3U4UA 2GFCA 3SDJA 2G9XA 4IX3A 3VS7A 3S4QA 5I9YA 3EQBA 3VONA 2WHBA 3CE3A 3VRZA 3PRFA 3FMEA 4MF0A 1IR3A 1GZKA 4RJ6A 4D2SA 3E5AA 4WD5A 1IASA 1VEBA 3HECA 4LI5A 3ZLYA 4EYMA 3AC1A 3GCPA 3RZBA 3BI6A 3H0YA 2Z60A 1PKDA 2OG8A 2X2KA 3LXPA 2QOHA 3PY0A 4M68A 1YI3A 2FSTX 3ZC5A 4AAAA 3FLSA 3FZ1A 4DGLC 3R9HA 3DAJA 4AT3A 3TXOA 5AR3A 4RA5A 2BTRA 2R3OA 1FINA 4FTQA 4DDGA 1WBTA 2UW4A 1LUFA 3NYVA 4AU8A 3TYKA 5BV3A 3E62A 4J8MA 2QOIA 4DEEA 3QRUA 4YLJA 3RPSA 4DEGA 1BX6A 1XKKA 3ORLA 4YNOA 3WYYA 3DTWA 1K3AA 3C4FA 5LMAA 4C3PA 3LMHA 5JKGA 4LRJA 2DUVA 4TW9A 3ETAA 3ERKA 5D1JA 2I1MA 3PJ2A 1Y91A 4BTKA 5K9IA 4GUEA 1MP8A 1VJYA 2YM7A 4RWIA 4TNDA 4JIAA 1OL1A 1OBDA 2W0JA 3R7IA 2WXVA 4FSQA 2Q0BA 3G9LX 4YBJA 3AKLA 3LFCA 4OR5A 2ZV8A 5IDNA 5AR7A 1OGYA 4M12A 1FVTA 4FZDB 4UMPA 3WI6A 2OJGA 5CTPA 3PSBA 1OMWA 4BDCA 4GFMA 3LXLA 4S33A 2GU8A 1P5EA 5E8YA 4EZ5A 3NZ0A 4X2KA 1TKIA 5KE0A 4FNZA 4JRVA 2SRCA 2GNJA 4DTBA 4BJJB 2Y0AA 4YTHA 4LRMA 1KV2A 3HVCA 4FKSA 3UPXA 3DKOA 4DEIA 3OTVA 3IG7A 4JNWA 5KCVA 1MRYA 3QZFA 3RWQA 5EQPA 4ZEGA 4G5JA 2UZEA 2W5AA 4J97A 3G9NA 3WZEA 1G8JA 1Y6BA 2OH4A 2CN5A 3SW7A 3R0TA 3CD3A 2OGVA 3C4WA 3JY9A 2B55A 3SRVB 3AKJA 3BPRA 3QTRA 4ZSEA 4RX5A 1GNGA 3QA0A 2ZDTA 3QQJA 1OM1A 2W4OA 3DBFA 1J1CA 2YIRA 4O6LA 2YWPA 3D15A 1OZ1A 1QPCA 2C3KA 2W9ZB 4DH7A 3QKLA 4OBOA 2P3GX 3OEZA 2R9SA 4JVGA 4W9XA 3KFAA 2QU6A 4X3JA 5AUWA 2VO3A 4FV0A 2XJ2A 5CU3A 2XK7A 4CCUA 4NM7A 3PIZA 4F9YA 4QMQA 4O91A 1IAJA 4FKOA 4AXAA 3G6HA 3OT3A 4USEA 3HEGA 1J7UA 1R39A 5FEDA 4PWNA 4EOSA 3RPRA 2YITA 1PMVA 3PPKA 1JLUE 4IIRA 4KINA 4KRCA 4LUEA 3S95A 5HKMA 4D28A 2ITPA 1Y8YA 1TQMA 3MPAA 4WUNA 3EKKA 3LFDA 3QX4A 4F7JA 2ZDUA 5FQDC 3BZ3A 3BLQA 5HE1A 1DS5A 2F4JA 1XH5A 3PVUA 5EG3A 2QC6A 4II5A 2XIYA 3TV6A 5BUIA 4XEYA 2QOCA 2Z7LA 3F5PA 4UMRA 3FXWA 3EFJA 1REKA 5A14A 1HCLA 3KULA 3MH0A 4IJPA 2XK6A 3GU8A 