4L53A

Crystal structure of (1r,4r)-4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)-3-chlorofuro[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}cyclohexan-1-ol bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
296
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1: Optimization of kinase selectivity and pharmacokinetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 296
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l53A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l53A01
2GNJA 4FK6A 4KRDA 3QXPA 2PVRA 2OXYA 3CIKA 3TV6A 3TNHA 4W9WA 3MVJA 3BWJA 4IXPA 2R7BA 2ACXA 4O0TA 1Y6BA 3LKMA 1ZMWA 5AP6A 1J1CA 2GSFA 3DZOA 4EOQA 3IPHA 3TACA 4NWMA 4EHEA 2F7ZE 4EH5A 4AG8A 2ITUA 3GCQA 3E7VA 4MWIA 4YLJA 2OSCA 1YI3A 2WTKB 4IB1A 4LYNA 5EHOA 5C4LA 5CZIA 3DAEA 3EFWA 2R2PA 4DAWA 3KKVA 4RA4A 1Q3WA 3E88A 3VAPA 4UMQA 1OPKA 2FA2A 4MBJA 2W9FB 3ZUTA 4BCGA 4MXCA 5EHLA 5EYDA 3PVGA 5B2KA 3TKIA 3UIUA 4ZJJA 4UMRA 3S4QA 1MRUA 4IAAA 2OXXA 3FDNA 1PRYA 3RK9A 1OPJA 1U4DA 1OB3A 3IGOA 1Q8ZA 4ZLOA 5C1QB 3OT8A 4R7HA 4JRVA 4V01A 5AWMA 4ALWA 4CZYB 2PVKA 5DYJA 4ACHA 2C0TA 1CDKA 3I81A 5HO6A 3LJ2A 5AV1A 3PSCA 1SVGA 5KMOA 2WTCA 4I5HA 4YZ9A 2QONA 5CXHA 4CCBA 4QP1A 2WAJA 5ETIA 1H1QA 5IUIA 3O96A 5M57A 4JLCA 3SW4A 4ANOA 4ANLA 4R5YA 3VBTA 4E26A 2CGXA 4I20A 2X9FA 5HO7A 3VS0A 2BMCA 2W4JA 4L6QA 2WEVA 5DIAA 5AX3A 4JDHA 4ZSLA 4QMSA 5CS6A 5GJGA 5CT7A 4TYEA 2OJGA 2Y9QA 4BCPA 4FSQA 4FV0A 4XHKB 4BR3A 5IEVA 4H3QA 4DG2E 5IPJA 2EWAA 3OROA 5EI8A 4O1PA 5DA3A 4IAIA 3KL8A 5HBHA 4LOQA 3RAHA 4DEAA 3COMA 1PKGA 2DQ7X 4DEDA 3L9MA 5IQAA 3CTQA 2UZVA 1H1RA 3L9PA 2Z2WA 4G6LA 3IW6A 4O7SA 3CKXA 5H3QA 5ICPA 5HE2A 4XLIA 4AGDA 3TNQB 3QKMA 2IZRA 2X6EA 2XA4A 3BQCA 5BVNA 4Y5QA 4D2RA 5LVMA 5IEYA 2JAVA 3M11A 5EQPA 5M56A 2EXCX 3EMGA 2YITA 5J95A 1YDRE 3RAIA 5AMNA 3H10A 5HBEA 4HNFA 1YXVA 3DXPA 4JX3A 4XX9A 4DYMA 1QPCA 4NM0A 2OZOA 3QA8A 1XH4A 2R3GA 5D11A 4JBQA 2UW6A 3S95A 4EOPA 3HV5A 4YJNA 4HZRA 3GFWA 5D7AA 3O8UA 3W16A 4G9CA 4IJPA 3CPCA 5IQEA 1PXOA 5KZIA 2VWIA 3QQGA 1VEBA 2ETKA 4DBXA 2OF2A 2I40A 4IEBA 3ORXA 3NPCA 1I44A 3I60A 3ZSGA 3QTWA 4M69A 4KUJA 3RM7A 4EQUA 4FKPA 5GZ8A 3LFSA 4ZY6A 1IAHA 4XG6A 4DGMA 3R30A 2J7TA 5KMKA 4APPA 5FXRA 4MXYA 3UNZA 1OI9A 3PWDA 5FXSA 4XYFA 3R9NA 3BYVA 5DR9A 4EH8A 4RQVA 5ITAA 4ID7A 5C4KA 3I6WA 3ZO4A 4FA2A 3ZMMA 4YTHA 2XNMA 2P33A 3D83A 3IOPA 2VD5A 3P5KA 4FIFA 3IW4A 4GV1A 4M13A 4QTDA 2ZV7A 4RIWA 3UVPA 4BDHA 5AUTA 4I6HA 3KB7A 4WBBB 2JKMA 2G01A 4MWHA 1V1KA 3KMWA 3O8PA 3NDMA 3Q9ZA 4W9XA 2J0JA 3I79A 3QTXA 3NX8A 5BX0A 4D9UA 4ITIA 3QQLA 2FSMX 2QHMA 4EOSA 4C38A 5JGDA 4G31A 2ITNA 2R3KA 4C4GA 3QKKA 4JVGA 3IDPA 1NVQA 5CYIA 4O0YA 3FMMA 1UU9A 4DFXE 4CMUA 3IGGA 5JFSA 4XH6A 3VW6A 4FUYA 3EFJA 3U6IA 1IR3A 4FF8A 3UIBA 5KKRC 3WI6A 2R9SA 3PA5A 3I7BA 3BYSA 4L53A 5HKMA 4FTTA 2J90A 2C3JA 4RIYB 3FEGA 4OT5A 1ZZ2A 3G9NA 4WG5A 5T68A 3RPSA 3Q52A 5IU2A 1U5QA 3GU5A 3U87A 1PXLA 4QMPA 5F9EA 3MIYA 2WMUA 4BBMA 1OECA 3F9NA 4O91A 4YTCA 2JAMA 3M2WA 3OY3A 4EHGA 3BLQA 2ZM3A 1BUHA 4M0YA 4R3RA 2ZMDA 1NXKA 4KBKA 4P90A 1DM2A 2VN9A 5L6OA 2Y4PA 4NYEA 4R3PA 4QQJA 3RI1A 3JYAA 5HU3A 4QMZA 3MVLA 4GIHA 4YC8A 2ZV9A 5DI1A 4K11A 5EW9A 3LCSA 4AAAA 2XK6A 3LJ0A 3PY1A 2XKFA 3IK3A 4WRGA 1JOWB 4O7LA 2Y6MA 4A4OA 4CRSA 3HYHA 5ETFA 3WZJA 4G2FA 2C1AA 3FY2A 4L45A 2HWOA 2CMWA 4DC2A 3AC8A 2RFNA 3QALE 1ZOEA 3ANQA 3Q2MA 3ET7A 3P1AA 2B7AA 2PZRA 3F5GA 3ELJA 3FHRA 3EL7A 4O96A 3S1HA 1VR2A 3FLSA 3DS6A 2JEDA 3SXSA 4NEUA 1JWHA 3VRZA 5CF4A 1OVEA 3S00A 4D9TA 4TWCA 4RX5A 3GVUA 4A07A 3RNYA 1Q24A 4D0WA 3FMLA 4D2VA 4E6DA 5E8UA 3ITZA 4IB5A 4AE9A 3MW1A 3CQWA 5BVEA 4D2TA 3OCGA 4NM7A 1ZZLA 4PWNA 1OL6A 2ZAZA 3D14A 4L42A 3E87A 3R63A 4U97A 3KCKA 4RG0A 5DVRA 2PL0A 2R4BA 3CBLA 5AM7A 5HG9A 1ATPE 1DI8A 4IZYA 4IE9A 4PMSA 3KC3A 4W4YA 4BC6A 5A4QA 3NZ0A 2X8DA 3SV0A 4FKWA 4I23A 4M97A 3A7GA 2W7XA 2PY3A 1OKVA 4U79A 4Z7GA 1J3HA 2CGUA 4D5KA 3RPYA 1BLXA 5JGAA 4CYJA 3IG7A 5BVDA 2X8EA 2XBJA 2YDKA 5TO8A 2QLQA 1DAWA 2QOHA 3RK5A 5GJFA 4AN2A 2IZUA 5L2SA 2ERZE 3NLBA 3UPZA 2PUPA 2X0GA 4FZFB 3QWJA 3VBYA 4O0SA 1GIJA 3MH2A 3ZFXA 2J0MB 5CXZA 3T9IA 5KCVA 4X2NA 3F3ZA 5D10A 2WB8A 1QPDA 3OCTA 5CU6A 4WSYA 1ZOHA 3ZDIA 4C4FA 4CV9A 5BVFA 5CSWA 2HY81 3V04A 3LFDA 4FEUA 5CY3A 2OXDA 5EW8A 4PTCA 2I1MA 2WMBA 4BKJA 2A19B 1XH9A 5C01A 4XRLA 4DEBA 5BUIA 4IVDA 4CLJA 3QTSA 4K77A 4FVQA 2GS7A 3FL5A 4CFNA 3N4TA 3FKLA 4YURA 2W1CA 4Z9LA 4HPUE 5KHWA 3TJCA 3AT3A 3ROCA 3RINA 5AUUA 3PUPA 2JGZA 3DBQA 3OP5A 3PJ3A 4I41A 5JRQA 1NW1A 1OITA 1DAYA 2HCKA 3C4EA 4BGGA 2NP8A 3SOAA 3LMGA 4LI5A 4A7CA 2F7EE 3QLFA 1UVRA 4WNKA 3FQHA 4FZAB 2BAQA 2OJJA 5AA9A 4FTQA 1M2PA 2BR1A 3V6RA 2GQSA 4ENXA 3BGQA 3TM0A 4KA3A 4EONA 3D5WA 2FYSA 4EUTA 4RLKA 1OBGA 5ANGA 4D4VA 3QZHA 3V5JA 4I0RA 3UOHA 4HGLA 1PW2A 4M0ZA 4XEYA 3ZO2A 4PV0A 4BBFA 2ZDUA 1FOTA 3PXRA 1O9UA 2OIDA 3RP9A 2XNGA 4E6AA 2WTIA 2YFXA 5A54A 4JQEA 1HOWA 3CD8A 4FR4A 4NJDA 5HICA 3UC4A 4C4JA 2C68A 2GHLA 5EKNA 3PIZA 1XH6A 4X2KA 3RNIA 4O82A 4QTCA 2QOLA 3RWQA 3ZBFA 4I24A 3KXMA 2RL5A 3ZBXA 3Q5ZA 2HWPA 4M7IA 4BICA 1WBPA 2R3IA 3D0EA 1KE6A 2PVYA 2QU6A 5J9ZA 4I0SA 3MY0A 2NNWB 