4L53A

Crystal structure of (1r,4r)-4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)-3-chlorofuro[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}cyclohexan-1-ol bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
296
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
publication title Discovery of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1: Optimization of kinase selectivity and pharmacokinetics.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 296
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l53A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l53A01
5ANGA 4PQNA 1ZOHA 4FSWA 4YTHA 3QBNA 5C27A 4TTHB 1L3RE 2CDZA 4FSYA 4FT0A 2UVYA 4LGHA 5H9BA 4ZEGA 4D2RA 4DTBA 5IQHA 4MCVA 2YERA 4U9AA 4FV4A 4JRNA 4LGDA 4LOQA 3OCTA 2GNGA 4FSQA 3E88A 3LCDA 4H3BA 2J50A 4HCUA 5CI6A 5HCYA 4BTFA 4EH7A 3OC1A 2HYYA 4ANSA 4AP7A 2CMWA 5A6NA 1JPAA 1Q3WA 5CEKA 3BU5A 1K9AA 4RVMA 5EW9A 1TKIA 4ORKA 3VBXA 4FV3A 3NWWA 2OXYA 1BL7A 4F6SA 3ZLWA 1IEPA 2W9FB 4YJPA 5A4EA 2PVFA 3ORIA 4RSSA 1YHSA 4OAUC 4CSVA 3DK3A 2YHVA 3OBGA 3FKLA 5CT0A 4X3FB 3D0EA 4W4YA 3FMKA 3OXTA 3Q96A 2PVJA 1CTPE 3K54A 3VBTA 4AW2A 4EH3A 3TT0A 3A7FA 2OZAB 3DB8A 2E9UA 4LOPA 3GOKA 1BKXA 3CIKA 3A7IA 3NDMA 2J0MB 3G5DA 5CAQA 4CFWA 3F2RA 3KXGA 3QX4A 4I0TA 1S9IA 2GFCA 3V5PA 2GTMA 3WARA 3W2RA 2VTTA 3EJ1A 3LMGA 4GU6A 4I22A 4WSQA 2OJIA 2PK9A 3AMBA 4CEGA 4USFA 5BVNA 2LGCA 1BL6A 3CQEA 4OR5A 4K8AA 4CKIA 4DGLC 2YJSA 2I6LA 4D58A 3HNGA 4H3PA 2W1DA 4FKGA 3DJ6A 4CKJA 5DG5A 4EEVA 4NYEA 5HO6A 4M0ZA 2YACA 4IM3A 5IDPA 3COKA 4FV5A 1STCE 4FZFB 4RIWA 3HGKA 4OGRA 5HO8A 1RJBA 2BUJA 4PL4A 3G0EA 2I0VA 3PXQA 3SD0A 3NR9A 4NM5A 3Q4TA 2X7FA 2YCSA 4GSBA 3K2LA 4QTEA 3U8WA 1ZOGA 2Y4IC 2ZB1A 1IA8A 2X39A 3FPMA 3R02A 3R2YA 4KD1A 4YHTA 3POZA 2ZDTA 3QQUA 4YJOA 5DHJA 3RAKA 3O17A 3TJCA 5DRDA 5JN2A 3DAKA 1J1BA 5KHXA 4DGOA 5FLFA 2QNJA 4RX9A 4YLJA 5HTBA 5JFVA 1YXVA 2JC6A 3IS5A 1QL6A 2FSTX 3PIYA 3KXXA 4U5JA 4DH8A 2P3GX 2QQ7A 3F3TA 2Z7RA 4C02A 2RFDA 4FKRA 4IWPA 3RK5A 5CY3A 3EQFA 4WG3A 4YP8A 4B9DA 3KEXA 2ITPA 4CZTA 4J96A 4IJPA 5AAEA 3WYXA 3LFNA 3IW6A 5EDPA 1OUKA 3IKAA 4G1WA 4HPTE 4LRKA 4RMZA 5B0XA 4PDPA 3TI1A 4F1MA 4D9TA 1OZ1A 3KFAA 4AZSA 3AQVA 3IQ7A 3LFFA 4A9SA 4I4FA 3S0OA 4NM3A 3UGCA 4ZZMA 3ZZWA 4JVGA 4D55A 2C6TA 2XJ2A 3ANRA 2WQBA 3E62A 4QMOA 3TNWA 3V5TA 1H1PA 5CF4A 3MJ1A 4FV1A 4FBXA 2PZ5A 4AN9A 5JSMA 2JAVA 4DF3A 1G5SA 2E9NA 3OTVA 4I1ZA 3CY2A 4E5WA 1OL7A 3KRLA 4I6BA 3R21A 3VUKA 3BQCA 5E4HA 3O8UA 4DGGA 3VAPA 3WF8A 3G9NA 1M7NA 4ZJJA 4UALA 4I6QA 1JWHA 2QOBA 3O51A 3I0QA 4JBVA 1CMKE 1IASA 2EUFB 4V05A 3BWJA 4JLCA 1DI9A 4Y5QA 3D83A 2BIYA 2JBPA 3WI6A 5AV3A 2PZYA 2Y4IB 2W4OA 3A4OX 1V0BA 5AR5A 2QKRA 3GGFA 4HNIA 2PUUA 4CG9A 2E9OA 3SAYA 5G1XA 5IUIA 4BL1A 4D2PA 5C4LA 3KCKA 4NL0A 2W1GA 3PE1A 4MVFA 3FSKA 4UY9A 4AG8A 4CFUA 5DYJA 2PY3A 2W1HA 2FSMX 2BRBA 4UMQA 5LMBA 3C4ZA 2VWUA 3QALE 2V5QA 4PMSA 2BVAA 2X2KA 4QYHA 2HWOA 3UC4A 3R0TA 3W8QA 1F3MC 4OTIA 2UZBA 3QQLA 4O7ZA 2C6OA 1YDTE 4E20A 1S9JA 5KBRA 3DQXA 2GHMA 4C57A 4G3FA 1OIQA 5HLWA 5M53A 