2AC3A 4IX6A 3VW6A 2OZAB 4RJ4A 2XNBA 4EBVA 3NS9A 2VTQA 4FYOA 2ETKA 1XH4A 4GCJA 4BDGA 4EOLA 4F7NA 2QR7A 4BC6A 3E8NA 2Z7QA 2GS7A 4AZVA 2GTMA 3UG1A 2X7GA 4BGGA 4OLIA 1BLXA 3D7TA 4P2KA 3ZHPC 3KK8A 3BL9A 1JOWB 3AT2A 4L3PA 2QURA 5AAGA 1BI7A 4AN9A 4ZMFA 1JPAA 3TUCA 3MYGA 4YZDA 5M51A 2OICA 3IK3A 4ZIMA 5J5TA 2QO2A 3ZDIA 4O7NA 1CKJA 2WQMA 1PYEA 3G2FA 4DTKA 4FSZA 1CKIA 4FT5A 2VV9A 4O4EA 4D4YA 4RJ5A 4DDIA 3ORKA 4FZ6A 2VO0A 5CAOA 3FZOA 4I3ZA 4RC4A 4CLJA 5M4CA 4IC7A 3UZRA 5AIRA 1JKSA 4APPA 5CU0A 1GIIA 4AX8A 1W0XC 3RHXA 4ZSGA 4HZSA 4X21A 4BCFA 2I6LA 4IADA 3BBTB 3O50A 3F5GA 5HE3A 1QCFA 4NWMA 5AMNA 4JAJA 3DU8A 2WMSA 3M11A 4XP2A 5DR9A 1CSNA 5HCZA 2XA4A 3WILA 4PNKA 2B7AA 2W1FA 4NFNA 4BL1A 2X8DA 4CQGA 2CSNA 4L68A 5IISA 3OG7A 4C8BA 5A9UA 2BRHA 5K5XA 3R02A 1V0OA 3P1AA 3QYZA 2Z7SA 4PF4A 5HG5A 3PA5A 2C1BA 3MVHA 4ZXTA 3KXZA 1GAGA 2QNJA 2CKEA 2PVHA 3D5WA 3DB8A 3EN6A 4HYHA 4F7LA 3FQSA 3CKXA 5LMKC 2F2CB 2E9OA 3RAHA 4AGDA 4AZSA 2I0EA 5M4UA 3ATTA 3L9MA 4FIFA 5ANIA 4DN5A 1UU9A 2PZPA 1RJBA 3T3VA 3DJ5A 3OFMA 4UY9A 3WF5A 2ITTA 4F0GA 3OWPA 2PTKA 2WB8A 4WHZA 3KK9A 2XK3A 4DG3E 4EOQA 4R3RA 3WE4A 1QMZA 5DG5A 4CT2A 4PMTA 5B0XA 4DEBA 2PU8A 1M7QA 2IW6A 2VTPA 3HV4A 2ERKA 5DHJA 5AP0A 4KIPA 3RCDA 3ZBFA 4ACCA 3KXXA 4G2FA 4L53A 4BCOA 3RWPA 3VBXA 4EUTA 3E87A 1MQBA 2JKOA 4RX9A 4I6LA 3LHJA 3VW8A 4YU2A 4QMXA 1SVGA 1DM2A 1QPEA 3LM5A 3T8OA 3KA0A 3U8WA 4QMZA 3ZEWA 3C9WA 3GCUA 4EH4A 5A46A 1ZARA 3H9OA 4C7TA 2XK4A 5DRDA 4FYNA 4M69A 4FNWA 4K2RA 5IZFA 5CWZA 3RKBA 4O81A 3BL7A 4EOJA 4XJ0A 2BROA 3PZHA 1Q4LA 1SM2A 4C33A 4UN0C 4BDAA 1YHVA 3KF7A 4Q9SA 5CALA 2OJIA 3GQIA 4ZMEA 2BUJA 3R01A 2IJMA 3I5NA 4WO5A 4ANSA 3EQFA 5L6WL 2QQ7A 2YDKA 4NFMA 3Q6UA 3LFAA 3VNTA 5BYLA 4YSMA 4JXFA 3F61A 4MD9E 4QTAA 3NLBA 4JMQA 2C3JA 3HKOA 4RGJA 5ICPA 3JVSA 2ZJWA 4IXPA 4C02A 5A6OA 2UZNA 5F20A 3PUFC 1GZOA 