4XS2A

Irak4-inhibitor co-structure
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
297
structure length
283
Chain Sequence
b'TRFHSFSFYELKNVTNNFDERPISVNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Discovery and hit-to-lead optimization of 2,6-diaminopyrimidine inhibitors of interleukin-1 receptor-associated kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 283
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xs2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xs2A01
2UZDA 4I4FA 5CAPA 2OH4A 4RC4A 5EYDA 3SKCA 2PVHA 3H10A 4ZIMA 5I3RA 5AAEA 4CZUA 3VF9A 1GZKA 1O6YA 3OOMA 4RWJA 3U54A 4UYAA 5AR8A 4D5KA 3VIDA 5J95A 5EW3A 1WVWA 4DBNA 4W9XA 3CKXA 4WRSA 3NCGA 3ANRA 4W8DA 1TQMA 1V0PA 2GS6A 2BKZA 2XA4A 2YAKA 3FYJX 4JL9A 4UMPA 1ZZ2A 4YBJA 4M13A 2QU5A 3CE3A 2VTIA 2VWBA 3PRIA 3PVWA 1UVRA 3I5NA 3RAWA 4YO4A 3OG7A 3WF6A 3CTHA 4O7NA 5D10A 2JIUA 4JQEA 5CNOA 3ZRMA 3B8QA 2BRGA 1MRUA 1KE6A 3FZSA 4RG0A 5F1ZA 4FVRA 4PNKA 2BMCA 2CCIA 2R3JA 3U4WA 2PUNA 5HE1A 2XIXA 3OP5A 3OTVA 3CJFA 1WBWA 4FIJA 4LFIA 4XV2A 3UGCA 2X2KA 4BWKA 4BCPA 3EQRA 5DMZA 5HZNA 5KNJA 4QMVA 3GU5A 3O7LB 4O83A 4Z3VA 4RX8A 4BDIA 4CVAA 4TYGA 4OTRA 2DYLA 4PTGA 4PMSA 4QMOA 5DVRA 3D2KA 5AAGA 1A06A 2EVAA 2QO9A 5JQ8A 3W2PA 4GJ2A 2QHMA 5EW8A 4L01A 3D83A 4M14A 3DBDA 3LMIA 4F63A 5JSMA 2W17A 3HAVA 4EWQA 3ULZA 3D7ZA 2FA2A 3I0OA 3NYNA 3FYKX 3BYSA 3LQ5A 4DH1A 5EM6A 1Q41A 2XZSA 3R1QA 4O7TA 3AXWA 2C1BA 4AW5A 3TZ8A 1OPKA 4IAYA 1B38A 5FP5A 3OWKA 2XNEA 4QTDA 3COKA 2VTMA 1SNUA 5CYIA 5L8LA 4ZJVA 2H6DA 2WXVA 2NPQA 4JBOA 4P4CA 3EFWA 5JEBA 2IPXA 5A6NA 4GK3A 3IKAA 3PLSA 4DGGA 2WFYA 1H1RA 4IB1A 1G3NA 1YI4A 2P0CA 4ANOA 2ZB0A 3GEQA 4F7LA 3BZ3A 4C34A 3BHVA 1PMVA 3GB2A 2R5TA 4IJPA 2IG7A 5LMKC 1H0VA 2IZTA 4IHPA 3VNTA 4GKHA 3R6XA 2NRUA 1YHVA 4FSNA 4EOOA 3BGPA 4QMMA 4L7SA 2A19B 3ULIA 4I20A 2CKEA 2J5FA 1XBAA 4HYIA 4EC8A 5AV4A 1U59A 5EKNA 4O82A 4EOPA 2VO7A 1MRVA 5CENA 1M52A 2W4OA 3FLSA 1XKKA 3H30A 5ANGA 4IWQA 5HICA 4K77A 5HIBA 3FLNC 4FKJA 5CANA 3S1HA 2WGJA 5LXMA 4ASDA 4MTAA 3T3VA 2HYYA 3A7IA 3F3UA 3QF9A 4YBKA 1YWRA 4FTOA 2V55A 4LM5A 5D7VA 4RSSA 5CTPA 5ETAA 3ZRLA 3N9XA 3TN8A 3GU6A 2HXQA 2IO6A 3WF7A 4U45A 4FSMA 4PL5A 2OLCA 3CEKA 4NT4A 3FLQA 3FLZA 3MH3A 3ORLA 4OT5A 1XH4A 4E93A 2EWAA 5CU6A 5C4LA 5ETCA 5HX6A 3ORZA 3PZHA 4FYNA 2KULA 5EHOA 2FVDA 4DLJA 4E6AA 5IQHA 1IR3A 3R8MA 1CKIA 2CGVA 3VQUA 3D5VA 4NTSA 2GNFA 4LOQA 2CKOA 3IDPA 2I0HA 4P5QA 2W99B 2A4LA 4PP9A 1UWJA 3SXFA 3TTJA 1DS5A 2C68A 3CQWA 5L2WA 3C5UA 1G5SA 2WMTA 4WBOA 1SVGA 4KD1A 2WO6A 2PTKA 3IOPA 2Y6MA 1WBSA 2J6MA 4MVFA 4GRBA 5FD2A 2QOHA 4OTWA 3T8OA 3OF0A 5HNIX 5L6OA 3FMJA 5GJFA 4KWPA 3DFAA 1FOTA 4ZSGA 4FICA 4XH6A 3SA0A 2X0GA 5ITAA 5CEIA 4WNMA 5A4TA 5CI6A 4D1XA 3DBQA 3R28A 5GZ8A 2BAKA 3Q60A 2JBPA 4GIIA 4AOJA 4A9SA 4USEA 5KKRC 5ETIA 1YXXA 1W83A 5D7AA 3KN6A 1S9JA 4K11A 4X3FB 2B0QA 3LCOA 5EQEA 5E7RA 4IC8A 5H8BA 4BTFA 4G9CA 5HU3A 2CDZA 3D2IA 4D4VA 3Q9WA 5DBXA 1OIRA 3WILA 2Z8CA 4II5A 3S2PA 2W5AA 3GU7A 4I6BA 4Q2AA 1UKIA 4KKGA 3RKBA 3ZMMA 4XG3A 2YM7A 4E4NA 2RSVA 2ITYA 4FT3A 4G2FA 4PDPA 4IX5A 3QZFA 2VNWA 1FBNA 3MVJA 2YERA 1PY5A 3Q52A 5AA9A 1SNXA 4QP6A 4ANLA 4EKLA 4F7JA 4RX7A 5D12A 1LEZA 4FZ7A 1NT2A 4F99A 4Z7GA 3MWUA 2FSLX 4WHZA 2PHKA 4B99A 3HV3A 5LJJA 5CZIA 5AR5A 3PJCA 3Q9ZA 3QUPA 2C6MA 1Q3DA 3QGYA 3ZUUA 4FK6A 2W1HA 5G6VA 1H01A 4JG8A 1WBVA 3KKVA 3AQVA 2YIYA 3C0GA 4FYOA 4NW6A 4TPTA 1NVSA 2XH5A 2YLEA 3ID6C 2BDJA 4FIGA 2HY0A 2UZLA 3R2YA 4EUUA 1URWA 2EUFB 3NZ0A 2QR7A 3CR0A 3PJ8A 1XH5A 2E2BA 4TW9A 4XOZA 3VVHA 3EL8A 4KS8A 3UVQA 4AACA 4BGHA 2GQRA 2I7QA 4CFWA 2HWOA 3E88A 5GIPE 2VTAA 2WMXA 1BI7A 3LFDA 2C69A 4UMRA 4O86A 3KXHA 3QA0A 4GFGA 4UWYA 2YZAA 2XS0A 1UU3A 2F9GA 4GUBA 4U41A 4F09A 4ZMFA 3BE2A 5IMEA 4FL2A 2PZPA 3FMKA 4YZBA 4EQMA 1JSUA 1FGKA 1PMUA 3HV5A 4K0YA 5HLNA 5BUIA 2X7GA 3O17A 5FXQA 4E5BA 2LGCA 4ACGA 5AP7A 3R7IA 3NNUA 4FF8A 4AW2A 4I5PA 2VWIA 1TQIA 2PVJA 3BYUA 4QP1A 3K2LA 3NUNA 3ZFYA 3QCXA 2ONLA 4J71A 5EK7A 5K3YA 2B52A 4PPCA 3P79A 2ETKA 4L68A 4BKYA 1JNKA 3LXNA 3OT3A 1YWVA 4YHJA 2PU8A 2BHHA 3CP9A 4G3EA 5ANEA 1PMEA 3IK3A 3C4WA 4QYFA 5EG3A 2JDRA 2CN5A 4J99A 4CFMA 3BLRA 1R3CA 2NP8A 4BHNA 4NH1A 4GVJA 3MB7A 4O2ZA 3U9NA 3PXRA 2WQBA 5I9WA 4GJ3A 3ENMA 3CBLA 5F4NA 2DUVA 3ZO4A 3PWDA 3B2TA 2VTHA 3C4FA 4B8MA 1M2PA 3DLSA 3MVLA 4RIWB 4DFBA 3LE6A 3DS6A 5AR3A 2B55A 2WD1A 3G6GA 3ZM4A 4D2PA 4DEHA 2VX1A 5BQ0A 3ATTA 1H0WA 3MTFA 4R6VA 3RPOA 1ND4A 3VBXA 5C8MA 4NJDA 5IA1A 4IDVA 1FVRA 1Q62A 5EM5A 5BVEA 4UY9A 2Y4IB 3UIXA 2YFXA 2OZAA 3O0GA 4I6HA 4GV1A 5E8XA 4BDGA 4I0TA 1PKGA 2CMWA 4AFEA 4IB5A 2PSQA 3FMHA 4M3QA 5J1WA 3GCQA 4DEBA 5D9HA 3EKKA 3ZO2A 2R3FA 4J97A 4RIXB 4MH7A 2R7IA 2QHNA 4MYGA 3QRUA 3WF8A 3THBA 4C2VA 4OTQA 3R1NA 5LOHA 2XRUA 5DN3A 5IDPA 1GIJA 4NWMA 4BBFA 5JH6A 3NCZA 5FTOA 3MVMA 4AGWA 3I5ZA 2UW7A 3PY0A 3QQKA 1O6KA 4M15A 4ZSLA 3P9JA 5FQDC 5TT7A 3GXLA 2WQNA 4RVLA 4L3JA 3WE8A 3WOWA 4BCOA 5GIOE 4BDBA 2WOTA 2WU6A 2XNOA 5DWRA 3RNYA 4HPTE 4D9TA 4S30A 4RT7A 4CG9A 3LQ8A 4WSYA 2E9NA 2OF4A 2X1NA 3CGOA 5DEWA 5AUYA 2JKKA 3CTQA 4DLIA 3QD2B 3HEGA 3D5WA 4UMUA 3DBFA 3H3CA 3E5AA 3QCQA 