3EKKA 3LMIA 3ID6C 3NGAA 2A0CX 3KQ7A 3A4PA 4F6SA 4PDPA 3FWQA 3RZBA 1WBTA 5AP0A 3AC5A 3NIZA 3MY1A 4IBMA 3QLGA 4AOIA 4QT1A 4YLLA 3GC7A 4XV3A 4EH7A 1A48A 3NUYA 3E93A 3OXTA 2B4SB 3LFNA 4M8TA 4IZ5A 2EB2A 5H9BA 4BDGA 2PMLX 2B0QA 1FMOE 3FLWA 5LVPA 1REJA 2YJRA 4BCNA 3G15A 3P7BA 4ZS0A 4XRJA 3F2AA 3QYZA 2YEXA 4GVJA 4DEIA 4TNBA 3VS7A 3DJ7A 3L1SA 4XV1A 5DG5A 4P2KA 2OJIA 5CSVA 5E1SA 4UXQA 4BZOA 2P55A 4UYAA 5CSPA 4QMXA 2C4GA 2WMVA 4CCUA 4F08A 3FQSA 3AMYA 5T6KA 4ACCA 5DRDA 2PZYA 3UP7A 2GHGA 4DINA 4OR5A 4HGSA 1OZ1A 4FZDB 4TYHA 3N4UA 1UWHA 2B52A 1H28A 3ZLWA 2GS2A 3PVUA 4DT9A 2F7XE 3QCXA 4EOKA 3UGCA 2RKUA 5AAFA 4JDJA 4DGNA 3TJDA 1LEWA 3IS5A 2IW8A 2O0UA 2XIXA 3AOXA 3Q60A 2I0EA 3PXKA 2EU9A 4GRBA 3JY0A 2JFMA 3UQCA 4F0IA 4R78A 4BI2A 2F4JA 3NUPA 1OBDA 3BEAA 1S9IA 5FDPA 5LVLA 5IMXA 4ACDA 3NYXA 5IH6A 1SNUA 1ZMUA 4QPAA 5A46A 2YM4A 1JKTA 2WTVA 4PUZA 4CFXA 4D2WA 5BUEA 5CAQA 1PXPA 5FEDA 1MRVA 2PYWA 2YCQA 5GIOE 3E8EA 5CNOA 5HCZA 3VS5A 4ZP5A 2IVSA 4C4EA 3AC1A 3OMVA 3QD2B 2VX0A 5B0XA 3FV8A 3P7CA 4DA5A 4YTFA 2WQOA 3DGKA 4A9RA 3KXHA 3E3BX 4S33A 4U80A 4X6RA 5EW3A 4C62A 1YWRA 4Q5HA 3B8RA 3CGFA 1WVXA 3BYMA 3NR9A 5L2IA 4BZDA 4ZOGA 3NS9A 2UZNA 5J5SA 2VWZA 3FLQA 1H01A 2AC5A 2XH5A 3KGAA 3MPAA 4NH1A 4QYFA 4BGQA 2XZSA 4BI0A 2REIA 3LCOA 4BRXA 4R7BA 4YHJA 2HZIA 3FMJA 2FB8A 2XIYA 4AT3A 4AZEA 3MTLA 5CX9A 3R8LA 1YI4A 4EI4A 4F65A 3DAJA 5FEQA 2E9PA 3NUAA 3VUDA 3EN5A 4B4LA 2OIQA 1PYEA 4FZ7A 2VX1A 3KXXA 4FT9A 2XCKA 5CEOA 3ERKA 3POOA 2CKPA 4AFEA 5AM6A 4ZK5A 1P5EA 3MH3A 2CGWA 3HV6A 4IVCA 3MB7A 3K3IA 3R6XA 4J98A 2B9FA 4L67A 4RJ5A 4OTWA 4KKGA 2VTPA 3COIA 2OJFE 3H3CA 3QWKA 4IC8A 3ZEPA 3NUSA 1XBAA 3SVVA 2OH4A 2UZOA 2YZLA 2BDWA 4I4FA 1PF8A 4U0IA 4FTLA 3A4OX 2IW6A 2VNWA 1J1BA 2UV2A 3U6HA 3F3WA 2WGJA 4PPBA 3GENA 4XMOA 3UODA 4NKSA 3ZONA 4O7ZA 1YQJA 5IF1A 3H9RA 3DBEA 2G2HA 4FKTA 4EK3A 3MI9A 4O7NA 3U8WA 5AV3A 4CLIA 4USFA 1OPLA 3LQ5A 4FICA 5LCJA 5HNIX 2CKOA 4H05A 3FI2A 5C9CA 1YDSE 3AC4A 3HNGA 3QFVA 3O7LD 4C59A 3PJ8A 2BFYA 2UZEA 3KK8A 4JR3A 5I4NA 1BL7A 4FV3A 4ZMFA 5BMSA 3FI8A 2XVDA 1ZY5A 2V55A 3GI3A 4MH7A 3V5PA 1P2AA 2BIYA 3VUGA 4ANNA 3ZFMA 2XYUA 3D7TB 5IISA 3MFRA 3OF0A 4AZSA 2XK7A 3OS3A 4I1ZA 3QX4A 2J9MA 5G6VA 2V7AA 3GUBA 1H0WA 2C3KA 2YIRA 2XRUA 4LQMA 5D7VA 5M55A 3F61A 5CF5A 4FV8A 1WAKA 1YW2A 2JDVA 2UZLA 3AD4A 4XBRA 4CV8A 2XIKA 4L52A 3OCBA 4BKZA 5M07A 5IUHA 3Q04A 4O7RA 2UW9A 3FMKA 4DT8A 1LR4A 4O21A 3AMBA 4CTBA 1ZY4A 4JAIA 4CKJA 2BDJA 3UP2A 2VUWA 3T8OA 2OBJA 3DV3A 3DFCB 4ZTHA 5T3QA 3BU3A 4I21A 1YVJA 3HP5A 4B7TA 2CNUA 2XK3A 2VTHA 3RAWA 3U51A 2ZV2A 4TXCA 3VF9A 3ZOSA 3G5DA 5E92A 4BYIA 5CF6A 3GXLA 5HLWA 1M14A 4U40A 4LRMA 4MKCA 3SXRA 3V5QA 2VWWA 3ZLXA 5L8KA 4Y72A 5EFQA 1Q5KA 2IPXA 4S2ZA 3HL7A 2ITYA 3ATSA 4FIEA 3DTCA 2IVTA 4YBKA 3ZLSA 1H1SA 4E4NA 4O38A 3LXLA 5IMEA 4J97A 3UOKA 4K0YA 4LMNA 2W1EA 3LVPA 5LWMA 2ITXA 3HGKA 2IVUA 3QF9A 4YUQA 4ZTQA 4HYUA 1WBSA 4YZNA 2XEYA 1OUKA 4HVHA 4PL3A 4J1RA 1CM8A 3W32A 2X6DA 1Y91A 3QC4A 5LJJA 4IVBA 5EDRA 3P7AA 3AD6A 1VJYA 5J7HA 4GK2A 3DXQA 4FEVA 3F5XA 4QP2A 2NRYA 3UMXA 4B6LA 3OWKA 1W7HA 2OIBA 5HIBA 3NUNA 1J7UA 1YHWA 2YAAA 3ALNA 4RIYA 3F66A 3OBGA 3C0HA 3KXZA 4ARKA 4I6QA 4UMUA 4O7WA 2PVFA 4BDJA 5CU0A 3VHKA 3FSFA 4F7SA 5HTIA 4YBJA 5C8KA 1Q8WA 2IZTA 4JG7A 5ANKA 5JKGA 5D41A 4X0MA 2YIXA 4FKOA 4JDKA 2NO3A 4G34A 3OT3A 4GU6A 4DFYA 3AT2A 3C4WA 2WZJA 4S30A 5AR8A 5HHWA 3ENHA 1B39A 5CAUA 3R71A 2QCSA 3ORKA 5E91A 3GCSA 4UMPA 4Z3VA 5E8SA 4AP7A 3ACKA 4BDAA 4IWQA 4Q9ZA 4K33A 4QP6A 3RALA 4LGDA 1W83A 3LM5A 3FZTA 3BYOA 3LXPA 3QGYA 2HZ4A 3MY5A 4WD5A 1ZWSA 4FV7A 3ZCLA 2JDRA 3CD3A 3ULIA 3ZO3A 1V0BA 3B2WA 1PMEA 5E8YA 1K2PA 4FKLA 1L3RE 4B99A 3LQ8A 3M42A 2C6DA 2VO6A 2XM9A 4C2VA 5CSHA 4UB7A 2G9XA 3NVMB 4UEUA 2BHHA 4C0TA 2IG7A 4GG5A 4HVIA 4EQMA 3SW7A 2PPQA 3E7OA 5BUJA 2GDOA 5ETCA 4XJ0A 5TKDA 1GIIA 1ZXEA 3BE2A 4L7FA 3UTOA 4JBOA 2WHBA 4JL9A 2EUFB 4EORA 2SRCA 2QOCA 4G9RA 1U46A 3FLYA 1SNXA 3I0OA 4ANSA 5D1JA 4FNZA 3W10A 3HAVA 3LJ1A 4OTRA 4AZVA 4AT4A 5K4JA 3QRTA 2FH9A 1Q61A 3SA0A 3VJOA 5IA5A 4FBXA 3LFEA 4EH2A 3FE3A 3OZ6A 1W84A 5CI6A 1G8AA 4I92A 2ONLC 4NIFB 3KREA 1M2RA 3C4CA 1IG1A 3BKBA 3PLAE 2PMIA 1JVPP 4W8EA 4DN5A 4F09A 3JS2A 2UVXA 4C57A 4L01A 3FY0A 4YLKA 5TF9A 5IQBA 4KBCA 1SZMA 3EWHA 4UMTA 4YZDA 5IG1A 3TTJA 3HECA 4O0RA 4FT7A 3HMNA 4E3CA 4M84A 3UO5A 4YGAA 3N4VA 2GNGA 1JKSA 4XG4A 1XJDA 3EQCA 1PMNA 1JSVA 2XJ2A 4J96A 4MXZA 2UZUE 3A7IA 3QTUA 5HI2A 3CTHA 5HEZA 4DG0E 4C36A 4F7LA 3PIXA 3WIGA 3ZHPC 4QYGA 2B54A 2WQMA 5EH0A 5I9WA 3F82A 1KE8A 2EXEA 1UNGA 2RG6A 4U41A 5HG8A 4UN0C 2QR7A 3KCFA 3O2MA 3R7OA 4H36A 3HEGA 5E8XA 1YWVA 1R0EA 2G2FA 5GINE 4OAVB 4MF1A 3G51A 4DCEA 2WTKC 3FHIA 3VUIA 5L2WA 3JR1A 2UW7A 3P0MA 3R28A 2I6LA 5CVHA 4HCTA 5L3AA 2OFUA 4Q2AA 4O0WA 2XP2A 3TG1A 4NUSA 4ZY4A 3U6JA 2P3GX 2ETMA 3C7QA 2OO8X 3AD5A 4RFMA 3A62A 1OIYA 4QPSA 2R3NA 4UZDA 1KWPA 3R9DA 5CALA 4RJ3A 5A6NA 4XLVA 3V51A 3R04A 4MK0A 3QCSA 3PFQA 2YZAA 4D4RA 3FPMA 3BWFA 1JAMA 2OH0E 3F7ZA 4K1BA 5JQ8A 3DPKA 4ZY5A 4BTKA 4RLLA 4FSMA 1B38A 4GFGA 4WUNA 4ZTLA 4K18A 3SX9A 3WE4A 4D2PA 4EWHA 5DNRA 2J0KA 1H4LA 1R39A 3TUDA 2BILB 5BVWA 2BALA 2VV9A 4BVUA 