3L8XA 4F9AA 2UW0A 4OTGA 3TACA 4O7ZA 3OC1A 4JG8A 3ZM4A 2OI4X 3T9IA 5CEPA 3UZTA 4M0ZA 2J90A 4PDOA 4D4VA 2XNEA 3V8SA 4IX4A 4MF1A 1ZY4A 2BHHA 4F4PA 5BMSA 3MBLA 4C58A 4IDVA 3U9CA 1OL6A 2J5FA 4BFMA 4RBLA 3AC4A 5C03A 5EFQA 3SW4A 2UZOA 1KE6A 2VWXA 1OIYA 2OF4A 1Q8ZA 3NUNA 2WFYA 5AP6A 3V8WA 4ALUA 2J2IB 3KXMA 1FMKA 4CFUA 5HCXA 4U8ZA 4YLLA 2DWBA 4ZLZA 5IUHA 2VTAA 3QQUA 3H0ZA 3BKBA 4MBLA 3VS5A 3CP9A 4RIWB 4AUAA 4FTIA 3SA0A 5AUTA 3HV5A 3NUPA 2W1GA 2VTMA 5HIBA 3ZZWA 3GOKA 2ZB0A 4DFXE 4Z9LA 5HQ0A 2GMXA 2UVZA 3OS3A 4U40A 5LCKA 5FDPA 5CSWA 2WTKB 3E93A 1OKZA 5CAVA 4EH2A 1YWRA 3CTJA 2E9VA 4Q2AA 1O6LA 1B38A 2A1AB 4ANNA 3CGFA 2R3HA 3PP1A 5LVMA 1NY3A 3ACKA 1G8KA 3FI8A 3W0MA 5HESA 4KIKA 2YWVA 3VS3A 3GENA 3DZOA 2HENA 3O8UA 4FV2A 3UIBA 1G8AA 2XH5A 4EH7A 3MDYA 1H4LA 5KZIA 4YR8A 3ORXA 1ST0A 3GCSA 5K0KA 5FTQA 2WNTA 4F70A 4RIYB 1ZOHA 2EU9A 1M14A 5CI7A 4YJNA 1WBVA 3RAKA 4KIQA 5JRQA 1I09A 3EIDA 4YC3A 2KULA 3MIYA 3I60A 2XIRA 4N70A 4QMNA 3LJ1A 3H4JA 2VX0A 2W1HA 2ZYBA 3ACJA 3L9PA 4JT3A 3R8VA 2OLCA 3W10A 3P86A 4PL3A 3OXZA 2JDSA 4GT5A 2PE1A 3Q52A 4WBOA 4G16A 3FMHA 4ZAUA 4IAAA 3SLSA 5KMKA 2YM4A 2QO7A 2F7EE 4PTCA 4DCAA 4F64A 2OXYA 2WAJA 1AGWA 3HLLA 2Y4PA 4MNEA 4RFYA 2NYAA 2BAJA 2ITYA 3ENMA 2VNWA 3PSDA 4QTCA 4CKIA 1UNGA 1A06A 4HGLA 4EORA 4C3FA 4EH3A 3U9NA 4FEXA 1YXUA 2UW8A 4HGTA 3SKCA 3IPHA 4GW8A 3HDMA 3QQFA 3BGPA 4O4FA 4Y73A 1VYWA 3Q4UA 3DNDA 1H1SA 4BZOA 4GK3A 4FK3A 5CVHA 3HV3A 5FXQA 3WF6A 2Q0NA 4O38A 2V62A 3E8CA 3TZMA 3HX4A 3FQHA 3R8MA 4E6CA 4IAYA 5JMSA 4PTEA 3DXQA 4AQKA 2F7XE 2JDTA 1H8FA 3LXNA 4TYHB 4NL0A 5KBQA 5DWRA 3ODZX 3KRRA 5HGIA 2VTIA 3MPMA 4O0UA 5BNJA 2JIUA 3HDNA 5DEYA 3N9XA 2C69A 4EOKA 3NAXA 4PDPA 3FC2A 5EM8A 2YCQA 4F9CA 5FM3A 2IZSA 4ZOGA 3L9LA 5CXHA 4CT1A 4X3FB 3KVXA 2AUHA 4KS8A 4AE6A 5CF8A 4QMYA 3W2PA 5AADA 4GKIA 4O0VA 3PJ1A 4IH8A 4MAOA 