2IW9A 3ZSIA 2QO2A 4I5CA 1X8BA 4J53A 4JRNA 4O27B 2HW7A 2GHGA 4PUZA 1Q8YA 2I0YA 2W1EA 1ZYLA 4O2PA 3D5UA 1P4FA 4LGGA 1IAJA 3D94A 3PRFA 1OKZA 2VX3A 4RA4A 3EYHA 4C62A 4ZSAA 5EQPA 4AN3A 3VRYA 4D2VA 4YU2A 3KXMA 2GPHA 4YLJA 1DM2A 2H8HA 2IVVA 2WMSA 5E8ZA 2CKQA 4FIEA 1JKTA 3L8XA 3Q4CA 4E4LA 4M68A 4YJQA 4EK8A 5IF1A 3POOA 4ACMA 1RW8A 5DEYA 2OXYA 4CMOA 5I9VA 4E3CA 3ORNA 3KREA 3DU8A 4ANSA 1H24A 3EYGA 3QTSA 3FXWA 4FTCA 2WHBA 3DB6A 2JLDA 2BUJA 4G34A 4A4OA 4ZAUA 3UOKA 4FTQA 3AC1A 2G2FA 3G15A 1P5EA 3IW7A 4XCUA 1KSWA 3QBNA 5F95A 1OVEA 4OTDA 3FI2A 3VN9A 4BWXA 4KBAA 4KIQA 3EJ1A 4MQ1A 2NO3A 3L9LA 3IW5A 5CSXA 4EH4A 5AM7A 2DS1A 4E7WA 3COMA 4C02A 3U6JA 4TKSA 4G6NA 4CGAA 4MXZA 4DF3A 3COIA 1XBBA 3Q53A 1ZLTA 2WMAA 4UEUA 4AGCA 1M7QA 5JMSA 2BRHA 2GQGA 2C6LA 1URCA 3KL8A 5KMIA 4I92A 4EOLA 4CRLA 3LFAA 5FG8A 3NUAA 1YDSE 4AP7A 5HNGA 1H08A 1Y6AA 2W1ZA 5EH0A 4BF2A 4O7SA 3MPAA 3TUCA 3MESA 4D1ZA 4KUJA 2C6OA 1YXSA 4QP2A 5HNBA 3VS5A 3RZBA 1QCFA 4YJVA 3ZM9A 5DHJA 2BKKA 4XP0A 3IW8A 5AP2A 3RM7A 2RIOA 1FVVA 4ENYA 2GQSA 3VW6A 4PMPA 3VBWA 5IEXA 1Q8WA 4LQMA 4RMZA 3P7AA 2HK5A 4BCMA 1H1PA 1M7NA 3DPKA 3W10A 4BBMA 4EQCA 5L6PA 1U5QA 3UQCA 3K3IA 4R78A 3ETAA 3MVHA 2R3HA 2JITA 4RJ7A 5AIKA 4EUTA 3NUUA 3HGKA 5GINE 4XLVA 4RA5A 4L9IA 1O9UA 3Q9YA 2P33A 4F1TA 2OJJA 3IDBA 4QTEA 4GT3A 3HZTA 4RRVA 4D4SA 4ASZA 4I24A 3KVXA 3RTPA 4H1MA 3QWKA 2YDIA 4OBQA 3ROYA 2R3OA 2Z7LA 3G33A 4ZJJA 4CKIA 4U8ZA 3C0HA 2C3KA 2C5XA 5C01A 5IQFA 4GVAA 2XJ1A 2CLXA 2FSTX 4O1PA 4UWCA 4E20A 3W32A 2ERZE 4JOAA 4JIAA 5JRSA 3BRBA 3DCVA 4UMTA 2YN8A 4EHZA 3P1AA 2J90A 1B6CB 5J79A 4F0IA 4RIYA 4XRJA 4TY1A 5AP1A 3OWJA 5H9BA 3N4TA 2C6EA 4WG3A 4O7WA 3QUEA 5FP6A 3QUDA 4HZRA 1RJBA 3TNHA 5A4CA 1LPUA 3OROA 2JAMA 2OG8A 1ZYCA 4IWOA 3VC4A 3ANQA 1ZRZA 3C13A 4H1JA 4QMPA 4XOYA 4EEVA 2HY81 3NVMB 4RGJA 3GU4A 1H1WA 3MA3A 3Q3BA 3PG3A 4FVQA 2Y9QA 1PXIA 2UZOA 2RFDA 1T45A 4BGGA 4FV3A 3RAIA 3OD6X 4XBUA 3JS2A 2XMYA 3EN6A 1OL6A 4YPSA 5JZNA 3VHKA 4BI1A 2W1GA 2XBJA 2XKFA 4YHTA 4APCA 4W4VA 4F6WA 5C27A 5BVOA 4IWDA 3G6HA 2GHMA 3VRZA 4RIOA 3FDNA 5AP0A 4M69A 1XJDA 4ZY6A 5E8VA 3A2CA 4CFXA 4IZAA 1Q5KA 4AG8A 3OEZA 2HAKA 2HXLA 2ITWA 3D14A 3NX8A 4QMNA 3I81A 2OJFE 4GFOA 3F5PA 4N6ZA 3VBVA 4AW1A 1CMKE 2PMOX 4L42A 3R7YA 4HYSA 5CF6A 2YM3A 4ZSJA 2C5OA 4G1WA 2YACA 4O1OA 4G9RA 1H1SA 2VU3A 4NJ3A 1Y57A 4EH3A 4BDJA 1NVQA 4JRVA 2OIDA 1Y8GA 3G9NA 3NUYA 1IASA 5A4EA 3NVKI 2BROA 2C0IA 2QVSE 2VTNA 1K2PA 4O81A 1WBOA 4BCHA 3UNZA 4G6LA 1PJKA 1P4OA 2ZJWA 2B4SB 1MQBA 3DZOA 3VS0A 4TZRA 3LJ1A 1YXUA 2GS7A 4R3CA 2R3GA 4FIFA 3L9NA 4RJ8A 4MQ2A 4FZDB 4IM0A 3E8CA 3FY0A 4R3PA 4CCBA 3C9WA 4HNFA 2W9FB 5DPVA 2ZDUA 4EK5A 2YISA 5JQ5A 4CLJA 4O38A 3V5QA 4G6OA 3FI8A 3ERKA 5KE0A 4EH6A 3KMMA 3MTLA 3A8WA 3PLAE 4J52A 4DEGA 1W98A 4FNXA 4DITA 2ZM3A 2P3GX 3BKBA 4FODA 3FPMA 4AZFA 3R0TA 4DG2E 2WTVA 3TCPA 2C4GA 4IE9A 2C3LA 3HV4A 4JJRA 2YIXA 3DJ7A 3MA6A 4QYEA 3G0FA 4OR5A 1OGUA 3G0EA 3R9NA 2J0IA 3R8VA 3UQGA 4RBLA 1UNLA 3DK3A 2AYPA 5BVKA 1PHKA 4UX9A 5CI7A 3QL8A 4X6RA 4F0FA 4AU8A 5IEVA 2UW5A 5HG7A 3QQJA 2XK4A 4BDAA 4C3FA 4M67A 2JKMA 3QRIA 4V0GA 2XIRA 3KVWA 3W2SA 4AN2A 4F9BA 2R4BA 4GT5A 3TV7A 3VQHA 2CN8A 3FAAA 2XK3A 3VBTA 4OAUC 3DXPA 3ZC6A 2Z2WA 3VW8A 2ZYBA 3LM5A 4QMXA 3P86A 3JY9A 3OCSA 4W9WA 3P0MA 4EORA 3FKNA 2Z7QA 3DAEA 2Z7SA 3K3JA 4RWKA 5M53A 4BGQA 3BEAA 4FNYA 3W1FA 4EHGA 4QTAA 3BPRA 5KUPA 3I1AA 5IU2A 4JS8A 5J1VA 5E4HA 5M55A 5I3OA 5JRQA 3S00A 5T3QA 1JWHA 3WZDA 4IAFA 3OUNB 3VULA 3CQEA 5C1QB 1R0PA 1UU8A 3OHTA 3RPRA 3VUKA 2GDOA 4BC6A 3G9LX 2WKMA 4C58A 1U46A 4FC0A 4C4HA 2ETRA 5KX8A 3QQLA 5DRDA 5CAQA 4ZTSA 2XF0A 2WTJA 1OM1A 2O3PA 4MXAA 5K4IA 3RHXA 3IG7A 4G5JA 5BUJA 3A8XA 4EI4A 3AMBA 3A61A 4MWHA 4RQKA 1WMKA 2QURA 2VGPA 3LJ0A 4ITIA 5IA2A 4OT6A 2REIA 1TQPA 3OBJA 4GMYA 4BBEA 5AUWA 5AWMA 3NMUF 1A9UA 2F57A 3HX4A 4PTCA 3UPXA 3LFQA 5IEYA 3Q2JA 3REPA 2GNHA 2W9ZB 4MK0A 1U4DA 4ZTQA 4W4YA 4DT8A 4AA5A 3W55A 2CGWA 2ZMDA 4U79A 1YOJA 5DA3A 4DGMA 2XEZA 2R3NA 4MD7E 5F20A 2ACXA 4YO6A 3SW7A 4FGBA 3VWAA 4NUSA 3LXLA 5CSWA 3MI9A 3L1SA 5HBJA 1FPUA 5DYJA 3NSZA 3UOLA 5BNJA 3HDMA 3UOHA 4EH2A 4EHEA 4FTTA 3UIUA 4D1SA 3NDMA 4DT9A 4C4FA 5KO1A 3RK7A 4BN1A 5C8NA 4O7ZA 4N57A 4M66A 5EI6A 3VS1A 3PG1A 4DA5A 4RFYA 3PDTA 4A9UA 2BFXA 5AIRA 2WPAA 2WAJA 3PJ2A 3FKLA 3UP2A 1PRYA 3UG1A 1GIHA 3AMYA 3HMOA 1M2QA 2W1CA 4QTBA 2OSCA 3FQSA 1ERKA 2JEDA 1CKPA 3HUBA 3I79A 4C3RA 4WOVA 1TKIA 2XM8A 4Y5QA 5JFVA 4I1ZA 2YWPA 2X6EA 4O0SA 4MXXA 2XIZA 3VBQA 5CZHA 3DXQA 3DBEA 5LVOA 3BU6A 3OXZA 3DNEA 3UOJA 2GTMA 4ZTMA 5DRBA 1J3HA 3TWJA 1OPJA 2BZJA 1J1CA 3FMDA 4DTBA 4V01A 5HGIA 1QPJA 2R3IA 5CVFA 4QPAA 4ZZOA 3JY0A 4IIRA 4A9YA 4FKLA 2C6DA 4D55A 2EB3A 5HO7A 5L8KA 3Q04A 3QXPA 3IO7A 4OTPA 1R1WA 5D1JA 4AA4A 4FEXA 1ZOEA 1Q8ZA 2WTDA 4JDKA 3ACKA 4W4XA 5FGKA 2VNYA 3NS9A 2YABA 5CEPA 3WARA 1FVTA 3MFUA 4KBCA 3ITZA 1JVPP 4CFFA 2J50A 4LL5A 3U8WA 4R7BA 2DQ7X 5IQEA 4DFYA 4LL0A 2OZAB 5FBOA 3OUKA 4PV0A 3FI4A 1Q97A 2VGOA 4TWPA 5CSHA 4FE2A 4EJ7A 3UJGA 5LVPA 1IAHA 2UW3A 2C0TA 3MV5A 2WOUA 3DOGA 3BWJA 5HIDA 5BYYA 2BR1A 2GCDA 3A62A 3F7WA 3NYVA 2JKQA 2XRWA 2WZJA 4GL9A 3UNJA 5HTBA 2YIWA 1ZMWA 3MH1A 