3QTXA 2VTOA 3EN6A 3O50A 2JIIA 2Z8CA 2YM3A 4F0IA 2JITA 1AGWA 3RZFA 3FMHA 2OXDA 2HELA 1ND4A 1B6CB 5HIEA 4PPCA 4IVCA 4WSYA 4YJSA 5IEVA 4J71A 1H00A 4I24A 3NMUF 1OITA 3R9OA 5BMMA 1XR1A 2GU8A 4G17A 2H8HA 1Y91A 3I7BA 4FK3A 2EXCX 5T68A 4K33A 3KU2A 4BI0A 3SG9A 4C2WA 2ZM4A 4IH8A 3DK7A 1YDSE 1XH7A 2J0LA 4QRCA 3NCZA 3F7WA 3R1YA 4M8TA 1PXMA 5CAPA 4DFUA 2XJ0A 3R7UA 5CAVA 3PXKA 2QOHA 4L67A 3F3WA 4MF0A 1ZYJA 5EQYA 5FDPA 2OSCA 4A9YA 4FZAB 3RKBA 3VWAA 2YAAA 5IEXA 1F0QA 4E6AA 3ENHA 2CGUA 1CM8A 4IJ9A 3ODYX 4B0GA 5CXZA 5DLSA 5E7RA 3TKIA 1OIUA 4IMYA 2YIXA 1TVOA 3LM5A 4C4IA 3G90X 5L8LA 4O96A 3K5VA 4OLIA 4Z3VA 3BHYA 3FI3A 4O84A 2B9HA 2P4IA 3RPSA 3ZRLA 5CF5A 2HZ4A 4IE9A 3PPKA 2WOTA 3ODZX 4FSMA 5KKRC 4CQGA 2CKOA 3COIA 5FGKA 1H08A 1QCFA 3C5UA 3C5IA 3IK3A 5A46A 3JS2A 3KN5A 4WNPA 3TWJA 3ERKA 5BPYA 4M69B 4NJ3A 4EOMA 3QU0A 3VJOA 4LUDA 4C4JA 4ZY4A 3NCGA 2DS1A 3R30A 1KE7A 3DBCA 3FI4A 4FIJA 4YZMA 5HICA 3W33A 2CNQA 4K11A 4MNEA 5LCKA 4YO4A 2YM6A 3CR0A 5JFXA 3U6IA 4IDTA 3NW7A 2JBOA 3W32A 5HD7A 5AV4A 2IZSA 3H9OA 2B1PA 3LXLA 2C6KA 4FV9A 1H4LA 3ELJA 3JVSA 4PTCA 4YJVA 3QD4A 5J8IA 4O81A 4GYGA 3VF9A 2YM7A 5BYYA 3G15A 4EYJA 2G2FA 3BU6A 4RIXB 4YPSA 1BMKA 5I9YA 1PXPA 5FM3A 5FM2A 3RNYA 5IKWA 4FG9A 5AUUA 3WZDA 2XZSA 3MA3A 2R3PA 3R6XA 5J87A 5DFPA 2PWLA 1H07A 1UNGA 4C7TA 4QMZA 4D1SA 3G33A 4DLJA 3ZOSA 1TQPA 4DEIA 3TACA 2PVMA 2X4FA 3MH2A 1FVRA 2WELA 2AYPA 3CS9A 4IIRA 3AT3A 2BRNA 2BROA 3UE4A 2R4BA 4MXAA 1FVVA 3HRBA 2ZV7A 3A7JA 5AJQA 4CD0A 3NVMB 3KK9A 2O5KA 4DITA 3LFEA 4TWPA 4L46A 4X6QC 5DPVA 5JZNA 2LAVA 4BYJA 5HQ0A 2UW9A 3PA5A 4M67A 5BUEA 5KKRB 3NYNA 4FKOA 4WNOA 5FEDA 3ALNA 3DA6A 3CCNA 5AEPA 1YOMA 4YC6A 4J95A 4R5SA 4IAIA 5C26A 4FIGA 4FKPA 4GEOA 4MQ1A 4E93A 3VUIA 4JNWA 3OEFX 1ZXEA 3BPRA 3VUHA 2W0JA 4UZHA 1Q99A 5IQBA 4PDSA 3E93A 3RALA 5KHWA 1NVQA 4TNDA 3DXQA 4D2TA 2PSQA 2EVAA 3FLZA 1GZOA 3N4VA 2G2IA 4JT3A 3KXMA 2QO9A 3FWQA 2BFXA 4TXCA 3ZM4A 4UMTA 5DE2A 5IQGA 3MW1A 4EWQA 3SQQA 3EQPA 4OTGA 3IW5A 5IDNA 3ACJA 4JDHA 5IU2A 1E1VA 3VS2A 2BIKB 4XV9A 3QTWA 3QD3A 3UMWA 2QHMA 3EFWA 5JKGA 5L2WA 2VO3A 2YJRA 4KS7A 2F49A 3BYUA 3QX2A 4AOIA 1WCCA 2V22A 2UW7A 2YITA 3MY0A 2WQNA 4GRBA 4RFYA 1H26A 1M14A 3E7VA 5AUZA 4BDBA 5HNBA 4GUBA 4BGHA 4D0WA 2PVNA 3K3IA 4GYIA 1NXKA 2W5BA 4BDGA 3FEGA 2BPMA 4QMSA 4QTDA 4XV1A 2RL5A 4FTLA 5K5XA 3NAXA 2R3JA 4BN1A 4I5CA 4DINA 1ZMUA 4FIHA 4Y8DA 4YGAA 4QMUA 3DXPA 4EH5A 4BHNA 3V6SA 4AE9A 4UWYA 1IR3A 4XYFA 4QP2A 3MPMA 2QONA 4FF8A 4UMUA 2C5YA 4QO9A 2BZHB 2CHLA 2ITYA 2W4JA 3TKHA 4EOSA 5CEOA 5I0BA 3DB6A 4JJRA 2X8IA 2C3JA 5JFWA 2X2LA 3SRVB 5KMMA 3WIGA 1B39A 3NUYA 4QMNA 3CQUA 2JD5A 2PE1A 3M1SA 4O0WA 5J9LA 3QKKA 2Z60A 2J51A 3W18A 3FLNC 3UO4A 3VHKA 2WU7A 4FIFA 2J5EA 3MVLA 4I41A 2OK1A 3MWUA 3DFAA 1MRVA 4TY1A 4R78A 4N4SA 4EL9A 2OWBA 1M2QA 2UW5A 4ZZOA 3D15A 5CVGA 5DR6A 4EH6A 5DMZA 4ZSGA 3HEGA 2OFVA 4DH5A 4E73A 3IDCA 3T3VA 5LXMA 4M68A 2YWPA 5AM7A 2C6DA 4DG3E 4FTCA 1OMWA 4I6FA 4ZTMA 2HXQA 1JVPP 2NRYA 3BYOA 3H0YA 3D5VA 4B8MA 4FOCA 4RX5A 3FMLA 3KMMA 3DBQA 5DT3A 4LI5A 5E8VA 4EWHA 4P2KA 4N0SA 4XG7A 3BX5A 3BYMA 