1YHWA 2YJSA 3HGKA 3LFEA 4FKGA 4RWKA 1YOMA 3D7ZA 4FTKA 2BRNA 3HP2A 4FSNA 5J5SA 4QMOA 2BPMA 3P5JC 3CPBA 3WE8A 4UB7A 3E3PA 5FM2A 4NM0A 3P7AA 4QNAA 3UPZA 4FV5A 5KMLA 3UO6A 4EEVA 3TUBA 3V5TA 4AN3A 1RDQE 4TWOA 2R0UA 3JR1A 1OKYA 3ORPA 5GZAA 4ANOA 4JI9A 4FIHA 4G3CA 4BDEA 1KE5A 4AZTA 3QLFA 3EYGA 3IDCA 4GYGA 2P2IA 1O9UA 5LVLA 3ZU7A 4AZFA 3Q9YA 2CDZA 4F99A 3I4BA 3CGOA 3V04A 4UWYA 3ZS5A 1REJA 3ML1A 3A7HA 3Q32A 4UBAA 5HLNA 3U4WA 3NVKI 3EN5A 4XLIA 1Q41A 2X0PA 5H8BA 2GDOA 4J53A 1J91A 5IA0A 3GT8A 4Q5EA 4RX7A 4GT4A 4IM3A 5EM6A 4BZNA 4FV1A 3L9NA 1X8BA 3LE6A 4S2ZA 4YJVA 4B8MA 2YM6A 4JL9A 1EH4A 3IS5A 3VF9A 4BBEA 2V22A 5BVDA 3KMMA 4UXQA 3UC4A 2YEXA 5IQGA 2X7OA 2ITWA 3NMUF 3F2AA 2OW3A 3EQPA 3R22A 2PVJA 2YACA 5EM5A 3KRWA 2PVLA 3QTWA 2XANA 2XCHA 3CBLA 3MVMA 4DFNA 5K3YA 1NT2A 5JSMA 1WAKA 3BHUA 3LCSA 5HTIA 5AM6A 1ZYJA 2J51A 2HOGA 2O8YA 4I22A 3L1SA 4TNBA 4QMTA 5EI8A 5I9ZA 1BMKA 4FGRA 2P33A 3C7QA 4YZ9A 4USFA 1WBNA 3RZFA 1PXNA 2XF0A 3GBZA 3SXRA 4IAIA 3UC3A 5AAEA 5JFVA 2OIBA 3KEXA 4I4EA 3UE4A 3UMWA 2QVSE 4F0FA 2WMRA 2C6LA 4QO9A 4QP6A 3BV3A 2ETRA 4M8TA 4NKSA 4UEUA 4MQ1A 3WIGA 1XMLA 4QTEA 2XAOA 3LOKA 4FV6A 4NM3A 4CFFA 4YJTA 3RALA 4MEDA 4E1ZA 5IH4A 4FJVA 2YIXA 4ITIA 4IVDA 2C1AA 1KE9A 3DCVA 4BRXA 3W2QA 5M4IA 2X9EA 3W0SA 4AFJA 3FLYA 3C51A 3VUKA 3EL8A 4IX5A 5KMOA 4UWBA 2GNFA 2Y7JA 3M42A 4K77A 5I3OA 5I9VA 3UQFA 4PX6A 4FRFA 3MS9A 1GZNA 4BCHA 3TTJA 2X4FA 3LVPA 4H1MA 4FV3A 3MY5A 1OI9A 4ZK5A 1OUKA 4DH1A 3KMWA 5HNGA 4DAWA 3UBDA 3LPBA 2C6OA 3ZRMA 3DLSA 5BVWA 5K0XA 5L8KA 5DPVA 4DA5A 4MVFA 4FG9A 3GU4A 2ZMDA 5I0BA 2VTJA 3MIAA 2ITQA 4C34A 3NGAA 5IEVA 3O7LD 3RPOA 3COKA 4O7LA 3RAWA 3DZQA 1Q62A 3TZ9A 1H25A 1OITA 4UWCA 3WZUA 3AKKA 5GINE 2XNOA 3C50A 4F1MA 3VUGA 4CFVA 2YM3A 2VWWA 4PV0A 4K33A 4ZTQA 4M7IA 4FMQA 4FZAB 5EKOA 4D2RA 3LCTA 4HPUE 3NW6A 3LFQA 2P55A 2YCSA 3ITZA 