4I22A 3H4JA 3HVCA 1GJOA 5TKDA 2JIVA 4LOPA 4QMLA 2IVUA 5BMMA 3ZBFA 4DTAA 4FTLA 4S34A 4FSTA 5A6OA 3E63A 4YSJA 4PDYA 3MSSA 4DTKA 2PZ5A 3GC8A 2H9VA 3NAYA 4OTIA 2OH0E 3FZPA 3ODYX 2Q0NA 4F70A 3LFNA 2I0EA 3WIGA 4YTFA 2HELA 3ZC5A 4GYGA 2PUPA 3EN5A 4J95A 1U54A 4IVCA 5CAUA 3QHRA 4R7HA 4WUAA 4F6UA 3RAHA 4H3BA 5L3AA 1FMOE 3UVRA 4KKEA 4U6RA 3MN3A 4DYMA 4X3FC 5IH5A 5BYZA 3GENA 1QMZA 1IEPA 2XP2A 3OS3A 5FDPA 1QL6A 2YM4A 4CMTA 5HE2A 3NW7A 3RGFA 4AWIA 4CQGA 4RX5A 5FDXA 3Q6UA 2GS2A 2VTOA 4O7VA 4IVAA 5AJQA 3V8WA 4Y83A 4FKOA 5IZFA 4U43A 4AZEA 4FL3A 4X2JA 4BCQA 4FV8A 2PVRA 3OY3A 4Z55A 2OFVA 4QP4A 2YZLA 3I60A 4L67A 2PE0A 4UV0A 3AT4A 1YXTA 2QU6A 1JOWB 4F9AA 3BE9A 3QTQA 4C4EA 5CALA 5HIEA 4GUEA 4JQ7A 4AAAA 2B9FA 5CSPA 1WBPA 1YKRA 1NY3A 4C33A 4CKJA 4YTHA 3TT0A 2F2UA 2VTQA 3DZQA 1KV2A 4IM2A 3LM0A 3PXQA 3V5JA 3UNKA 3QKMA 1SVEA 4UN0C 4EZ3A 4KKHA 2E9VA 2IZSA 2C3IB 3L9PA 3MS9A 4FTIA 4FVPA 3FMEA 4KSPA 4XRLA 4DC2A 3LOKA 4DEDA 2BRBA 4S31A 4IXPA 5AR2A 2Z7RA 2UW8A 3M11A 4QMWA 4MBIA 5HI2A 5AAFA 2P2IA 4QTCA 3KC3A 3R73A 4GS6A 5A14A 4TYIA 3POZA 5ANDA 3QQGA 3QTRA 4AT4A 2QOQA 3TDWA 5E8TA 5T6KA 3CPCA 4BWPA 3PUPA 1JKLA 2VTLA 3R04A 4XP2A 3QGWA 4JDJA 2YM8A 4D9UA 1OMWA 5IMXA 2OKRA 2Q0BA 2QLQA 3NNXA 2QOKA 3MJ2A 3W2OA 3RHKA 3E62A 4FUXA 5I9ZA 3HP5A 2GHLA 4PPBA 2XYNA 2ITZA 3WF5A 5J5SA 4CQEA 5HORA 4Q5HA 4RZWA 3SV0A 2C0OA 2VWUA 4UZDA 4LMNA 1WBNA 4LUDA 5L6WL 3T9TA 2WU7A 3QA8A 4TXCA 2EU9A 3FHRA 2BILB 4IZ7A 2F49A 3FSKA 4TWNA 4W4WA 5HQ0A 1PXPA 5HOAA 1YWNA 2GFSA 4Q5EA 5HESA 4BDEA 4DFZE 3PVBA 5HE3A 3HMPA 4KS7A 4WNKA 4F6SA 4CMUA 3ZEPA 3KFAA 3GOPA 2E9UA 1MRYA 4NCTA 4Q9ZA 2BAQA 3FL4A 2BIYA 4XEYA 2VO3A 3SC1A 4CKRA 3GQIA 4I5MA 2ETMA 2WEVA 2R0UA 3RP9A 3CSVA 5T68A 1YI6A 3OCGA 4Y95A 1PKDA 2PVYA 4XV9A 2YCRA 4JX3A 3VHEA 3FUPA 4FZFB 4FTNA 5B2KA 4L3LA 4YPDA 5J7BA 1ZYSA 3A7HA 4RPVA 4ITHA 4GG7A 4G3DA 4IH8A 4L43A 3QCSA 4WO5A 1STCE 2XM9A 4OBPA 3TJCA 4FKIA 3E8EA 3TKIA 4X7QA 4C59A 3KXZA 2XNMA 2YWVA 4JAJA 4IZYA 5H2UA 3W2RA 2A1AB 4YTIA 3RVGA 3SOAA 2WTWA 3F82A 3R7UA 5CASA 3BBTB 4WG5A 2JGZA 1OI9A 3PY1A 4HGEA 2QD9A 3WZJA 1HOWA 4EYJA 2BHEA 5TF9A 3V8SA 3ZBXA 5A54A 2Y4IC 3TACA 3VS3A 3F88A 2BRMA 4RIYB 3KK9A 4KNBA 3DKOA 3HRCA 3NYOA 4NM7A 5AM6A 4KB8A 1UNHA 2WQMA 4OTFA 5AMNA 3D15A 4USFA 2OFUA 3ACJA 3K5VA 1W0XC 1BKXA 3HNGA 4LUEA 4NKSA 4UYNA 1T46A 3TUBA 3BYVA 5KHWA 3I0QA 3S4QA 4R1VA 4RC2A 1BUHA 5HLWA 2WMWA 1XQZA 4FL1A 4CV9A 1DAWA 3UIMA 2PZIA 3KY2A 4D58A 4EOJA 2YIRA 1PXOA 5TE0A 5KBQA 2QNJA 4F1MA 4UALA 3HUCA 3PP0A 3QU0A 3WYYA 4A4XA 1L3RE 3RZFA 4BCNA 4NW5A 3LQ3A 4RVMA 2VTTA 3FBVA 5KMNA 2PULA 3LW0A 4C36A 3OXIA 3IECA 2XVDA 4M69B 1VZOA 3AC5A 4UBAA 3R8ZA 2PL0A 1OKWA 3QTXA 2WQOA 4FNZA 1LEWA 3ZUTA 4BFMA 4BYIA 4J1RA 2FB8A 1F5QA 5A3XA 5L4QA 1J91A 4O0XA 3Q96A 1K3AA 4U44A 5KMJA 3HDNA 2X4FA 3KRWA 4FSUA 2GMXA 5CT7A 4FKGA 1I09A 4HVHA 4IAAA 5IUHA 4A9TA 4MBLA 1R39A 4FIIA 4FKTA 5BUEA 2FUMA 3VJNA 4PMTA 2EXMA 4FTUA 4HCVA 5DR6A 4FTRA 5EKOA 2Y0AA 1XHAA 3V6RA 4C0TA 3AC8A 1ZXEA 3BELA 3IW4A 2B9HA 4BTKA 2CJMA 3E7OA 2CGUA 2YDJA 4JG7A 4XBRA 4YZCA 1KE9A 5IUIA 4DFLA 5IQBA 4RJ3A 4ZY4A 1RQQA 5FEDA 3E92A 1TVOA 4BI0A 1REKA 4QPMA 2CPKE 3UODA 2PPQA 3OCBA 4GFMA 4FBXA 4NZWB 4AZWA 5JFSA 3W33A 1VR2A 4D2SA 4EK4A 1A48A 2W7XA 5DG5A 3PPKA 1YI3A 3RWQA 2J0JA 3TV4A 2JKOA 3HRFA 4AXAA 2XJ0A 4S2ZA 3ZU7A 3G5DA 3LXKA 3U9CA 3Q6WA 1IA9A 4AA0A 1H4LA 1XH6A 4TYHA 4ZOGA 3RM6A 1OB3A 3PWYA 3Q5IA 3JPVA 4YC8A 3KK8A 4G5PA 4GK2A 3TI1A 2AUHA 2YCFA 3UQFA 4U97A 3TNQB 3ZXTA 1JKSA 2WNTA 4YC6A 4V05A 3P7CA 4WKQA 4IACA 3HKOA 3MH0A 2HENA 4KA3A 5HU9A 4P2KA 4AN9A 1LP4A 1H28A 3QAME 4ONAA 4FSZA 4HVIA 3LFCA 4CD0A 1MP8A 3CXWA 3E3BX 4OUCA 3FL5A 4C2WA 3BQRA 5I5ZA 4XG8A 2YM6A 1KE7A 5J87A 4YLLA 5FWKK 3HP2A 3MY1A 1PYEA 3BLQA 3CD3A 2RFNA 2QG7A 5I9UA 2J2IB 4V0GB 4TWOA 4BTMA 3AG9A 3DKFA 3EN4A 4G3GA 5FEQA 4O21A 3K5UA 4X2GA 4JR7A 3VBYA 4FIHA 3KRXA 3LCKA 4S33A 4C4GA 4EOKA 2ZVAA 3EQFA 4XNEA 4D2TA 3DAKA 2RGPA 1QPDA 2ITTA 3KGAA 2W1FA 4R3RA 2NNWB 4HCTA 4XLIA 3FZRA 5A46A 2A0CX 3QRKA 4IANA 4RX9A 4ANNA 3C4ZA 1NVRA 5DIAA 5KMLA 1QPEA 4O0TA 3UPZA 3FSFA 3MPMA 3QTIA 4F9WA 4BCJA 2OWBA 5IA4A 2QOCA 3ODZX 4MXOA 5E92A 2JDTA 3AMAA 2V7OA 1PXMA 2BFYA 4K2RA 2W4JA 4NM3A 3ZS5A 5A9UA 4DAWA 4FT7A 4G3CA 2CHLA 3TUDA 4IFCA 2PZRA 5JGBA 3AT2A 1OL2A 4FEWA 3NLBA 5AP6A 2UW0A 4AOTA 3PJ1A 4ERWA 2R7BA 3ET7A 5FTGA 1V0BA 5LCKA 1NA7A 3QLFA 5B7VA 5M08A 5DH3A 4FSQA 4QYHA 4JR3A 4R5YA 4WSQA 2XIKA 4LG4A 4Y73A 4EH5A 2J51A 4MX9A 5CVHA 3GGFA 1ZAOA 2YHVA 3R83A 3PXKA 4JBQA 4ZS4A 3KQ7A 3RCDA 1XH8A 4ZSEA 3F3VA 2BDFA 4FUYA 2C6KA 3F2AA 2C5YA 2RG5A 5CU0A 2VTPA 1OBGA 1OITA 4WBBB 3S95A 3P08A 3LFBA 4AZSA 4QOXA 5E9EA 2VWZA 4RJ5A 3EQIA 3SXSA 1JQHA 4CFUA 4QMQA 4FTMA 4YZ9A 4LV5A 4TL0A 2PVMA 2WIPA 3R02A 3ZLWA 2ZV7A 2YAAA 2BAJA 3DB8A 5FM3A 2X2LA 3LFEA 4UXQA 3R7EA 5EYKA 3TV6A 5HD4A 2V0DA 5FM2A 5AV0A 4BZOA 4UB7A 3D0EA 4FV0A 5CU4A 4I41A 3SHEA 3AD4A 5M09A 3ZEWA 4YP8A 1ZYDA 2QI8A 4PP7A 4EOQA 5DT0A 3F6XA 3BEGA 4C61A 3HECA 5BVWA 1Q24A 2IZUA 3KCKA 3U51A 4C8BA 4MF1A 4C4JA 5J8IA 2WMBA 2JC6A 2VTRA 3HYHA 4DFXE 4EZ7A 3IDCA 4N6YA 4ZTRA 4IX3A 4PTEA 4Y46A 3SD0A 4ARKA 4FA2A 