4XS2A

Irak4-inhibitor co-structure
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
297
structure length
283
Chain Sequence
TRFHSFSFYELKNVTNNFDERPISVNKMGEGGFGVVYKGYVNNTTVAVKKLATTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Discovery and hit-to-lead optimization of 2,6-diaminopyrimidine inhibitors of interleukin-1 receptor-associated kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 283
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xs2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xs2A01
3FMMA 1LPUA 3R30A 3MTLA 3BU3A 3C51A 3R7IA 4A9YA 4QPMA 4YZNA 5GIPE 3PXZA 2UW4A 4NJDA 4BDGA 4LG4A 4GFMA 4O21A 4RIOA 5G6VA 4FZDB 4JBOA 4YZBA 3HA8A 4HVGA 1PHKA 1APME 4AACA 2Y4IC 1X8BA 4FC0A 3SXRA 4X2NA 5JZJA 2OK1A 3EN7A 2VD5A 4H58A 3ZBXA 2PUNA 2RFSA 2YA9A 3QXPA 2J2IB 4JDHA 5ETCA 5M55A 4CMOA 3HL7A 3DZOA 4S34A 2OJFE 5E91A 4HOKA 3PJ8A 3HV7A 5DPVA 3HRFA 2BZJA 5I9XA 3UIBA 5HI2A 1Q61A 3DTCA 3OTVA 3IW4A 3FSFA 3QKKA 3ULZA 4YR8A 2BZKB 2XNNA 3ZTXA 4BY9E 2RG6A 4NIFA 4QP2A 1M14A 3VC4A 5IQIA 3NR9A 4FTNA 3DK3A 2BZIB 3OD6X 1Y91A 4R5SA 3V5QA 3ZRKA 4EZ5A 4C37A 3SDJA 4C0TA 4LUEA 4Q2AA 4QP8A 4K6ZA 4AZEA 3QD2B 4I4EA 5LWNA 2HWPA 3CY3A 4MYGA 3FDNA 3H0ZA 1NVQA 4CG8A 2CJMA 2Z7LA 3Q9WA 4K8AA 2X7OA 4FYOA 2WU7A 4EKLA 4WG3A 3PIYA 2QU6A 4FIJA 3DB6A 3CD3A 3IW6A 5J8IA 1BMKA 2YDKA 2CNQA 4YZCA 3ZCLA 3MY0A 4OTIA 5IEXA 3E63A 4MBLA 4P90A 2OG8A 4YPDA 5E8SA 2QODA 2B9HA 4GFOA 2G2FA 3V3VA 4R7IA 4ZLYA 5I9ZA 3MVMA 2J0JA 4IAZA 5C4LA 4YJRA 4PL5A 3PJCA 3UPZA 3BQRA 3DCVA 3E8CA 3FQEA 4IX3A 2VN9A 5ETIA 3VIDA 1REJA 1GJOA 3LZBA 2I0YA 3LHJA 3OWPA 3C4WA 4K1BA 4LV5A 3S0OA 5HQ0A 4A9SA 5M06A 4PP9A 4ALWA 2XS0A 3EFJA 4NIFB 4M68A 3QHWA 4QMXA 5E90A 3WF5A 1PW2A 2HXQA 2A19B 1QPJA 3LOKA 2WMAA 5DHJA 5HEZA 4DFUA 5F9EA 4UV0A 4FUYA 2QLUA 3GT8A 5KUPA 4F0FA 3TUDA 1PXMA 3SXSA 3T9TA 5DRDA 5GZ8A 5KKRB 2VTHA 3QXOA 4CYIA 2I6LA 3W10A 2VWXA 4IXPA 3QTQA 3QZFA 3RNIA 5BVWA 4HGLA 3FZTA 2EVAA 2IZTA 3ZFMA 5AV3A 3LFQA 5DT4A 4CFVA 3ZS5A 3QTXA 4FI1A 2C4GA 2JAVA 5L8JA 5CALA 4IVBA 1VEBA 2IZSA 2R0IA 3FYKX 4EOMA 1BI7A 3MPTA 5JGDA 3Q2JA 4IB1A 3WF9A 4GIHA 4W4VA 3R7VA 3RAKA 5KNJA 3QRUA 3DXNA 5K4JA 3UVQA 3ZLYA 3VUIA 4H3QA 4RWJA 4KIPA 4RJ5A 5M56A 2X2KA 1ZYDA 1XBBA 4IWDA 4GCJA 3D83A 4FV4A 2FUMA 4DCEA 2RGPA 4QQJA 3T3VA 2P55A 5CSVA 3FWQA 4RJ7A 5CF4A 5K0XA 4TWPA 4KINA 3CEKA 3IGGA 4AFEA 2BMCA 4NKSA 2W17A 5HX6A 2QHNA 3OVVA 3OY1A 2DWBA 4GT3A 4C58A 5IA4A 4I93A 3ZLXA 5IQDA 3P86A 4J96A 4UWCA 4G5JA 5HZNA 4TWNA 5HO7A 1WVYA 3Q9YA 3NYOA 2PVHA 4EH7A 2HZ4A 3C50A 4YTHA 1FMOE 3FMHA 3KGAA 4ZZMA 3HNGA 2YWPA 2WEIA 4F64A 4FVQA 5EQYA 3RWQA 4S30A 4WKQA 3D5VA 3EWHA 4GUEA 4LM5A 4MXXA 4RJ3A 3QCSA 4U41A 2PYWA 2W1CA 1UA2A 4BYIA 4HYHA 3DT1A 5CTPA 2WTJA 3O96A 5AR5A 5BVEA 2GTMA 3E88A 3UPXA 2X2MA 4F0GA 5C4KA 4BIBA 2HOGA 2Z60A 4YSMA 4CZTA 3B8RA 5C8KA 3ATTA 3LFEA 2X7GA 3QQUA 3UMWA 2WZJA 5D1JA 1TQPA 3IDBA 4LFIA 5C9CA 3KRXA 5CEQA 3ZH8A 4EHEA 5JFSA 3A60A 4PMTA 3C5IA 3OT3A 1ZRZA 1A9UA 3ENMA 2R3MA 3F3WA 3IOKA 1JKLA 2C1BA 2WMRA 1FVRA 5I5ZA 5I9WA 3UIUA 4G5PA 4F63A 3MH2A 3M11A 5H3QA 2JC6A 1WCCA 2BR1A 3EFLA 2OF2A 4O82A 3LE6A 3NLBA 4UMTA 5AUVA 3SW4A 1W82A 1YHSA 4ZTSA 4XG7A 4I21A 4XH6A 1G8AA 2W9ZB 4YC6A 4QYFA 2UVZA 3Q4UA 3QQHA 5IPJA 1SNUA 3F2NA 4IAKA 2J0LA 4MEDA 3E7VA 4IEBA 4FKLA 3CC6A 5E8TA 4CGAA 1O6LA 5L8KA 1M2RA 3MY1A 4BGGA 5FXQA 2BDJA 4O0UA 3EL7A 3NSZA 4LL5A 4CMTA 3PLSA 4DH8A 4XNEA 1F0QA 2H96A 4WOVA 3BHUA 4YJQA 4DYMA 4A4XA 3SD0A 2PMLX 3BBTB 4YUQA 3MH3A 4BZNA 4JAIA 2DS1A 4ZSAA 2R3HA 3O50A 1FGIA 5EM5A 2YM4A 5D7VA 4B8MA 5CZHA 3TNWA 2YIXA 3LFSA 2X8IA 4L67A 4WNPA 1OKWA 2CDZA 3PRFA 1UNHA 4RIWA 3NW7A 4GT4A 4E6QA 1SVHA 5HO8A 1YXTA 4ZY6A 3AQVA 3E62A 1Q41A 3SHEA 3KFAA 4YP8A 4NM0A 1E9HA 4LRMA 4YJUA 3U9NA 5AP3A 3VS6A 5L2SA 5LMKC 3HUBA 2UW5A 3RPYA 3ZUUA 5FQDC 5LVNA 4GS6A 5BVOA 1RDQE 3OUNB 2R7IA 2RL5A 4FYNA 1KV1A 3NUXA 3TV6A 4AGUA 2UV2A 3ACJA 3C0HA 2RSVA 3GCQA 3L8XA 2Z2WA 4CD0A 2W4KA 4I5HA 3DXQA 2DQ7X 4BTJA 3JUHA 4TXCA 5EI6A 4FSWA 2QU5A 3HV4A 4BHZA 5C8MA 4H39A 4NCTA 2WKMA 3TZ9A 4EOSA 2QI8A 2PU8A 3CP9A 4Z7HA 3K5VA 4WO5A 2ACXA 2B4SB 3GFEA 5CEMA 3FQSA 1Z9XA 1B38A 4PPAA 4F70A 3QQLA 4APPA 2R3NA 4YGAA 5IA1A 4U97A 4EQMA 2RFEA 1TKIA 4USFA 1U5RA 4O7RA 3L9MA 1JBPE 3V51A 4ZY4A 2UW3A 3WBLA 1PXIA 1RJBA 2R7BA 2WTDA 3KC3A 3OG7A 4FIGA 5CQWA 4WD5A 4YU2A 2OIQA 1KE6A 2XK7A 3C7QA 3ORIA 1LEWA 4GRBA 1OPKA 5AM6A 4DFLA 2FSLX 4X6RA 3R00A 4R1VA 4BDAA 4TYGA 4O6EA 2HK5A 4KRDA 5TKDA 2YITA 2YM3A 4UXQA 5FD2A 3WIGA 2C5OA 2HW7A 4C8BA 3RAHA 5IUGA 4HVIA 3NUNA 3LXLA 2F4JA 2X39A 5CASA 1V1KA 4K33A 4OTFA 1SVEA 4EH4A 4DT9A 1UU3A 2QQ7A 2ZB1A 3R9OA 3FMEA 3BIZA 4L3PA 2BHEA 2O2UA 4LRKA 1E1VA 2XKEA 3U6IA 4AT4A 4YBJA 4ID7A 4W4YA 4EK6A 4FIFA 4OTRA 4ZSGA 3PVBA 4ACHA 3GEQA 1S9JA 4FEXA 1TQMA 5FP6A 3WI6A 4QYEA 4P5QA 4YLJA 4F9CA 3B2TA 4MHAA 3K3JA 1WVXA 4AWIA 3ZO3A 5AV4A 3A62A 5BYYA 5BMMA 3FHRA 2QO2A 1XR1A 3HEGA 3ENHA 4LGGA 4H05A 1P4FA 2PSQA 4IAYA 4JDKA 4JI9A 5H2UA 2ITTA 4XOZA 2XKDA 4L01A 2YZLA 5CXHA 2V7AA 1P2AA 4B0GA 2P2IA 4A9UA 4QMYA 4ZLOA 4XG2A 4QP6A 3QA0A 1OL5A 1JWHA 3OBJA 5M53A 3DS6A 4X6QC 3LFFA 4XLVA 