5D41A 3NYOA 2FSLX 3FPQA 5B7VA 4ACGA 4C4FA 4D2VA 4BCGA 2YABA 3ZSGA 2CLQA 3O7LB 4RIXA 2G1TA 3IGOA 3KRJA 3CCNA 4I21A 3ROCA 3HMOA 4EQMA 2W05A 5L2TA 2BDJA 3ORNA 2GNIA 2VTOA 4I5PA 4UALA 3RMFA 5FG8A 3ZUUA 4GFOA 2JLDA 2Y9QA 3FLNC 2NRYA 3MFRA 5DT4A 3LM0A 5CNOA 1ND4A 3DNEA 5IPJA 3BWFA 5JK3A 2W1DA 4BWKA 4BYJA 1PW2A 3BQCA 3R9OA 2JC6A 5C8KA 1SVEA 1J3HA 5C01A 4NKAA 5GIPE 4U3ZA 1HCKA 2VRXA 1IAHA 3V6SA 5LVOA 1L3RE 3VQUA 2UV2A 2UW3A 4C2WA 4AA0A 3EZVA 4PUZA 2QODA 4KKGA 4BBFA 3ZLWA 4FTNA 1PXPA 4B8LA 3NEWA 3P08A 5HVYA 3NVMB 2CGXA 2VWZA 4RLKA 1TVOA 3L8SA 4QP7A 2BZIB 3MY1A 3MI9A 2AC5A 3PJ3A 5AP5A 4E4NA 4EH9A 2RFSA 3GC8A 3SOCA 4ZTNA 4O1OA 4NK9A 1Q5KA 2PMIA 2ZV2A 4XH6A 4P5ZA 3VF8A 1VZOA 4IEBA 4GIHA 1YRPA 2OZAA 3GNIB 4P90A 5F95A 4NYEA 3K3IA 1PMNA 4QQCA 5TT7A 5AUVA 4BF2A 3GFWA 3TJDA 1F5QA 3RP9A 2BAKA 3R63A 4LOPA 5M06A 1Q61A 2H34A 4G3EA 2HCKA 4U80A 2ITNA 5DE2A 3NCGA 5AA8A 1XH9A 3G33A 1KWPA 3QRIA 5TOZA 2PK9A 1A9UA 1PJKA 5CZHA 2JEDA 2XMYA 4K8AA 4V0GB 2QLQA 3ATSA 3ORIA 1YWVA 3ZO3A 3NUSA 4C4JA 3FMDA 2BTSA 2UVXA 1W84A 3OY3A 2HYYA 2JDOA 4CYIA 1FGKA 2BAQA 3UNJA 2ACXA 5HE0A 3WF7A 3PG3A 2YAKA 4AT5A 4FUYA 4XG3A 4FKJA 4R3PA 3ZEPA 3LMIA 2BDFA 3BHHA 2O2UA 3JVRA 4IMYA 2BIKB 4LL5A 4MCVA 1H1QA 4XCUA 2J0IA 5AJQA 4D4RA 3AMBA 4I93A 5JEBA 3A60A 3OWJA 1NW1A 3SAYA 3EN9A 2VN9A 1GZ8A 4N6YA 3IO7A 4NJDA 4TYJA 5J9ZA 3R04A 4XV9A 4X2NA 2Z8CA 4DT9A 3B8RA 3K5VA 4EC9A 5E92A 4FV4A 4CKRA 3P9JA 4OW8A 3HNGA 2BDWA 3JY0A 4J52A 2CKQA 1JSUA 4BTMA 2VAGA 2R64A 4TXCA 5KBRA 4U81A 1UNLA 4GUBA 3MVLA 2UZLA 2BKZA 3R2YA 4FSYA 1HOWA 4LV5A 1H01A 2JIVA 3DK3A 1UA2A 4BCIA 4DGMA 5AX3A 4XMOA 4CZUA 3RK9A 4CFXA 1OVEA 5JGDA 4CG9A 3QCXA 3NW5A 2H96A 3FHIA 2BRBA 3CR0A 3LFNA 3OW4A 5DOSA 4AOIA 4YUQA 3BLRA 3FL4A 1FMOE 4E20A 4HVDA 4KBAA 5ACKA 5BUEA 4RVTA 4IFGA 2C6IA 4WRSA 3R7OA 2QOQA 3WF9A 3A4PA 3D9VA 