3H9RA 4BZDA 5IPJA 5LMKA 3CKWA 2PVFA 4KBKA 4PMMA 3FZ1A 1W84A 3A4OX 3D4QA 4RVTA 3ZSHA 2C3JA 3ZH8A 3MIYA 1Z5MA 5FTQA 1I44A 5GZAA 4YZMA 2V62A 3QX4A 4GCJA 3UC4A 3MB6A 4J8NA 5KBRA 3W2QA 4BICA 3R01A 3LJ2A 5J9ZA 3AOXA 4NEUA 4FG8A 3KB7A 3O71A 1VJYA 3QXOA 3QC9A 3MPTA 5ANOA 4CCUA 4QP9A 4RLLA 4IAZA 3BCEA 1Q8UA 2VTSA 3TKHA 3GCPA 5B0XA 3HA6A 4MF0A 3UP7A 2OF2A 5E1EA 3GBZA 2FO0A 4YNEA 3DBCA 3TKUA 2B9JA 3BI6A 4FKSA 3M1SA 1VYWA 2Z02A 2GU8A 2IW6A 3ORPA 5E91A 3V3VA 4I4EA 4JBVA 4ERKA 1O6LA 3EQDA 4O0YA 3RI1A 3SG8A 3M2WA 3A60A 5HLPA 3FMMA 4LMUA 4UXLA 2XNPA 2YA9A 4O0VA 2OW3A 3IGOA 3PIZA 2W06A 4MWIA 3DT1A 4DG3E 5IQDA 2IN6A 4QP8A 2NRYA 3ZTXA 4F65A 2XNNA 4XV1A 3SX9A 2VV9A 2XJ2A 3GCSA 5LWNA 1U54B 3BYMA 3DKCA 2PUUA 2X8EA 4Y72A 4O22A 4QYGA 2KTYA 4PDSA 4OGRA 3ZLXA 4EH8A 2H34A 2R9SA 5CSVA 5JZJA 4QQJA 1OPLA 5GJGA 5M4IA 3COHA 3QHWA 2XCKA 1UA2A 5CEQA 2JFLA 5EOLA 4MNEA 4CTCA 5JT2A 3EIDA 2BZKB 2YJSA 1SM2A 2QOOA 3EKNA 3GI3A 4YGAA 2ZDTA 5HG5A 3EQCA 3R8PA 4NYEA 2QODA 3RPYA 4AT3A 3NUXA 5FEEA 5KZ0A 3U4UA 3HRBA 1M2RA 3F5GA 4AE6A 3FZTA 2ZM1A 4FSYA 2XK9A 4KIKA 4FTJA 4HJOA 2UVXA 2X6DA 3GP0A 3QC4A 4MKCA 3RBWA 4E5WA 4FKWA 3IONA 1J7IA 5A4LA 1GZOA 3N4UA 3R22A 1FGIA 4FK3A 3DY7A 3E8NA 1Z9XA 2WEIA 3GFWA 2GFCA 3OW3A 3PA4A 4R7IA 4YJUA 5AUTA 3HMIA 2OK1A 2ZOQA 1ZWSA 2VRXA 3PA3A 4K8AA 4EZ5A 3Q4UA 3DNDA 3NRMA 3PP1A 5HEZA 4WNPA 5I0BA 2VN9A 4NFMA 4YZDA 4XYFA 3BWFA 4BIDA 3CLYA 4KIOA 3F9NA 4YR8A 3EFLA 3PE2A 5IUGA 3PVGA 3ZXZA 4RQVA 4IB0A 3OVVA 5IQGA 5EQYA 3VUTA 3G51A 3B8RA 4ACCA 1YDRE 5DI1A 5FBNC 4EBWA 5K9IA 4ZP5A 3F3WA 2OGVA 4LGHA 4BDCA 4YUQA 4R5SA 4X6QC 5KHXA 4FV1A 3KULA 4YJTA 3UIBA 1DAYA 1ATPE 3KU2A 4KRCA 4IEBA 3R9RA 3OW4A 2BZIB 2PMIA 4CXAA 3AC2A 2JDVA 2R64A 2XK8A 4EWHA 5EDRA 4O0RA 5AADA 1JPAA 1SMHA 4YJOA 2FH9A 3QKLA 3GOKA 3PVUA 4FV2A 4I93A 4AUAA 3U55A 3ZUVA 3EFJA 4UMQA 3V5TA 3NIZA 3PXFA 3NWWA 2ONLC 3ATSA 2X2MA 3RALA 1BYGA 4AX8A 1WAKA 3DQXA 4H3PA 4FMQA 4FI1A 3Q5ZA 5AP4A 4RWIA 5M56A 3OTUA 2ITOA 2OJGA 3E87A 3PZEA 3VJOA 3EZRA 1BLXA 1WVXA 3II5A 2XBAA 4GT4A 3LCSA 4TNBA 2GNIA 1XH9A 5CNNA 3TNIA 4FX3A 2GNGA 3KA0A 3R00A 3DK6A 5BVFA 1OUKA 3DXNA 3R1YA 2JDSA 4S32A 3FZOA 2OBJA 2QOFA 4CZYB 3BBWA 3R1SA 1IRKA 2W05A 3PTGA 5DGZA 2W4KA 3E3PA 4N0SA 4DGOA 5FUTA 4HNIA 3OWLA 4FV9A 4F1OA 4GW8A 4QMYA 4B0GA 4TN6A 3P78A 3DK7A 4DGLC 3BHYA 4TYEA 3Q4ZA 4F7SA 1ZMUA 3P5KA 4E73A 3TNWA 5M44A 3GC7A 1UWHA 3MIAA 4N70A 3VS6A 4ENXA 2ITUA 5M07A 1UNGA 2WMRA 1QPCA 4TNDA 2Y6OA 3QFVA 4FKQA 4E6CA 4CFNA 1OL1A 3E64A 3D7TA 4MBJA 1ZARA 3UO6A 5KCVA 2UW6A 3U6IA 3BX5A 2XKEA 4AOIA 4BCFA 3SRVA 3C0IA 5M4CA 1Y6BA 4IADA 2HZIA 4WT6A 2PE2A 3OOGA 4PL4A 4W8EA 5HCXA 1GAGA 5LVLA 4XV3A 4AE9A 2C6IA 2XKCA 4ANQA 4CG8A 2WTKC 3PIXA 3QCYA 2EXEA 2CGXA 2R3RA 4M84A 4QPSA 5GZ9A 4ZK5A 3VUDA 5ICPA 4QNYA 4ORKA 1Z57A 4JBPA 4ASEA 5EOBA 4DH5A 3ZZEA 2HZNA 3ORTA 4ZTLA 2I40A 3NUSA 2OIBA 2R3LA 5DR2A 5L2TA 4TTHB 3KXXA 3I6WA 4JG6A 3VUHA 1U5RA 2GNLA 4BDFA 4DINA 2CKPA 4GIHA 4Y5HA 1BX6A 3R9OA 4ZMEA 2X4ZA 2V22A 1BMKA 4XG9A 4CSVA 3F5UA 1YDTE 2O8YA 3GU8A 3OFMA 5IA0A 3Q32A 3BHUA 4EH9A 3FQEA 1UV5A 4NU1A 2RG6A 3QTWA 1HCLA 4YJNA 4D2WA 5IQAA 2BZHB 5GNKA 4C4IA 4K9YA 4L00A 3Q4TA 2Y8OA 4L8MA 5CX9A 4B9DA 2O64A 1EH4A 4USDA 5FLFA 1Q4LA 3MW1A 3TG1A 3D5XA 2O2UA 3OC1A 4UWBA 5BMSA 1F0QA 2R3KA 2IZRA 2H96A 4QQ5A 5M4UA 3HL7A 4NL0A 3ZO3A 4ACHA 2W1IA 4D28A 4H36A 4H05A 3LMGA 4AT5A 5AUUA 2CLQA 3P23A 4HGTA 5L8JA 4Z7HA 2Z60A 3FLYA 4J7BA 4FKRA 3FY2A 4IWPA 2W5HA 4O84A 3NUPA 1BL7A 3CS9A 4WD5A 3V6SA 5AR4A 3ORIA 3L8VA 2LAVA 2WTCA 3KRRA 4EK6A 3AGMA 3MY0A 3GNIB 4YNOA 3R9DA 3VUIA 3KXNA 4EONA 2QCSA 5HBHA 2XK6A 3DFCB 3MDYA 3LFSA 3ORXA 3LCDA 4FEQA 3PY3A 4DCAA 2Q83A 4G3FA 4JDHA 2QONA 3MFTA 2VWWA 2YLFA 4TYHB 3ZDIA 4BR3A 3FJQE 2RKUA 2WTKB 2ZV2A 2J0MB 3KCFA 3JUHA 4NIFA 4RWLA 4XHKB 2PE1A 5IDNA 3O7LD 3U6HA 4QNAA 4ZTHA 2HWPA 4NK9A 5AX3A 3B2WA 4K6ZA 5AV1A 1WVYA 5LWMA 3ROCA 4F7NA 4LRMA 4DCEA 2HZ4A 5CT0A 3W8QA 4QT1A 4B6LA 3C1XA 3OZ6A 4QMSA 2J5EA 2QKWB 3EHAA 3RMFA 4UZHA 1XR1A 1YHWA 2QKRA 3LAUA 2GSFA 1H8FA 2ZB1A 4F64A 4IFGA 5CF4A 1AQ1A 4O91A 4GK4A 3IQ7A 1HCKA 3EH9A 3JVSA 3D9VA 4IAIA 4MNFA 3JVRA 3E7VA 3GVUA 4X2FA 4BRXA 4LOOA 3O23A 5CAVA 4AQCA 4OAVB 3G90X 4IVBA 2W5BA 5AUVA 3AD5A 1KE5A 5DT4A 4L53A 4KIPA 4QRCA 3PPZA 1Q8TA 4HYUA 4QMTA 4BKZA 2B7AA 5E8UA 3MH2A 4B8LA 3AC4A 2UZUE 3VO3A 4U3ZA 2XKDA 3QZGA 3QQHA 1CDKA 4JNWA 4D0XA 4MHAA 4IX6A 1GIIA 2YDKA 4L7FA 4DE4A 3PA5A 4BIEA 4LYNA 4BDKA 2CNQA 4DH3A 4C3PA 5HTCA 2FSOX 4KSQA 5L2IA 5LVMA 3OEFX 3V04A 1RDQE 3ORKA 1ZOGA 5E8WA 3UBDA 2HCKA 3HMMA 3ZLSA 4CZTA 2X9FA 1IG1A 4L46A 3NIEA 4P90A 3SW4A 4ZLZA 5CQUA 4FT0A 4FV7A 3NW5A 2XUUA 2ITNA 2O65A 3BV2A 1DI8A 3MFSA 1MUOA 3W2CA 2OI4X 3F3ZA 5HTIA 2UVZA 4P7EA 2QO7A 3FI3A 4FT9A 3PYYA 4HPUE 1GOLA 4WA9A 4XX9A 4BDDA 1NW1A 2UZTA 3A7FA 3PPJA 4JDIA 4OTGA 4U80A 4PWNA 5H3QA 3GT8A 5JGDA 3VS4A 4D2RA 2VX0A 1LUFA 2OZOA 4IAKA 3OBGA 3FQHA 2JAVA 2ZV8A 4P5ZA 4ZY5A 3O2MA 4IJ9A 2JDOA 5IQCA 3G2FA 3W18A 3TXOA 3HLLA 2XNGA 1W7HA 1JAMA 1Q61A 4C7TA 2ITPA 3BYOA 3UZTA 2VD5A 3UYTA 5DNRA 1M14A 2UW9A 3DAJA 5EDQA 4MD8E 5HO8A 3QKKA 3TEIA 4DFUA 1OL5A 2X8IA 3FMLA 4O7LA 4OBOA 5K0KA 