4RT7A 3R1QA 5AFVA 5F4NA 4U7ZA 3P1AA 3VHEA 5CU2A 3SX9A 3VS3A 2F2CB 2C30A 3CQWA 2ZOQA 5F20A 4CRSA 4YZBA 4EK3A 1URWA 2QOFA 2VWYA 5BVWA 5KZIA 2UZTA 3RAIA 4EQCA 5KCVA 4L9IA 4QP3A 2YIWA 3PP1A 5CSHA 4AXAA 1OPJA 5L3AA 3OW4A 4C3FA 1JAMA 1WAKA 4HGLA 4MTAA 4AZTA 4FNYA 1QPEA 2G15A 4O7TA 3RCDA 4E4LA 3A99A 2WD1A 1OKWA 2PMIA 2WTVA 4OT6A 5AUWA 4RWLA 4AE6A 4EHGA 3L8VA 3Q9ZA 4FEUA 3FYKX 2WQOA 4BKYA 2ITNA 1QMZA 4GIHA 3D5UA 4UMPA 3RMFA 3H9RA 4Q9SA 4L3PA 3BHVA 3BE2A 5AR7A 4IFCA 5IQDA 4C4EA 3E3BX 3ZLSA 4EI4A 4FOBA 2RFSA 1A06A 2VTIA 3Q04A 3PIZA 4EH8A 4O21A 5AIRA 3R8ZA 3WF9A 2F7XE 5AV2A 4BFMA 4PMPA 5LWMA 3S00A 3L9MA 2OG8A 5AADA 4PNKA 1ZYSA 4NKSA 5JRSA 4FTQA 4J8MA 2P0CA 1MRUA 3BHHA 3TKUA 4DGNA 1OUYA 4D0XA 3BBTB 5J5SA 5HE2A 2G2HA 1SM2A 3DNDA 2YZLA 4IC8A 5A4TA 1LUFA 4BTMA 4I0SA 5GZ8A 3P9JA 3NAYA 2XYNA 5IQIA 3FZOA 4JQ8A 4IANA 3H3CA 3BI6A 1TQMA 3PP0A 2YWVA 3RZBA 4EH9A 3MESA 5CI7A 3ZS5A 3NW6A 4DEDA 3CPBA 1FQ1B 2PPQA 3R1NA 1VYWA 4FV0A 3E5AA 4AZEA 2WMVA 2PU8A 3Q2JA 3R9RA 5EOLA 4ALVA 2GHLA 2R3MA 4JBPA 3R22A 2QR8A 4MQ2A 5HIDA 3PY3A 2OH4A 4ZTHA 4W4XA 4O1OA 3UYTA 4EONA 4MXCA 1Q8ZA 3V5QA 1A48A 3MY1A 1U54B 4B8LA 2H9VA 3AG9A 2OKRA 3QTIA 3EHAA 4YJQA 4DEHA 2JDSA 2FB8A 4I94A 3TNQB 3WE8A 4NKAA 4JI9A 3CY3A 3CTHA 3LQ8A 2VUWA 2B9FA 3JXWA 4AGCA 3NSZA 4FEWA 2Q83A 4XHKB 4EC8A 3OUKA 4KBAA 1PXLA 3O8PA 3SV0A 4G5PA 3O71A 4AA5A 4QMYA 4E3CA 2GQSA 3UO5A 4LGGA 2BDFA 4YTFA 3BRBA 1QPCA 3EN4A 4IWQA 4PRJA 1OI9A 2RF9A 2XYUA 4FSZA 3DQWA 4ZIMA 3W8LA 4U6RA 5H3QA 5M4UA 2IZTA 1XH9A 4W9XA 5AUTA 3VBQA 5KUPA 5L6OA 4BTJA 3AD4A 1BI8A 4Y72A 3VQHA 4F99A 3GU5A 2WTKC 3R7VA 4AT4A 1XHAA 4XV3A 5G6VA 5DEYA 4L7FA 4MD9E 3L8XA 2W5HA 3HA8A 3TIZA 4N6YA 4MD7E 4C35A 4AGDA 1Z5MA 4USEA 2V0DA 3CXWA 1WBWA 2OIQA 2CN5A 4GFGA 4GKIA 2QU5A 2BALA 4CMOA 1PXKA 2ZVAA 3GC0A 5I9XA 2OXXA 5FTOA 4O6LA 4S2ZA 4FSTA 4JG6A 2AUHA 5GZ9A 4C3PA 2XM8A 4EJNA 5AR4A 5EYCA 3NUSA 4M0YA 2WEIA 4FKJA 5D7AA 5AP3A 4EQMA 5IA2A 5M07A 4ZSAA 4HOKA 2IW8A 2O3PA 4U41A 2VX0A 2ITOA 4S32A 5EHLA 5BUJA 4DEGA 4U80A 1FMKA 2OLCA 5BNJA 2WMTA 3MFSA 3U51A 3W2SA 1YKRA 3OT3A 4AS0A 1P2AA 4WNKA 4D5HA 2A4LA 1FPUA 3HV4A 4DHFA 4CRLA 5LVPA 1LEZA 4F63A 4IADA 5EYKA 2VNYA 2ZM1A 4O38A 4Y46A 3ZFYA 2C68A 3C50A 3QF9A 3GT8A 3KF4A 3UOKA 3THBA 1UVRA 4WHZA 3ZRKA 4CZYB 3F5XA 4KIQA 4EBWA 5K0XA 2WMAA 1NVRA 2KULA 1PXJA 3UYSA 4D9UA 2PVYA 2CN8A 5I5ZA 2IPXA 3O8TA 4QTBA 4YJTA 3ZC5A 5HBEA 1XO2B 4JAIA 4DFLA 3FXXA 3W1FA 3FI2A 1ZOEA 3NIEA 2BTSA 1GIJA 1J7UA 2I7QA 3W16A 2IN6A 2G9XA 2IW9A 3DKGA 3H9FA 1WVXA 2WTKB 3FLWA 3D2IA 2PMLX 3GFWA 4L7SA 4AW1A 5DA3A 4G9RA 4KS8A 1F5QA 1YHVA 1UU7A 2JDTA 5H2UA 3W2OA 2UW6A 4IB5A 4EUTA 2WTWA 4CT1A 5AV0A 3PVUA 5HLNA 3PXZA 2R3GA 3QUPA 4UYAA 4FE2A 2A0CX 2RSVA 2HZNA 4DFYA 1XH8A 1J7IA 2C5OA 3CTJA 3C0IA 5HVKA 3GC7A 4XLIA 3QQJA 3E3PA 3EQRA 5IH5A 4BVUA 3E64A 5HEZA 3DZOA 4FEQA 3OOMA 4BCFA 2ERZE 1NVSA 2QOOA 1DAWA 5IA5A 3A2CA 3QCSA 4DBNA 4F64A 4RJ3A 5HTIA 3ZBXA 2H96A 2IWIA 1H0VA 2X8EA 5AX9A 3VS5A 2W4KA 1SMHA 3AMAA 4DLIA 5HX8A 4O7YA 4RVTA 3BKBA 3HP2A 4CV9A 2HZ0A 2XJ1A 3QL8A 4A9TA 4JX7A 1YWVA 3U4WA 