4IWQA 4BDDA 4DT8A 3UP2A 5BMMA 3ZLXA 1QPJA 5G1XA 4K9YA 4IB0A 4K0YA 3ZCLA 5HX6A 2PPQA 3O23A 5CVFA 3UOKA 5ACBC 4PRJA 3PYYA 4ACDA 3FYJX 3FUPA 2H8HA 3FHRA 3MSSA 2XNPA 3PSCA 2WMVA 3RI1A 3M2WA 3V5PA 5IQBA 4L7FA 2WOUA 3CKWA 4LGHA 2R3MA 2X39A 5IMEA 4O0TA 4AOTA 1P2AA 5M08A 2PHKA 5M09A 4DBXA 3QC4A 3SQQA 1T46A 3OVVA 3DXPA 3HUCA 4BDIA 4BN1A 1VLRA 2QLUA 4JOAA 3UTOA 4IDTA 4I1ZA 1F3MC 4FV9A 4NCTC 5J8IA 3W0QA 2WTVA 4AE9A 4LL0A 2DS1A 1JKTA 2W1EA 4DYMA 2OU7A 1G8SA 3MESA 2YISA 1QL6A 5CVGA 3IKAA 1OL7A 4FR4A 4XP3A 5FRIA 5JZNA 4R78A 3BBWA 4RLLA 4QRCA 4A07A 3WF8A 3F88A 3O2MA 4LV8A 4A4OA 1YDSE 3PA4A 4KB8A 3TKIA 4EYJA 5A4EA 2PWLA 2OFUA 3QQLA 2BRMA 1OL5A 3GCVA 2QOOA 2QO9A 3FAAA 3PXRA 3H3CA 3TN8A 3FI2A 3DLZA 5EDQA 3MN3A 4FTTA 3OCSA 4JG6A 2NO3A 4FF8A 3F3WA 4KNBA 5BYZA 1ZZ2A 3MTFA 3CXWA 3NRMA 4IB1A 4E6DA 4OT6A 5HIDA 1FVVA 1ERKA 1W82A 4E4XA 4D2TA 5M07A 1NA7A 5CENA 4AW2A 5HVKA 2NNWB 3W8LA 4YURA 3F66A 2YZAA 1U5RA 3KGAA 3QZHA 5D11A 3NAYA 4UXLA 4PMPA 1OECA 5LWNA 4IVBA 3W55A 3VQHA 4BIDA 1TQPA 4IZ7A 3H10A 3Q9ZA 4AWIA 2R7BA 5ANOA 3CTHA 4U97A 4EJNA 3IW7A 3EQDA 5JQ5A 2W17A 2EUFB 5CX9A 3GU6A 2QKWB 5T3QA 4C4EA 3NNVA 2F49A 4E6QA 5EHYA 3AOXA 4AXDA 3VS2A 3FPMA 3C4CA 2QR8A 2X8EA 4N0SA 3KRLA 2ZMCA 1CMKE 2XKEA 5IUGA 3VVHA 4X6QC 4ANLA 4BTJA 4BCJA 2I40A 3P0MA 4ANMA 4Z16A 3UOHA 2R3IA 3G51A 1Z5MA 4C4HA 3H9RA 4D1SA 5L2SA 3QKKA 3D5VA 2P0CA 3WARA 5CAQA 3AMAA 4QDEA 3EFLA 4CTCA 4H1JA 5CAPA 2WTJA 2I0VA 4NM5A 4RJ8A 3DBDA 1OPJA 1CDKA 2XJ0A 3KB7A 5EYCA 5FP5A 2A2AA 4L7SA 2V55A 2BALA 3FZSA 4YGAA 4BHZA 3FLQA 1GJOA 2X2LA 3QZIA 1M52A 3KN6A 3OT8A 3TT0A 4XG6A 3SOAA 2GS6A 2H6DA 2Y4IC 2YA9A 4KAOA 2C5XA 5EYDA 2WD1A 5CF6A 1ZYLA 4AF3A 5E8WA 3KY2A 5K5NA 4NSTA 1TFFA 2YFXA 1BL6A 1H07A 2O63A 5E8VA 1LEWA 1BL7A 3MW1A 4TN6A 1PRYA 2XYUA 5JZJA 5CSHA 3E64A 3U6JA 5IQIA 1U54B 3BIZA 3QCSA 4GYIA 3UZPA