5E8SA 3BHTA 4Q9SA 3PSCA 2G1TA 3MYGA 1S9IA 3C4EA 3R71A 4AFJA 1Q99A 1Y91A 3TNPC 4AGUA 4U5JA 4LI5A 3DTCA 3ALNA 4I3ZA 3LLTA 4TWCA 5FXSA 4DEIA 3ZDUA 3Q2MA 3LHJA 2IW8A 4BCGA 3F2NA 3BU3A 3VAPA 2EXCX 5JK3A 2CNVA 3DKGA 5D41A 2JD5A 5CS6A 4NFNA 2YEXA 4O6LA 4IQ6A 4RVKA 4YSMA 2ERKA 3WBLA 4U40A 4ALUA 4E8AA 4EH7A 3UG2A 1W82A 1FMKA 3R9HA 2G15A 4C57A 2I6LA 2RFSA 5DLSA 2HZ0A 4U3YA 5AX9A 5CF5A 5C26A 2HW6A 3KXGA 3RNIA 4ZLOA 4APPA 3UE4A 3VF8A 1WBTA 3NW6A 2EB2A 1ZZLA 2BTSA 3NNVA 1R78A 2JBOA 4ZJIA 3F2RA 4EOSA 4F4PA 1W8CA 2QOIA 2X7FA 2UZVA 3BGZA 1GNGA 3KF7A 3H9FA 4FOCA 4JT3A 3ELJA 3R21A 2X8DA 3GUBA 4U9AA 3VUGA 3Q9XA 4Y85A 5AR7A 3L9MA 4ACDA 3R2BA 4XJ0A 1VYZA 1YVJA 3EOCA 3QLGA 4FOBA 2P2HA 5K5NA 3R7VA 3TZMA 3OY1A 5ACKA 4HVDA 3QALE 4FNWA 4XG4A 2G2HA 3QYZA 4PY1A 3O50A 5JFXA 4EQUA 4Y8DA 5IG1A 4NTTA 5M06A 3FHIA 4ZXTA 4BYJA 2Y7JA 5CU2A 5FRIA 2C5NA 4C35A 3CIKA 1OBDA 2QOLA 3WZEA 1PXNA 3GQLA 4WG4A 5ANKA 3T9IA 3GC0A 4FGRA 2HOGA 3EQGA 4G31A 1WFCA 4NSTA 2QC6A 4E5AX 3F7ZA 4QP3A 5DOSA 5AP3A 4JAIA 2ITXA 2B54A 1V1KA 4ANMA 2R3QA 4YJSA 5K0XA 4M0YA 3SGCA 3F3TA 4TYJA 4EOIA 1FINA 3BQCA 1JSVA 2C6TA 4DHFA 3IOKA 5CEKA 2A27A 3DJ5A 5EW9A 4QP7A 4WUNA 5LARA 4EC9A 2JIIA 3EWHA 2OJIA 5TOZA 3DJ6A 2C1AA 2OU7A 5AEPA 4R8QA 1YOLA 2QR8A 2UW4A 2VO6A 4NM0A 3R8UA 3UYSA 1E9HA 1YRPA 2C30A 2UZBA 3EQHA 2SRCA 3LPBA 4JIKA 2CNUA 1E1XA 5LVNA 4BTJA 2E9OA 1OECA 4MNEB 4I0SA 3A99A 3U87A 3AC3A 4YZNA 4YTCA 5KKRB 1DI9A 4JLCA 3CD8A 4RFMA 2WB8A 4I21A 1SYKA 4B4LA 2BPMA 1ZMVA 5I9XA 4JXFA 4KIKB 2W1DA 2XK7A 2J0KA 1ZOHA 3EZVA 1KV1A 4FR4A 3CQUA 4JVGA 4A07A 4DFNA 3RCJA 4QQCA 2FYSA 1PW2A 4FV5A 4L52A 3IS5A 4RJ6A 3ZO1A 2BCJA 2V7AA 4FG9A 1KWPA 3VS2A 2O5KA 4HYHA 2B1PA 2PK9A 4KINA 2GTNA 3SAYA 2Y4PA 4MEDA 4EOMA 5CXZA 3UO5A 3V01A 3RK5A 1YOMA 1JBPE 4AF3A 4IM3A 5EHLA 2PYWA 3F61A 3VUMA 5FXRA 5LQFA 3JYAA 5AV3A 1SZMA 3UMWA 3PSBA 4IB3A 4WNOA 3RPSA 2V5QA 5E1SA 4YURA 3L8PA 5BVNA 4BIBA 3HV7A 4XG7A 4ALWA 3OCTA 5KMMA 3IW6A 3SG9A 2G01A 4X3JA 4E4XA 3EMGA 3O8TA 4EHVA 4F9CA 4HVSA 3CTJA 4G17A 5CWZA 5E8YA 3KULB 3WI6A 4AW0A 4J8MA 5BVDA 4E26A 2WMVA 3FV8A 2CCHA 1L8TA 3FLWA 4PF4A 3C50A 1YHSA 4K33A 3PXZA 3DGKA 3HMNA 4GG5A 2UZWE 2RL5A 3QZIA 5HBEA 3UTOA 4QQTA 3FMNA 2G9XA 3ZONA 3MY5A 4H3QA 1XBCA 4F0GA 4O0WA 5HO6A 2CSNA 3H0YA 5K5XA 3CJGA 3EQPA 1J7LA 4L3PA 3WIKA 5C4KA 3TL8A 2WMQA 4A7CA 1F3MC 1PMNA 3C5IA 4R77A 2W0JA 1OL7A 3H9OA 4RC3A 5HD7A 4ANBA 5BX0A 5JN2A 1PYXA 3NGAA 3LMHA 2YITA 5AA8A 3K54A 5AUXA 4D4YA 2HIWA 4CFVA 4WRGA 5G1XA 5GHVA 4BKJA 1V0OA 2YIQA 2C5VA 3QD4A 1KE8A 5IH6A 4FZAB 3RAKA 3QRJA 3ZSGA 2F7EE 3PFQA 1CM8A 4J96A 2E9PA 1WCCA 2VWVA 1Y8YA 2ITQA 3E8DA 3F5XA 3KEXA 4Z16A 5LCJA 4X0MA 2BIKB 4GYIA 1PF8A 3ZHPC 2OJ9A 3PIYA 4O0UA 2F2CB 3BV3A 2JFMA 3ENHA 1Q3WA 3ZYAA 2R3PA 1CTPE 3AGLA 4IMYA 3FEGA 4CT1A 4K18A 4H39A 3FWQA 2I0VA 4EK3A 1REJA 3V5LA 2AC3A 4DEAA 3RK9A 3QWJA 2UZEA 4OW8A 3O8PA 4R1YA 3SXRA 3D7TB 3JR1A 2J9MA 4GH2A 2AC5A 2PY3A 5M51A 3DTWA 4PRJA 2XYUA 3JXWA 3SRVB 5TR6A 4F08A 3QTUA 5HE0A 5HVYA 5BYLA 4ZZMA 5CU3A 1GY3A 3R7GA 5EI8A 3AT3A 1ZY4A 5C9CA 3MFRA 4FV4A 2FGIA 4IX4A 3EN9A 3WZUA 3A4PA 3KN5A 2BRNA 4ZEGA 3DDQA 1B39A 4FV6A 3IGGA 4U81A 4CLIA 3DV3A 3LZBA 3M42A 4XUFA 4EJNA 1ZYJA 2PWLA 2X9EA 4HGLA 4MXCA 3TDVA 2OXXA 2XEYA 5L2SA 3R8LA 4E6QA 5CEMA 4DH7A 3O96A 3WYXA 5C8KA 4BI2A 2OXDA 3CC6A 1H1QA 3LVPA 4Z9LA 3N51A 5EFQA 4BDHA 1OIQA 1OKVA 4PX6A 4DG0E 2PMNX 3UVPA 1AD5A 5F9EA 5JFWA 3ALOA 2BTRA 2OICA 2PMLX 5EYCA 1R0EA 4TRLA 5J9YA 5KMOA 3NAXA 4L44A 2OIQA 4N4SA 3R63A 3ZZWA 2UZNA 3DLZA 4XG6A 2WELA 3V5WA 4ZS0A 4DEEA 4GEOA 4AZVA 3R30A 4YMJA 4PNIA 4CYJA 3KRLA 4L6QA 5EI2A 4A9RA 3FPQA 4DBXA 3H0ZA 2A2AA 2R3MA 4X3FA 5D11A 3I4BA 3ZLYA 4E6DA 1KOBA 2BDWA 4DH8A 4IDTA 1CSNA 4M8TA 4RZVA 3F66A 3PXYA 2B53A 4LRKA 1J1BA 3EL7A 2J0LA 2C47A 5EDPA 3PSDA 5TO8A 5F94A 3RPVA 1XH7A 4MD9E 2IVTA 3QRTA 5CVGA 4ID7A 3CPBA 1PXKA 1KOAA 4AGDA 2VZ6A 1WZYA 3UC3A 4M97A 2R2PA 1NXKA 3BU5A 5IISA 3V51A 2ZAZA 5AFVA 4OTHA 5I4NA 4I0RA 5EHYA 4B7TA 1E1VA 3PE1A 3OWPA 2O0UA 3KMWA 3CCNA 2ZV9A 4ZZNA 4M0ZA 4NKAA 1OZ1A 3SLSA 5CXHA 5HKMA 5B2MA 5M4FA 2XNBA 1P14A 3C7QA 4C38A 3HAMA 4BVUA 3RJCA 3QQFA 3AD6A 3TIZA 2WMUA 4F9YA 4K1BA 4CYIA 2ITVA 4X21A 3FC1X 4NIFB 3ZOSA 1BI8A 2ESMA 3SOCA 4FKUA 4EBVA 3S0OA 5CQWA 5JKGA 3IPHA 1JSTA 2BVAA 4I5HA 3BHHA 5HCZA 1YXVA 3DQWA 1H00A 1GZ8A 2GNJA 3WE4A 4U42A 3LXPA 5ANJA 5CAOA 1H07A 5CLPA 4XP3A 3BGQA 3WF9A 4GU6A 3P7BA 3T3UA 3UZPA 2YCSA 3MGYA 3GCVA 4U0IA 5K4JA 4D5HA 4ZLYA 1XO2B 3I6UA 4XMOA 5ANIA 5H8EA 2DWBA 3C4CA 4M12A 3SVVA 1J7UA 5M57A 4FEVA 4QMUA 3ZFXA 4RFZA 3O51A 3FC2A 4BL1A 3LKMA 4CRSA 2F4JA 3EQBA 3SQQA 2B9IA 4EYMA 2J4ZA 3ORMA 3NEWA 4PPAA 3KMUA 4J98A 1FQ1B 4YC3A 2FSMX 4GKIA 5KZIA 5DR9A 2QLUA 2ZM4A 1VEBA 5ACBC 4I6FA 4A06A 2QQ7A 4NCTC 4IBMA 5E90A 2X81A 4PQNA 3RINA 4LGDA 5C03A 2PUIA 4HOKA 2OO8X 1PXLA 3NYXA 4GSBA 5J5TA 4IVDA 1H26A 1UKHA 3FXZA 4IC7A 2RFEA 4HCUA 5DE2A 1H25A 2VUWA 2YCQA 2YM5A 3OMVA 4BCIA 4EKKA 3KRJA 4QD6A 4KRDA 5AV2A 4XG2A 4G16A 3FKOA 4FKPA 3DA6A 4RLKA 5H8GA 3R7OA 5IA3A 5HG8A 1UU9A 3UZRA 2R0IA 3ZCLA 5EM8A 4C37A 4FT5A 4D4RA 4RIWA 2X39A 3UMXA 4GU9A 4X2KA 3CY3A 4NM5A 3EFKA 