4RJ7A 2RKUA 3A62A 5GIOE 4UMRA 3B8QA 3FAAA 3ATSA 3GCPA 1K2PA 1UV5A 4U42A 4FVRA 2GHGA 3KRWA 4Y5HA 4C4GA 3F82A 2R3HA 3FMMA 4ZMEA 2XK9A 4TYHB 2V55A 3LMHA 3N4UA 4KINA 1KV2A 4FIIA 4KIOA 5E8SA 4HYHA 3PPZA 2VWIA 4PNIA 3F7ZA 4EK6A 5ANJA 3TUBA 5EM7A 2WQMA 4IC7A 1JSVA 4ITHA 1Q97A 3V6RA 4EOQA 4PMMA 2BAJA 3GQLA 1GZKA 1W83A 3SOCA 5KX8A 4QP4A 2P55A 5HIBA 3BV3A 1M2PA 4IZ5A 4WKQA 3ENMA 4TKSA 4MXYA 4ALUA 3VRZA 4X21A 3ACKA 2F9GA 1R39A 4O27B 4E6QA 5CALA 4RZVA 1YXXA 4KSQA 3QHWA 3DTCA 3DDPA 4BZOA 4XRLA 1U46A 4R3RA 5CT7A 4EUUA 1Q4LA 5BYZA 2YM8A 1KE5A 2IW6A 4BHZA 2V7AA 3DK6A 4MAOA 3F61A 3OS3A 3PYYA 2OW3A 3LCTA 3IDBA 1X8BA 3E7OA 2CLQA 3NYOA 4OBPA 4S33A 4IACA 3ZUUA 5B2LA 3R04A 4YPDA 5LVMA 1E1XA 4UV0A 3QQGA 1PF8A 1RW8A 3IDPA 4JDKA 2Y6MA 2GS2A 3OFMA 3V04A 1FBNA 3R8VA 1XH4A 2OIBA 4UXLA 2BZKB 2ITZA 3HZTA 2VNWA 3NNUA 3HMNA 4RJ5A 3EFJA 3EN9A 3C0GA 5E8UA 4AFEA 4M13A 3CP9A 3KXHA 5ANDA 5FTQA 4QP8A 1H1SA 4AFJA 5LJJA 5LVNA 2UZOA 4RWIA 3EQIA 1J1CA 3Q2MA 2CPKE 3DGKA 4U3YA 1Z9XA 3OCSA 1LP4A 3NEWA 4HZRA 2R3FA 5ACKA 4F7NA 4MXXA 5H8BA 1P4FA 3G9LX 3CGOA 1YI6A 4XV2A 4O83A 2XNPA 4L53A 4XRJA 3Q5ZA 2G1TA 4I21A 3QRUA 4RQKA 2C3LA 4V0GA 3FZTA 3U9CA 2I0EA 3FMNA 4F7JA 2XIKA 1J3HA 3C0HA 4G5JA 2XH5A 4IW0A 3LXKA 2I40A 4GMYA 3AMYA 4CTCA 3PY0A 1PW2A 2V62A 2R7BA 2XIYA 5BVKA 2WOUA 4C33A 5C03A 2Q0NA 4IB0A 4EQUA 4IDVA 4TYGA 5C8MA 4YR8A 3IG7A 4LV8A 3ZEPA 5CANA 3OEZA 2WMSA 3DKCA 5LVLA 1B38A 2IO6A 4DG0E 4XG2A 5A4CA 3NUAA 4H05A 3G2FA 2CCHA 1L8TA 4F0FA 1NA7A 5C4KA 3DFCB 4BZNA 4FR4A 3OW3A 4HGTA 4XG4A 4XNEA 4AWIA 4EBVA 5JT2A 1PYEA 3EN7A 4WD5A 2Y8OA 3QRKA 3NIZA 2OJFE 1P5EA 3HRCA 4LG4A 5KZ0A 4JDIA 4D4SA 1G3NA 4XBRA 4EZ3A 2YCQA 3W2CA 4Z16A 3KQ7A 3OXIA 3NUNA 3OWPA 5CVFA 3TXOA 4FGBA 4LRJA 3SW7A 4PPAA 4QMWA 3SXRA 3P86A 1FMOE 3UMXA 1UNLA 4F6WA 2A1AB 1KOBA 4GT3A 5GJFA 2VTLA 3EMGA 3EFLA 4F7SA 3AD5A 4E5AX 5HX6A 3R7GA 3TNIA 3FMJA 2BCJA 4BI2A 4E5BA 2GNFA 1OGUA 4RPVA 4PMTA 3RAWA 1GJOA 4ACGA 5K5NA 3FKNA 4IWDA 3KA0A 3BGQA 3ZZEA 3LFBA 3DPKA 3P79A 3TN8A 5M4CA 5LWNA 3LJ0A 4IWOA 4NH1A 4XH6A 5K3YA 4Q9ZA 2QO7A 4MWHA 4TZRA 5E8TA 4IVDA 5EHOA 1FGKA 4IAAA 5KE0A 3SOAA 3ZFMA 4F9BA 2ETKA 5AR8A 3S2PA 5AP4A 1UKIA 2C47A 4QYGA 2PMOX 1RQQA 2W1EA 4JDJA 3ZSHA 2Q0BA 1KE9A 1ZYLA 3C4WA 4E8AA 1JKSA 4YZ9A 2RFNA 2CKEA 4EOOA 3HV7A 5C9CA 4ZLZA 3IW7A 3MIYA 4CXAA 3COMA 4KKEA 2R7IA 2VO6A 2VTHA 4PX6A 5EYDA 2XRWA 2PVLA 2Z2WA 4I23A 4RIWB 4R7BA 2FUMA 3DV3A 4JQEA 4PTEA 1OBDA 2GNIA 5JGDA 2C5NA 2ONLA 3FE3A 3S95A 2ZYBA 3Q60A 5CSXA 4CCUA 1JSUA 3L9LA 3MH0A 3ZDUA 5J7HA 4KBKA 4ALWA 5ETFA 3HLLA 4MYGA 3T9TA 3SW4A 4BKZA 3EYGA 4P5ZA 2PL0A 2QHNA 3PVWA 4GVAA 2EB2A 3PVBA 5H8EA 3L1SA 5HG9A 2VO7A 4ARKA 3I1AA 4QMXA 3EL8A 3QTRA 4C34A 2YCFA 4RWJA 3CC6A 2X7GA 3PDTA 4DT9A 3AXWA 3ZFXA 4FYNA 4AACA 5CAUA 2OJJA 1VYZA 3MGYA 4NEUA 2X7OA 4B4LA 4KRDA 4AZWA 4R3CA 4L3JA 2UW8A 1M7QA 2CLXA 4HVIA 5KNJA 3QCYA 4JQ7A 4YU2A 3H30A 4ZS4A 4A07A 3PE2A 2E9PA 3QLFA 4CKRA 4KSPA 4BIDA 3LHJA 5HO7A 1WFCA 2QVSE 5HG7A 5HG5A 3VUMA 1YOLA 4I4EA 4A06A 3ORTA 2C1BA 3R7YA 2BILB 2XVDA 5EHYA 3HV5A 4K6ZA 4NJDA 1H1RA 1Q61A 