4XRJA 3CQUA 3FQHA 4I0RA 3W2QA 2HZIA 4FX3A 4G31A 4RJ6A 4AOJA 3AT4A 3FI3A 3IO7A 4UBAA 1JAMA 3BPRA 3V8SA 2F9GA 2YM8A 5GHVA 3EOCA 4PL3A 3G6GA 3KU2A 2F2UA 2XJ1A 3O0GA 3OWKA 3R8ZA 3VRZA 5AP6A 3ZC5A 3O17A 3ZM4A 4S32A 3LFCA 5KHXA 4YJVA 5AA8A 3VS0A 3E3BX 3E7OA 5M57A 4MD8E 3FI8A 1H07A 2O8YA 3FMKA 2GNIA 1Q99A 2BROA 3R9HA 5AR2A 3JY9A 3LMIA 2WO6A 2UZOA 2O3PA 5EDRA 2ITYA 5CF6A 2VNWA 3LFBA 2CKQA 4O81A 1OPLA 2XM9A 3ITZA 1J7UA 4JG8A 2WMBA 1UWHA 2C6LA 5D12A 3ODYX 4BDCA 3G9LX 4GUBA 2F7ZE 3QKLA 2UZNA 3VUMA 2JITA 4FTAA 4ASZA 4BDKA 3NAXA 2WMXA 4L52A 4MD9E 1L3RE 4JQ7A 5FEQA 1WBTA 3UTOA 2PE2A 4U81A 4XBUA 4I94A 2GMXA 2XNPA 2YISA 3PSCA 5AV1A 4BICA 4F9AA 5CQUA 4ZMEA 3MFRA 4BDFA 4U7ZA 3BRBA 4AX8A 5FLFA 4QNAA 5LMBA 1F5QA 4XCUA 3LVPA 4L53A 4AT5A 2WTVA 3KXMA 1YI3A 4QTDA 4MK0A 5CENA 4CZYB 5AAEA 2IW9A 4EJ7A 3DQXA 3QRKA 2EUFB 5IMXA 2YACA 1H24A 3NPCA 4PNIA 1PXPA 3RGFA 5J87A 3UO5A 2VTSA 4F65A 4GU9A 3RHXA 4O0WA 5A6NA 2R9SA 3FJQE 4IDTA 3IPHA 3DFAA 4ITIA 4MCVA 4RX7A 1H27A 3H9FA 3FLZA 3I7CA 5DN3A 3BHYA 3PP1A 5B2KA 4G3GA 4QMUA 4RRVA 3RAIA 3RK9A 4W4XA 5EM7A 5C27A 1MQ4A 5E8WA 3KXXA 3F5XA 3DBCA 2WPAA 2R3IA 3PSDA 3LLTA 4X2KA 3SOAA 4D4SA 4LI5A 3F69A 3QRTA 4S33A 2J0IA 3OFMA 4EHGA 5HIBA 3Q2MA 5CX9A 4EQCA 4QMVA 5BVNA 2W1FA 4WHZA 5L2TA 4IAIA 1VR2A 1QPEA 1ZYSA 4J53A 5DT0A 5CF5A 4QNYA 4XV1A 4PDYA 2YDJA 4MVFA 5I3RA 4FT3A 4JL9A 4ZLZA 3GI3A 2XYUA 5BQ0A 3EJ1A 2X4ZA 3IGOA 3KXHA 4B4LA 1R0PA 4EBVA 2XMYA 2GQRA 2KTYA 4I1ZA 4F99A 2ZV9A 4RWKA 4ACCA 5C8NA 5GJFA 1FPUA 4KB8A 3R9DA 3QF9A 3RPOA 4XG9A 2CCIA 3HP5A 4FGBA 2G15A 3OOGA 1ZY4A 1NA7A 2CPKE 2WOTA 3MS9A 1Y6BA 4HGEA 4IC7A 5JZNA 3WIKA 3ZM9A 3DKGA 3GGFA 3VW6A 4APCA 1HCLA 4RA5A 2OZOA 4JOAA 5BMSA 4I0TA 3BE2A 4OTDA 1Y57A 2CSNA 2XK9A 3UYTA 2VTPA 4O83A 3PSBA 4ZP5A 3R1SA 5HD7A 2PMIA 5IQGA 2IVTA 4GSBA 4DTBA 4X3FA 3KF7A 2F7XE 3EZRA 3QCXA 2BDFA 2QO9A 3UG1A 3VS7A 4DF3A 3NX8A 4XX9A 2JEDA 4XOYA 4MF0A 1F3MC 5HBEA 3RINA 4FSZA 2BIKB 5F1ZA 3PVWA 5AUWA 4BDHA 5LARA 5CT7A 2REIA 1CKIA 3E87A 4L00A 3NIZA 3DBDA 1ZMWA 4OGRA 2IW8A 1Q62A 2UZLA 5M4FA 4FA2A 4YJOA 4MXYA 4XV3A 4MF1A 4FSTA 4M14A 4IWPA 4ANSA 5J5TA 5LQFA 3NUAA 5FTGA 5DI1A 3LCDA 5AUTA 5F95A 5HORA 3TV7A 3EQBA 4HZRA 3CJGA 3W2RA 3COIA 3QWKA 4EKKA 1OBGA 2YWVA 3V5LA 3ETAA 1YVJA 2JIUA 2V0DA 4AN3A 4IIRA 1GOLA 3F5PA 3GC0A 2IVSA 2VTNA 2WQNA 3G9NA 3HUCA 3C4CA 5JQ5A 2CGXA 5CWZA 3DXPA 3JR1A 4EBWA 3KVWA 2BVAA 4ITJA 3BYSA 4EWQA 4CFXA 3DY7A 3MFSA 2W4OA 4ALVA 4CMUA 2JD5A 3DK6A 5CZIA 5EYCA 2XK8A 4ORKA 1BLXA 3Q4CA 1OVEA 3GU8A 3MPMA 4FTOA 4YJNA 4F9WA 4D2VA 4HW7A 4O38A 4J8MA 3VULA 4A4LA 5JEBA 2XKCA 4X3FB 4PPBA 5J1VA 1Z57A 2PZPA 2YFXA 3IW8A 3UIMA 4HGTA 2UZBA 2C6KA 5HTBA 3ORKA 2BHHA 4JBPA 1XH6A 4BVUA 1FVTA 5DBXA 5JQ8A 4PF4A 1KE5A 4FKIA 4EH6A 3VRYA 2Q83A 4RWIA 2VTRA 5AP4A 4QTEA 5KO1A 5HLWA 1ZARA 4ANLA 2VO7A 3DV3A 1OMWA 2CHLA 4G2FA 2PZIA 5I0BA 4J98A 1OIYA 4Q5HA 4NTSA 5B7VA 4FK6A 3A4OX 4E7WA 3DJ5A 1URWA 4U6RA 2XIXA 4O27B 2W1IA 4U9AA 4DBNA 3KA0A 5TT7A 2A2AA 2F57A 3W8LA 4PPCA 3GU5A 4BL1A 5DR6A 4C02A 5EI2A 3JVRA 4JS8A 4Y95A 2VO6A 3ZDUA 5AADA 3RJCA 2IVUA 4Y85A 3FEGA 5AIKA 5J9YA 3GOPA 2Q0NA 3V5WA 4B6LA 3TXOA 2H34A 4CRLA 3OROA 3QA8A 2FH9A 4IACA 4F6UA 2QKRA 5JRSA 4RSSA 4MXAA 5HCZA 3WARA 4E3CA 3W33A 3QKMA 4ZOGA 2XJ0A 2C0TA 1R0EA 4ZJVA 4F1OA 4UWBA 4CFMA 4ZTLA 3GCUA 2YM5A 4LGDA 2BKKA 3D2KA 4OBPA 4L8MA 3GB2A 4JG6A 1VYZA 1WBVA 2F2CB 3VW8A 1OECA 4KIKA 4RX9A 1WBSA 5K3YA 5KCVA 4BBFA 2W5AA 1YHVA 1NY3A 2P0CA 1R78A 4FKGA 4FV2A 4JDJA 3SV0A 3U4WA 2WTIA 4WT6A 2ZM1A 3F3UA 1Q8TA 2X6EA 2XVDA 5EYDA 5DFPA 1WZYA 4E5BA 5TR6A 2C6TA 1FVVA 4GT5A 4QMMA 2ERKA 5HE1A 3R9RA 5E8VA 4XG6A 4CT2A 5HX8A 4BF2A 4YPSA 3W2PA 3PJ3A 3DLZA 4DH5A 1H01A 4EK4A 3CTQA 2VAGA 4FV9A 3C9WA 4NU1A 1ZWSA 4UZDA 3EN6A 2V22A 4PTGA 4NT4A 3ZLSA 4DGNA 5EM8A 5JGAA 2UW6A 1JSVA 1YWRA 3ZO2A 3HAVA 3CLYA 5IDPA 3NDMA 4D2SA 1GNGA 2QR7A 2QOIA 3FUPA 5E8ZA 4CEGA 3DNDA 4M66A 2HIWA 4IVDA 5EDPA 5DLSA 3OCGA 3RI1A 4E93A 4ZTQA 1SZMA 2YLFA 4Q5EA 3DNEA 2R2PA 3UZRA 5EQEA 2VTLA 2QOKA 4WBOA 1YXVA 2W0JA 4C38A 4X2FA 4EOQA 4FT5A 4N6ZA 4TRLA 4EZ7A 4KSPA 3GCVA 3VS3A 4F7LA 3GUBA 4ZZOA 4U3YA 2G01A 2F49A 3R22A 4PQNA 4MNFA 5F20A 4BI0A 5GINE 3OC1A 4TYHA 1DS5A 3TTJA 1H25A 2BCJA 4O0XA 3NS9A 2CKOA 4E4XA 2HAKA 1PKGA 3KN6A 3P79A 1Y6AA 4A06A 1M7QA 2YCRA 1OUYA 4FTLA 2VGPA 2J0KA 4H1JA 2OXXA 4JBVA 4FMQA 3ZEWA 3H10A 5IU2A 2JKOA 2BRBA 4FIHA 4PTCA 4I6HA 5EHLA 4EL9A 4U42A 4DGLC 4HJOA 5JRQA 1U4DA 2IO6A 2PE1A 1G8SA 3VVHA 3NUUA 3MJ1A 1SVGA 1HOWA 4BR3A 2X9EA 1WAKA 3G6HA 1AQ1A 4RFZA 3OCSA 4FZAB 3QX2A 4I5PA 3V01A 4D4RA 5CEOA 4FTTA 4FZFB 5KMNA 3LM5A 4DGOA 4YNEA 4N6YA 4U44A 2WQEA 3A99A 2VWZA 3CTJA 1H26A 2WMSA 3DB8A 3MI9A 3HGKA 3QQJA 4BTFA 4EK3A 5CAQA 4U43A 2PVYA 3QX4A 4RJ8A 3PLAE 5J7HA 5LMKA 2ITPA 1KWPA 2BZHB 4J71A 4TYHB 4UWYA 2W06A 2X81A 4H3BA 3EQHA 4YJPA 3PXKA 3ZO4A 5TO8A 2Y7JA 3WYYA 3F88A 3FLNC 3SAYA 3E8NA 2WEVA 1Q5KA 4BZOA 1M52A 4JR3A 2R3PA 1SMHA 2RFDA 3UIXA 3ZXTA 2B9IA 3W1FA 5AAGA 2A0CX 4W8EA 3IS5A 3UBDA 2VZ6A 2HXLA 2WIHA 5M51A 4AF3A 3LQ3A 4PMMA 4WBBB 3UODA 3FLQA 5DIAA 4XG4A 5M4CA 2LAVA 3LM0A 4FNYA 4QO9A 3U4UA 2JDVA 2B54A 4L3LA 3QUDA 4W4WA 