2XYNA 5A9UA 3WZDA 3SLSA 4X2JA 4ZZNA 4Z7HA 3Q4ZA 5BVOA 1I09A 2PZPA 5KMLA 4UWBA 5EK7A 3CQUA 1QPEA 1TVOA 4PMMA 3OC1A 4HYIA 3EN9A 3KULB 2W1IA 4EEVA 1PMVA 2GNFA 2X81A 3FJQE 4FIHA 3FL4A 4GL9A 5A4CA 5IA0A 5C03A 2XM8A 5DT0A 4ALVA 5KMNA 2ITQA 3RM6A 3SGCA 4YPSA 3FC2A 4FIGA 4O86A 3PA3A 4Y85A 4QYHA 4DFBA 2QG5A 2J51A 2B9IA 1YWNA 5AP4A 2E2BA 5J1VA 4I0TA 3IKAA 4OTHA 4KRCA 2CJMA 4OUCA 5AP3A 3V8SA 3WZUA 2W5BA 4FL3A 4AZTA 3TUBA 2YN8A 4I93A 2IN6A 4IJ9A 4C2WA 4JIAA 4ZTSA 2X9EA 4OT6A 3W55A 3V5TA 3F3TA 4ZMEA 3OEFX 3ZSIA 3HP2A 5FRIA 4KB8A 3TNPC 3QUEA 4D2SA 3FYKX 3ZO1A 3F2RA 3RTPA 3R8ZA 2HW7A 3PE2A 2PULA 3LXKA 4WNOA 2CPKE 2WD1A 2OICA 3CCNA 5CT0A 5CASA 5KO1A 3R2YA 1IA8A 3R7EA 3I5ZA 4IHPA 2QVSE 3CPBA 3DKFA 4ITHA 3OD6X 1MP8A 3SQQA 3MB6A 3NAYA 2JIIA 3TWJA 2I0HA 4E73A 4EH9A 2GS6A 5IEXA 4IADA 1GAGA 1YI6A 2C6KA 4P5QA 4F63A 2J0IA 3TKHA 4W4VA 4QTEA 3ZFYA 4C4HA 2PE2A 4EOIA 2P2HA 3BBWA 2V62A 3PP0A 4RBLA 2LAVA 3GU8A 4G3FA 4HVDA 4TL0A 4FTKA 5J87A 4E1ZA 4CYIA 4E8AA 1DS5A 4WT6A 5FDXA 2Y4IB 3HV7A 4MBLA 3EFKA 2JLDA 3DNDA 1YKRA 2FSTX 4IWDA 4DCAA 5I0BA 3QXOA 4M15A 4WSQA 1JKKA 4GT3A 4BIDA 4F9CA 2QKRA 3O8TA 5DR6A 2CLXA 4U6RA 3IDBA 1Q97A 4NZWB 5EI6A 2HXLA 3QUPA 4MQ1A 4PDSA 4QP9A 4PPAA 2HXQA 4DEGA 1UV5A 2BKZA 3G6GA 4IFGA 2AC3A 3CC6A 3H0YA 4RWKA 3SRVB 5ANIA 1YOJA 3PZHA 5A3XA 4S31A 4LV8A 3T3VA 4EK5A 2NPQA 5C8NA 3EQFA 3EYGA 4ZZMA 3PIYA 1IRKA 4GMYA 5AIKA 4RJ4A 1PXKA 3NNWA 4C37A 3KXGA 5HD4A 4WG4A 3LQ3A 2G15A 3LFFA 4IWPA 4JR7A 4RWJA 3UQGA 3JPVA 5DT4A 4RC3A 1XO2B 1Y8GA 2WEIA 5HCYA 3DU8A 3EKNA 4BTFA 4YJPA 5FTQA 3KFAA 3QX2A 4M66A 3I4BA 1BX6A 5CTPA 4QO9A 5M44A 4U5JA 4OAUC 4MD9E 2EXMA 2VWUA 3VQHA 4LOPA 4EHZA 4GJ2A 4IQ6A 4M3QA 1GOLA 4P4CA 4UXLA 4WOVA 4HOKA 3A7HA 3HLLA 4BKYA 3BHHA 3QZIA 1R0PA 4N6ZA 3TZMA 4A4LA 2W17A 4C58A 1Z57A 4RFYA 1Q8UA 3PXZA 3NNXA 4UBAA 2YM3A 5LMAA 3ORZA 4QYEA 5HIDA 3LW0A 3BV2A 3RHKA 1H26A 1Q8TA 2WIPA 2XRWA 2YM6A 4PF4A 4D1ZA 4F70A 3V8WA 3CTJA 5DHJA 5HTCA 4ORKA 5C27A 4JIKA 1QL6A 2WXVA 3TIYA 1ND4A 2C6LA 2XBAA 2XMYA 2C5NA 3PSBA 4UYNA 5L2TA 4IM0A 5K9IA 4J7BA 4Z16A 4E93A 3PZEA 2E9UA 3TT0A 4K6ZA 2XUUA 3KRWA 4Y95A 4DLIA 4ZAUA 3UC3A 3EN4A 1OL7A 1O6KA 2VTQA 3MIAA 2GFCA 4HVSA 4DE4A 1ZYLA 1SVEA 5FWKK 2BKKA 2PUUA 4IX3A 4YHTA 5ANEA 4D4YA 3OUNB 5DRBA 5K3YA 4ASZA 4XG9A 2Q0NA 4QMLA 5EM5A 1GZKA 2VTOA 4WNMA 2HYYA 4QTBA 3OWPA 4RIOA 3KRLA 1KE9A 3KVXA 2J4ZA 3DKGA 3HV3A 3ULZA 4E4LA 3NNVA 4FK3A 5TT7A 2GCDA 3BGZA 1FGIA 1M7NA 3GNIB 4I6BA 5EI2A 3NAXA 4MYGA 4X2GA 2VTSA 3WIKA 2WMAA 4GYGA 4HZSA 4TWPA 3I5NA 3UYTA 2Y0AA 3CLYA 3F3VA 2BZKB 3PJCA 2UW8A 3K3JA 3V5LA 2W1FA 5BPYA 4FVPA 2UVZA 1Y6AA 4KBAA 2GNLA 2YACA 4O0VA 4RIXB 2CKQA 2CNVA 3HDNA 4H3BA 4MXXA 5L2QA 4ANMA 3UBDA 3FAAA 2XNEA 3D7TA 5FLFA 5DLSA 3NYNA 3SAYA 3TV7A 4PX6A 3LAUA 3KU2A 4KSQA 3UZRA 3MFUA 3CS9A 4N6YA 4FKJA 4OBOA 5AV2A 1G5SA 2DYLA 2F57A 2QOQA 3NSZA 4LGGA 4M12A 4IMYA 5FBOA 5KNJA 3MDYA 5LWNA 3HX4A 4U8ZA 5H8EA 4ANQA 4YPDA 3AC2A 4JOAA 4D0XA 4EH3A 4EWQA 2UW0A 1WBNA 2J0LA 3HUBA 3NRMA 4XG2A 2C6EA 1Z5MA 3ROYA 3UOJA 4NM3A 2BCJA 4BDCA 4RVKA 3FYJX 4OGRA 2JBOA 4X3FB 1IEPA 4R7IA 2LGCA 4Y73A 5CEMA 5M4UA 4WNPA 4AZWA 4F7NA 2BRNA 1ERKA 3PWYA 4FV4A 3D5UA 5I3OA 3SKCA 2Z7LA 3LCKA 3BCEA 3ENMA 3CY2A 3H0ZA 2J50A 5BYYA 4DHFA 3SG9A 4BFMA 4O22A 4FIIA 3R2BA 3KRJA 2VTLA 5HG7A 4PNKA 3PA4A 4JG6A 2YERA 3SG8A 2WMQA 2WOUA 4F0GA 4W4XA 5ETAA 4ZTNA 3OOMA 4L46A 3RWPA 4BZNA 5EOBA 4QQTA 4NU1A 4GVAA 4RJ8A 1BYGA 5EG3A 5M51A 1W82A 4E6CA 3BIZA 4QOXA 3EYHA 5CEPA 3C4FA 1A06A 4CKIA 2R7IA 3ZLYA 2C69A 5L6WL 1JSTA 2R3FA 4YJOA 1TQMA 3UZTA 2W0JA 4DFLA 3OW3A 3QA0A 3FI4A 3LZBA 4GG7A 3I1AA 4JDIA 1JLUE 3I0QA 3U9NA 4BI1A 1KV1A 4GFOA 4RZWA 4ASDA 4F0FA 5HU9A 1NVRA 1PXJA 5LCKA 2RIOA 4BIEA 2C6IA 4U42A 4NFMA 4FSWA 4AOJA 4AA0A 4E5AX 3TIZA 1P4FA 2O64A 4XV2A 4UWYA 5E8VA 4AW0A 1FBNA 4DFUA 3CJGA 2UW5A 3FMEA 4PQNA 5AP7A 4J99A 2C0OA 4RGJA 3H4JA 4D55A 1OL1A 5LARA 1HCKA 3KRXA 4WKQA 4IW0A 3UYSA 4A4XA 4F6UA 3RPRA 4B8LA 4JT3A 4CZTA 3DOGA 1VZOA 4EKLA 3HRCA 2OKRA 1H0VA 3A61A 3L8XA 3QTRA 4U3ZA 5I9XA 2PTKA 3R1QA 4I94A 1XR1A 4RRVA 3WILA 3LIJA 5TOZA 3DFAA 5FTOA 2I0VA 5JZNA 5H2UA 3CQEA 3BZ3A 4XP0A 4Y5HA 4PPCA 3BHYA 4UALA 5EQYA 1TQIA 3EQHA 3R1SA 4TWNA 3SXFA 4RX7A 2CGVA 2JKKA 2ZB1A 3OBJA 4CSVA 2OU7A 3GGFA 4CKRA 4A9UA 3O23A 2ZM4A 4GS6A 1CMKE 2FUMA 2VO7A 3DDQA 4BF2A 2PVJA 3EL8A 4S32A 5DE2A 5FBNC 4AE6A 4DFZE 3LFCA 5AFVA 1WCCA 3VWAA 3U55A 1UKHA 1GNGA 3Q6UA 4DGGA 4EC8A 1M52A 2AUHA 2HW6A 3IW8A 4CMOA 3F88A 4HYHA 3BV3A 1F0QA 3WF6A 5CEKA 4LV5A 5BYLA 3V3VA 5FTGA 2X2KA 4DBNA 3BHVA 1OUYA 3VBXA 2O63A 3NW5A 4YJTA 3EJ1A 3MBLA 4TYGA 5IUGA 4FKIA 4ZS4A 2GNIA 2R3MA 2WU7A 3WF7A 2C0IA 2JITA 2JKOA 4JI9A 1XH5A 4NIFA 3ZZWA 5DH3A 4GSBA 3RKBA 4B8MA 2A4LA 1DI9A 4R77A 4BCIA 3W2QA 4NCTA 3UJGA 4H58A 3WF8A 3VIDA 2Z60A 3RGFA 4OTDA 4F1MA 3MYGA 4GUEA 2QOIA 4FKSA 5IH4A 2Z8CA 1JNKA 2YABA 5DPVA 5CVFA 4XOZA 4AACA 5H8GA 1YRPA 4O0UA 4PL5A 3R9HA 3RMFA 3EQDA 4R3CA 1NVSA 3WZEA 3QYWA 3UVQA 4FSNA 4L9IA 4XOYA 3NUUA 3HRFA 3UG2A 3FBVA 1YOMA 3C51A 1YOLA 5CEIA 4ERKA 5J9LA 3GC0A 4UY9A 3VS1A 2GQRA 3R02A 4UWCA 5DEWA 5L6PA 1KE5A 2BZJA 3QL8A 3R7UA 4MQ2A 3R21A 5FGKA 