2JEDA 3SXFA 3VC4A 4DTKA 4YMJA 4WG5A 4ZJIA 2HY0A 1HCLA 1P14A 3ORPA 4FI1A 3TEIA 2YZAA 4YSMA 4MKCA 2R3KA 3LZBA 3DLSA 3KK8A 3KL8A 3FSFA 4FZ7A 3PSCA 4FTRA 3HV3A 2RG6A 4XP3A 4ZSEA 5JK3A 1FGIA 5DR2A 4BCJA 2OGVA 3VN9A 4RVLA 3MH3A 4F1TA 4BRXA 4N57A 1K3AA 3SKCA 3L8PA 2QU6A 4RBLA 4GVJA 1DI8A 3UZTA 4XUFA 3KRRA 4F9YA 2WZJA 2XK4A 2XIRA 2QD9A 4YNOA 2EXMA 4FV6A 4J99A 4I5MA 4QTCA 4QQCA 4YTIA 4NW6A 1SZMA 4GIIA 3I5NA 5FD2A 1OL5A 4GG7A 4GK4A 4EZ5A 4AOTA 4HYSA 3U6HA 3OWJA 1CDKA 3LXNA 3QTQA 3FL4A 3HVCA 3WZUA 5J1WA 4DA5A 4CZUA 3HRFA 3U55A 2BKKA 3FQEA 3Q9WA 3BGPA 3AGLA 1Q8WA 3WIKA 2VWBA 2O64A 1KSWA 3C1XA 3Q4UA 4FKLA 4FTTA 3RPVA 3ZUVA 4GT4A 4M84A 2XNGA 3HV6A 2JKOA 2JDRA 2UZEA 2XK6A 3B2WA 3JUHA 4APCA 5DN3A 4ERWA 2PUNA 3TG1A 3A61A 5EFQA 3RGFA 4I3ZA 3FBVA 4EKLA 5BVOA 4ZTLA 3FQHA 2R5TA 2IVUA 3SXSA 3UIMA 2HENA 4C38A 4YC3A 5AWMA 3HDNA 3PXYA 3CJFA 3WBLA 2VTPA 3ORNA 2ITQA 3GU8A 4HW7A 1ATPE 5AR2A 5DRBA 2XS0A 4S34A 4YLKA 3SC1A 5HE1A 2R3LA 5CEIA 2JKMA 2CKPA 3NPCA 4IZAA 2VX1A 4QPAA 4XBUA 1QPJA 4BYIA 1REJA 2B55A 3UVRA 4TWOA 3R73A 2C5VA 2BAKA 4M14A 4BR3A 4ANQA 4R7HA 4H3QA 4FTKA 2J2IB 2OJ9A 4D28A 4I92A 4ENXA 3VNTA 5A14A 3A4PA 4MWIA 2XBJA 3H10A 4PL3A 3EQHA 5D1JA 1SVHA 1YI3A 5AV1A 3TZ9A 4G3CA 3V8TA 1OL2A 2VD5A 4FSNA 3IGGA 1TQIA 5HG8A 3CD8A 3BWFA 5F9EA 3RNIA 3PIXA 3QUEA 1M2RA 4S31A 1OIRA 2VTMA 3ORKA 3R7IA 2OZOA 1APME 1SNUA 2W1IA 3D7ZA 5GJDA 3QQFA 4O2PA 5K0KA 1R1WA 3D5WA 1OL1A 5TE0A 3P78A 1REKA 4JX3A 2E9VA 2O0UA 1WVWA 3TDWA 2C3KA 4A4XA 2C0TA 3Q4ZA 3DLZA 5GJGA 2WU6A 2X9FA 1YXUA 3LPBA 5CZIA 1R0EA 1ZMWA 2AC3A 4QMQA 1OB3A 1M52A 1YVJA 3B8RA 3SVVA 3OY1A 3PLSA 2FSLX 2IVTA 3EWHA 3EYHA 3M11A 4MNEB 2HW6A 4NW5A 1MUOA 4RLLA 4BBMA 3QZFA 3ZTXA 2VZ6A 3NVKI 4A9UA 4LYNA 2OBJA 5B2KA 2PVKA 3PSBA 2HAKA 4P4CA 4BDJA 3AT4A 3MFUA 3HP5A 1I44A 3D94A 3RAHA 4WT6A 4JG8A 1Q3DA 2GDOA 2OU7A 2XK8A 5HORA 4ACHA 3HX4A 4PP7A 3ULZA 2BZIB 2XKDA 5CU3A 5DOSA 3F88A 4NM7A 4Z7GA 3KXZA 2BTRA 2F2UA 1VJYA 4IAYA 3U4UA 3V5LA 5C8KA 1BYGA 5A4QA 4CFFA 2KTYA 3WZEA 4XG3A 2BDJA 2OF2A 3LLAA 3PUPA 2ITTA 5HU3A 3RINA 2ZV8A 1IAJA 3MTFA 3MV5A 3U54A 1PMVA 3OVVA 5D12A 3GC8A 1XBBA 4O2ZA 3ROYA 4FV2A 1JNKA 3DBEA 3LOKA 4IVAA 4RJ6A 5CU4A 4AT3A 3TZMA 3FJQE 2PZRA 3UC3A 2QR7A 4U0IA 3AGMA 3K5UA 3D7TA 2ZDUA 2FSOX 3FZ1A 4TWCA 5CSVA 4TL0A 4QNAA 3ZSGA 3CPCA 2GCDA 4ANMA 2Z7QA 2VGPA 3MN3A 4ACMA 4HZSA 2J0KA 4QMVA 5CF8A 2R2PA 3DCVA 3ORZA 4DAWA 4FG7A 4TW9A 3QTSA 3LCKA 3QC9A 4BGQA 4O7SA 3NNXA 3ZONA 3MPAA 4U97A 3P7BA 3UIUA 3GU6A 4II5A 4L3LA 4U43A 1EH4A 4JAJA 3OG7A 4G2FA 4RJ8A 2UW0A 4FUYA 3SA0A 4J8NA 4XOZA 5AP2A 4YNEA 4AQCA 4ZLYA 4FT9A 4TYIA 1Q8YA 2BRHA 1ZYCA 2VTAA 3QGYA 4L44A 4RC3A 2HK5A 3FZRA 1OL6A 4DBXA 2X4ZA 3QKLA 4X2JA 1ZLTA 4ZSLA 4W8DA 3NS9A 3TJDA 4I20A 4CGAA 4RC4A 3F2NA 3G6GA 3UNZA 4FNZA 4ITJA 1PKGA 4IZYA 3DU8A 4J97A 3KMUA 1E9HA 5EM8A 4FZDB 5ANEA 4E4MA 5K4JA 3R9NA 4HPUE 5HD4A 3GP0A 1UA2A 4OTQA 4RG0A 3QRTA 5LVOA 3TNHA 5EG3A 4D4YA 4HVGA 3FMEA 3R71A 3HAMA 3S1HA 1SYKA 4BDHA 3HUCA 5KMLA 5ICPA 3BZ3A 3FLQA 4H58A 3MVJA 1WZYA 3P7CA 2R3IA 3UP7A 2DYLA 3GUBA 4NCTA 3LFCA 5D10A 