4CEGA 1OKYA 3DDPA 5BPYA 1K9AA 2PVNA 2UUEA 4CV8A 1BL6A 2PZYA 4PL3A 5A4QA 5AP5A 3UDBA 3BLHA 4L45A 3MBLA 2WQEA 3QTZA 3FE3A 2O63A 3SDJA 3BIZA 2VWYA 4PDOA 4YLKA 1JLUE 1IA8A 3OT8A 2VO0A 1MQ4A 4LRJA 4MCVA 4TT7A 1YW2A 4O7YA 4A4LA 5IH4A 5HHWA 4RIXA 2UV2A 2X7OA 3GFEA 3VS7A 3N4VA 4RJ4A 4MAOA 5LMAA 2BALA 5B2LA 4IW0A 2RF9A 3LCTA 4IZ5A 5KMKA 1RE8A 4FSRA 2WIHA 4YHFA 1APME 1KUTA 5J7HA 3I7CA 4BB4A 3FXXA 4BZNA 3LIJA 4XS2A 4AZTA 2P4IA 4O6EA 3RWPA 1G8SA 3OXTA 3QZHA 4ITJA 2QG5A 5IA5A 1GZNA 2XB7A 5HG9A 4ZTNA 4YJRA 5CF8A 4WIHA 1SVHA 5I9YA 1CKJA 4YJPA 3I7BA 4HZSA 3V5PA 5EYMA 4FTKA 1AGWA 4DGNA 5CEOA 3MJ1A 3EB0A 2G2IA 3HV6A 4JX7A 1LR4A 4BY9E 1YQJA 3UO4A 2I1MA 2ZMCA 4LV8A 3L8SA 4QO9A 2XIYA 4FZ6A 4HVGA 2J7TA 4M7IA 3QYWA 4JI9A 4OLIA 3ZRKA 5HCYA 3KF4A 3GCUA 4FSWA 4FTAA 5DFPA 4U7ZA 2XCHA 2F7ZE 5J9LA 5EM7A 4AS0A 3ZFMA 3C51A 1M17A 5L2QA 4CT2A 3GC9A 3WZKA 3TM0A 3CGFA 1UU7A 4D0WA 5HVKA 3QX2A 3EN7A 2PVLA 2QOBA 1ZY5A 2VTJA 5ETFA 5GJDA 3LFFA 3E93A 2IJMA 3TZ7A 1H27A 3A7GA 2IWIA 1PXJA 3W8LA 4KAOA 4DN5A 2P55A 2YJRA 3F69A 3QD0A 3C4XA 3TJDA 5LMBA 4E4MA 4QMZA 2W96B 3A7JA 3QD3A 4HW7A 4H58A 3TIYA 2PVKA 2VWXA 4FEUA 3P4KA 2F7XE 4I23A 2UVYA 3QQUA 4MXYA 5IQIA 1OIUA 2IVSA 4BHZA 4JQ8A 4O96A 3W16A 5AUZA 3HA8A 3V8TA 3NPCA 4X2NA 4ALVA 4EL9A 1OUYA 3S3IA 5HVJA 4CNHA 5JGAA 5DT3A 3O8UA 4V04A 4CTBA 3PJ3A 3TTIA 4BCKA 1P2AA 4FG7A 4HGSA 4O7RA 4KABA 4ASXA 1XWSA 3TZ9A 4FKVA 2WTIA 4I6QA 4I94A 5IKWA 1G8AA 3NNWA 4E1ZA 3LLAA 5CY3A 2VAGA 5HX8A 4QYYA 3NR9A 1JKKA 3CY2A 1OIYA
chains in the Genus database with same CATH superfamily
2UZDA 4I4FA 5CAPA 2OH4A 4RC4A 5EYDA 3SKCA 3W0MA 2PVHA 3H10A 4ZIMA 5I3RA 5AAEA 4CZUA 3VF9A 1GZKA 1O6YA 3OOMA 4RWJA 3U54A 4UYAA 5AR8A 4D5KA 1ST0A 3VIDA 2X0QA 5J95A 5EW3A 4AAYA 1WVWA 4DBNA 4W9XA 3CKXA 4WRSA 3NCGA 3ANRA 4W8DA 1TQMA 1V0PA 2GS6A 2BKZA 2XA4A 2YAKA 3FYJX 4JL9A 4UMPA 1ZZ2A 4YBJA 3KIOC 4M13A 2QU5A 3CE3A 2VTIA 2VWBA 3PRIA 3PVWA 1UVRA 3I5NA 3RAWA 4YO4A 3OG7A 3WF6A 3CTHA 4O7NA 5D10A 2JIUA 4JQEA 5CNOA 3ZRMA 3B8QA 2BRGA 1MRUA 1KE6A 3FZSA 4RG0A 5F1ZA 4FVRA 4PNKA 2BMCA 2CCIA 2R3JA 3U4WA 2PUNA 5HE1A 2XIXA 3OP5A 3OTVA 3CJFA 1WBWA 4FIJA 4LFIA 4XV2A 3UGCA 2X2KA 4BWKA 4BCPA 3EQRA 5DMZA 5HZNA 5KNJA 4QMVA 3GU5A 3O7LB 4O83A 4Z3VA 4RX8A 4BDIA 4CVAA 4TYGA 4OTRA 2DYLA 4PTGA 4PMSA 4QMOA 5DVRA 3D2KA 5AAGA 1A06A 2EVAA 2QO9A 5JQ8A 3W2PA 4GJ2A 2QHMA 5EW8A 4L01A 3D83A 4M14A 3DBDA 3LMIA 4F63A 5JSMA 2W17A 3HAVA 4EWQA 3ULZA 3D7ZA 2FA2A 3I0OA 3NYNA 3FYKX 3BYSA 3LQ5A 4DH1A 5EM6A 1Q41A 2XZSA 3R1QA 4O7TA 3AXWA 2C1BA 4AW5A 3TZ8A 1OPKA 4IAYA 1B38A 5FP5A 3OWKA 2XNEA 4QTDA 3COKA 2VTMA 1SNUA 5CYIA 5L8LA 4ZJVA 2H6DA 2WXVA 2NPQA 4JBOA 4P4CA 3EFWA 5JEBA 2IPXA 5A6NA 4GK3A 3IKAA 3PLSA 4DGGA 2WFYA 1H1RA 4IB1A 1G3NA 1YI4A 2P0CA 4ANOA 2ZB0A 3GEQA 4F7LA 3BZ3A 4C34A 3BHVA 1PMVA 3GB2A 2R5TA 4IJPA 2IG7A 5LMKC 1H0VA 2IZTA 4IHPA 3VNTA 4GKHA 3R6XA 2NRUA 1YHVA 4FSNA 4EOOA 3BGPA 4QMMA 4L7SA 2A19B 3ULIA 4I20A 2CKEA 2J5FA 1XBAA 4HYIA 4EC8A 5AV4A 1U59A 5EKNA 4O82A 4EOPA 2VO7A 1MRVA 5CENA 1M52A 1XMMA 2W4OA 3FLSA 1XKKA 3H30A 5ANGA 4IWQA 5HICA 4K77A 5HIBA 3FLNC 4FKJA 5CANA 3S1HA 2WGJA 5LXMA 4ASDA 4MTAA 3T3VA 2HYYA 3A7IA 3F3UA 3QF9A 4YBKA 1YWRA 4FTOA 2V55A 4LM5A 5D7VA 4RSSA 5CTPA 5ETAA 3ZRLA 3N9XA 3TN8A 3GU6A 2HXQA 2IO6A 3WF7A 4U45A 4FSMA 4PL5A 2OLCA 3CEKA 4NT4A 3FLQA 3FLZA 3MH3A 3ORLA 4OT5A 1XH4A 4E93A 2EWAA 5CU6A 5C4LA 5ETCA 5HX6A 3ORZA 3PZHA 4FYNA 2KULA 5EHOA 2FVDA 4DLJA 4E6AA 5IQHA 1IR3A 3R8MA 1CKIA 2CGVA 3VQUA 3D5VA 4NTSA 2GNFA 4LOQA 2CKOA 3IDPA 2I0HA 4P5QA 2W99B 2A4LA 4PP9A 1UWJA 3SXFA 3TTJA 1DS5A 2C68A 3CQWA 5L2WA 3C5UA 4BJJB 1G5SA 2WMTA 4WBOA 1SVGA 4KD1A 2WO6A 2PTKA 3IOPA 2Y6MA 1WBSA 2J6MA 4MVFA 3BL7A 4GRBA 5FD2A 2QOHA 4OTWA 3T8OA 3OF0A 5HNIX 5L6OA 3FMJA 5GJFA 4KWPA 3DFAA 1FOTA 4ZSGA 4FICA 4XH6A 3SA0A 2X0GA 5ITAA 5CEIA 4WNMA 5A4TA 5CI6A 4D1XA 3DBQA 3R28A 5GZ8A 2BAKA 3Q60A 2JBPA 4GIIA 4AOJA 4A9SA 4USEA 5KKRC 5ETIA 1YXXA 1W83A 5D7AA 3KN6A 1S9JA 4K11A 4X3FB 2B0QA 3LCOA 5EQEA 5E7RA 4IC8A 5H8BA 4BTFA 4G9CA 5HU3A 2CDZA 3D2IA 4D4VA 3Q9WA 5DBXA 1OIRA 3WILA 2Z8CA 4DHZA 4II5A 3S2PA 2W5AA 3GU7A 4I6BA 4Q2AA 1UKIA 4KKGA 3RKBA 3ZMMA 4XG3A 2YM7A 4E4NA 2RSVA 2ITYA 4FT3A 4G2FA 4PDPA 4IX5A 3QZFA 2VNWA 1FBNA 3MVJA 2YERA 1PY5A 3Q52A 5AA9A 1SNXA 4QP6A 4ANLA 4EKLA 4F7JA 4RX7A 5D12A 1LEZA 4FZ7A 1NT2A 4F99A 4Z7GA 3MWUA 2FSLX 4WHZA 2PHKA 4B99A 3HV3A 5LJJA 5CZIA 5AR5A 3PJCA 3Q9ZA 3QUPA 2C6MA 1Q3DA 3QGYA 3ZUUA 4FK6A 2W1HA 5G6VA 1H01A 4JG8A 1WBVA 3KKVA 3AQVA 2YIYA 3C0GA 4FYOA 4NW6A 4TPTA 1NVSA 2XH5A 2YLEA 3ID6C 2BDJA 4FIGA 2HY0A 2UZLA 3R2YA 4EUUA 1URWA 2EUFB 3NZ0A 2QR7A 3CR0A 3PJ8A 1XH5A 2E2BA 4TW9A 4XOZA 3VVHA 3EL8A 4KS8A 3UVQA 4AACA 4BGHA 2GQRA 2I7QA 4CFWA 2HWOA 3E88A 5GIPE 2VTAA 2WMXA 1BI7A 3LFDA 2C69A 4UMRA 4O86A 3KXHA 3QA0A 4GFGA 4UWYA 2YZAA 2XS0A 1UU3A 2F9GA 4GUBA 4U41A 4F09A 4ZMFA 3BE2A 5IMEA 4FL2A 2PZPA 3FMKA 4YZBA 4EQMA 1JSUA 1FGKA 1PMUA 3HV5A 4K0YA 5HLNA 5BUIA 2X7GA 3O17A 5FXQA 4E5BA 2LGCA 4ACGA 5AP7A 3R7IA 3NNUA 4FF8A 4AW2A 4I5PA 2VWIA 1TQIA 2PVJA 3BYUA 4QP1A 3K2LA 3NUNA 3ZFYA 3QCXA 2ONLA 4J71A 5EK7A 1XMLA 5K3YA 2B52A 4PPCA 