2W4KA 5JSMA 4E5WA 4QMVA 3FC1X 2PMNX 3R83A 5HZNA 3HVCA 4O2ZA 4FSZA 5HNGA 3ZRMA 2XEZA 2W9ZB 3DB6A 5HG5A 5KZ0A 4CFUA 5CQUA 4C7TA 3QTIA 3L9LA 4RX8A 4MNFA 4O7YA 4X3JA 3PJ1A 3BYUA 3OFMA 1URCA 4AA5A 1G8SA 4OTPA 2W5AA 2PSQA 5HBJA 3MESA 1LEZA 4EYMA 3PDTA 1YHSA 5AX9A 4MAOA 2JKQA 2HENA 2C6MA 2VWVA 3O50A 2H8HA 5D9HA 5AAGA 4DLJA 2R3JA 4GU9A 4LFIA 5GJDA 1GIHA 3IW7A 3GC8A 3LHJA 3R00A 4H39A 2WQNA 3TL8A 4AFJA 4MBIA 5AUZA 4XP2A 3FKNA 3Q9YA 4XG7A 2OZAB 4HCVA 1YDTE 4DEHA 2XNOA 3TTIA 4EL9A 3BBTB 3E3PA 2O65A 3MVMA 4IX4A 2F2UA 3DQXA 5AR7A 5HQ0A 2B1PA 1NT2A 1H24A 4KNBA 4E4XA 3BU6A 4O84A 3BU5A 1EH4A 4BWKA 3K2LA 3KULA 4FTCA 4AF3A 4Y46A 4CT1A 1J91A 3OWLA 5F20A 1S9JA 2CHLA 3NIEA 5BYZA 4JJRA 4NTSA 4RC4A 1GJOA 3HMIA 2RG5A 4BCJA 4V04A 4U43A 4YR8A 1XH7A 3KN6A 3FSKA 4IAFA 2WTDA 3AC3A 4NT4A 1XKKA 4AW2A 4R1VA 1LUFA 2QHNA 5JK3A 3VNTA 3EB0A 3PG1A 3F5UA 3CR0A 1SMHA 3UMWA 3R7IA 3DBFA 1FGKA 3QC9A 5LQFA 3BLHA 3QQHA 1STCE 2C47A 2C5VA 2UZWE 2ZV8A 5I9YA 5IQCA 3CSVA 2CDZA 4NTTA 4B0GA 4N0SA 5D12A 4G5JA 4YC6A 2QOFA 5HX8A 3KF4A 4ENYA 2VTIA 2FSLX 4GFMA 4JS8A 4KKHA 3B2TA 4HYSA 2B9JA 2BRBA 4PMTA 3VVHA 5HCXA 4BYJA 3UNJA 2OG8A 3Q9WA 4BGHA 4GK3A 2XNBA 3GQLA 3O7LB 3MFSA 1ZAOA 4FL1A 4J52A 4NJ3A 5EKOA 3DQWA 1E1XA 4QP4A 4RQKA 3EQPA 4TTHB 5EM8A 4F4PA 3P9JA 3FUPA 1KOAA 1LP4A 3FZOA 4ZXTA 3OW4A 3NVKI 1PKDA 2FVDA 3K54A 4E6QA 1WVYA 3F2NA 4FEWA 3BPRA 3SDJA 3N9XA 2OWBA 1VYZA 4FTRA 3VS4A 3OHTA 4RSSA 4RMZA 1ZYCA 5EOLA 3S2PA 4BDEA 5LOHA 4KIKB 4L7SA 3W18A 3G0FA 3GU6A 3QD3A 4WRSA 4LMUA 4QMYA 4YTIA 4YZCA 5EQEA 4XG3A 3JY9A 4N70A 4B9DA 1JBPE 4BWXA 4TPTA 4AZFA 4ZTRA 2BZHB 4FSRA 4EBVA 5FQDC 5CZHA 3SOCA 3U54A 3LFAA 4O6EA 3Q32A 5GZ9A 5GZAA 5HX6A 2R3RA 5CU2A 5I5ZA 2XK8A 3ZC5A 3ZSHA 3MJ2A 4IAKA 4QMUA 2YLFA 4MF0A 2J2IB 3FXWA 5IQDA 3SRVA 2QQ7A 1QCFA 2NRUA 3DAKA 4QYYA 3P86A 3C5UA 4BCKA 1P14A 3JUHA 3DBDA 3Q53A 3NNUA 3Q4TA 1Q8YA 4A9YA 4HVGA 3OOGA 3HMOA 3Q6WA 5IDNA 3KVWA 2R3OA 2C1BA 3FMDA 4YNOA 3O0GA 3R8VA 4FT0A 1Q4LA 3II5A 4YMJA 5CU3A 3A7FA 3DJ5A 4LRKA 1OIRA 3C13A 3QUDA 4U44A 2PWLA 3GBZA 1URWA 3BRBA 4FSUA 4W4WA 5DEYA 3JVSA 3VBWA 2ZM1A 4II5A 4JRNA 5DOSA 3W8LA 4EOOA 4F9BA 3BHTA 3W1FA 5M4IA 4U9AA 2Q83A 2OGVA 4FTUA 5K0KA 3EQRA 3TDWA 2QR8A 4GYIA 4RVMA 2A2AA 3TKUA 3NW7A 5JN2A 3QCYA 1PXNA 1O6YA 1PHKA 3MJ1A 4G6NA 3I7CA 5AR4A 1UKIA 5HO8A 4KAOA 3V5WA 3TNIA 2CCHA 3HKOA 4RPVA 5IA1A 2YAKA 3EIDA 3WE8A 5CENA 4ACGA 5LVOA 3D9VA 3F3UA 5CF8A 4AGUA 4FEXA 2BVAA 4WA9A 5FM3A 5KUPA 2YIWA 3HAMA 3A99A 3VBVA 5ANJA 3ALOA 4G16A 2O8YA 3P08A 4JQ8A 4R1YA 2AYPA 3NYVA 1JSUA 3PLSA 3D5XA 5F4NA 1Z9XA 3QRIA 3S3IA 4FL2A 3WBLA 4IDVA 4DH3A 4XS2A 4FZ6A 5EHYA 4L44A 4U45A 4USEA 4ZEGA 3PVWA 2YIYA 1Y8YA 5AR5A 5AUYA 4QP7A 5G1XA 5JRSA 3SHEA 1Y57A 2B53A 1B6CB 3KEXA 3IW5A 1FMKA 2YCRA 4FKGA 3BI6A 2F49A 5DGZA 4AGWA 3ODYX 3BHUA 4HW7A 2RFEA 3C4XA 1H25A 2YCSA 4OBPA 2IVVA 2GHMA 4RT7A 3E63A 3LXNA 2XJ0A 3IDCA 4FNXA 3F5PA 5ANDA 2UZDA 4L00A 3VHEA 3L8PA 4L8MA 4E4MA 3RHXA 5IH5A 2DS1A 5J7BA 5KBQA 4XV9A 3R73A 2JFLA 5JZJA 1OKYA 3R7YA 3MA3A 2W1ZA 2PMOX 1BL6A 5LXMA 3Q96A 1BMKA 3MGYA 3W8QA 5CI7A 1YXSA 2BROA 1OIUA 2UW3A 3CXWA 3JXWA 2J5EA 3PPZA 4BHNA 2FO0A 5KMMA 4RIXA 4IX5A 1TKIA 4FVRA 3O51A 2ZVAA 2CN8A 1AD5A 5HORA 3V6SA 1TQPA 5K4IA 4CGAA 4C33A 4ZJIA 3F69A 3HA8A 4HGEA 4M14A 3TXOA 5C26A 1OIQA 4MNEB 4PDOA 2BZIB 4NCTC 2CKEA 1MQBA 3DDPA 5IDPA 3UOLA 1IA9A 4IAZA 4F9YA 2ITOA 1CSNA 3A60A 2GPHA 3AT4A 4DFNA 1GZNA 5EDQA 4PL4A 4I5MA 3GCPA 4YJRA 2BRGA 1KE7A 3E8NA 4G5PA 4IM2A 5KX8A 3EN7A 4X3FA 4YNEA 4BDFA 5JFWA 5JT2A 4D1XA 4K2RA 3G6HA 2QOBA 3MTFA 4EH6A 3GU7A 5BMMA 2VNYA 5HESA 3FQEA 5IKWA 3UIXA 4JBVA 1APME 4GIIA 4RZVA 4YHFA 4JQ7A 3V8TA 5AEPA 3ZH8A 2Y6OA 3BELA 5AR3A 1UWJA 3RBWA 3F6XA 3ZM4A 5AIRA 1V0PA 4QP3A 4CNHA 3GEQA 3Q2JA 2R0IA 3DA6A 2P0CA 2WO6A 3OXZA 1RQQA 2ETRA 3EOCA 4I4EA 1OM1A 2QO2A 2VAGA 3POZA 4M68A 4RJ6A 3ZDUA 5BNJA 5HE3A 4ALUA 2JIUA 1IASA 3Q4UA 4AQCA 4V0GB 2Y7JA 1BKXA 3TZ7A 4CT2A 2Z02A 4U81A 3QTQA 2HY0A 3VS6A 3FZSA 1KV2A 3KK9A 3PJ2A 5BVKA 2ITPA 3MV5A 4TY1A 5TR6A 3VUHA 2XCHA 5HGIA 3MFTA 4CG8A 1FINA 4FEQA 2WIHA 4IIRA 2BAKA 3E5AA 4L68A 3T3UA 3W2RA 2A27A 2ITWA 3C1XA 4IX6A 4EOJA 1ZMVA 2ZYBA 3WYXA 3COHA 4QMNA 2VGOA 3D7ZA 3FI3A 5CQWA 2WMSA 3RVGA 3R8MA 1UNLA 2H6DA 4BCMA 3DNEA 3OWJA 4FTAA 4BL1A 3ZS5A 4G3GA 3PPJA 4PMPA 2C30A 3P23A 5DT3A 2QODA 4NSTA 4S34A 3UQFA 1H27A 3EQIA 3HZTA 3ETAA 1REKA 3NWWA 5IQIA 5AA8A 3WYYA 3H30A 1G3NA 2YHVA 1FVVA 4QP8A 3ZYAA 1RW8A 4D4SA 1U54B 2BRHA 4KKEA 2WMWA 3QRJA 2B55A 4IZAA 3QBNA 3UZPA 5L8LA 4MVFA 5E8WA 4EZ3A 2G1TA 2IJMA 1FPUA 5CWZA 4A9SA 5CAPA 2IO6A 4UV0A 3UIMA 3GB2A 2V7OA 3IQ7A 4FG8A 5B7VA 4Y8DA 1U59A 3THBA 4FTMA 2VWBA 3ZU7A 4G3EA 4R6VA 4H1JA 4FSTA 3TZ9A 1R1WA 1RJBA 2VTRA 3VJNA 4BDKA 2W05A 3OY1A 4O0XA 5HOAA 1JKLA 3H9FA 3QGWA 4TN6A 3WARA 4Y83A 3KF7A 5M4FA 5AP1A 4QRCA 2QG7A 2XB7A 2YA9A 4D28A 5CU4A 4ZSAA 2YWVA 5DBXA 2X1NA 3R01A 2PZIA 1XHAA 5HLNA 3GQIA 4C4IA 4RC2A 2VRXA 5L8JA 3U4UA 3KMUA 4K9YA 4CZUA 2QC6A 5LMKA 4TNDA 5AR2A 4D1SA 4O7TA 3NW6A 5KE0A 2KULA 3T9TA 2G2IA 2Y8OA 2IWIA 2OF4A 2BPMA 4FI1A 5KMJA 5KKRB 4GKIA 3DT1A 4FT3A 4WG3A 2XF0A 4YJVA 5F95A 2W06A 3A8WA 