3EQDA 4FX3A 4FNXA 1J7LA 2J0IA 4BDAA 2BHEA 3FZPA 4NSTA 2EB3A 4HGSA 3HKOA 3R8LA 2GNHA 2F4JA 3BYSA 5IQEA 5ANKA 3PXRA 4ZJVA 4CNHA 3PJ1A 1H24A 4BY9E 3AC4A 2ZV9A 5HCXA 3EKKA 3UIXA 4YTCA 1YHWA 4P7EA 2J6MA 3VJNA 4FIEA 2C1AA 4ANOA 4DC2A 5GZAA 2QI8A 3E8CA 2BZJA 4PDYA 3REPA 4R77A 2ESMA 2QOQA 4ENYA 2CNUA 3QQHA 2A27A 4YBJA 5IZFA 4ZK5A 2IG7A 3IONA 2G01A 4WUNA 4FSUA 4MXOA 3RWPA 4KWPA 1ZZ2A 3VIDA 4RJ4A 5CQWA 5LOHA 2W7XA 3II5A 4OTFA 5CSWA 4ASZA 4FL3A 3VBWA 4WOVA 3GC9A 2YCRA 4NFNA 2P2IA 4QP7A 1PKDA 4BBFA 4KBCA 2OO8X 1ZWSA 4NCTC 3RK7A 3VS7A 4RLKA 2WEVA 2QOLA 3C4EA 4YUQA 2H6DA 1URCA 3RBWA 4O0TA 4FT7A 3HA6A 3DKFA 3BLRA 3PVGA 2JKQA 3Q6UA 2XIXA 4FTAA 3QCQA 5FBNC 5GNKA 2PE2A 2W99B 3FXZA 4QOXA 1YWRA 2VRXA 4M12A 3ZLXA 2ZM3A 5CNOA 4H1MA 1YQJA 4DFXE 2DQ7X 3GVUA 1R3CA 2ETRA 2Z02A 2UUEA 4MBJA 5J7BA 4I5HA 2YIYA 3LM0A 4Z55A 1H28A 2HXLA 4J98A 4JG7A 1Y8YA 4IZ7A 3ZMMA 4ZY5A 5EW8A 1BUHA 3V3VA 4CTBA 1GY3A 3C4FA 4L52A 5E1EA 1Q41A 1V1KA 1XH5A 5ETCA 3TDVA 3NNVA 4EK5A 1LR4A 4I0RA 3DJ7A 3VO3A 3FYJX 1DM2A 1GZNA 2GS6A 4IVBA 4OBOA 3D4QA 4PL5A 3IO7A 2VX3A 4WNMA 2PE0A 3R9DA 1PMUA 4R3PA 3VS0A 3E92A 4F6UA 5DEWA 1KE6A 3KY2A 2ITXA 2V7OA 4FKVA 2WMUA 3N9XA 4MBIA 2RG5A 5AUVA 3L8SA 2VWZA 3SGCA 5HNGA 2O8YA 3NUPA 4R8QA 1Q5KA 4MX9A 4C3RA 1P4OA 3UOLA 5B7VA 4FTIA 3U87A 5EKNA 5IF1A 3LXPA 4EJ7A 4QP9A 4QYYA 5A9UA 3LJ2A 5E91A 3PG3A 2GFSA 3Q32A 3FLSA 3L9NA 5AMNA 4UN0C 4YURA 5C8NA 3ZM9A 3NW5A 2O65A 5IQAA 1R0PA 3P4KA 1HOWA 4DFZE 1H01A 4GU9A 4YO6A 3V5JA 4A7CA 4AAAA 2YLEA 1WVYA 1PXNA 2OFUA 5D41A 3FQSA 2HOGA 4FTMA 4ZTQA 3CLYA 5KMKA 3AT2A 4GH2A 1NY3A 3HMMA 3D5XA 5HU9A 5LQFA 4M3QA 2W5AA 4GKHA 5JH6A 4DEAA 3I60A 1RE8A 5IEYA 4V04A 1G8SA 2WO6A 2VTQA 1XJDA 4USDA 2GQRA 2JGZA 2CSNA 2ZJWA 3QHRA 5B2MA 4O7RA 1U5QA 3PZHA 5M06A 4K0YA 4OTDA 3WZKA 3CTQA 4ASDA 3EB0A 2BHHA 5J95A 3F3UA 2P2HA 2X8DA 4IXPA 3FI8A 4KA3A 2B9IA 4X3FA 3UODA 2WTDA 3E8EA 4ZTSA 4Q2AA 5L6PA 2XEZA 1JLUE 3BGZA 4FV8A 5JQ8A 4MBLA 5I9UA 4GFOA 4UWBA 4RVKA 5I3RA 4OTRA 3FZSA 3S3IA 3ZRMA 4FKIA 4L43A 3TL8A 4ZY6A 1PYXA 3ZU7A 3DS6A 2XNEA 3R63A 2DWBA 4FKWA 4NT4A 4OTHA 4W4WA 3ZLYA 3ROCA 3TTJA 1WBVA 3R7OA 1YWNA 4ZP5A 3LIJA 4IM2A 2CGXA 5CWZA 5LARA 5TO8A 4AZFA 1JBPE 5M56A 4EYMA 4YSJA 2J7TA 1MRYA 1V0PA 5ANIA 2C6EA 1ZMVA 5EI2A 2QCSA 2WHBA 4RZWA 1XH6A 3WF6A 3ZDIA 1JKKA 3TV7A 4G6NA 5JGAA 2C69A 2C6MA 3ZO4A 1U5RA 4FT3A 1KOAA 4K2RA 3R1SA 2X6EA 3OCGA 3AC5A 3BLHA 3C9WA 5KO1A 3HMOA 4ACDA 2CGWA 2R64A 5T3QA 5L4QA 2B53A 4N6ZA 3VUTA 3BEAA 1W8CA 2VU3A 3I79A 3GI3A 3NGAA 5FXQA 4EOJA 1Y6BA 3FXWA 1AD5A 3OTUA 4FC0A 5FP5A 4XJ0A 5DBXA 3BYVA 2W1FA 5DI1A 4BCKA 3OWKA 2IVSA 5A3XA 3D2KA 4JXFA 4YJUA 2WPAA 1OKZA 4E4XA 3EZRA 3S4QA 3WE4A 5L2IA 2EU9A 3Q53A 3I4BA 3V8WA 3RPOA 3EQBA 1Z57A 3I7CA 2EXEA 4FEVA 3UO6A 4ZZNA 3AD6A 3Q9YA 2J5FA 4B7TA 4BZDA 3DOGA 1ZY4A 3LQ5A 2YM5A 4HNFA 4M7IA 5EK7A 3ZO1A 4D5KA 3AC3A 3QLGA 1Q8UA 5EM6A 5C01A 2CCIA 2Z7LA 5L8JA 4LFIA 2XKFA 5EOBA 2YIRA 1O9UA 2VTJA 4OUCA 2XM9A 5A6OA 4FTUA 1VEBA 4G3GA 1WBPA 2J0JA 4WBOA 3CBLA 1U4DA 4QQ5A 1PY5A 4E26A 2ZB0A 3R7EA 4PY1A 3C7QA 3BHTA 5HCZA 4YZNA 3GQIA 2FYSA 