2WNTA 1WBOA 4P4CA 3LW0A 3NUPA 5E8YA 2C6DA 2YCQA 4JVGA 4RPVA 2GDOA 1OM1A 1JVPP 3VBTA 3WF7A 4D4YA 2XB7A 2OJGA 3FAAA 4KNBA 3R01A 4FIEA 4WIHA 5HKMA 4XG8A 4Q9ZA 2EB2A 3DQWA 1WFCA 2XRUA 1XBCA 2W5HA 1KE9A 4ENYA 1IA9A 1XWSA 5D7AA 2J51A 2BRMA 3A7GA 2ITXA 3HMNA 3QQKA 5DE2A 4RT7A 3SKCA 3UO4A 4ASDA 4RVKA 3PDTA 4RC4A 1NT2A 3O8UA 2UVYA 4WNOA 4O2PA 4U5JA 4PDSA 3NNUA 4E6DA 2CGWA 5A9UA 3U55A 2YJSA 3H9RA 3KRJA 5CXZA 1UKIA 5HNBA 1L8TA 3PJ1A 3UOLA 3P08A 3OZ6A 5D10A 2PVMA 2YJRA 2AC3A 3R8VA 5CT0A 2J0MB 1DM2A 4O91A 5E7RA 4XP0A 5AFVA 2ITNA 4BRXA 4QTAA 5M44A 4FV5A 4O0SA 3KXNA 2XH5A 4C3FA 2BTRA 3E3PA 3TJDA 4NW5A 1UU8A 2HZNA 3F3TA 4GK4A 3DOGA 4GG7A 1ZOGA 2W1HA 4QMLA 3MA6A 1BYGA 4D1ZA 3MJ2A 5FM2A 3ZBFA 2QC6A 3D0EA 2PVNA 4TNBA 4DEEA 4DEAA 1Q8ZA 4PDPA 4ANNA 5ANIA 4ZTRA 3ROYA 4AE6A 4E73A 3KB7A 4KAOA 4LL0A 3NCZA 3BKBA 3QALE 2QLQA 5KZ0A 4BCGA 3ZZWA 4EJNA 2I7QA 5H9BA 5K5XA 4DEGA 3SW7A 4HNIA 4RVTA 4IDVA 2IPXA 1CDKA 2BAQA 3EHAA 5CVGA 5A4CA 4IVAA 1BI8A 5M08A 2WMWA 4UYAA 4FVRA 2V7OA 4G34A 1ZZLA 4O22A 3MESA 3EQGA 3KK9A 4M15A 2BTSA 2IWIA 1UU9A 2CMWA 3PPKA 1H28A 2C6IA 2BDWA 3T8OA 4QTCA 3KREA 4BHNA 4UEUA 5EKOA 4CQEA 3LCKA 4U40A 2BUJA 3TZ7A 2IW6A 3HDNA 3VBVA 4BI2A 4C3PA 5BYLA 3IQ7A 3POZA 4LRJA 1UVRA 3MVLA 4RG0A 1A06A 2C69A 2QOCA 4DEBA 3FLSA 4CKRA 5J9ZA 2XBAA 4NH1A 2NPQA 5HE0A 2WAJA 4DBXA 4C59A 4HPUE 3EQPA 1O6KA 5IDNA 1H1RA 2A27A 4J52A 4ASEA 4CZUA 3CE3A 4QP9A 4F4PA 4XMOA 3T9IA 4OT6A 3DJ6A 4TY1A 4EI4A 4O7LA 1V0OA 5HO6A 3BYOA 4X2JA 2R3QA 3FY0A 3A8WA 3CKXA 3KQ7A 3TN8A 3COKA 5DNRA 4ERKA 1J7IA 2CNUA 4KS8A 5ANKA 3LKMA 4FF8A 2WFYA 3R0TA 4RIYA 3UDBA 3EIDA 4GL9A 5AUXA 1FINA 1PMEA 3F7WA 4PTEA 3GC8A 4GVAA 4U45A 3R7YA 1Z5MA 3VS5A 4D58A 1YOJA 4O7WA 5EOLA 5EFQA 5IEVA 5EI8A 4FV8A 3TIZA 2E9OA 4FTJA 5HESA 4HZSA 4JIAA 4L68A 2ZB0A 3OW3A 4JRVA 4CTCA 3IKAA 4GIIA 5LOHA 4KKEA 3ERKA 2HZ0A 3QL8A 3UQFA 1Q8WA 3GENA 4XUFA 3PIXA 3KMMA 3B2WA 3NUSA 5CI6A 1PKDA 4LYNA 4O0VA 3VQHA 2WTWA 1JLUE 2XNOA 4RIXA 1FBNA 2R3GA 3AC5A 4F6SA 4QMSA 4ZMFA 1CTPE 2NRUA 2IN6A 3EFKA 3MFTA 4M97A 4V05A 3R8LA 4Y46A 2ZMDA 2FB8A 4NM7A 4E4NA 3FV8A 2LGCA 4NEUA 3NAYA 3G51A 4PL4A 4PUZA 3THBA 1PY5A 1YDRE 3AD5A 4ZTNA 2BKZA 1NXKA 1OKZA 3BX5A 3Q5ZA 4BCPA 4BI1A 3G90X 5AWMA 3II5A 2QG5A 4AA0A 4M12A 4NTTA 4RIYB 5L3AA 5C01A 5KMMA 3OEFX 4AAAA 3P1AA 3ELJA 3KKVA 2C5NA 2VX1A 3LMGA 1UU7A 3PA4A 4HNFA 2I0VA 4W9XA 2IZUA 2VTJA 2PULA 2GNGA 4FE2A 4TL0A 4IJPA 2JFMA 3CCNA 4YO6A 3SC1A 4CQGA 2GFCA 3L9PA 2PE0A 4TTHB 2GFSA 2QOBA 3ZRMA 4BDBA 4CFWA 2BILB 4K2RA 5KKRC 1W7HA 5CF8A 5HOAA 4O2ZA 5K0KA 2V55A 2Y6OA 5EK7A 3FBVA 2GCDA 4XRLA 4DFYA 1U54A 1OIUA 5LVPA 4C4GA 2W96B 3QCQA 5E92A 3DDQA 3OF0A 3R7OA 4EUUA 3Q60A 3QHRA 4RIWB 4RIXB 4DINA 2C5YA 3EMGA 2WTKB 5CU6A 4C35A 1SNXA 2QCSA 5EDQA 2BFXA 5DRBA 3FY2A 4AOTA 1YHWA 3JY0A 4R8QA 1ZZ2A 2GHLA 3A2CA 2VUWA 3UNZA 4YJTA 1YW2A 1P5EA 3HX4A 2VTMA 3L8PA 4IADA 3HV5A 2UW7A 5BNJA 4G17A 2V62A 2C3IB 2JAMA 3BELA 4FIIA 3D7ZA 3VF9A 2IJMA 3ORLA 3NNVA 1OKVA 3VF8A 4RZVA 5HTCA 3P5KA 3KL8A 1OI9A 4TZRA 4ERWA 1FMKA 3EZVA 3FKOA 4FKWA 3N9XA 1RQQA 1K9AA 1A48A 4CLIA 3FI4A 5KE0A 3R2BA 3AGLA 3HMOA 4QMTA 1M17A 3D5XA 1OIRA 3UO6A 1ZOHA 3H0YA 3U6HA 3IDPA 3K54A 4UYNA 4O7TA 3TUBA 4AW0A 4YNOA 4OTGA 4FL2A 4IE9A 1U54B 1MUOA 4RBLA 4BCKA 1FQ1B 2A4LA 5T6KA 5JT2A 1OB3A 4LOOA 2AUHA 4U80A 5JGBA 3MDYA 4PV0A 4JNWA 5AUZA 4DEHA 5FWKK 4UX9A 3IOPA 5BVDA 1W0XC 5A46A 2J7TA 4BYJA 4MXZA 4GYGA 2FA2A 3WYXA 4GW8A 1IA8A 2Y6MA 3QQFA 3TNPC 1DI9A 4ZAUA 5EH0A 4GEOA 4JX3A 1MQBA 4OUCA 2ITVA 1H0WA 3F3ZA 4I24A 5AUYA 5DEYA 3GU7A 2EWAA 2YCFA 5A14A 5AP7A 3NVKI 4FODA 2OIBA 4J7BA 2F7EE 2PUUA 3FC2A 3MPAA 5CNNA 5DG5A 4HVDA 5EW3A 3ULIA 2ZV2A 2RG5A 4E1ZA 4RX5A 3FSKA 5CU2A 4CFFA 4MTAA 5LVOA 3HV6A 2BFYA 4NSTA 5HIDA 5HNGA 3FXZA 4NL0A 1NW1A 3CQEA 4FTCA 3AOXA 4YJSA 3PG1A 2I0HA 4N4SA 1Y8GA 5FDXA 4NWMA 3QTIA 3JS2A 3VHEA 4ENXA 2XM8A 4EONA 3Q6UA 4MH7A 3VBWA 3EKKA 3R1YA 4FL3A 4QMOA 2WMTA 2XK3A 1E1XA 3DAKA 3Q6WA 4O7VA 4L44A 4GFGA 2Q0BA 5GNKA 3SVVA 3VNTA 3SG9A 1CSNA 3R8MA 1J1CA 2R0UA 5LCJA 3CGOA 5IQAA 5HVJA 4CTBA 1GZOA 4D1SA 3RCJA 2VV9A 3OS3A 3TZMA 1OBDA 4NYEA 4I23A 2ETRA 4I5CA 1B6CB 2XKFA 3CXWA 1PXJA 4V01A 5EYMA 2ITZA 2PZ5A 2QVSE 5AJQA 5E1EA 5GZ9A 2R4BA 4BWPA 1EH4A 1GIJA 4RC3A 2OF4A 4FR4A 4R3PA 1YQJA 4ZZNA 2YHVA 1T46A 4L46A 3M2WA 1WVWA 3PWDA 1J91A 2YZAA 3IECA 2VU3A 3NEWA 3DKCA 4L43A 4M69A 1XBAA 4B99A 3SX9A 3PY0A 3RZFA 4XLIA 4DEIA 4FKQA 2VWWA 5DA3A 5DOSA 4HYIA 4AP7A 3BLRA 4G6LA 4QQCA 5KMKA 3TI1A 2OFVA 3R1QA 3W16A 4CSVA 2VO3A 4WG4A 1IG1A 5HVYA 4PNKA 5IH6A 3OY3A 4G3DA 3MWUA 2WMUA 1KOBA 5FTQA 4IHPA 4DA5A 3PTGA 2WMQA 1U59A 1M2QA 5HG5A 3W8QA 5CYIA 2RKUA 4D55A 3GC9A 3UVRA 2C68A 4RQKA 4A7CA 2E2BA 4RJ4A 2OWBA 3AC8A 3NYVA 1QPCA 4LOQA 3W55A 1OL1A 3I81A 3NIEA 4DLIA 2WELA 4I5MA 2JIIA 3DFCB 4BCHA 4AU8A 1S9IA 4HVHA 4KIQA 2HY0A 4F1TA 2CKPA 5LMAA 3REPA 1IAHA 2O0UA 4RWLA 5HU9A 4S2ZA 2Z7RA 4WSQA 4GKHA 3W2OA 3EYGA 2HCKA 4YLLA 4BB4A 2XK4A 3DKOA 4JXFA 2UZEA 2R3JA 2BPMA 3GBZA 4TWCA 4MWHA 4ALUA 5JFVA 1SM2A 4EYJA 4L42A 5HHWA 3PE2A 3QD3A 4IAFA 2VX0A 2QOQA 2Y8OA 4Z9LA 4RZWA 4TKSA 3R63A 5AA9A 2E9NA 2OJ9A 5AUUA 3CPBA 3L9NA 5IG1A 