3P79A 2ETKA 4L68A 4BKYA 1JNKA 3LXNA 3OT3A 1YWVA 4YHJA 2PU8A 2BHHA 3CP9A 4G3EA 5ANEA 1PMEA 3IK3A 3C4WA 4QYFA 5EG3A 2JDRA 2CN5A 4J99A 4CFMA 3BLRA 1R3CA 2NP8A 4BHNA 4NH1A 4GVJA 3MB7A 4O2ZA 3U9NA 3PXRA 3BLAA 2WQBA 5I9WA 4GJ3A 3ENMA 3CBLA 5F4NA 2DUVA 4O4EA 3ZO4A 3PWDA 3B2TA 2VTHA 3C4FA 4B8MA 1M2PA 3DLSA 3TMOA 3MVLA 4RIWB 4DFBA 3LE6A 3DS6A 5AR3A 2B55A 2WD1A 3G6GA 3ZM4A 4D2PA 4DEHA 2VX1A 5BQ0A 3ATTA 1H0WA 3MTFA 4R6VA 3RPOA 1ND4A 3VBXA 2ZFYA 5C8MA 4NJDA 5IA1A 4IDVA 1FVRA 1Q62A 5EM5A 5BVEA 4UY9A 2Y4IB 3UIXA 2YFXA 3PUFC 2OZAA 3O0GA 4I6HA 4GV1A 5E8XA 4BDGA 4I0TA 1PKGA 2CMWA 4AFEA 4IB5A 2PSQA 3FMHA 4M3QA 5J1WA 3GCQA 4DEBA 5D9HA 3EKKA 3ZO2A 2R3FA 4J97A 4RIXB 4MH7A 2R7IA 2QHNA 4MYGA 3QRUA 3WF8A 3THBA 4C2VA 4OTQA 3R1NA 5LOHA 2XRUA 5DN3A 5IDPA 1GIJA 4NWMA 4BBFA 5JH6A 3NCZA 5FTOA 3MVMA 4AGWA 3I5ZA 2UW7A 3PY0A 3QQKA 1O6KA 4M15A 4ZSLA 3P9JA 5FQDC 5TT7A 3GXLA 2WQNA 4RVLA 4L3JA 3WE8A 3WOWA 4BCOA 4FJVA 5GIOE 4BDBA 2WOTA 2WU6A 2XNOA 5DWRA 3RNYA 4HPTE 4D9TA 4S30A 4RT7A 4CG9A 3LQ8A 4WSYA 2E9NA 2OF4A 2X1NA 3CGOA 5DEWA 5AUYA 2JKKA 3CTQA 3AKKA 4DLIA 3QD2B 3HEGA 3D5WA 4UMUA 3DBFA 3H3CA 3E5AA 3QCQA 2IW9A 3ZSIA 2QO2A 4I5CA 1X8BA 4J53A 4JRNA 4O27B 2HW7A 2GHGA 4PUZA 1Q8YA 2I0YA 2W1EA 1ZYLA 4O2PA 3D5UA 1P4FA 4LGGA 1IAJA 3D94A 3PRFA 1OKZA 2VX3A 4RA4A 3EYHA 4C62A 4ZSAA 5EQPA 4AN3A 3VRYA 4D2VA 4YU2A 3KXMA 2GPHA 4YLJA 3VONA 1DM2A 2H8HA 2IVVA 2WMSA 5E8ZA 2CKQA 4FIEA 1JKTA 3L8XA 3Q4CA 4E4LA 4M68A 4YJQA 4EK8A 5IF1A 3POOA 4ACMA 1RW8A 5DEYA 2OXYA 4CMOA 5I9VA 4E3CA 3ORNA 3KREA 3DU8A 4ANSA 1H24A 3EYGA 3QTSA 3FXWA 4FTCA 2WHBA 3DB6A 2JLDA 2BUJA 4G34A 4A4OA 4ZAUA 3UOKA 4FTQA 3AC1A 2G2FA 3G15A 1P5EA 3IW7A 4XCUA 1KSWA 3QBNA 5F95A 1OVEA 4OTDA 3FI2A 3VN9A 4BWXA 4KBAA 4KIQA 3EJ1A 4MQ1A 2NO3A 3L9LA 3IW5A 5CSXA 4EH4A 5AM7A 2DS1A 4E7WA 3COMA 4C02A 3U6JA 4TKSA 4G6NA 4CGAA 4MXZA 4DF3A 3COIA 1XBBA 3Q53A 1ZLTA 2WMAA 4UEUA 4AGCA 1M7QA 5JMSA 2BRHA 2GQGA 2C6LA 1URCA 3KL8A 5KMIA 4I92A 4EOLA 4CRLA 3LFAA 5FG8A 3NUAA 1YDSE 4AP7A 5HNGA 1H08A 1Y6AA 2W1ZA 5EH0A 4BF2A 4O7SA 3MPAA 3TUCA 3MESA 4D1ZA 4KUJA 2C6OA 1YXSA 4QP2A 5HNBA 3VS5A 3RZBA 1QCFA 4YJVA 3ZM9A 5DHJA 2BKKA 4XP0A 3IW8A 5AP2A 3RM7A 2RIOA 1FVVA 4ENYA 2GQSA 3VW6A 4PMPA 3VBWA 5IEXA 1Q8WA 4LQMA 4RMZA 3P7AA 2HK5A 4BCMA 1H1PA 1M7NA 3DPKA 3W10A 4BBMA 4EQCA 5L6PA 1U5QA 3UQCA 3K3IA 4R78A 3ETAA 3MVHA 2R3HA 2JITA 4RJ7A 5AIKA 4EUTA 3NUUA 3HGKA 5GINE 4XLVA 4RA5A 4L9IA 1O9UA 3Q9YA 2P33A 4F1TA 2OJJA 3IDBA 4QTEA 4GT3A 3HZTA 4RRVA 4D4SA 4ASZA 4I24A 3KVXA 3RTPA 4H1MA 3QWKA 2YDIA 4OBQA 3ROYA 2R3OA 2Z7LA 3G33A 4ZJJA 4CKIA 4U8ZA 3C0HA 2C3KA 2C5XA 5C01A 5IQFA 4GVAA 2XJ1A 2CLXA 2FSTX 4O1PA 4UWCA 4E20A 4DDIA 3W32A 2ERZE 4JOAA 4JIAA 5JRSA 3BRBA 3DCVA 4UMTA 2YN8A 4EHZA 3P1AA 2J90A 1B6CB 5J79A 4F0IA 4RIYA 4XRJA 4TY1A 5AP1A 3OWJA 4QEBA 5H9BA 3N4TA 2C6EA 4WG3A 4O7WA 3QUEA 5FP6A 4F78A 3QUDA 2AQXA 4HZRA 1RJBA 3TNHA 5A4CA 1LPUA 3OROA 2JAMA 2OG8A 1ZYCA 4IWOA 3VC4A 3ANQA 1ZRZA 3C13A 4H1JA 4QMPA 4XOYA 4EEVA 2HY81 3NVMB 4RGJA 3GU4A 1H1WA 3MA3A 3Q3BA 3PG3A 4FVQA 2Y9QA 1PXIA 2UZOA 2RFDA 1T45A 4BGGA 4FV3A 3RAIA 3OD6X 4XBUA 3JS2A 2XMYA 3EN6A 1OL6A 4YPSA 5JZNA 3VHKA 4BI1A 2W1GA 2XBJA 2XKFA 4YHTA 4APCA 4W4VA 4F6WA 5C27A 5BVOA 4IWDA 3G6HA 2GHMA 3VRZA 4RIOA 3FDNA 5AP0A 4M69A 1XJDA 4ZY6A 5E8VA 3A2CA 4CFXA 4IZAA 1Q5KA 4AG8A 3OEZA 2HAKA 2HXLA 2ITWA 3D14A 3NX8A 4QMNA 3I81A 2OJFE 4GFOA 3F5PA 4N6ZA 3VBVA 4AW1A 1CMKE 2PMOX 4L42A 3R7YA 4HYSA 5CF6A 2YM3A 4ZSJA 2C5OA 4G1WA 2YACA 4O1OA 4G9RA 1H1SA 2VU3A 4NJ3A 1Y57A 4EH3A 4BDJA 1NVQA 4JRVA 2OIDA 1Y8GA 3G9NA 3NUYA 1IASA 5A4EA 3NVKI 2BROA 2C0IA 2QVSE 2VTNA 1K2PA 4O81A 1WBOA 4BCHA 3UNZA 4G6LA 1PJKA 1P4OA 1OGYA 2ZJWA 2B4SB 1MQBA 3DZOA 3VS0A 4TZRA 3LJ1A 1YXUA 2GS7A 4R3CA 2R3GA 4FIFA 3L9NA 4RJ8A 4MQ2A 4FZDB 4IM0A 3E8CA 3FY0A 4R3PA 2XALA 4CCBA 3C9WA 4HNFA 2W9FB 5DPVA 2ZDUA 4EK5A 2YISA 5JQ5A 4CLJA 4O38A 3V5QA 4G6OA 3FI8A 3ERKA 5KE0A 4EH6A 3KMMA 3MTLA 3A8WA 4AQKA 4J52A 4DEGA 1W98A 3PLAE 4FNXA 4DITA 2ZM3A 2P3GX 3BKBA 4FODA 3FPMA 4AZFA 3R0TA 4DG2E 4DDGA 2WTVA 3TCPA 2C4GA 4IE9A 2C3LA 3HV4A 4JJRA 2YIXA 3DJ7A 3MA6A 4QYEA 3G0FA 4OR5A 1OGUA 3G0EA 3R9NA 2J0IA 3R8VA 3UQGA 4RBLA 1UNLA 3DK3A 2AYPA 5BVKA 1PHKA 4UX9A 5CI7A 3QL8A 4X6RA 4F0FA 4AU8A 5IEVA 4O4DA 2UW5A 5HG7A 3QQJA 2XK4A 4BDAA 4C3FA 4M67A 2JKMA 3QRIA 4V0GA 2XIRA 3KVWA 3W2SA 4AN2A 4F9BA 2R4BA 4GT5A 3TV7A 3VQHA 2CN8A 3FAAA 2XK3A 3VBTA 4OAUC 3DXPA 3ZC6A 2Z2WA 3VW8A 2ZYBA 3LM5A 4QMXA 3P86A 3JY9A 3OCSA 4W9WA 3P0MA 4EORA 3FKNA 2Z7QA 3DAEA 2Z7SA 3K3JA 4RWKA 5M53A 4BGQA 3BEAA 4FNYA 3W1FA 4EHGA 4QTAA 3BPRA 5KUPA 3I1AA 5IU2A 4JS8A 5J1VA 5E4HA 5M55A 5I3OA 5JRQA 3S00A 5T3QA 1JWHA 3WZDA 4IAFA 3OUNB 3VULA 3CQEA 5C1QB 1R0PA 1UU8A 3OHTA 3RPRA 3VUKA 2GDOA 4BC6A 3G9LX 2WKMA 4C58A 1U46A 4FC0A 4C4HA 2ETRA 5KX8A 3QQLA 5DRDA 5CAQA 4ZTSA 2XF0A 2WTJA 1OM1A 2O3PA 4MXAA 5K4IA 3RHXA 3IG7A 4G5JA 5BUJA 3A8XA 4EI4A 3AMBA 3A61A 4MWHA 4RQKA 1WMKA 2QURA 2VGPA 3LJ0A 4ITIA 5IA2A 4OT6A 2REIA 1TQPA 3OBJA 4GMYA 4BBEA 5AUWA 5AWMA 1G8JA 3NMUF 1A9UA 2F57A 3HX4A 4PTCA 3UPXA 3LFQA 5IEYA 3Q2JA 3REPA 2GNHA 2W9ZB 4MK0A 1U4DA 4ZTQA 4W4YA 