4KB8A 1WBTA 4BWPA 4TPTA 3BELA 4H36A 3QYZA 4LM5A 2BMCA 4ID7A 5M4FA 5BVFA 3JPVA 5K4IA 4O0RA 3OT8A 4RGJA 4IM0A 4LV5A 3UVQA 4FVPA 4HVHA 3QUDA 1XBCA 4L8MA 4TRLA 4TYEA 3RWQA 3UZPA 3GB2A 3UG1A 5KMOA 4QPSA 5CU0A 1DS5A 2YN8A 4PUZA 4A4LA 4Y95A 3H4JA 1ZRZA 3POOA 4G3EA 2X6DA 5CXHA 4G6LA 1MQ4A 2JKKA 2O63A 5T6KA 3WOWA 4BDIA 4GK3A 4R1VA 3LCSA 4EHEA 4YJNA 4JIAA 3P7AA 5DT0A 4NUSA 3TNPC 2JAMA 3RI1A 4BCHA 1SVEA 1W82A 4EC9A 3JVRA 2SRCA 3GXLA 5DH3A 4O22A 3JR1A 5C1QB 2PUIA 4KUJA 1UWJA 2W96B 2QO2A 2R3OA 3GU7A 4EKKA 2VTNA 4UEUA 2JDOA 3LJ1A 3N51A 4FL2A 3MBLA 3QA8A 5HKMA 2QKWB 4CMUA 2XIZA 4FTJA 2I0YA 4RFMA 4Z7HA 3ORLA 1ZAOA 4M66A 3EH9A 3UTOA 4RIOA 3WZJA 2XNNA 1O6LA 2ZAZA 4FGRA 5FUTA 4DT8A 4HCVA 1Q24A 2PVRA 3LFDA 3ZYAA 4EZ7A 2B4SB 2BR1A 3FV8A 5EKOA 2QG7A 2PTKA 2UZLA 3PPJA 4R6VA 1KE8A 2QURA 5E1SA 4F9CA 4CYJA 5HOAA 2UW4A 2DUVA 1PXOA 4QYFA 2IVVA 3UQFA 4BGGA 5LMAA 4KNBA 2ZV2A 3W2QA 4C36A 4E4NA 2R3RA 3FY0A 2B54A 3OROA 4XX9A 5ANOA 4DTAA 3EKNA 3DKOA 4FKSA 5LCJA 2WIHA 3DZQA 2C6IA 2W9ZB 4AT5A 2NP8A 4F0GA 4NFMA 3BLQA 5FWKK 4V01A 4BWXA 1W7HA 3IW8A 5DR9A 3HMIA 3P5KA 5AP7A 1MQBA 3W2PA 1OECA 5J79A 3R8UA 3UBDA 2CNVA 3GEQA 5D7VA 4C4HA 4D4VA 4DCAA 2QLUA 5DWRA 3IOKA 2W05A 4DN5A 3BQRA 3PA4A 3PJ2A 1M17A 3BU3A 2QC6A 3EQCA 3RP9A 3VVHA 4G9CA 3VS6A 2NNWB 4DFNA 3ORMA 2X81A 4L45A 2WMQA 2UVXA 3QZGA 4LUEA 4QP6A 2XP2A 3C4CA 5D11A 4DH1A 2F7EE 3FC1X 4O0UA 5BUIA 2XKCA 3O7LD 3UNJA 3DAEA 5AA9A 4L42A 3VBYA 4DGMA 3PA3A 4DE4A 3TV6A 2WMRA 3F3ZA 3L9PA 4BKJA 5CTPA 1GNGA 3LAUA 4WRSA 4M69A 5F94A 3KB7A 3Q9XA 3GCSA 4U79A 3OD6X 3M42A 3MIAA 1XQZA 5AP6A 5ITAA 2P33A 5I4NA 1IG1A 2E2BA 3TUCA 2IZUA 2Y7JA 3F69A 4Q5EA 1YRPA 5FDXA 5FXRA 3PJ8A 3KRXA 3LVPA 4QQTA 1J91A 3EQGA 3D14A 4K9YA 4W4VA 4UXQA 1YXSA 3BBWA 2FVDA 4EH2A 4W8EA 4X2NA 4J7BA 4TYJA 4AX8A 4YLLA 4K77A 3TIYA 4RIYA 2GQGA 4ZAUA 4I5PA 5IQFA 3OBJA 4RIXA 2ITWA 4BCGA 4FV7A 4KKHA 3FLYA 4GW8A 4V0GB 2JIVA 4U3ZA 3EIDA 3VULA 4C0TA 4CFNA 4EK4A 4DEBA 3UQCA 4O7VA 5BMSA 5FBOA 3V01A 1RDQE 4XCUA 1FOTA 3OMVA 4K1BA 5IH4A 2WIPA 1H0WA 3Q4CA 4QNYA 4BDCA 3F3VA 4WRGA 3PFQA 5FXSA 4E1ZA 3WF7A 3KVWA 3OWLA 5HHWA 2UZWE 4HVDA 3OOGA 4AF3A 3PG1A 3NZ0A 5CASA 2PMNX 5IMXA 2VWVA 3GENA 4BDFA 3ZSIA 3BCEA 2UZVA 4FODA 4FTOA 4YBKA 1UU8A 3KKVA 2UZNA 4GFMA 5FRIA 4EOIA 4JBQA 4BCOA 4ANNA 3VRYA 4NZWB 5A4LA 1UU9A 5E90A 3MVHA 3A8WA 4ZLOA 4X6RA 3U9NA 5CAOA 4LRMA 1OIYA 4GL9A 3MY5A 3Q5IA 4HYIA 5AP0A 3U6JA 2EWAA 4LOOA 2WXVA 3DTWA 4FSRA 3TUDA 3BV2A 3TV4A 3A7GA 3MJ2A 1H1QA 2ETMA 2VAGA 5HE0A 4EOKA 4BDEA 2ONLC 4YZCA 3RHKA 5HESA 3MH1A 2Y6OA 2YDJA 4C2VA 4BCPA 3O96A 4QD6A 3ZBFA 3UQGA 4UX9A 3F2AA 4MEDA 2WGJA 2B0QA 4LL5A 3I81A 4D1ZA 4JS8A 2C3IB 1H8FA 4FA2A 5IUGA 4J52A 4IAKA 3E8DA 2GNLA 3NLBA 4ZMFA 3KCFA 1YI4A 2WQEA 3ZH8A 2YEXA 5M44A 3T9IA 2W1CA 4GG5A 4IB1A 2WMBA 3GNIB 1PJKA 3OP5A 1O6KA 5F95A 2CJMA 2NO3A 2UZUE 1UU3A 4MK0A 3W55A 5EI6A 2B7AA 4DG2E 4YHFA 2WB8A 3R83A 1H27A 5I3OA 2HW7A 3ZEWA 2VO0A 3DDQA 2OICA 4IAFA 2VTRA 4NM0A 5H8GA 4ZOGA 2HY81 5E92A 3ATTA 4BIBA 4H39A 2J9MA 2JIUA 3AC8A 3QD0A 1CKJA 5TT7A 1V0OA 4B99A 2A2AA 4CQEA 3QAME 