4DH1A 4UX9A 1R3CA 4CFFA 1WVWA 1YXTA 4TYJA 3DKOA 5AUVA 4CEGA 3NUXA 4TW9A 3C4ZA 3ZRKA 4F1TA 3G9LX 5TE0A 1K9AA 3OVVA 5M08A 4HPTE 2QKWB 3DLSA 3DY7A 2W1DA 3OEZA 3R1NA 4WBOA 2WOTA 5I9VA 4OTFA 2RSVA 3EQBA 2X2MA 3K5UA 2Y4IC 3R7VA 3PY3A 4BY9E 3PVBA 4D5HA 2PE0A 2WKMA 4E5BA 4EHVA 1WBVA 3ORMA 2V22A 4LUDA 2P4IA 5AP5A 3ZRLA 3QAME 4IB0A 4KIOA 4PP9A 3FPQA 5JH6A 1M2QA 5FUTA 2YDJA 4TWOA 4EZ7A 4MX9A 4QMTA 3O71A 4BHZA 3K5VA 4ZLYA 4HGTA 3C50A 1W8CA 4LL5A 3TNWA 2C6TA 5IQFA 4WUAA 4A9TA 3DJ6A 4A06A 3MN3A 3G33A 3W2PA 4KS7A 2RFDA 4MEDA 2ZB0A 1OL2A 2PVNA 1OGUA 1UU7A 1KUTA 3E8CA 1H8FA 2C5OA 2CSNA 3VUKA 2C6OA 4DH8A 2ZOQA 1W98A 3VS3A 1E9HA 1QPJA 4K8AA 4G1WA 3NMUF 5M53A 3CP9A 1MQ4A 1YXUA 4DF3A 4L43A 3MSSA 5E1EA 4J8NA 2W99B 1GY3A 1V0OA 5ACBC 2RF9A 3GC9A 4BWPA 2ZDTA 4BN1A 5EYKA 3RK7A 1SYKA 4FV2A 4H1MA 4FYNA 3HDMA 4PRJA 4BCOA 1CKPA 3MA6A 3UO6A 4MTAA 3ZC6A 2PVHA 2WMTA 1YXXA 3AGLA 3PRIA 3W2OA 3PTGA 3ZTXA 5AUWA 3Q9XA 4WO5A 4RWIA 1BI7A 5I9ZA 3VULA 4FE2A 3COKA 3DTWA 2OZAA 3SC1A 4QPMA 3A2CA 1XWSA 4APCA 2GU8A 5HD7A 2XKCA 3ZXTA 4C61A 1ZRZA 2I0YA 3R0TA 3C5IA 4FTIA 4O27B 3QQUA 1P4OA 4FSYA 3R8UA 2X7FA 1PY5A 5IQGA 3QU0A 4GKHA 1H1PA 2XIRA 3E8DA 4GUBA 4JAJA 4FV9A 3R8PA 4EUUA 3GOPA 3BLRA 3VO3A 5A4LA 2O5KA 1ZYDA 4AW5A 4G17A 4HNIA 1UNHA 3G2FA 4H3PA 4OBQA 4ZTMA 2UW4A 4FYOA 4X6QC 4DITA 4FX3A 3Q3BA 3UG1A 3SD0A 4C02A 4F6WA 1A9UA 4KIQA 5FXQA 5ACKA 1UU8A 4FNYA 2JC6A 3DXNA 3QKLA 1RDQE 4EH4A 2WELA 2VTTA 2X7OA 2VZ6A 3MWUA 3G90X 3ORLA 5DN3A 4IZ7A 3FLNC 3PP1A 4NK9A 2JDOA 5GHVA 3E92A 4BCFA 4C34A 5K0XA 2EB3A 2F2CB 3EHAA 4C8BA 1RE8A 3UPXA 3VBQA 4RJ7A 3EZRA 2ITZA 3VC4A 3HMPA 5KBRA 3RCJA 2OLCA 3W2SA 3PSDA 5ANOA 2X39A 4IC7A 2H96A 4FT5A 3QHRA 1FQ1B 4E7WA 2XK9A 5FG8A 3QQKA 3VS2A 3DCVA 3TDVA 1L8TA 2YCFA 4KD1A 1ZLTA 4BB4A 2PE1A 2UZTA 4YSMA 3C0IA 3VW8A 4DGLC 3FXXA 3VUMA 1CKJA 4YJQA 2QLUA 3GU4A 3WF5A 5AJQA 4BDBA 5JFVA 3BGPA 3F7WA 2FSOX 2QO7A 4GK4A 1UU3A 4KIKA 4EK4A 4FKVA 3BE9A 5FP6A 5AV4A 2P2IA 3DB8A 3ATTA 1LPUA 1XQZA 4LGHA 4OTGA 4G6OA 4P5ZA 3LCDA 1UA2A 2UUEA 4X3FC 4NL0A 2QD9A 4GCJA 3CGOA 3TN8A 5HTBA 2BUJA 2WNTA 4YP8A 2YISA 3ZXZA 3MVHA 4DG3E 5AAEA 4OW8A 2R0UA 4AXAA 4CG9A 1OMWA 5DR2A 2WQEA 3DZQA 4IAYA 4KIPA 4LG4A 4AGCA 3AQVA 1JPAA 3O17A 4EK6A 4FOBA 4ZIMA 4BIBA 1O6LA 3VF8A 1PJKA 2JD5A 4DH7A 3LCTA 4ZJVA 2J6MA 3LM0A 3IOKA 2HELA 2QO9A 4FKUA 2YIQA 2UVYA 3MPMA 4AS0A 3HMMA 3R7GA 4IWOA 2UZBA 3C0GA 4FODA 2PK9A 3ZUVA 3PPKA 4NW6A 3GCUA 3TCPA 2WU6A 1CKIA 4FNWA 4QD6A 3VN9A 4BCHA 2WMRA 5J1WA 2QURA 4V0GA 4DEEA 5LMBA 3GT8A 4N57A 4PNIA 5JEBA 2ITTA 4N4SA 4XP3A 3TEIA 4O2PA 5IA2A 2VTJA 5J9YA 2YDIA 2DWBA 4XNEA 1ZYJA 3PXQA 5M09A 3ANRA 3L8SA 4TKSA 4ANBA 3IO7A 4AN3A 2HZNA 1T46A 2O2UA 4U7ZA 3REPA 4Q9SA 4YJUA 4PTEA 4FV5A 3PE1A 5HVYA 2OJ9A 3OCSA 4I3ZA 4L3JA 4FKQA 4M69B 4YZBA 5HE1A 2W1GA 4QMOA 3PYYA 5GIPE 3Q4CA 3QQFA 1W0XC 3WOWA 3ORTA 4JX7A 4KABA 3FXZA 3ODZX 5IA4A 2W5HA 5HVKA 3NCGA 3E64A 3VRYA 2E9VA 2XKDA 5K5NA 4AUAA 3QRKA 2WTWA 1NA7A 1OKZA 3RZFA 4F7JA 1AQ1A 2WQBA 4FV1A 2YM8A 3QZGA 1T45A 5I3RA 4KINA 1WZYA 4BBEA 3R22A 1MRYA 4RIWB 2ZJWA 2RGPA 3D94A 3RPOA 2ONLA 4EJNA 4CQGA 3HA6A 5BQ0A 5HE0A 4NM5A 4YO4A 5LVNA 3VUTA 1WFCA 2V5QA 3FZRA 5K5XA 4BDDA 4CXAA 4QMQA 2F9GA 4TRLA 3KY2A 4AOTA 3IONA 3R1YA 5DFPA 3RAKA 3AMAA 1Q41A 2VO0A 4RWLA 1PMUA 1QMZA 3I6UA 4GH2A 5FM2A 2PVMA 4YU2A 2Q0BA 5LMKC 5H8BA 4EBWA 1Q99A 2VTMA 1NY3A 4IDTA 2C5YA 2WFYA 4C3RA 3OTUA 4UZHA 5JMSA 4MCVA 4C3FA 4F9AA 2BHEA 3P4KA 4BTMA 1GZOA 2HIWA 4FGRA 2CN5A 3U9CA 5AADA 1F5QA 4LOOA 3ZZEA 3L9NA 3KRRA 4G3CA 3C9WA 3ZEWA 3CY3A 3P78A 4J71A 1FVTA 2R5TA 3V01A 2CCIA 4CFWA 4PTGA 4ZLZA 3VQUA 5AP2A 2Z7RA 2XNNA 5F94A 2X7GA 2KTYA 4EOLA 3HUCA 5FP5A 4BDIA 5B2MA 4MNEA 3UNKA 4AW1A 3W2CA 2PZ5A 5CANA 3OUKA 4CRLA 4EKKA 3NEWA 3UDBA 4CQEA 4MXAA 2XKEA 3HV4A 4HCUA 2H9VA 2J5FA 3EN6A 2GFSA 4XBUA 1ZOGA 2BAJA 4J8MA 5E9EA 4DTAA 5E8TA 3CJFA 5EM6A 4FTJA 2OFVA 4ITJA 5KHXA 1H07A 3TUCA 2XIZA 3QZFA 2R64A 3E62A 4WHZA 2HK5A 3RJCA 4YJSA 3L8VA 4PY1A 5EM7A 4MD7E 2JIVA 1Q3DA 3UE4A 2VO3A 4ASXA 2HAKA 4IVAA 4QMWA 2CLQA 4R8QA 3DBCA 4EZ5A 2XS0A 2R3PA 1M7QA 2GQGA 2YJSA 3DK6A 3JVRA 3N51A 3UVRA 2B9HA 5J79A 3CKWA 3GP0A 4LUEA 4X2FA 1R78A 2BTRA 5IA3A 3PY0A 4ASEA 2HOGA 4ACMA 5A6OA 2YM5A 1HCLA 4YSJA 2C3IB 4CMTA 2PUIA 1WBOA 3BEGA 3DK7A 3P79A 3QD4A 1OKWA 2C5XA 3DLZA 4FMQA 4IACA 3UO4A 4I5CA 3ZM9A 4USDA 4E20A 2BFXA 2DUVA 2X4ZA 2GTNA 4RFZA 3G0EA 3FMHA 4FC0A 4I6FA 5M4CA 4FGBA 3W33A 2WTJA 2HZ0A 4QQCA 4QTAA 2OK1A 4X7QA 1GZ8A 4KWPA 3BQRA 4KSPA 4QNAA 1E1VA 4JBPA 3LPBA 4P7EA 4ZSEA 5CEQA 4BCQA 2RFSA 4MXOA 4TZRA 1J7IA 2OW3A 3ACJA 3PXFA 2OI4X 5HVJA 4RA5A 5A14A 4AX8A 3LFBA 4O6LA 4AA4A 3NCZA 5A4TA 5L4QA 2JDSA 2CNQA 4NW5A 3PXYA 1JQHA 2XK4A 4IH8A 1J7LA 1AGWA 5EYMA 4Q5EA 3D4QA 3NYOA 4EYJA 3S0OA 4XUFA 4I5PA 2QU5A 3QQJA 1SM2A 3D2IA 4FUXA 5CNNA 5DWRA 5IZFA 4PDYA 4ONAA 2VGPA 3FKOA 5J5TA 4RX9A 5CAVA 4GT4A 4EC9A 5CAOA 5KMIA 3KXNA 4YO6A 1M17A 1U54A 4GJ3A 4EOMA 3OTVA 1IAJA 4LM5A 2A1AB 1CTPE 2IW9A 3WF9A 2QI8A 4GEOA 3QTZA 4C3PA 3LLAA 4AU8A 3D15A 4AT5A 2E9NA 3DK3A 1WMKA 2FGIA 4GT5A 3D5VA 4R5SA 4YC3A 3KA0A 1U5RA 4DGOA 4ZZOA 1PXIA 4CVAA 1ZARA 5CVGA 4OTIA 3RCDA 