2VTTA 2W1EA 2VX3A 3DTWA 1YDTE 4CCBA 5CSXA 2VTIA 1MP8A 4C4JA 4DH7A 1LUFA 4DFZE 4ARKA 4C62A 3KY2A 3HP2A 4BCIA 1ZY5A 3N4UA 4GU6A 3RTPA 4RQVA 5AR7A 4YZDA 2P3GX 3NW6A 1H0VA 5DEWA 1MRYA 2G9XA 5CANA 5G1XA 2JGZA 3OHTA 4QTBA 2ZYBA 2FSTX 4HYSA 4I6QA 2XK6A 3UJGA 1SYKA 4FG8A 2Y4PA 4EOJA 4Y72A 5J79A 5IA5A 5IH4A 3PXQA 3FKLA 1H1SA 1OPJA 4MNEA 4ACGA 3SLSA 4I4FA 4UY9A 2H9VA 4C3RA 3QTRA 2OJIA 2UW9A 3IW7A 2OJJA 4KSQA 3AT3A 4WNMA 3TNHA 3UP7A 4F08A 3P0MA 3TUCA 3NNWA 3TNQB 5JKGA 3VBXA 1JKTA 2ERZE 4IANA 1J7LA 1W98A 3BBWA 3KEXA 4RFMA 3POOA 4NK9A 4BCFA 2WD1A 4C4HA 2JKQA 2W05A 4QQTA 1AD5A 4FG9A 2GS6A 3QC4A 3PPZA 4M8TA 5IH5A 4X21A 4C33A 3HAMA 2OH4A 5FDPA 3ID6C 4O1PA 4CFNA 3VS1A 3UC4A 4D1XA 2GHGA 3EQDA 2OZAA 5JFWA 3PJ2A 3R2YA 3FL5A 4FVPA 4DITA 5BVFA 4OT5A 5H8GA 1DAWA 2IZRA 4EQUA 4X0MA 1PRYA 5CAPA 2R3KA 4E8AA 4ZY5A 2ESMA 2G1TA 4IX4A 4MNEB 5AR3A 1OZ1A 1PJKA 4IJ9A 1PYXA 2WMVA 3W2CA 4EK8A 5CS6A 5F4NA 3K2LA 4QMQA 4IFGA 2Y4IB 2ZM4A 2I40A 5H8BA 1DAYA 4ZK5A 2PL0A 4L6QA 4YHFA 3BYUA 3VUDA 2XIZA 3HMMA 5LXMA 5KHWA 1ZXEA 5HU3A 2X8EA 3B8QA 3VBQA 5ANDA 4AW2A 4BN1A 2UZUE 2ZDUA 5CEPA 3I5NA 3G33A 5FRIA 4GJ2A 2PZRA 3S00A 3SRVA 3VHKA 5A4LA 2O64A 4FUXA 4AGDA 3OCBA 4L7FA 2ITWA 4KD1A 3GU6A 2EU9A 3GVUA 3MVHA 4AUAA 3FL4A 3ORTA 4M67A 4DEDA 3GP0A 3BHVA 4QRCA 3RVGA 3D7TA 2AYPA 4FTRA 4QYHA 3WE8A 4X7QA 3Q53A 4AOIA 3A7HA 5BYZA 5FEDA 2JDTA 1Y8YA 4KWPA 2OZAB 5HVKA 4FL1A 5EQPA 4OTPA 3WZDA 3UQGA 5GZAA 3HYHA 1XH4A 4KUJA 5CU4A 3VS2A 3R02A 2OH0E 3TIYA 2ONLC 4BGHA 4Z55A 2VRXA 4HYUA 4KKHA 3PPJA 4ASXA 1URCA 2YCSA 3AC4A 4FZ6A 4DLJA 5BUIA 3FMDA 1Q4LA 5AP0A 2W9FB 4G3CA 4GYIA 3LAUA 1YI6A 3TG1A 5JSMA 2KULA 4K11A 3BZ3A 4AE9A 1JOWB 4A4OA 2FO0A 1XQZA 2R3OA 3GNIB 4AN2A 3DJ7A 4EOKA 3BCEA 1STCE 4KBAA 4BGQA 5CAOA 5IUHA 3EB0A 3RKBA 5JN2A 3FKNA 5HIEA 1ATPE 2J6MA 3MV5A 5DR2A 2W4JA 1OIQA 4UALA 4AGCA 2R5TA 4MBIA 4C2WA 3N4TA 3HVCA 5ANOA 4YTCA 3P7BA 1IAJA 4D2PA 4E6CA 4C4FA 3LIJA 3SRVB 3O51A 1K3AA 3O7LB 3PY3A 3CIKA 5M4UA 4FNXA 4DAWA 3QC9A 4A9TA 1JSTA 3H30A 1R1WA 5L6PA 4OBOA 3ZUVA 4G6OA 4IC8A 4FG7A 4E4LA 4ZTHA 3UE4A 4N57A 1KE7A 2OIDA 3OMVA 1WMKA 3TNIA 2X8DA 1FOTA 2W5BA 4BCQA 4EC8A 4DE4A 5DR9A 3RK7A 4PP7A 3QTUA 3CPCA 2VWYA 3V5TA 4FEWA 1J1BA 4GG5A 2XBJA 5AMNA 1PXKA 2YEXA 1OUKA 2O5KA 4BDIA 4IX5A 3TWJA 4AZVA 2CN8A 4KIKB 4M84A 3VQUA 2YAAA 3QU0A 1WBNA 5GJDA 1JKKA 2CN5A 2HWOA 3PG3A 1HCKA 4J97A 5B2MA 4GJ3A 1AGWA 5AP5A 4YC8A 3W32A 1PXNA 3LFAA 5CSPA 3CS9A 1Q8UA 2VTAA 4NZWB 2GU8A 4EOPA 2WU6A 1KSWA 1REKA 3MYGA 3Q5IA 3QTSA 5A3XA 4D4VA 4BBEA 4IZAA 4FKVA 1BL7A 4MAOA 4G3FA 3F61A 3R8PA 3QBNA 2YLEA 3C0IA 2OU7A 1UNGA 2IVVA 3E5AA 3QQGA 5AX9A 2X7FA 3WZEA 5JMSA 3AGMA 3WZUA 4ZXTA 4EOOA 2XF0A 3ORZA 3QYZA 2PK9A 4QT1A 2J90A 3I0OA 4R3CA 3HRCA 1DI8A 4AQCA 1YOMA 2W1DA 2ZMCA 3IONA 4EOLA 4X2GA 2C0IA 5GIOE 2JKKA 2WQBA 3I6WA 3VJNA 2UZVA 4MQ1A 3S4QA 4XV2A 1WBPA 5I4NA 4X3FC 4FSRA 2XCKA 3K5UA 3BWFA 3Q3BA 2CLXA 2GQGA 2X1NA 4U79A 1WBWA 3C1XA 4FSYA 3L8SA 3ZYAA 2VO0A 3P4KA 4RA4A 4FSUA 4EORA 4CKIA 3ACKA 3AMBA 3FZRA 3UNJA 3DBEA 3RPSA 3LFNA 4EOIA 5KZIA 3CBLA 3U87A 4UXLA 2ETMA 5JH6A 3MBLA 3ZFXA 4FSQA 5H8EA 1T45A 5KMIA 2NNWB 5AIRA 3MH0A 3F9NA 4ZIMA 2XNGA 5CNOA 5AV2A 1H1WA 2NP8A 2YIYA 4IBMA 4DGMA 1H00A 3BQCA 3KULA 4FZ7A 5HTIA 5HE3A 1ZOEA 3TL8A 2JBOA 5J9LA 5CLPA 3LXPA 3PVUA 1Q24A 4G16A 5E1SA 5D41A 1XH7A 3FC1X 4CFUA 3NVMB 3VO3A 3DGKA 4R6VA 4C7TA 5HICA 4DFBA 1Q3WA 3AG9A 5DMZA 3D4QA 4BDDA 2OKRA 4R77A 4FNZA 4IH8A 5J1WA 4K0YA 5IA3A 1KE8A 2QOHA 5T68A 3S3IA 2VTQA 5C1QB 3O2MA 2ZVAA 3GOKA 4IM2A 5FXSA 5KX8A 1YOLA 2XCHA 2GS2A 3MIAA 3R9NA 4USEA 3AC2A 4CT1A 2QKWB 3E92A 2VTOA 4FK3A 3KVXA 2I0EA 4FOBA 4HGSA 2JKMA 4Y8DA 5AAFA 3DAJA 3BYMA 3JVSA 4I22A 4F9BA 5DVRA 2CGUA 4YMJA 2BRNA 4RGJA 4UB7A 4ACDA 2JDRA 4ANOA 2OXDA 2VNYA 4PMSA 4AZFA 1XH5A 3DK7A 3KMUA 4JG7A 5HBHA 3KULB 4DT8A 5EKNA 3PP0A 3I4BA 2G2HA 4CKJA 3QLGA 1QCFA 2QOLA 1CKJA 3DBQA 2O63A 2UZDA 3BU6A 3CJFA 3QD4A 4KBKA 2ITQA 4C2VA 2EXEA 2NO3A 3I6UA 4FSNA 4J1RA 2E9UA 4E6AA 1JPAA 2XA4A 3Q04A 4W9WA 3AC3A 3HZTA 4IZ5A 5EW9A 2GPHA 2B9FA 3D5UA 4N70A 3BGPA 4I6FA 4OTWA 2YDIA 3IDCA 4FKSA 5EOBA 4DH3A 3NW5A 4RVMA 3BHTA 4J8NA 4TPTA 3UMXA 4AZTA 3OXZA 2AC5A 3IW5A 3COHA 4O6LA 4XYFA 5IISA 5FGKA 1G3NA 5HGIA 3BV3A 3GXLA 4USDA 5E8XA 2XYNA 3CQWA 1YWNA 2YN8A 3PRIA 4IWOA 4M0ZA 4IQ6A 4AW1A 4FEVA 2X2LA 4FKRA 4JRNA 4U3ZA 3PXFA 1K2PA 3NUYA 4V0GA 3KK8A 4KKGA 3F5GA 3RM7A 3ANRA 3F2AA 4XG3A 4QP3A 1JNKA 3MVJA 2BIYA 3RNYA 4OTHA 4H3PA 4ZS0A 4FKOA 5IQCA 3C4EA 4XJ0A 3S95A 4ANQA 5JFXA 2HENA 2JDSA 3AC1A 3ZSHA 3DU8A 4I20A 2EB3A 3VUHA 3BGZA 3M1SA 4BDEA 3OUKA 2BRGA 3FZOA 2C6OA 3Q96A 4D2RA 4Y5QA 2DUVA 4AW5A 2QOFA 4EH3A 1M7NA 5EM6A 3WF6A 4EHVA 3BEGA 4QMPA 4QYGA 1YXXA 4JIKA 5TF9A 2QG7A 3LJ2A 4O86A 3BLQA 3I5ZA 3TT0A 4E20A 1IEPA 3ZUTA 4EC9A 4U8ZA 5IUIA 5ITAA 1YXUA 3TDWA 5J5SA 3ROCA 3O8PA 4GK2A 3DBFA 2J9MA 3EN9A 3MA3A 4AT3A 1UKHA 5ICPA 5K9IA 3KRWA 4O84A 1MRUA 3MH1A 5FEEA 4F7SA 2CNVA 1W84A 3V6SA 2ZM3A 4R7BA 2XNEA 1W8CA 3OEZA 2Y0AA 1U46A 3PZEA 3C4ZA 3CSVA 4YBKA 3DA6A 4R78A 3CY2A 3VUTA 3QYWA 2WOUA 4OLIA 3VAPA 2QURA 1LR4A 4V0GB 5CSHA 5KMOA 2WQMA 5FBOA 3GCPA 3W2SA 2VWBA 3Q52A 