4DT8A 4AA5A 3W55A 2CGWA 2ZMDA 4U79A 1YOJA 5DA3A 4DGMA 2XEZA 2R3NA 4MD7E 5F20A 2ACXA 4YO6A 3SW7A 4FGBA 3VWAA 4NUSA 3LXLA 5CSWA 3MI9A 3L1SA 5HBJA 1FPUA 5DYJA 3NSZA 3UOLA 5BNJA 3HDMA 3UOHA 4EH2A 4EHEA 4FTTA 3UIUA 4D1SA 3NDMA 4DT9A 4C4FA 5KO1A 3RK7A 4BN1A 5C8NA 4O7ZA 4N57A 4M66A 5EI6A 3VS1A 3PG1A 4DA5A 4RFYA 3PDTA 4A9UA 2BFXA 5AIRA 2WPAA 2WAJA 3PJ2A 3FKLA 3UP2A 1PRYA 3UG1A 1GIHA 3AMYA 3HMOA 1M2QA 2W1CA 4QTBA 1W2FA 2OSCA 1ERKA 2JEDA 1CKPA 3FQSA 3HUBA 3I79A 4WOVA 4C3RA 1TKIA 2XM8A 4Y5QA 5JFVA 4I1ZA 2YWPA 2X6EA 4O0SA 4MXXA 2XIZA 3VBQA 5CZHA 3DXQA 3DBEA 5LVOA 3BU6A 3OXZA 3DNEA 3UOJA 2GTMA 4ZTMA 5DRBA 1J3HA 3TWJA 1OPJA 2BZJA 1J1CA 3FMDA 4DTBA 4V01A 5HGIA 1QPJA 2R3IA 5CVFA 4QPAA 4ZZOA 3JY0A 4IIRA 4A9YA 4FKLA 2C6DA 2X0OA 4D55A 2EB3A 5HO7A 5L8KA 3Q04A 3QXPA 3IO7A 4OTPA 1R1WA 5D1JA 4AA4A 4FEXA 1ZOEA 1Q8ZA 2WTDA 4JDKA 3ACKA 4W4XA 5FGKA 2VNYA 3NS9A 2YABA 5CEPA 3WARA 1FVTA 3MFUA 4KBCA 3ITZA 1JVPP 4CFFA 2J50A 4LL5A 3U8WA 4R7BA 2DQ7X 5IQEA 4DFYA 4LL0A 2OZAB 5FBOA 3OUKA 4PV0A 3FI4A 1Q97A 2VGOA 4TWPA 5CSHA 1VLRA 4FE2A 3UJGA 5LVPA 1IAHA 2UW3A 2C0TA 3MV5A 2WOUA 3DOGA 3BWJA 5HIDA 5BYYA 2BR1A 2GCDA 3A62A 3F7WA 3NYVA 2JKQA 2XRWA 2WZJA 4GL9A 3UNJA 5HTBA 2YIWA 1ZMWA 3MH1A 4I22A 3H4JA 3HVCA 1GJOA 5TKDA 2JIVA 4LOPA 4QMLA 2IVUA 5BMMA 3ZBFA 4DTAA 4FTLA 4S34A 4FSTA 5A6OA 3E63A 4YSJA 4PDYA 3MSSA 4DTKA 2PZ5A 3GC8A 2H9VA 3NAYA 1W2CA 2OH0E 4OTIA 3FZPA 3ODYX 2Q0NA 4F70A 3LFNA 2I0EA 3WIGA 4YTFA 2HELA 3ZC5A 4GYGA 2PUPA 3EN5A 4J95A 1U54A 4IVCA 5CAUA 3QHRA 4R7HA 4WUAA 4F6UA 3RAHA 4H3BA 5L3AA 1FMOE 3UVRA 3PFYA 4KKEA 4U6RA 3MN3A 4DYMA 4X3FC 5IH5A 5BYZA 3GENA 1QMZA 1IEPA 2XP2A 3OS3A 5FDPA 1QL6A 2YM4A 4CMTA 5HE2A 3NW7A 3RGFA 4AWIA 4CQGA 4RX5A 5FDXA 3Q6UA 2GS2A 2VTOA 4O7VA 4IVAA 5AJQA 3V8WA 4Y83A 4FKOA 5IZFA 4U43A 4AZEA 4FL3A 4X2JA 4BCQA 4FV8A 2PVRA 3OY3A 4Z55A 2OFVA 4QP4A 2YZLA 3I60A 4L67A 2PE0A 4UV0A 3AT4A 1YXTA 2QU6A 1JOWB 4F9AA 3BE9A 3QTQA 4C4EA 5CALA 5HIEA 4GUEA 4JQ7A 4AAAA 2B9FA 5CSPA 1WBPA 1YKRA 1NY3A 4C33A 4CKJA 4YTHA 3TT0A 2F2UA 2VTQA 3DZQA 1KV2A 4IM2A 3O5AA 3LM0A 3PXQA 3V5JA 3UNKA 3QKMA 1SVEA 4UN0C 4EZ3A 4KKHA 2E9VA 2IZSA 2C3IB 3L9PA 3MS9A 4FTIA 4FVPA 3FMEA 4KSPA 4XRLA 4DC2A 2XAOA 3LOKA 4DEDA 2BRBA 4S31A 4IXPA 5AR2A 2Z7RA 2UW8A 3M11A 4QMWA 4MBIA 5HI2A 5AAFA 2P2IA 4QTCA 3KC3A 3R73A 4GS6A 5A14A 4TYIA 3POZA 5ANDA 3QQGA 3QTRA 4AT4A 2QOQA 3TDWA 5E8TA 5T6KA 3CPCA 4BWPA 3PUPA 3W0NA 1JKLA 2VTLA 3R04A 4XP2A 3QGWA 4JDJA 2YM8A 4D9UA 1OMWA 5IMXA 2OKRA 2Q0BA 2QLQA 3NNXA 2QOKA 3MJ2A 3W2OA 3RHKA 3E62A 4FUXA 5I9ZA 3HP5A 2GHLA 4PPBA 2XYNA 2ITZA 3WF5A 5J5SA 4CQEA 5HORA 4Q5HA 4RZWA 3SV0A 2C0OA 2VWUA 4UZDA 4LMNA 1WBNA 2X0PA 4LUDA 5L6WL 3T9TA 2WU7A 3QA8A 4TXCA 2EU9A 3FHRA 2BILB 4IZ7A 2F49A 3FSKA 4TWNA 4W4WA 5HQ0A 1PXPA 5HOAA 1YWNA 2GFSA 4Q5EA 5HESA 4BDEA 4DFZE 3PVBA 5HE3A 3HMPA 4KS7A 4WNKA 4F6SA 4CMUA 3ZEPA 3KFAA 3GOPA 2E9UA 1MRYA 4NCTA 4Q9ZA 2BAQA 3FL4A 2BIYA 4XEYA 2VO3A 3SC1A 4CKRA 3GQIA 4I5MA 2ETMA 2WEVA 2R0UA 3RP9A 3CSVA 1ST4A 5T68A 1YI6A 3OCGA 4Y95A 1PKDA 2PVYA 4XV9A 2YCRA 4JX3A 3VHEA 3FUPA 4FZFB 4FTNA 5B2KA 4L3LA 4YPDA 5J7BA 1ZYSA 3A7HA 4RPVA 4ITHA 4GG7A 4G3DA 4IH8A 4L43A 3QCSA 4WO5A 1STCE 2XM9A 4OBPA 3TJCA 4FKIA 3E8EA 3TKIA 4X7QA 4C59A 3KXZA 2XNMA 2YWVA 4JAJA 4IZYA 5H2UA 3W2RA 2A1AB 4YTIA 3RVGA 3SOAA 2WTWA 3F82A 3R7UA 5CASA 3BBTB 4WG5A 2JGZA 1OI9A 3PY1A 4HGEA 4AXFA 2QD9A 3WZJA 1HOWA 4EYJA 2BHEA 5TF9A 3V8SA 3ZBXA 5A54A 2Y4IC 3TACA 3VS3A 3F88A 2BRMA 4RIYB 3KK9A 4KNBA 3DKOA 3HRCA 3NYOA 4NM7A 5AM6A 4KB8A 1UNHA 2WQMA 4OTFA 5AMNA 1W2DA 3D15A 4USFA 2OFUA 3ACJA 3K5VA 1W0XC 1BKXA 3HNGA 4LUEA 4NKSA 4UYNA 1T46A 3TUBA 3BYVA 5KHWA 3I0QA 3S4QA 4R1VA 4RC2A 1BUHA 5HLWA 2WMWA 1XQZA 4FL1A 4CV9A 1DAWA 3UIMA 2PZIA 3KY2A 4D58A 4EOJA 2YIRA 1PXOA 5TE0A 5KBQA 2QNJA 4F1MA 4UALA 3HUCA 3PP0A 3QU0A 3WYYA 4A4XA 1L3RE 3RZFA 4BCNA 4NW5A 3LQ3A 4RVMA 2VTTA 3FBVA 5KMNA 2PULA 3LW0A 4C36A 3OXIA 3IECA 2XVDA 4M69B 1VZOA 3AC5A 4UBAA 3R8ZA 2PL0A 1OKWA 3QTXA 2WQOA 4FNZA 1LEWA 3ZUTA 4BFMA 4BYIA 4J1RA 2FB8A 1F5QA 5A3XA 5L4QA 1J91A 4O0XA 3Q96A 1K3AA 4U44A 5KMJA 3HDNA 2X4FA 3KRWA 4FSUA 2GMXA 5CT7A 4FKGA 1I09A 4HVHA 4IAAA 5IUHA 4A9TA 4MBLA 1R39A 4FIIA 4FKTA 5BUEA 2FUMA 3VJNA 4PMTA 2EXMA 4FTUA 4HCVA 5DR6A 4FTRA 5EKOA 2Y0AA 1XHAA 3V6RA 4C0TA 3AC8A 1ZXEA 3BELA 3IW4A 2B9HA 4BTKA 2CJMA 3E7OA 2CGUA 2YDJA 4JG7A 4XBRA 4YZCA 1KE9A 5IUIA 4DFLA 5IQBA 4RJ3A 4ZY4A 1RQQA 5FEDA 3E92A 1TVOA 4BI0A 1REKA 4QPMA 2CPKE 3UODA 2PPQA 3OCBA 4GFMA 4FBXA 4NZWB 4AZWA 5JFSA 3W33A 1VR2A 4D2SA 4EK4A 1A48A 2W7XA 5DG5A 3PPKA 1YI3A 3RWQA 2J0JA 3TV4A 2JKOA 3HRFA 4AXAA 2XJ0A 4S2ZA 3ZU7A 3G5DA 3LXKA 3U9CA 3Q6WA 1IA9A 4AA0A 1H4LA 1XH6A 4TYHA 4ZOGA 3RM6A 1OB3A 3PWYA 3Q5IA 3JPVA 4YC8A 3KK8A 4G5PA 4GK2A 3TI1A 2AUHA 2YCFA 3UQFA 4U97A 3TNQB 3ZXTA 1JKSA 2WNTA 4YC6A 4V05A 3P7CA 4WKQA 4IACA 3HKOA 3MH0A 2HENA 4KA3A 5HU9A 4P2KA 4AN9A 1LP4A 1H28A 3QAME 4ONAA 4FSZA 4HVIA 3LFCA 4CD0A 1MP8A 3CXWA 3E3BX 4OUCA 3FL5A 4C2WA 3BQRA 4CLIA 5I5ZA 4XG8A 2YM6A 1KE7A 5J87A 4YLLA 5FWKK 3HP2A 3MY1A 1PYEA 3BLQA 3CD3A 2RFNA 2QG7A 5I9UA 2J2IB 4V0GB 4TWOA 4BTMA 3AG9A 3DKFA 3EN4A