1KOBA 4F9WA 5JGBA 2R3HA 3FLZA 2ITVA 5E4HA 4O7VA 4O81A 4ZSJA 3A8XA 3IECA 2W4OA 4FV6A 2ESMA 2GNHA 4NKAA 4MD8E 4FOCA 3MH1A 3PG3A 1WBWA 4TT7A 4F99A 1OL5A 2XNPA 2VWYA 2PU8A 3CE3A 1YHVA 2YLEA 1K3AA 4FTNA 1SVHA 4FIJA 1H08A 4MHAA 3R9RA 5EDPA 2GTMA 4FKRA 4DTKA 4FG9A 4D58A 3MH0A 3H9OA 3EH9A 4ZSGA 3KN5A 2ERKA 3R9OA 4XCUA 2JBPA 5E8ZA 4EK8A 2BDFA 1FVRA 2H34A 4W8DA 5F1ZA 4YZMA 4M67A 4Z55A 5FD2A 1MUOA 2VU3A 3LFQA 4G3DA 4ERWA 5IQHA 2R3QA 3AXWA 2XJ1A 3EQGA 3MS9A 4HJOA 4LL0A 5E90A 4CD0A 4EQCA 3FZPA 2PVLA 3QRUA 3HRBA 3RPVA 5I9UA 4V05A 3U4WA 2I7QA 4DTBA 3ORPA 1F3MC 4JXFA 5CSXA 5C8MA 1PXMA 2X2LA 4OTQA 2YM7A 2Z7QA 3QHWA 1VYWA 2O3PA 4O1OA 5AV0A 5DMZA 4IFCA 3LMHA 4NFNA 5HIEA 2E9OA 3D2KA 1KSWA 2VWXA 2Z7SA 2BIKB 5HLPA 3LOKA 3GFEA 1XBBA 4QMMA 3EZVA 4JG8A 4XG8A 3PRFA 4IB3A 5HNBA 2ZMCA 3CEKA 2X4FA 5M06A 4WIHA 1X8BA 2VX3A 2VTNA 3ORIA 4U3YA 2W1HA 4TYIA 4I22A 2BRMA 4L3LA 5E7RA 2QOOA 2W96B 3GOKA 4IM3A 3B8QA 1H1WA 1XH8A 1ZYSA 2WPAA 1XBCA 4OLIA 3WZKA 4AWIA 3OG7A 3A7JA 3AGMA 5AUXA 3EFLA 3Q5IA 4PP7A 4C35A 1BI8A 1PYXA 4IANA 3QD0A 1H00A 5J8IA 2X8IA 2V0DA 2WMXA 3BX5A 4FG7A 4CFMA 3MPTA 4RVTA 3TV4A 4O83A 4L3PA 4DH5A 3DKCA 4LRJA 5A4EA 2PUNA 4FTOA 4CTCA 2JDTA 5JFXA 2C3LA 4KS8A 5CLPA 3M1SA 2R3LA 3LE6A 4J53A 3TZ8A 3OXIA 2QNJA 5EYCA 1Q62A 2EVAA 2YWPA 4GW8A 3FMNA 4AN9A 5GNKA 4QQ5A 2BTSA 3KMMA 4F64A 2PHKA 3LLTA 4J95A 4JNWA 3FZ1A 4BTJA 2IZSA 4QNYA 3QCQA 3TI1A 3AG9A 4CFVA 3ORNA 5JQ5A 4F1OA 4TYHB 5B2LA 4X21A 5FEEA 4RVLA 2QOKA 2VTAA 3GCVA 2GMXA 3ZUUA 4EJ7A
chains in the Genus database with same CATH superfamily
2GNJA 4FK6A 4KRDA 3QXPA 2PVRA 2OXYA 3CIKA 3TV6A 3TNHA 4W9WA 3MVJA 3BWJA 4IXPA 2R7BA 2ACXA 4O0TA 1Y6BA 3LKMA 1ZMWA 5AP6A 1J1CA 2GSFA 3DZOA 4EOQA 3IPHA 3TACA 4NWMA 4EHEA 2F7ZE 4EH5A 4AG8A 2ITUA 3GCQA 3E7VA 4MWIA 4YLJA 2OSCA 1YI3A 2WTKB 4IB1A 4LYNA 5EHOA 5C4LA 5CZIA 3DAEA 3EFWA 2R2PA 4DAWA 3KKVA 4RA4A 1Q3WA 3E88A 3VAPA 4UMQA 1OPKA 2FA2A 4MBJA 2W9FB 3ZUTA 4BCGA 4MXCA 5EHLA 5EYDA 3PVGA 5B2KA 3TKIA 3UIUA 4ZJJA 4UMRA 3S4QA 1MRUA 4IAAA 2OXXA 3FDNA 1PRYA 3RK9A 1OPJA 1U4DA 1OB3A 3IGOA 1Q8ZA 4ZLOA 5C1QB 3OT8A 4R7HA 4JRVA 4V01A 5AWMA 4ALWA 4CZYB 2PVKA 5DYJA 4ACHA 2C0TA 1CDKA 3I81A 5HO6A 3LJ2A 5AV1A 3PSCA 1SVGA 5KMOA 2WTCA 4I5HA 4YZ9A 2QONA 5CXHA 4CCBA 4QP1A 2WAJA 5ETIA 1H1QA 5IUIA 1ST4A 3O96A 5M57A 4JLCA 3SW4A 4ANOA 4ANLA 4R5YA 3VBTA 4E26A 2CGXA 4I20A 2X9FA 5HO7A 3VS0A 2BMCA 2W4JA 4L6QA 2WEVA 5DIAA 5AX3A 4JDHA 4ZSLA 4QMSA 5CS6A 5GJGA 5CT7A 4TYEA 2OJGA 2Y9QA 4BCPA 4FSQA 4FV0A 4XHKB 4BR3A 5IEVA 4H3QA 4DG2E 5IPJA 2EWAA 3OROA 5EI8A 4O1PA 5DA3A 4IAIA 3KL8A 5HBHA 4LOQA 4F78A 3RAHA 4DEAA 3COMA 1PKGA 2DQ7X 4DEDA 3L9MA 5IQAA 3CTQA 2UZVA 1H1RA 3L9PA 2Z2WA 4G6LA 3IW6A 4O7SA 3CKXA 5H3QA 5ICPA 5HE2A 4XLIA 4AGDA 3TNQB 3QKMA 2IZRA 2X6EA 2XA4A 3BQCA 5BVNA 4Y5QA 1W2FA 4D2RA 4O4FA 2JAVA 3M11A 5IEYA 5M56A 2EXCX 3EMGA 2YITA 5J95A 1YDRE 3RAIA 5AMNA 3H10A 5HBEA 4HNFA 1YXVA 3DXPA 4JX3A 4XX9A 4DYMA 1QPCA 4NM0A 2OZOA 3QA8A 1XH4A 2R3GA 5D11A 4JBQA 2UW6A 3S95A 4EOPA 3HV5A 4YJNA 4HZRA 3GFWA 5D7AA 3O8UA 3W16A 4G9CA 4IJPA 3CPCA 5IQEA 1PXOA 5KZIA 2VWIA 3QQGA 1VEBA 2ETKA 4DBXA 2OF2A 2I40A 4IEBA 3ORXA 3NPCA 1I44A 3I60A 3ZSGA 3QTWA 4M69A 4KUJA 3RM7A 4EQUA 4FKPA 5GZ8A 3LFSA 4ZY6A 1IAHA 4XG6A 4DGMA 3R30A 2J7TA 5KMKA 4APPA 5FXRA 4MXYA 3UNZA 1OI9A 3PWDA 5FXSA 4XYFA 3R9NA 3BYVA 5DR9A 4EH8A 4RQVA 5ITAA 4ID7A 5C4KA 3I6WA 3ZO4A 4FA2A 3ZMMA 4YTHA 2XNMA 2P33A 3D83A 3IOPA 2VD5A 3P5KA 4FIFA 3IW4A 4GV1A 4M13A 4QTDA 2ZV7A 4RIWA 3UVPA 4BDHA 5AUTA 4I6HA 3KB7A 4WBBB 2JKMA 2G01A 4MWHA 1V1KA 3KMWA 3O8PA 3NDMA 3Q9ZA 4W9XA 2J0JA 3I79A 3QTXA 3NX8A 5BX0A 4D9UA 4ITIA 3QQLA 2FSMX 2QHMA 4EOSA 4C38A 5JGDA 4G31A 2ITNA 2R3KA 4C4GA 3QKKA 4JVGA 3IDPA 1NVQA 5CYIA 4O0YA 3FMMA 1UU9A 4DFXE 4CMUA 3IGGA 5JFSA 4XH6A 3VW6A 4FUYA 3EFJA 3U6IA 1IR3A 4FF8A 3UIBA 5KKRC 3WI6A 2X0QA 2R9SA 3PA5A 3I7BA 3BYSA 4L53A 5HKMA 4FTTA 2J90A 2C3JA 4RIYB 3FEGA 4OT5A 1ZZ2A 3G9NA 4WG5A 5T68A 3RPSA 3Q52A 5IU2A 1U5QA 3GU5A 3U87A 1PXLA 4QMPA 5F9EA 3MIYA 2WMUA 4BBMA 1OECA 3F9NA 4O91A 4YTCA 2JAMA 3M2WA 3OY3A 4EHGA 3BLQA 2ZM3A 1BUHA 4M0YA 4R3RA 2ZMDA 1NXKA 4KBKA 4P90A 1DM2A 2VN9A 5L6OA 2Y4PA 4NYEA 4R3PA 4QQJA 3RI1A 3JYAA 5HU3A 4QMZA 3MVLA 4GIHA 4YC8A 2ZV9A 5DI1A 4K11A 5EW9A 3LCSA 4AAAA 2XK6A 3LJ0A 3PY1A 2XKFA 3IK3A 4WRGA 1JOWB 4O7LA 2Y6MA 4A4OA 4CRSA 3HYHA 5ETFA 3WZJA 4G2FA 2C1AA 3FY2A 4L45A 2HWOA 2CMWA 4DC2A 3AC8A 2RFNA 3QALE 1ZOEA 3ANQA 3Q2MA 3ET7A 3P1AA 2B7AA 2PZRA 3F5GA 3ELJA 3FHRA 3EL7A 4O96A 3S1HA 1VR2A 1XMLA 3FLSA 3DS6A 2JEDA 3SXSA 4NEUA 1JWHA 3VRZA 5CF4A 1OVEA 3S00A 4D9TA 4TWCA 4RX5A 3GVUA 4A07A 3RNYA 1Q24A 4D0WA 3FMLA 4D2VA 4E6DA 5E8UA 3ITZA 4IB5A 4AE9A 3MW1A 3CQWA 5BVEA 4D2TA 3OCGA 4NM7A 1ZZLA 4PWNA 1OL6A 2ZAZA 3D14A 4L42A 3E87A 3R63A 4U97A 3KCKA 4RG0A 5DVRA 2PL0A 2R4BA 3CBLA 5AM7A 5HG9A 1ATPE 1DI8A 4IZYA 4IE9A 4PMSA 3KC3A 4W4YA 4BC6A 5A4QA 3NZ0A 2X8DA 3SV0A 4FKWA 4I23A 4M97A 3A7GA 2W7XA 1TZDA 2PY3A 1OKVA 4U79A 4Z7GA 1J3HA 2CGUA 4D5KA 3RPYA 1BLXA 5JGAA 4CYJA 3IG7A 5BVDA 2X8EA 2XBJA 2YDKA 5TO8A 2QLQA 1DAWA 2QOHA 3RK5A 5GJFA 4AN2A 2IZUA 5L2SA 2ERZE 3NLBA 3UPZA 2PUPA 2X0GA 