2VWUA 5CEIA 4O0TA 4WUAA 4BFMA 1RE8A 3V5PA 3VN9A 3GQIA 4F7JA 1ND4A 3BV2A 2YERA 1JSUA 2GNLA 5AV0A 3LFDA 2J5EA 5I9UA 3RPVA 4AGWA 4C57A 1G5SA 4EH9A 4UN0C 4AA5A 4ZTMA 2B52A 5J7BA 5IF1A 5FTOA 3ZONA 2CGVA 3RPRA 5CVFA 2OSCA 3ZLWA 2GNHA 2RIOA 4OR5A 4O7NA 3V04A 3A7IA 3VWAA 3BI6A 2OGVA 3L1SA 3ZU7A 3F2RA 4OBQA 3EKNA 3WF8A 2GHMA 4B7TA 2Z02A 4L45A 4D5HA 5LCKA 2JDOA 2X4FA 4M7IA 3DZQA 1O9UA 4EH5A 4KIOA 5BX0A 3ZSGA 5AR4A 4TN6A 2QHMA 4D28A 1H8FA 5J95A 3JXWA 4YC3A 3QTZA 5KBRA 2UUEA 2C1AA 4BC6A 3AXWA 3QLFA 1ZYCA 4K18A 1V0BA 3MN3A 3MTFA 4TYIA 3PXRA 2QNJA 2VWIA 4DN5A 3F7ZA 2PPQA 2XEYA 4YO4A 4KABA 2J5FA 4BKYA 5B2LA 3UP2A 2JIVA 3PY1A 2PHKA 2W1ZA 3FXXA 3NYNA 4D9UA 3P23A 4HVSA 4ZSJA 4JQEA 3V6RA 4CVAA 4OAVB 3RBWA 4HCTA 2ZV8A 4Y5HA 5IQHA 4YHJA 1YDSE 2BAKA 3IK3A 2PY3A 3G2FA 2QO7A 4RLKA 4NKAA 4AZWA 4MXCA 3FYJX 5FUTA 3FPMA 4FICA 2CLQA 2OW3A 1PF8A 3EQRA 4Z16A 3EFWA 3GCSA 3D14A 4FTQA 3MFUA 2C3JA 5K5NA 1Q97A 3ZHPC 1P4OA 3G0FA 2BRHA 3LCSA 3ZFYA 2C30A 1QMZA 4JDIA 3P78A 3UNKA 3IG7A 1XH8A 3NGAA 4CCUA 4QP1A 3FXWA 1KV2A 5BUEA 3AMYA 3G5DA 3KCKA 2W1GA 3UOHA 2J50A 3M42A 3A8XA 3QRJA 3O71A 5FM3A 4FKUA 1ZMVA 2WGJA 3SXFA 3OP5A 3HLLA 4CYJA 1BUHA 2YIWA 4CRSA 3LLAA 5AR8A 3KXZA 4DFXE 5I9YA 1OKYA 3OWLA 3TKHA 3U8WA 3V5JA 2VWVA 5I3OA 4TYJA 3NMUF 3ZEPA 3LMHA 4YTFA 1V0PA 3FLWA 4CLJA 3E93A 2JLDA 3KF4A 5CVHA 2GTNA 4O7SA 2UZWE 1I09A 1H4LA 4GV1A 4NUSA 5L6WL 4OAUC 5EYKA 3FHIA 3T3UA 2P33A 1RW8A 3ATSA 2PVLA 3AT2A 2JBPA 5IQBA 2B1PA 3MY5A 3KXGA 5ETFA 4GKIA 4AZSA 4FT7A 4I0SA 4O7ZA 1JKSA 3LCOA 4FTMA 4A9RA 1P14A 4UZHA 3RM6A 5JK3A 3LQ5A 4UMQA 1PXOA 3VJOA 4FV0A 3KRLA 4AFJA 2YABA 4HCVA 5LVMA 4QYYA 2OO8X 4ITHA 3R7EA 2OBJA 4II5A 3A4PA 1ERKA 1VJYA 4YZMA 4ZSEA 3TDVA 2PUPA 4RC2A 4R7HA 1LP4A 4L3JA 5A54A 4JQ8A 4O0YA 4RLLA 3R83A 3QRIA 4GMYA 4XEYA 1IRKA 2C5XA 3BEAA 3MB7A 1KUTA 2GQSA 3GC7A 5CU3A 3FMLA 4F9YA 5GJGA 3MSSA 1PXLA 2JFLA 2XRWA 3U6JA 2R3LA 3CTHA 5E8UA 4D2TA 2UVXA 2ZV7A 4CV8A 2RFNA 4ZJIA 4IWQA 4IVCA 3Q9ZA 3UOJA 3R04A 4QP7A 4DG0E 4UMRA 1Q3DA 5E4HA 4DG2E 3D9VA 1O6YA 4QMWA 2BALA 4R5YA 4FT0A 4G1WA 2C47A 3F66A 5IMEA 4EUTA 4Q9SA 4D0WA 2C6EA 4I92A 2B55A 4DC2A 4C34A 5L2WA 2PVRA 1U5QA 3D15A 3DLSA 4D9TA 2B7AA 3KN5A 5FXRA 3QGYA 4MKCA 5FP5A 2WQOA 4O7YA 5T3QA 3L9LA 5FG8A 3C5UA 4JX7A 1TVOA 4DH1A 4IZ7A 3U54A 2W99B 3D2IA 1R3CA 3ORNA 4NM3A 4WRGA 4EH8A 1XHAA 1PMNA 1ZLTA 3PVGA 4BBMA 4FNWA 4U0IA 1PYEA 4WNKA 3EQFA 4JR7A 2C3KA 5HCXA 3DKFA 4FEQA 2QOOA 2XUUA 4NW6A 5DGZA 2OLCA 4TW9A 4RX8A 3PFQA 4F6WA 2PUIA 4QQ5A 5D11A 3SG8A 3TJCA 3FZSA 5KBQA 3RZBA 3TACA 3N4VA 4TNDA 4BCJA 4CG9A 4O96A 2SRCA 3FZ1A 3NRMA 3PYYA 3EL8A 3I0QA 4EH2A 3N51A 5HBJA 4QPSA 4LGHA 2FVDA 5DH3A 1IASA 1B39A 5HG8A 4E5AX 3ET7A 4MQ2A 3S1HA 4MWIA 3OTUA 4Z7GA 4R3RA 3FMJA 1TQIA 2FSMX 2OI4X 3R73A 3UYSA 5I9VA 5ANJA 4YSJA 4JBQA 4IMYA 3R71A 2OFUA 2ONLA 1XH9A 5ACKA 3U9CA 1UWJA 2GSFA 4FEUA 3MB6A 3C13A 3H4JA 4WA9A 4BCNA 2YIQA 5M09A 4QD6A 4PMPA 3FZPA 3I1AA 3CKWA 4P7EA 2OICA 3A61A 1GAGA 5L2QA 5KMJA 1XKKA 3FE3A 4E5WA 3R21A 3AD6A 2EXMA 2ITUA 4ANMA 4BCOA 2V5QA 4IB5A 4FTKA 4BCMA 1OL2A 2Z7SA 5EHOA 3I60A 1YRPA 1BX6A 2XIRA 4ACMA 2WXVA 3COMA 2GNJA 3HV3A 3JPVA 3NZ0A 4EHZA 4JLCA 3Q9XA 4EWHA 3GFWA 3HMPA 5LWMA 4QMNA 4FGRA 4PY1A 4H1MA 3WOWA 4EK5A 1OGUA 2PZYA 2X0GA 3EN4A 1ZYJA 2C0OA 4D2WA 4FV3A 2HELA 4ONAA 5CY3A 4BKJA 1H1QA 3FMNA 4K77A 2P2HA 3PWYA 4JAJA 2O65A 4DTKA 2WTKC 4ANBA 2QD9A 2ITOA 3BWJA 3PZHA 2CKEA 1J3HA 2UW8A 4R1YA 3UG2A 4F09A 4IB3A 4W8DA 3ALOA 4IM3A 5ANGA 2J4ZA 1GZ8A 4A07A 5K4IA 3R28A 5DWRA 3OW4A 4FT9A 4ZJJA 4FKJA 4M69B 3UQCA 2FSOX 2PVJA 3ZOSA 2B53A 3VUGA 5C26A 1UV5A 2OXYA 3KMWA 4BIDA 3RALA 3WZKA 5TOZA 1NVRA 3HKOA 4H36A 4HPTE 1GZNA 4XBRA 5ACBC 1PMVA 3FI2A 5HLPA 3E64A 5A4TA 2XIKA 4O1OA 3R7GA 4NCTC 3V8TA 4MXOA 4ZSLA 4FKPA 3PXYA 5EHYA 5TE0A 1KOAA 3G15A 1ZMUA 3ZSIA 1M2PA 3F82A 4C4EA 5LVLA 3D94A 4PDOA 4ZEGA 3DAEA 3QCYA 3HRBA 3ZDIA 1YWVA 4GVJA 3UC3A 3E8EA 4BKZA 3VS4A 2FGIA 3HA6A 3PUPA 1QL6A 4E4MA 4AA4A 2PTKA 2ZOQA 4M0YA 5IZFA 3P9JA 2EXCX 4FBXA 3BYVA 3Q32A 5CSWA 3UOKA 2X6DA 3LJ1A 3ORPA 2WTCA 5BPYA 3MIYA 3F6XA 4LUDA 5EW8A 4K9YA 3RCDA 4NFNA 4F1MA 2UW0A 4MBJA 3GQLA 4GK3A 3WE4A 4NFMA 3KCFA 2PMOX 4I3ZA 4BTKA 3OXIA 1LEZA 4LQMA 5IQFA 3HMIA 4BIEA 2UZTA 4P2KA 4DCAA 2HW6A 3R7UA 5DYJA 5HE2A 4UMUA 5AP1A 5ANEA 3ZRLA 1VYWA 4BWKA 1XO2B 4G9CA 2YAKA 4RFYA 3ANQA 3TKIA 4IB0A 3VUKA 4FTIA 3QGWA 3C4XA 3WILA 4YURA 3U51A 3LJ0A 2XNBA 3LXNA 3AD4A 3TCPA 4WSYA 3K3IA 3A7JA 2WB8A 3QUEA 1R39A 4LV8A 4D5KA 3QD0A 4YHTA 3D5WA 1CM8A 2W7XA 3LPBA 3R1NA 4IZYA 5BVKA 3PIZA 5IQEA 4M3QA 1YKRA 3SA0A 2FYSA 1CKPA 4QPAA 4S31A 5B0XA 3TV4A 2ZJWA 2R3RA 3F3VA 5CU0A 3AMAA 3FLYA 2XP2A 3RK5A 2HY81 2Y9QA 3CGFA 3H3CA 4C61A 4N0SA 4WUNA 3TZ8A 2C5VA 3EN5A 4XV9A 4XP2A 1ZAOA 4XS2A 4OW8A 3QWJA 1GIHA 3TM0A 3OOMA 2PMNX 2B0QA 4J99A 2ZAZA 4CV9A 4B8LA 4HCUA 5IA0A 4NJ3A 4XP3A 3ORXA 2YM6A 3R8UA 4KS7A 4F0IA 1Q8YA 4NM5A 2WIPA 3VBYA 3QUPA 5AM7A 3ZO1A 3F5UA 3ZXZA 3NNXA 2Z8CA 1XJDA 3Q4ZA 5HD4A 3RMFA 2C6MA 2H6DA 3TTIA 3C0GA 4E26A 3Q4TA 4J95A 4GH2A 2PWLA 3OCTA 4TT7A 4EYMA 5LJJA 2QR8A 2I1MA 4AN9A 2R64A 5IKWA 4YZ9A 3RP9A 1QPDA 5AEPA 5L8LA 4G3EA 3QTWA 2P4IA 2XJ2A 3DPKA 5M4IA 3WZJA 5CI7A 4PWNA 3P7CA 1GIIA 2GS7A 5DT3A 3PE1A 5F94A 3PA3A 5AX3A 2NRYA 4DGGA 3RAWA 2R3FA 2XEZA 1H08A 4LMNA 3TKUA 2E9PA 4LMUA 3S2PA 3BGQA 3UGCA 1W83A 4BDJA 2HYYA 5HNIX 4L9IA 4QMZA 1YI4A 3SQQA 3JYAA 3QAME 4YLKA 4B9DA 5A6OA 4WG5A 3W18A 4FTUA 4MD7E 4QOXA 4QP4A 4AXAA 3NYXA 5ETAA 3LXKA 4FKTA 3EH9A 2H8HA 3H9OA 3LCTA 5CEKA 2XZSA 1NVSA 1I44A 3NCGA 4F7NA 3G0EA 3RHKA 3TEIA 4G6NA 1VZOA 4IX6A 4XHKB 5L6OA 3R6XA 4IFCA 3KRRA 1H1PA 4IM0A 3O7LD 2X9FA 4PX6A 4DTAA 4BTMA 3DDPA 3ALNA 4C4IA 4TYEA 3I7BA 3P7AA 5L4QA 2Z7QA 4DHFA 4O0RA 3QZHA 2BAJA 2PVKA 3PA5A 3O8TA 2VGOA 4I41A 4EEVA 3D7TB 3EQIA 5E9EA 2ZDTA 2A1AB 3C4FA 5CAVA 5CAUA 4M13A 1BKXA 1GY3A 3OBGA 3SGCA 3UZTA 3CR0A 3BU5A 4FSMA 4Y73A 1OL7A 5BUJA 4RMZA 2XNMA 5M07A 4WRSA 3SOCA 4P5ZA 5C03A 1MRVA 4KBCA 2RF9A 4JJRA 3V8WA 4AG8A 4CNHA 5KMLA 3L8VA 4G9RA 3HDMA 1ZYLA 5IEYA 3UZPA 2YIRA 2DYLA 4IAAA 3CD8A 4V04A 3MGYA 3QZGA 3OXTA 2QONA 3BHHA 5HLNA 1IR3A 2B9JA 1CMKE 2GNFA 4FV6A 3FPQA 3ORMA 4UMPA 5D9HA 2CCHA 4KA3A 5HCYA 4L7SA 1PMUA 5HG7A 5A4QA 3NWWA 3HECA 5FBNC 4TWOA 1GZKA 3ZMMA 2G2IA 3MW1A 3UVPA 3OT8A 5A4EA 4FOCA 4Y83A 3BLHA 3EQCA 2XIYA 3QZIA 3ODZX 5HG9A 4CXAA 3BE9A 3ZZEA 1FGKA 1UNLA 2YM7A 2E9VA 1OL6A 5EG3A 3GU4A 3I79A 3LQ8A 4Z3VA 3ZC6A 3EYHA 4X3JA 4KRCA 4YTIA 3E8DA 2C3LA 4EZ3A 2IG7A 4LOPA 4AS0A 4OTQA 4RVLA 4BWXA 3A7FA 3QFVA 2ETKA 4JT3A 4D0XA 4FV1A 5AP2A 4BZDA 1OITA 4PRJA 3RWPA 1BL6A 2WHBA 4C36A 5L2IA 4IW0A 3O23A 4DFNA 4ZS4A 1YXSA 4DG3E 1JQHA 3OWJA 2PVFA 4I6BA 4MX9A 4FV7A 5IA2A
chains in the Genus database with same CATH superfamily
3FMMA 1LPUA 3R30A 3MTLA 3BU3A 3C51A 3R7IA 4A9YA 4QPMA 4YZNA 5GIPE 3PXZA 2UW4A 4NJDA 4BDGA 4LG4A 4GFMA 4O21A 4RIOA 5G6VA 4FZDB 4JBOA 4YZBA 3HA8A 4HVGA 1PHKA 1APME 4AACA 2Y4IC 1X8BA 4FC0A 3SXRA 4X2NA 5JZJA 2OK1A 3EN7A 2VD5A 4H58A 3ZBXA 2PUNA 2RFSA 2YA9A 3QXPA 2J2IB 4JDHA 5ETCA 5M55A 4CMOA 3HL7A 3DZOA 4S34A 2OJFE 5E91A 4HOKA 3PJ8A 3HV7A 5DPVA 3HRFA 2BZJA 5I9XA 3UIBA 5HI2A 1Q61A 3DTCA 3OTVA 3IW4A 3FSFA 3QKKA 3ULZA 4YR8A 2BZKB 2XNNA 3ZTXA 4BY9E 2RG6A 4NIFA 4QP2A 1M14A 3VC4A 5IQIA 3NR9A 4FTNA 3DK3A 2BZIB 3OD6X 1Y91A 4R5SA 3V5QA 3ZRKA 4EZ5A 4C37A 3SDJA 4C0TA 4LUEA 4Q2AA 4QP8A 4K6ZA 4AZEA 3QD2B 4I4EA 5LWNA 2HWPA 3CY3A 4MYGA 3FDNA 3H0ZA 1NVQA 4CG8A 2CJMA 2Z7LA 3Q9WA 4K8AA 2X7OA 4FYOA 2WU7A 4EKLA 4WG3A 3PIYA 2QU6A 4FIJA 3DB6A 3CD3A 3IW6A 5J8IA 1BMKA 2YDKA 2CNQA 4YZCA 3ZCLA 3MY0A 4OTIA 5IEXA 3E63A 4MBLA 4P90A 2OG8A 4YPDA 5E8SA 2QODA 2B9HA 4GFOA 2G2FA 3V3VA 4R7IA 4ZLYA 5I9ZA 3MVMA 2J0JA 4IAZA 5C4LA 4YJRA 4PL5A 3PJCA 3UPZA 3BQRA 3DCVA 3E8CA 3FQEA 4IX3A 2VN9A 5ETIA 3VIDA 1REJA 1GJOA 3LZBA 2I0YA 3LHJA 3OWPA 3C4WA 4K1BA 4LV5A 3S0OA 5HQ0A 4A9SA 5M06A 4PP9A 4ALWA 3TMOA 2XS0A 3EFJA 4NIFB 4M68A 3QHWA 4QMXA 5E90A 3WF5A 1PW2A 2HXQA 2A19B 1QPJA 3LOKA 2WMAA 5DHJA 5HEZA 4DFUA 5F9EA 4UV0A 4FUYA 2QLUA 3GT8A 5KUPA 4F0FA 3TUDA 1PXMA 3SXSA 3T9TA 5DRDA 5GZ8A 5KKRB 2VTHA 3QXOA 4CYIA 2I6LA 3W10A 2VWXA 4IXPA 3QTQA 3QZFA 3RNIA 5BVWA 4HGLA 3FZTA 2EVAA 2IZTA 3ZFMA 5AV3A 3LFQA 5DT4A 4CFVA 3ZS5A 3QTXA 4FI1A 2C4GA 2JAVA 5L8JA 5CALA 4IVBA 1VEBA 2IZSA 2R0IA 3FYKX 4EOMA 1BI7A 3MPTA 5JGDA 3Q2JA 4IB1A 3WF9A 4GIHA 4W4VA 3R7VA 3RAKA 5KNJA 3QRUA 3DXNA 5K4JA 3UVQA 3ZLYA 3VUIA 4H3QA 4RWJA 4KIPA 4RJ5A 5M56A 2X2KA 1ZYDA 1XBBA 4IWDA 4GCJA 3D83A 4FV4A 2FUMA 4DCEA 2RGPA 4QQJA 3T3VA 2P55A 5CSVA 3FWQA 4RJ7A 5CF4A 5K0XA 4TWPA 4KINA 3CEKA 3IGGA 4AFEA 2BMCA 4NKSA 3UDZA 2W17A 5HX6A 2QHNA 3OVVA 3OY1A 2DWBA 4GT3A 4C58A 5IA4A 4I93A 3ZLXA 5IQDA 3P86A 4J96A 4UWCA 4G5JA 5HZNA 4TWNA 5HO7A 1WVYA 3Q9YA 3NYOA 2PVHA 4EH7A 2HZ4A 3C50A 4YTHA 1FMOE 3FMHA 3KGAA 4ZZMA 3HNGA 2YWPA 2WEIA 4F64A 4FVQA 5EQYA 3RWQA 4S30A 4WKQA 4DHJA 3D5VA 3EWHA 4GUEA 4LM5A 4MXXA 2A98A 3QCSA 4RJ3A 4U41A 2PYWA 2W1CA 1UA2A 4BYIA 4HYHA 3DT1A 5CTPA 2WTJA 3O96A 5AR5A 5BVEA 2GTMA 3E88A 3UPXA 2X2MA 4F0GA 5C4KA 4BIBA 2HOGA 2Z60A 4YSMA 4CZTA 3B8RA 5C8KA 3ATTA 3LFEA 2X7GA 3QQUA 3UMWA 2WZJA 5D1JA 1TQPA 3IDBA 4LFIA 5C9CA 3KRXA 5CEQA 3ZH8A 4EHEA 5JFSA 3A60A 4PMTA 3C5IA 3OT3A 1ZRZA 1A9UA 3ENMA 2R3MA 3F3WA 3IOKA 1JKLA 2C1BA 2WMRA 1FVRA 5I5ZA 5I9WA 3UIUA 4G5PA 4F63A 3MH2A 3M11A 5H3QA 2JC6A 1WCCA 2BR1A 3EFLA 2OF2A 4O82A 3LE6A 3NLBA 4UMTA 5AUVA 3SW4A 1W82A 1YHSA 4ZTSA 4XG7A 4I21A 4XH6A 1G8AA 2W9ZB 4YC6A 4QYFA 2UVZA 3Q4UA 3QQHA 5IPJA 1SNUA 3F2NA 4IAKA 2J0LA 4MEDA 3E7VA 4IEBA 4FKLA 3CC6A 5E8TA 4CGAA 1O6LA 5L8KA 1M2RA 3MY1A 4BGGA 5FXQA 2BDJA 4O0UA 3EL7A 3NSZA 4LL5A 4CMTA 3PLSA 4DH8A 4XNEA 1F0QA 2H96A 4WOVA 3BHUA 4YJQA 4DYMA 4A4XA 3SD0A 2PMLX 3BBTB 4YUQA 3MH3A 4BZNA 4JAIA 2DS1A 4ZSAA 2R3HA 3O50A 1FGIA 5EM5A 2YM4A 5D7VA 4B8MA 5CZHA 3TNWA 2YIXA 3LFSA 2X8IA 4L67A 4WNPA 1OKWA 2CDZA 3PRFA 1UNHA 4RIWA 3NW7A 4GT4A 4E6QA 1SVHA 5HO8A 1YXTA 4ZY6A 3AQVA 3E62A 1Q41A 3SHEA 3KFAA 4YP8A 4NM0A 1E9HA 4LRMA 4YJUA 3U9NA 5AP3A 3VS6A 5L2SA 5LMKC 3HUBA 2UW5A 3RPYA 3ZUUA 5FQDC 5LVNA 4GS6A 5BVOA 1RDQE 3OUNB 2R7IA 2RL5A 4FYNA 1KV1A 3NUXA 3TV6A 4AGUA 2UV2A 3ACJA 3C0HA 2RSVA 3GCQA 3L8XA 2Z2WA 4CD0A 2W4KA 4I5HA 3DXQA 2DQ7X 4BTJA 3PUFC 3JUHA 4TXCA 5EI6A 4FSWA 2QU5A 3HV4A 4BHZA 5C8MA 4H39A 4NCTA 2WKMA 3TZ9A 