4FZFB 3QWJA 3VBYA 4O0SA 1GIJA 3MH2A 3ZFXA 2J0MB 4LDTA 5CXZA 3T9IA 5KCVA 4X2NA 3F3ZA 5D10A 1VLRA 2WB8A 1QPDA 3OCTA 5CU6A 4WSYA 1ZOHA 3ZDIA 4C4FA 4CV9A 5BVFA 5CSWA 2HY81 3V04A 3LFDA 4FEUA 5CY3A 2OXDA 5EW8A 4PTCA 2I1MA 2WMBA 4BKJA 2A19B 1XH9A 5C01A 4XRLA 4DEBA 5BUIA 4IVDA 4CLJA 3QTSA 4K77A 4FVQA 2GS7A 3FL5A 4CFNA 3N4TA 3FKLA 4YURA 2W1CA 4Z9LA 4HPUE 5KHWA 3TJCA 3AT3A 3ROCA 3RINA 5AUUA 3PUPA 2JGZA 3DBQA 3OP5A 3PJ3A 4I41A 5JRQA 1NW1A 1OITA 1DAYA 2HCKA 3C4EA 4BGGA 2NP8A 3SOAA 3LMGA 4LI5A 4A7CA 2F7EE 3QLFA 1UVRA 4WNKA 3FQHA 4FZAB 2BAQA 2OJJA 5AA9A 4FTQA 1G8KA 1M2PA 2BR1A 3V6RA 2GQSA 4ENXA 3BGQA 3TM0A 4KA3A 4EONA 3D5WA 2FYSA 4EUTA 4RLKA 1OBGA 5ANGA 4D4VA 3QZHA 3V5JA 4I0RA 3UOHA 4HGLA 1PW2A 4M0ZA 4XEYA 3ZO2A 4PV0A 4BBFA 2ZDUA 1FOTA 3PXRA 1O9UA 2OIDA 3RP9A 2XNGA 4E6AA 2WTIA 2YFXA 5A54A 4JQEA 1HOWA 3CD8A 4FR4A 4NJDA 5HICA 3UC4A 4C4JA 2C68A 2GHLA 5EKNA 3PIZA 1XH6A 4X2KA 3RNIA 4O82A 4QTCA 2QOLA 3RWQA 3ZBFA 4I24A 3BL9A 3KXMA 2RL5A 3ZBXA 3Q5ZA 2HWPA 4M7IA 4BICA 1WBPA 2R3IA 3D0EA 1KE6A 2PVYA 2QU6A 5J9ZA 4I0SA 3MY0A 2NNWB 3EKKA 3LMIA 3ID6C 3NGAA 2A0CX 3KQ7A 3A4PA 4F6SA 4PDPA 3FWQA 3RZBA 1WBTA 5AP0A 3AC5A 3NIZA 3MY1A 4IBMA 3QLGA 4AOIA 4QT1A 4YLLA 3GC7A 4XV3A 4EH7A 1A48A 3NUYA 3E93A 3OXTA 2B4SB 3LFNA 4M8TA 4IZ5A 2EB2A 5H9BA 4BDGA 2PMLX 2B0QA 1FMOE 3FLWA 5LVPA 1REJA 2YJRA 4BCNA 2XAOA 3P7BA 4ZS0A 3G15A 4XRJA 3F2AA 3QYZA 2YEXA 4GVJA 4DEIA 4TNBA 3VS7A 3DJ7A 3L1SA 4XV1A 5DG5A 4P2KA 2OJIA 5CSVA 5E1SA 4UXQA 4BZOA 2P55A 4UYAA 5CSPA 4QMXA 2C4GA 2WMVA 4CCUA 4F08A 3FQSA 3AMYA 5T6KA 4ACCA 5DRDA 2PZYA 3UP7A 2GHGA 4DINA 4OR5A 4HGSA 1OZ1A 4FZDB 4TYHA 3N4UA 1UWHA 2B52A 1H28A 3ZLWA 2GS2A 3PVUA 4DT9A 2F7XE 3QCXA 4EOKA 3UGCA 2RKUA 5AAFA 4JDJA 4DGNA 3TJDA 1LEWA 3IS5A 2IW8A 2O0UA 2XIXA 3AOXA 3Q60A 2I0EA 3PXKA 2EU9A 4GRBA 3JY0A 2JFMA 3UQCA 4AAYA 4F0IA 4R78A 4BI2A 2F4JA 3NUPA 1OBDA 1OGYA 3BEAA 1S9IA 2XANA 5FDPA 5LVLA 5IMXA 4ACDA 3NYXA 5IH6A 1SNUA 1ZMUA 4QPAA 5A46A 2YM4A 1JKTA 2WTVA 4PUZA 4CFXA 4D2WA 5BUEA 5CAQA 3W0OA 1PXPA 4AXDA 5FEDA 1MRVA 2PYWA 2YCQA 5GIOE 3E8EA 5CNOA 3AKKA 5HCZA 3VS5A 4ZP5A 2IVSA 4C4EA 3AC1A 3OMVA 3QD2B 2VX0A 5B0XA 3FV8A 3P7CA 4DA5A 4YTFA 2WQOA 3DGKA 4A9RA 3KXHA 3E3BX 4S33A 4U80A 4X6RA 5EW3A 4C62A 1YWRA 4Q5HA 3B8RA 3CGFA 1WVXA 3BYMA 3NR9A 5L2IA 4BZDA 4ZOGA 3NS9A 2UZNA 5J5SA 2VWZA 3FLQA 1H01A 2AC5A 2XH5A 3KGAA 3MPAA 4NH1A 4QYFA 4BGQA 2XZSA 4BI0A 2REIA 3LCOA 4BRXA 4R7BA 3W0SA 4YHJA 2HZIA 3FMJA 2FB8A 2XIYA 4AT3A 4AZEA 3MTLA 5CX9A 3R8LA 1YI4A 4EI4A 4F65A 3DAJA 5FEQA 2E9PA 3NUAA 3VUDA 3EN5A 4B4LA 2OIQA 1PYEA 4FZ7A 2VX1A 3KXXA 4FT9A 2XCKA 5CEOA 3ERKA 3POOA 2CKPA 3P5JC 4AFEA 5AM6A 4ZK5A 1P5EA 3MH3A 2CGWA 3HV6A 4IVCA 3MB7A 3K3IA 3R6XA 4J98A 2B9FA 4L67A 4RJ5A 4OTWA 4KKGA 2VTPA 3COIA 2OJFE 3H3CA 3QWKA 4IC8A 3ZEPA 3NUSA 1XBAA 3SVVA 2OH4A 2UZOA 2YZLA 2BDWA 4I4FA 1PF8A 4U0IA 4FTLA 3A4OX 2IW6A 3AKLA 2VNWA 1J1BA 2UV2A 3U6HA 3F3WA 2WGJA 4PPBA 3GENA 4XMOA 3UODA 4NKSA 3ZONA 4O7ZA 1YQJA 3W0MA 5IF1A 3H9RA 3DBEA 2G2HA 4FKTA 4EK3A 3MI9A 4O7NA 3U8WA 5AV3A 4CLIA 4USFA 1OPLA 3LQ5A 4FICA 5LCJA 5HNIX 2CKOA 4H05A 3FI2A 5C9CA 1YDSE 3AC4A 3HNGA 3QFVA 3O7LD 4C59A 3PJ8A 2BFYA 2UZEA 3KK8A 4JR3A 5I4NA 1BL7A 4FV3A 4ZMFA 5BMSA 3FI8A 2XVDA 1ZY5A 2V55A 3GI3A 4MH7A 3V5PA 1P2AA 2BIYA 3VUGA 4ANNA 3ZFMA 2XYUA 3D7TB 5IISA 3MFRA 3OF0A 4AZSA 2XK7A 3OS3A 4I1ZA 3QX4A 2J9MA 5G6VA 2V7AA 3GUBA 1H0WA 2C3KA 2YIRA 2XRUA 4LQMA 5D7VA 5M55A 3F61A 5CF5A 4FV8A 4QEBA 1WAKA 1YW2A 2JDVA 2UZLA 3AD4A 4XBRA 4CV8A 2XIKA 4L52A 3OCBA 4BKZA 5M07A 5IUHA 3Q04A 4O7RA 2UW9A 3FMKA 2NYAA 4DT8A 1LR4A 4DHZA 4O21A 3AMBA 4CTBA 1ZY4A 4JAIA 4CKJA 2BDJA 3UP2A 2VUWA 3T8OA 2OBJA 3DV3A 3DFCB 4ZTHA 5T3QA 3BU3A 4I21A 1YVJA 3HP5A 4B7TA 2CNUA 2XK3A 2VTHA 3RAWA 3U51A 2ZV2A 4TXCA 3VF9A 3ZOSA 3G5DA 5E92A 4BYIA 5CF6A 3GXLA 5HLWA 1M14A 4U40A 4LRMA 4MKCA 3SXRA 3V5QA 2VWWA 3ZLXA 5L8KA 4Y72A 5EFQA 1Q5KA 2IPXA 4S2ZA 3HL7A 2ITYA 3ATSA 4FIEA 3DTCA 2IVTA 4YBKA 3ZLSA 1H1SA 4E4NA 4O38A 3LXLA 5IMEA 4J97A 3UOKA 4K0YA 4LMNA 2W1EA 3LVPA 5LWMA 2ITXA 3HGKA 2IVUA 3QF9A 4YUQA 4ZTQA 4HYUA 1WBSA 4YZNA 2XEYA 1OUKA 4HVHA 4PL3A 4J1RA 1CM8A 4O4BB 3W32A 2X6DA 1Y91A 3QC4A 5LJJA 4IVBA 5EDRA 3P7AA 3AD6A 1VJYA 5J7HA 4GK2A 3DXQA 4FEVA 3F5XA 4QP2A 2NRYA 3O5AA 3UMXA 4B6LA 3OWKA 1W7HA 2OIBA 5HIBA 3NUNA 1J7UA 1YHWA 2YAAA 3ALNA 4RIYA 3F66A 3OBGA 3C0HA 3KXZA 4ARKA 4I6QA 4UMUA 4O7WA 2PVFA 4BDJA 5CU0A 3VHKA 3FSFA 4F7SA 5HTIA 4YBJA 5C8KA 1Q8WA 2IZTA 4JG7A 5ANKA 5JKGA 5D41A 4X0MA 2YIXA 4FKOA 4JDKA 2NO3A 4G34A 3OT3A 4GU6A 4DFYA 3AT2A 3C4WA 2WZJA 4S30A 5AR8A 5HHWA 3ENHA 1B39A 5CAUA 3R71A 2QCSA 3ORKA 5E91A 3GCSA 4UMPA 4Z3VA 5E8SA 4AP7A 3ACKA 4BDAA 4IWQA 4Q9ZA 4K33A 4QP6A 3RALA 4LGDA 1W83A 3LM5A 3FZTA 3BYOA 3LXPA 3QGYA 2HZ4A 3MY5A 4WD5A 1ZWSA 4FV7A 3ZCLA 2JDRA 3CD3A 3ULIA 3ZO3A 1V0BA 3B2WA 1PMEA 5E8YA 1K2PA 4FKLA 1L3RE 4B99A 3LQ8A 3M42A 2C6DA 2VO6A 2XM9A 4C2VA 5CSHA 4UB7A 2G9XA 3NVMB 4UEUA 2BHHA 4C0TA 2IG7A 4GG5A 4HVIA 4EQMA 3SW7A 2PPQA 3E7OA 5BUJA 2GDOA 5ETCA 4XJ0A 5TKDA 1GIIA 1ZXEA 3BE2A 4L7FA 3UTOA 4JBOA 2WHBA 4JL9A 2EUFB 4EORA 2SRCA 2QOCA 4G9RA 1U46A 3FLYA 1SNXA 3I0OA 4ANSA 