4EOSA 2QI8A 2PU8A 3CP9A 4Z7HA 3K5VA 4WO5A 2ACXA 2B4SB 3GFEA 5CEMA 3FQSA 1Z9XA 1B38A 4PPAA 4F70A 3QQLA 4APPA 2R3NA 4YGAA 5IA1A 4U97A 4EQMA 2RFEA 1TKIA 4USFA 1U5RA 4O7RA 3L9MA 1JBPE 3V51A 4ZY4A 2UW3A 3WBLA 1PXIA 1RJBA 2R7BA 2WTDA 3KC3A 3OG7A 4FIGA 5CQWA 4WD5A 4YU2A 2OIQA 1KE6A 4MUQA 2XK7A 3C7QA 3ORIA 1LEWA 4GRBA 1OPKA 5AM6A 4DFLA 2FSLX 4X6RA 3R00A 4R1VA 4BDAA 4TYGA 4O6EA 2HK5A 4KRDA 5TKDA 2YITA 2YM3A 4UXQA 5FD2A 3WIGA 2C5OA 2HW7A 4C8BA 3RAHA 5IUGA 4HVIA 3NUNA 3LXLA 2F4JA 2X39A 5CASA 1V1KA 4K33A 4OTFA 1SVEA 4EH4A 4DT9A 1UU3A 2QQ7A 2ZB1A 3R9OA 3FMEA 3BIZA 4L3PA 2BHEA 2O2UA 4LRKA 1E1VA 2XKEA 3U6IA 4AT4A 4YBJA 4ID7A 4W4YA 4EK6A 4FIFA 4OTRA 4ZSGA 3PVBA 4ACHA 3GEQA 1S9JA 4FEXA 1TQMA 5FP6A 3WI6A 4QYEA 4P5QA 4YLJA 4F9CA 3B2TA 4MHAA 3K3JA 1WVXA 4AWIA 3ZO3A 5AV4A 3A62A 5BYYA 5BMMA 3FHRA 2QO2A 1XR1A 3HEGA 3ENHA 4LGGA 4H05A 1P4FA 2PSQA 4IAYA 4JDKA 4JI9A 5H2UA 2ITTA 4XOZA 2XKDA 4L01A 2YZLA 5CXHA 2V7AA 1P2AA 4B0GA 2P2IA 4A9UA 4QMYA 4ZLOA 4XG2A 4QP6A 3QA0A 1OL5A 1JWHA 3OBJA 5M53A 3DS6A 4X6QC 3LFFA 4XLVA 4XRJA 3CQUA 3FQHA 4I0RA 3W2QA 2HZIA 4FX3A 4G31A 4RJ6A 4AOJA 3AT4A 3FI3A 3IO7A 4UBAA 1JAMA 3BPRA 3V8SA 2F9GA 2YM8A 5GHVA 3EOCA 4PL3A 3G6GA 3KU2A 2F2UA 2XJ1A 3O0GA 3OWKA 3R8ZA 3VRZA 5AP6A 3ZC5A 3O17A 3ZM4A 4S32A 3LFCA 5KHXA 4YJVA 5AA8A 3VS0A 3E3BX 3E7OA 5M57A 4MD8E 3FI8A 1H07A 2O8YA 3FMKA 2GNIA 1Q99A 2BROA 3R9HA 5AR2A 3JY9A 3LMIA 2WO6A 4DHIB 2UZOA 2O3PA 5EDRA 2ITYA 5CF6A 2VNWA 3LFBA 2CKQA 4O81A 1OPLA 2XM9A 3ITZA 1J7UA 4JG8A 2WMBA 1UWHA 2C6LA 5D12A 3ODYX 4BDCA 3G9LX 4GUBA 2F7ZE 3QKLA 2UZNA 3VUMA 2JITA 4FTAA 4ASZA 4BDKA 3NAXA 2WMXA 4L52A 4MD9E 1L3RE 4JQ7A 5FEQA 1WBTA 3UTOA 2PE2A 4U81A 4XBUA 4I94A 2GMXA 2XNPA 4QDEA 2YISA 3PSCA 5AV1A 4BICA 4F9AA 5CQUA 4ZMEA 3MFRA 4BDFA 4U7ZA 3BRBA 4AX8A 5FLFA 4QNAA 5LMBA 1F5QA 4XCUA 3LVPA 4L53A 4AT5A 2WTVA 3KXMA 1YI3A 4QTDA 4MK0A 5CENA 4CZYB 5AAEA 2IW9A 4EJ7A 3DQXA 3QRKA 2EUFB 5IMXA 2YACA 1H24A 3NPCA 4PNIA 1PXPA 3RGFA 5J87A 3UO5A 2VTSA 4F65A 4GU9A 3RHXA 4O0WA 5A6NA 2R9SA 3FJQE 4IDTA 3IPHA 3DFAA 4ITIA 4MCVA 4RX7A 1H27A 3H9FA 3FLZA 3I7CA 5DN3A 3BHYA 3PP1A 5B2KA 4G3GA 4QMUA 4RRVA 3RAIA 3RK9A 4W4XA 5EM7A 5C27A 3BL7A 1MQ4A 5E8WA 3KXXA 3F5XA 3UDTA 3DBCA 2WPAA 2R3IA 3PSDA 3LLTA 4X2KA 3SOAA 4D4SA 4LI5A 3F69A 3QRTA 4S33A 2J0IA 3OFMA 4EHGA 5HIBA 3Q2MA 5CX9A 4EQCA 4QMVA 4JMQA 5BVNA 2W1FA 4WHZA 5L2TA 4IAIA 1VR2A 1QPEA 1ZYSA 4J53A 5DT0A 5CF5A 4QNYA 4XV1A 4PDYA 2YDJA 4MVFA 5I3RA 4FT3A 4JL9A 4ZLZA 3GI3A 2XYUA 5BQ0A 3EJ1A 2X4ZA 3IGOA 3KXHA 4B4LA 1R0PA 4EBVA 2XMYA 2GQRA 2KTYA 4I1ZA 4F99A 2ZV9A 4RWKA 4ACCA 5C8NA 5GJFA 1FPUA 4KB8A 3R9DA 3QF9A 3RPOA 4XG9A 2CCIA 3HP5A 4FGBA 2G15A 3OOGA 1ZY4A 1NA7A 2CPKE 2WOTA 3MS9A 1Y6BA 4HGEA 4IC7A 5JZNA 4AXEA 3WIKA 3ZM9A 3DKGA 3GGFA 3VW6A 4APCA 1HCLA 4RA5A 2OZOA 4JOAA 5BMSA 4I0TA 3BE2A 4OTDA 1Y57A 2CSNA 2XK9A 3UYTA 2VTPA 4O83A 3PSBA 4ZP5A 3R1SA 5HD7A 2PMIA 1G8KA 5IQGA 2IVTA 4GSBA 4DTBA 4X3FA 3KF7A 2F7XE 3EZRA 3QCXA 2BDFA 2QO9A 3UG1A 3VS7A 4DF3A 3NX8A 4XX9A 2JEDA 4XOYA 4MF0A 1F3MC 5HBEA 3RINA 4FSZA 2BIKB 5F1ZA 3PVWA 5AUWA 4BDHA 5LARA 5CT7A 3W0RA 2REIA 1CKIA 3E87A 4L00A 3NIZA 3DBDA 1ZMWA 4OGRA 2IW8A 1Q62A 2UZLA 5M4FA 4FA2A 4YJOA 4MXYA 4XV3A 4MF1A 4FSTA 4M14A 4IWPA 4ANSA 5J5TA 5LQFA 3NUAA 5FTGA 5DI1A 3LCDA 5AUTA 5F95A 5HORA 3TV7A 3EQBA 4HZRA 3CJGA 3W2RA 3COIA 3QWKA 4EKKA 1OBGA 2YWVA 3V5LA 3ETAA 1YVJA 2JIUA 2V0DA 4AN3A 4IIRA 1GOLA 3F5PA 3GC0A 2IVSA 2VTNA 2WQNA 3G9NA 3HUCA 3C4CA 5JQ5A 2CGXA 5CWZA 3DXPA 3JR1A 4EBWA 3KVWA 2BVAA 4ITJA 3BYSA 4EWQA 4CFXA 3DY7A 3MFSA 2W4OA 4ALVA 4CMUA 2JD5A 3DK6A 5CZIA 5EYCA 2XK8A 4ORKA 3TYKA 1BLXA 3Q4CA 1OVEA 3GU8A 3MPMA 4FTOA 4YJNA 4F9WA 4D2VA 4HW7A 4O38A 4J8MA 3VULA 4A4LA 5JEBA 2XKCA 4X3FB 4PPBA 5J1VA 1Z57A 2PZPA 2YFXA 3IW8A 3UIMA 4HGTA 2UZBA 2C6KA 2ZFYA 5HTBA 3ORKA 2BHHA 4JBPA 1XH6A 4BVUA 1FVTA 5DBXA 5JQ8A 4PF4A 1KE5A 4FKIA 4EH6A 3VRYA 2Q83A 4RWIA 2VTRA 5AP4A 4QTEA 5KO1A 5HLWA 1ZARA 4ANLA 2VO7A 3DV3A 1OMWA 2CHLA 4G2FA 2PZIA 5I0BA 4J98A 1OIYA 4Q5HA 4NTSA 5B7VA 4FK6A 3A4OX 4E7WA 3DJ5A 1URWA 4U6RA 2XIXA 4O27B 2W1IA 4U9AA 4DBNA 3KA0A 5TT7A 2A2AA 2F57A 3W8LA 4PPCA 3GU5A 4BL1A 5DR6A 4C02A 5EI2A 3JVRA 4JS8A 4Y95A 2VO6A 3ZDUA 5AADA 3RJCA 2IVUA 4Y85A 3FEGA 5AIKA 5J9YA 3GOPA 2Q0NA 3V5WA 4B6LA 3TXOA 2H34A 4CRLA 3OROA 3QA8A 2FH9A 4IACA 4F6UA 2QKRA 5JRSA 4RSSA 4MXAA 5HCZA 3WARA 4E3CA 3W33A 3QKMA 4ZOGA 2XJ0A 2C0TA 1R0EA 4ZJVA 4F1OA 4UWBA 4CFMA 4ZTLA 3GCUA 2YM5A 4LGDA 2BKKA 3D2KA 4OBPA 4L8MA 3GB2A 4JG6A 4QEBA 1VYZA 1WBVA 2F2CB 3VW8A 1OECA 4KIKA 4RX9A 1WBSA 5K3YA 5KCVA 4BBFA 2W5AA 1YHVA 1NY3A 2P0CA 1R78A 4FKGA 4FV2A 4JDJA 3SV0A 3U4WA 2WTIA 4WT6A 2ZM1A 3F3UA 1Q8TA 2X6EA 2XVDA 5EYDA 5DFPA 1WZYA 4E5BA 5TR6A 2C6TA 1FVVA 4GT5A 4QMMA 2ERKA 5HE1A 3R9RA 5E8VA 4XG6A 4CT2A 5HX8A 4BF2A 4YPSA 3W2PA 3PJ3A 3DLZA 4DH5A 1H01A 4EK4A 3CTQA 2VAGA 4FV9A 3C9WA 4NU1A 1ZWSA 4UZDA 3EN6A 2V22A 4PTGA 4NT4A 3ZLSA 4DGNA 5EM8A 5JGAA 4O84A 2UW6A 1JSVA 1YWRA 3ZO2A 3HAVA 3CLYA 5IDPA 3UDSA 3NDMA 4D2SA 1GNGA 2QR7A 2QOIA 3FUPA 5E8ZA 4CEGA 3DNDA 4M66A 2HIWA 4IVDA 5EDPA 5DLSA 3OCGA 3RI1A 4E93A 4ZTQA 1SZMA 2YLFA 4Q5EA 3DNEA 