5D1JA 4FNZA 3W10A 3HAVA 3LJ1A 4OTRA 4AZVA 4AT4A 5K4JA 3QRTA 2FH9A 1Q61A 3SA0A 3VJOA 5IA5A 4FBXA 3LFEA 4EH2A 3FE3A 3OZ6A 1W84A 5CI6A 1G8AA 4I92A 2ONLC 4NIFB 3KREA 3W0NA 1M2RA 3C4CA 1IG1A 3BKBA 3PLAE 2PMIA 1JVPP 4W8EA 4DN5A 4F09A 3JS2A 2UVXA 4C57A 4L01A 3FY0A 4YLKA 5TF9A 5IQBA 4KBCA 1SZMA 3EWHA 4UMTA 4YZDA 5IG1A 3TTJA 3HECA 4O0RA 4FT7A 3HMNA 4E3CA 4M84A 3UO5A 4YGAA 3N4VA 2GNGA 1JKSA 4XG4A 1XJDA 3EQCA 1PMNA 1JSVA 2XJ2A 4J96A 4MXZA 2UZUE 3A7IA 3QTUA 5HI2A 3CTHA 5HEZA 4DG0E 4C36A 3ML1A 4F7LA 3PIXA 3WIGA 3ZHPC 4QYGA 2B54A 2WQMA 5EH0A 5I9WA 3F82A 1KE8A 2EXEA 1UNGA 2RG6A 4U41A 5HG8A 4UN0C 2QR7A 3KCFA 3O2MA 3R7OA 4H36A 3HEGA 5E8XA 1YWVA 1R0EA 2G2FA 5GINE 4OAVB 4MF1A 3G51A 4DCEA 2WTKC 3FHIA 3VUIA 5L2WA 3JR1A 2UW7A 3P0MA 3R28A 2I6LA 5CVHA 4HCTA 5L3AA 2OFUA 4Q2AA 4O0WA 2XP2A 3TG1A 4NUSA 4ZY4A 3U6JA 2P3GX 2ETMA 3C7QA 2OO8X 3AD5A 4RFMA 3A62A 1OIYA 4QPSA 2R3NA 4UZDA 1KWPA 3R9DA 5CALA 4RJ3A 5A6NA 4XLVA 3V51A 3R04A 4MK0A 3QCSA 3PFQA 2YZAA 4D4RA 3FPMA 3BWFA 1JAMA 2OH0E 3F7ZA 4K1BA 5JQ8A 3DPKA 4ZY5A 4BTKA 4RLLA 4FSMA 1B38A 4GFGA 4WUNA 4ZTLA 4K18A 3SX9A 3WE4A 4D2PA 4EWHA 5DNRA 2J0KA 1H4LA 1R39A 3TUDA 2BILB 5BVWA 2BALA 2VV9A 4BVUA 2XYNA 5A9UA 3WZDA 3SLSA 4X2JA 4ZZNA 4Z7HA 3Q4ZA 5BVOA 1I09A 2PZPA 5KMLA 4UWBA 5EK7A 3CQUA 1QPEA 1TVOA 4PMMA 4AXCA 3OC1A 4HYIA 3EN9A 3KULB 2W1IA 4EEVA 1PMVA 2GNFA 2X81A 3FJQE 4FIHA 3FL4A 4GL9A 5A4CA 5IA0A 5C03A 2XM8A 5DT0A 4ALVA 5KMNA 2ITQA 3RM6A 3SGCA 4YPSA 3FC2A 4FIGA 4O86A 3PA3A 4Y85A 4QYHA 4DFBA 2QG5A 2J51A 2B9IA 1YWNA 5AP4A 2E2BA 5J1VA 4I0TA 3IKAA 4OTHA 4KRCA 2CJMA 4OUCA 5AP3A 3V8SA 3WZUA 2W5BA 4FL3A 4AZTA 3TUBA 2YN8A 4I93A 2IN6A 4IJ9A 4C2WA 4JIAA 4ZTSA 2X9EA 4OT6A 3W55A 3V5TA 3F3TA 4ZMEA 3OEFX 3ZSIA 3HP2A 5FRIA 4KB8A 3TNPC 3QUEA 4D2SA 3FYKX 3ZO1A 3F2RA 3RTPA 3R8ZA 2HW7A 3PE2A 2PULA 3LXKA 4WNOA 2CPKE 2WD1A 2OICA 3CCNA 5CT0A 5CASA 5KO1A 3R2YA 1IA8A 3R7EA 3I5ZA 4IHPA 2QVSE 3TMOA 3CPBA 3DKFA 4ITHA 3OD6X 1MP8A 3SQQA 3MB6A 3NAYA 2JIIA 3TWJA 2I0HA 4E73A 4EH9A 2GS6A 5IEXA 4IADA 1GAGA 1YI6A 2C6KA 4P5QA 4F63A 2J0IA 3TKHA 4W4VA 4QTEA 3ZFYA 4C4HA 2PE2A 4EOIA 2P2HA 3BBWA 2V62A 3PP0A 4RBLA 2LAVA 3GU8A 4G3FA 4HVDA 4TL0A 4FTKA 5J87A 4E1ZA 4CYIA 4E8AA 1DS5A 4WT6A 5FDXA 2Y4IB 3HV7A 4MBLA 3EFKA 2JLDA 3DNDA 1YKRA 2FSTX 4IWDA 4DCAA 5I0BA 3QXOA 5BV3A 4M15A 4WSQA 1JKKA 4GT3A 4BIDA 4F9CA 2QKRA 3O8TA 5DR6A 2CLXA 4U6RA 3IDBA 1Q97A 4NZWB 5EI6A 2HXLA 3QUPA 4MQ1A 4PDSA 4QP9A 4PPAA 2HXQA 4DEGA 2XALA 1UV5A 2BKZA 3G6GA 4IFGA 2AC3A 3CC6A 3H0YA 4RWKA 3SRVB 5ANIA 1YOJA 3PZHA 5A3XA 4S31A 4LV8A 3T3VA 4EK5A 2NPQA 5C8NA 3EQFA 3EYGA 4ZZMA 3PIYA 1IRKA 4GMYA 5AIKA 4RJ4A 1PXKA 3NNWA 4C37A 3KXGA 5HD4A 4WG4A 3LQ3A 2G15A 3LFFA 4IWPA 4JR7A 4RWJA 3UQGA 3JPVA 5DT4A 4RC3A 1XO2B 1Y8GA 2WEIA 5HCYA 3DU8A 3EKNA 4BTFA 4YJPA 5FTQA 3KFAA 3QX2A 4M66A 3I4BA 1BX6A 5CTPA 4QO9A 5M44A 4U5JA 4OAUC 4MD9E 2EXMA 2VWUA 3PFYA 3VQHA 4LOPA 4EHZA 4GJ2A 4IQ6A 4M3QA 1GOLA 4P4CA 4UXLA 4WOVA 4HOKA 3A7HA 3HLLA 4BKYA 3BHHA 3QZIA 1R0PA 4N6ZA 3TZMA 4A4LA 2W17A 4C58A 1Z57A 4RFYA 1Q8UA 3PXZA 3NNXA 3VONA 4UBAA 2YM3A 5LMAA 3ORZA 4QYEA 4FJVA 5HIDA 3LW0A 3BV2A 3RHKA 1H26A 1Q8TA 2WIPA 2XRWA 2YM6A 4PF4A 4D1ZA 4F70A 3V8WA 3CTJA 5DHJA 5HTCA 4ORKA 5C27A 4JIKA 1QL6A 2WXVA 3TIYA 1ND4A 2C6LA 2XBAA 2XMYA 2C5NA 4I6LA 3PSBA 4UYNA 5L2TA 4IM0A 5K9IA 4J7BA 4Z16A 4E93A 3PZEA 2E9UA 3TT0A 4K6ZA 2XUUA 3KRWA 4Y95A 4DLIA 4ZAUA 3UC3A 3EN4A 1OL7A 1O6KA 2VTQA 3MIAA 2GFCA 4HVSA 4DE4A 1ZYLA 1SVEA 5FWKK 2BKKA 2PUUA 4IX3A 4YHTA 5ANEA 4D4YA 3OUNB 5DRBA 5K3YA 4ASZA 4XG9A 2Q0NA 4QMLA 5EM5A 1G8JA 1GZKA 2VTOA 4WNMA 2HYYA 4QTBA 3OWPA 4RIOA 3KRLA 1KE9A 3KVXA 2J4ZA 3DKGA 3HV3A 3ULZA 4E4LA 3NNVA 4FK3A 5TT7A 2GCDA 3BGZA 1FGIA 1M7NA 3GNIB 4I6BA 5EI2A 3NAXA 4MYGA 4X2GA 2VTSA 3WIKA 2WMAA 4GYGA 4HZSA 4TWPA 3I5NA 3UYTA 2Y0AA 3CLYA 3F3VA 2BZKB 3PJCA 2UW8A 3K3JA 3V5LA 2W1FA 5BPYA 4FVPA 2UVZA 1Y6AA 4KBAA 2GNLA 2YACA 4O0VA 4RIXB 2CKQA 2CNVA 3HDNA 4H3BA 4MXXA 5L2QA 4ANMA 3UBDA 3FAAA 2XNEA 3D7TA 5FLFA 5DLSA 3NYNA 3SAYA 3TV7A 4PX6A 3LAUA 3KU2A 4KSQA 3UZRA 3MFUA 3CS9A 4N6YA 4FKJA 4OBOA 5AV2A 1G5SA 2DYLA 2F57A 2QOQA 3NSZA 4LGGA 4M12A 4IMYA 4AXEA 5FBOA 5KNJA 3MDYA 5LWNA 3HX4A 4U8ZA 5H8EA 4ANQA 4YPDA 3AC2A 4JOAA 4D0XA 4EH3A 4EWQA 2UW0A 1WBNA 2J0LA 3HUBA 3NRMA 4XG2A 2C6EA 1Z5MA 3ROYA 3UOJA 4NM3A 2BCJA 4BDCA 4RVKA 3FYJX 4OGRA 2JBOA 4X3FB 1IEPA 4R7IA 2LGCA 4Y73A 5CEMA 5M4UA 4WNPA 4AZWA 4F7NA 2BRNA 1ERKA 3PWYA 4FV4A 3D5UA 5I3OA 3SKCA 2Z7LA 3LCKA 3BCEA 3ENMA 3CY2A 3H0ZA 2J50A 5BYYA 4DHFA 3SG9A 4BFMA 4O22A 4FIIA 3R2BA 3KRJA 2VTLA 5HG7A 4PNKA 3PA4A 4JG6A 2YERA 3SG8A 2WMQA 2WOUA 4F0GA 4W4XA 5ETAA 4ZTNA 3OOMA 4L46A 3RWPA 4BZNA 5EOBA 4QQTA 1XMMA 4NU1A 4GVAA 4RJ8A 1BYGA 5EG3A 5M51A 1W82A 4E6CA 3BIZA 4QOXA 3EYHA 5CEPA 3C4FA 1A06A 4CKIA 2R7IA 3ZLYA 2C69A 5L6WL 1JSTA 2R3FA 4YJOA 1TQMA 3UZTA 2W0JA 4DFLA 3OW3A 3QA0A 3FI4A 3LZBA 4GG7A 3I1AA 4JDIA 1JLUE 3I0QA 3U9NA 4BI1A 1KV1A 4GFOA 4RZWA 4ASDA 4F0FA 5HU9A 1NVRA 1PXJA 5LCKA 2RIOA 4BIEA 2C6IA 4U42A 4NFMA 4FSWA 4AOJA 4AA0A 4E5AX 3TIZA 1P4FA 2O64A 4XV2A 4UWYA 5E8VA 4AW0A 1FBNA 4DFUA 3CJGA 2UW5A 3FMEA 4PQNA 5AP7A 4J99<