2R2PA 3UZRA 5EQEA 2VTLA 2QOKA 4WBOA 1YXVA 2W0JA 4C38A 4X2FA 4EOQA 4FT5A 4N6ZA 4TRLA 4EZ7A 4KSPA 3GCVA 3VS3A 4F7LA 3GUBA 4ZZOA 4U3YA 2G01A 2F49A 3R22A 4PQNA 4MNFA 5F20A 4BI0A 5GINE 3OC1A 4TYHA 1DS5A 3TTJA 1H25A 2BCJA 4O0XA 3NS9A 2CKOA 4E4XA 2HAKA 1PKGA 3KN6A 3P79A 1Y6AA 4A06A 1M7QA 2YCRA 1OUYA 4FTLA 2VGPA 2J0KA 4H1JA 2OXXA 4JBVA 4FMQA 3ZEWA 3H10A 5IU2A 2JKOA 2BRBA 4FIHA 4PTCA 4I6HA 5EHLA 4EL9A 4U42A 4DGLC 4HJOA 5JRQA 1U4DA 2IO6A 2PE1A 1G8SA 3VVHA 3NUUA 3MJ1A 1SVGA 1HOWA 4BR3A 2X9EA 1WAKA 3G6HA 1AQ1A 4RFZA 3OCSA 4FZAB 3QX2A 4I5PA 3V01A 4D4RA 5CEOA 4FTTA 4FZFB 5KMNA 3LM5A 4DGOA 4YNEA 4N6YA 4U44A 2WQEA 3A99A 2VWZA 3CTJA 1H26A 2WMSA 3DB8A 3MI9A 3HGKA 3QQJA 4BTFA 4EK3A 5CAQA 4U43A 2PVYA 3QX4A 4RJ8A 3PLAE 5J7HA 5LMKA 2ITPA 1KWPA 2BZHB 4J71A 4TYHB 4UWYA 2W06A 2X81A 4H3BA 3EQHA 4YJPA 3PXKA 3ZO4A 5TO8A 2Y7JA 3WYYA 3F88A 2XAOA 3FLNC 3SAYA 3E8NA 4AQKA 2WEVA 1Q5KA 4BZOA 1M52A 4JR3A 2R3PA 1SMHA 2RFDA 3UIXA 3ZXTA 2B9IA 3W1FA 5AAGA 2A0CX 3NFFB 4W8EA 3IS5A 3UBDA 2VZ6A 2HXLA 2WIHA 5M51A 4AF3A 3LQ3A 4PMMA 4WBBB 3UODA 3FLQA 5DIAA 4XG4A 5M4CA 2LAVA 3LM0A 4FNYA 4QO9A 3U4UA 2JDVA 2B54A 4L3LA 3QUDA 4W4WA 2WNTA 1WBOA 4P4CA 3LW0A 3NUPA 5E8YA 2C6DA 1W2FA 2YCQA 4JVGA 4RPVA 2GDOA 1OM1A 1JVPP 3VBTA 3WF7A 4D4YA 2XB7A 2OJGA 3FAAA 4KNBA 3R01A 4FIEA 4WIHA 5HKMA 4XG8A 4Q9ZA 2EB2A 3DQWA 1WFCA 2XRUA 1XBCA 2W5HA 1KE9A 4ENYA 1IA9A 1XWSA 5D7AA 2J51A 2BRMA 3A7GA 2ITXA 3HMNA 3QQKA 5DE2A 4RT7A 3SKCA 3UO4A 4ASDA 4RVKA 3PDTA 4RC4A 1NT2A 3O8UA 2UVYA 4WNOA 4O2PA 4U5JA 4PDSA 3NNUA 4E6DA 2CGWA 5A9UA 3U55A 2YJSA 3H9RA 3KRJA 5CXZA 1UKIA 5HNBA 1L8TA 3PJ1A 3UOLA 3P08A 3OZ6A 5D10A 2PVMA 2YJRA 2AC3A 3R8VA 5CT0A 2J0MB 1DM2A 4O91A 5E7RA 4XP0A 5AFVA 2ITNA 4BRXA 4QTAA 5M44A 4FV5A 4O0SA 3KXNA 2XH5A 4C3FA 2BTRA 3E3PA 3TJDA 4NW5A 1UU8A 2HZNA 3F3TA 4GK4A 3DOGA 4GG7A 1ZOGA 2W1HA 4QMLA 3MA6A 1OGYA 1BYGA 4D1ZA 3MJ2A 5FM2A 3ZBFA 2QC6A 3D0EA 2PVNA 4TNBA 4DEEA 4DEAA 1Q8ZA 4PDPA 4ANNA 5ANIA 4ZTRA 3ROYA 4AE6A 4E73A 3KB7A 4KAOA 4LL0A 3NCZA 3BKBA 3QALE 2QLQA 5KZ0A 4BCGA 3ZZWA 4EJNA 2I7QA 3W0MA 5H9BA 5K5XA 4DEGA 3SW7A 4HNIA 4RVTA 4IDVA 2IPXA 1CDKA 2BAQA 3EHAA 5CVGA 5A4CA 4IVAA 1BI8A 5M08A 2WMWA 4UYAA 4FVRA 2V7OA 4G34A 1ZZLA 4O22A 3MESA 3EQGA 3KK9A 4M15A 2BTSA 2IWIA 1UU9A 2CMWA 3PPKA 2AQXA 1H28A 2C6IA 2BDWA 3T8OA 4QTCA 3KREA 4BHNA 4UEUA 5EKOA 4CQEA 3LCKA 4U40A 2BUJA 3TZ7A 2IW6A 3HDNA 3VBVA 4BI2A 4C3PA 5BYLA 3IQ7A 3POZA 4LRJA 1UVRA 3MVLA 4RG0A 1A06A 2C69A 2QOCA 4DEBA 3FLSA 4CKRA 5J9ZA 2XBAA 4NH1A 2NPQA 5HE0A 2WAJA 4DBXA 4C59A 4HPUE 3EQPA 1O6KA 5IDNA 1H1RA 2A27A 4J52A 4ASEA 4CZUA 3CE3A 4QP9A 4F4PA 4XMOA 3T9IA 4OT6A 3DJ6A 4TY1A 4EI4A 4O7LA 1V0OA 5HO6A 3BYOA 4X2JA 3NFGB 2R3QA 3FY0A 3A8WA 3CKXA 3KQ7A 3TN8A 3COKA 5DNRA 4ERKA 1J7IA 2CNUA 4KS8A 5ANKA 3LKMA 4FF8A 2WFYA 3R0TA 4RIYA 3UDBA 3EIDA 4GL9A 5AUXA 1FINA 1PMEA 3F7WA 4PTEA 3GC8A 4GVAA 4U45A 3R7YA 1Z5MA 3VS5A 4D58A 1YOJA 4O7WA 5EOLA 5EFQA 5IEVA 5EI8A 4FV8A 3TIZA 2E9OA 4FTJA 5HESA 4HZSA 4JIAA 4L68A 2ZB0A 3OW3A 4JRVA 4CTCA 3IKAA 4GIIA 5LOHA 4KKEA 3ERKA 2HZ0A 3QL8A 3UQFA 1Q8WA 3GENA 4XUFA 3PIXA 3KMMA 3B2WA 3NUSA 5CI6A 1PKDA 4LYNA 4O0VA 3VQHA 2WTWA 1JLUE 2XNOA 4RIXA 1FBNA 2R3GA 3AC5A 4F6SA 4QMSA 4BJJA 4ZMFA 1CTPE 2NRUA 2IN6A 3EFKA 3MFTA 4M97A 4V05A 3R8LA 4Y46A 2ZMDA 2FB8A 4NM7A 4E4NA 3FV8A 2LGCA 4NEUA 3NAYA 3G51A 4PL4A 4PUZA 3THBA 1PY5A 1YDRE 3AD5A 4ZTNA 2BKZA 1NXKA 1OKZA 3BX5A 3Q5ZA 4BCPA 4BI1A 3G90X 5AWMA 3II5A 2QG5A 4AA0A 4M12A 4NTTA 4RIYB 5L3AA 5C01A 5KMMA 3OEFX 4AAAA 3P1AA 3ELJA 3KKVA 2C5NA 1ST4A 2VX1A 3LMGA 1UU7A 3PA4A 4HNFA 2I0VA 4W9XA 2IZUA 2VTJA 2PULA 2GNGA 4FE2A 4TL0A 4IJPA 2JFMA 3CCNA 4YO6A 3SC1A 4CQGA 2GFCA 3L9PA 2PE0A 4TTHB 2GFSA 2QOBA 3ZRMA 4BDBA 4CFWA 2BILB 4LV7A 4K2RA 5KKRC 1W7HA 5CF8A 5HOAA 4O2ZA 5K0KA 2V55A 2Y6OA 5EK7A 3FBVA 2GCDA 4XRLA 4DFYA 1U54A 1OIUA 5LVPA 4C4GA 2W96B 3QCQA 5E92A 3DDQA 3OF0A 3R7OA 4EUUA 3Q60A 3QHRA 4RIWB 4RIXB 4DINA 2C5YA 3EMGA 2WTKB 5CU6A 4C35A 1SNXA 4BJJB 2QCSA 5EDQA 2BFXA 5DRBA 3FY2A 4AOTA 1YHWA 3JY0A 4R8QA 1ZZ2A 2GHLA 3A2CA 2VUWA 3UNZA 4YJTA 1YW2A 1P5EA 3HX4A 2VTMA 3L8PA 4IADA 3HV5A 2UW7A 5BNJA 4G17A 2V62A 2C3IB 2JAMA 3BELA 4FIIA 3D7ZA 3VF9A 2IJMA 3ORLA 3NNVA 1OKVA 3VF8A 4RZVA 5HTCA 3P5KA 3KL8A 1OI9A 4TZRA 4ERWA 1FMKA 3EZVA 3FKOA 4FKWA 3N9XA 1RQQA 1K9AA 1A48A 4CLIA 3FI4A 5KE0A 3R2BA 3AGLA 3HMOA 4QMTA 1M17A 3D5XA 1OIRA 3UO6A 1ZOHA 3H0YA 3U6HA 3IDPA 3K54A 4UYNA 4O7TA 3TUBA 4AW0A 4YNOA 4OTGA 3PFYA 4FL2A 4IE9A 1U54B 1MUOA 4RBLA 4BCKA 1FQ1B 2A4LA 5T6KA 5JT2A 1OB3A 4LOOA 2AUHA 4U80A 5JGBA 3MDYA 4PV0A 4JNWA 5AUZA 4DEHA 5FWKK 4UX9A 3IOPA 5BVDA 1W0XC 5A46A 2J7TA 4BYJA 4MXZA 4GYGA 2FA2A 4O4FA 3WYXA 4GW8A 1IA8A 2Y6MA 3QQFA 3TNPC 1DI9A 4ZAUA 5EH0A 4GEOA 4JX3A 1MQBA 4OUCA 2ITVA 1H0WA 3F3ZA 4I24A 5AUYA 5DEYA 3GU7A 2EWAA 2YCFA 5A14A 5AP7A 3NVKI 4FODA 2OIBA 4J7BA 2F7EE 2PUUA 3FC2A 3MPAA 5CNNA 5DG5A 4HVDA 5EW3A 3ULIA 2ZV2A 2RG5A 4E1ZA 4RX5A 3FSKA 5CU2A 4CFFA 4MTAA 5LVOA 3HV6A 2BFYA 4NSTA 5HIDA 5HNGA 3FXZA 4NL0A 1NW1A 3CQEA 4FTCA 3AOXA 4YJSA 3PG1A 2I0HA 2X0OA 4N4SA 1Y8GA 5FDXA 4NWMA 3QTIA 3JS2A 3VHEA 4ENXA 2XM8A 4EONA 3Q6UA 4MH7