2QOCA 3FY2A 3CEKA 4XG9A 4Y73A 3HUBA 2C5XA 4MHAA 3A60A 2J4ZA 4PV0A 3VF8A 3LW0A 2ITUA 5ETAA 2X0GA 3VQUA 5AX3A 4G31A 1JKTA 1LPUA 3UIBA 3UP2A 5CVHA 3TZ8A 5EQEA 3LFSA 1W98A 4NTSA 3SRVA 4OTPA 3RTPA 4DEEA 2GMXA 1VZOA 4GUEA 2B9JA 2GNJA 3HYHA 1ZY5A 3R01A 4RIYB 2R0UA 2OI4X 5M55A 1YXTA 2OIDA 1FVTA 4BDKA 4I6HA 3QWKA 4KIPA 3VUDA 2QOIA 4QMLA 3ZC6A 2BDWA 5CNNA 3ZCLA 4X7QA 3LLTA 1XBAA 3QWJA 4UBAA 4CFMA 1GOLA 3P23A 5BX0A 2NRUA 4GV1A 4C58A 4AA4A 3N4TA 2BFYA 2C0OA 3DBFA 3K3JA 4ACCA 3FKOA 3CE3A 2JLDA 4AN3A 1MP8A 3NYVA 1PMNA 3UOJA 4U8ZA 3MA6A 4O0YA 3OUNB 4ANLA 4XP0A 3M2WA 3E87A 3KF7A 4FUXA 3MDYA 2ZMDA 4O82A 3GU4A 4LMUA 3I0OA 4L01A 4X2KA 3A8XA 3I6UA 4FEXA 3IW4A 2GTNA 2C6LA 2YLFA 3VBVA 3MB6A 1XKKA 4BB4A 2JFLA 4O1PA 3PJ3A 4HGEA 5M08A 4HJOA 2IJMA 3OF0A 2BKZA 3SDJA 3DAJA 3B2TA 3QA0A 2I0HA 3MFTA 3PWDA 3FPQA 4AOJA 5DIAA 4CFXA 3QCXA 4ZS0A 4JOAA 3PY1A 4YJRA 2BRGA 3EZVA 1KWPA 2CGVA 2UV2A 1Q62A 1WBSA 4GJ2A 5HVJA 1R78A 2XNOA 3ET7A 4N70A 2XEYA 4F09A 5K9IA 4XOYA 1DAYA 3F5GA 5JEBA 2YFXA 3EL7A 3JYAA 4ONAA 3LKMA 4JR7A 3COHA 4G6OA 5FQDC 5CYIA 3O0GA 4FNWA 2XF0A 4JIKA 4NU1A 4UZDA 4RFZA 1Y57A 5GHVA 3WYYA 3Q52A 5IA1A 3R00A 1ERKA 1H25A 1XWSA 1ZZLA 3IPHA 5AM6A 3RHXA 2W1ZA 5JGBA 3E8NA 3MB7A 4GT5A 5E8YA 2HWPA 3NNWA 3T3UA 5CENA 5FTGA 4BTKA 4HCTA 5IA4A 4TT7A 3WF5A 3NX8A 5IH6A 3WILA 3D9VA 1GZ8A 5HBJA 3CD3A 2PVHA 3QFVA 5IQCA 4IX5A 3MVMA 4O91A 3A7HA 3GBZA 2X2MA 2XNBA 5CLPA 2GS7A 3F5PA 5EW3A 3SHEA 5JMSA 3MSSA 5CS6A 3UDBA 4F1OA 5L8KA 5JRQA 4CG8A 1BLXA 4QP1A 5BVDA 4QMMA 2QODA 4AZVA 4CCBA 4IX6A 3LMIA 3IECA 4WO5A 1H1WA 5E8WA 1Y6AA 3GOPA 5IPJA 1LEWA 2Y9QA 4FTNA 5FP6A 3ORXA 4PDOA 1JSTA 3AC2A 5IG1A 4PP9A 4F70A 4IQ6A 2HIWA 1U54A 3H0ZA 4L00A 4IHPA 3HMPA 4ASEA 2PULA 4C37A 3FL5A 2B52A 3FHIA 4FYOA 5FEQA 5E9EA 5I9ZA 5EYMA 2WMXA 3P0MA 4R5YA 4WBBB 2VGOA 4J1RA 5HNIX 4PWNA 2UZDA 2Z7SA 5J5TA 4CLJA 4PTGA 4XP2A 5CEMA 4F7LA 4XS2A 5HGIA 4CYIA 2BRMA 4BCIA 4BWKA 4ANBA 2XCHA 4XEYA 5IISA 4HYUA 5J1VA 4R7IA 2RIOA 2WKMA 3FMDA 3UOHA 5JQ5A 4A4OA 2FH9A 2UVZA 4QMPA 4UYNA 2YDIA 5BQ0A 4F08A 5BVEA 5A54A 3F9NA 1YOJA 2PYWA 4XG8A 5EDRA 3OY3A 3QGWA 1HCKA 3NYXA 5GIPE 5FG8A 3FHRA 4QT1A 3RPYA 4DCEA 1NT2A 2F57A 3G6HA 3O2MA 3LFQA 3QKMA 3VW6A 5AP5A 3ETAA 4YHJA 4RX8A 5DGZA 4U81A 5I9WA 4FKQA 3F5UA 1PHKA 5E8ZA 5I9VA 2J90A 4IX3A 4IFGA 1CSNA 3KRJA 4JBOA 3I5ZA 4CT2A 3GCVA 3LE6A 3F66A 1OVEA 1ZYDA 3KMWA 4U45A 4WG4A 2F7ZE 3V51A 4L68A 4UB7A 2WTIA 4IX4A 4WIHA 4KAOA 1W0XC 2OF4A 2PZPA 3W10A 2XNMA 2REIA 3RVGA 3ZHPC 4JRVA 4JR3A 4RX7A 5KMIA 3EFKA 5ACBC 4BF2A 2PZIA 4AGUA 3KGAA 1OPKA 1YW2A 4FMQA 4GJ3A 2FGIA 1OBGA 3ULIA 3E63A 3CJGA 2ZMCA 4A9RA 4KRCA 1PXIA 3JY0A 4OW8A 2XUUA 3OCBA 4BCMA 1I09A 1U59A 3UPXA 3QRIA 4M97A 2R0IA 3QXOA 2XBAA 3QZHA 4X2FA 5CQUA 4HVSA 2XA4A 4O0SA 1OPLA 4OBQA 4RQVA 3TTIA 4NIFA 2A19B 4DH7A 5IA3A 4UWCA 4EHVA 3GCUA 2NPQA 3KC3A 3MI9A 2QOKA 3BEGA 3O23A 4OTWA 5HI2A 4F4PA 5CSPA 3ID6C 2QG5A 5L2SA 4DFBA 3Q3BA 4QYEA 4OAVB 2WAJA 5AR3A 3LQ3A 3MTLA 4BDDA 3RPRA 4FL1A 1SVGA 3R2BA 1GIIA 3P08A 2GPHA 4QMTA 1OKYA 1T45A 2WTCA 4C61A 5F1ZA 2XMYA 1NW1A 4PF4A 3PSDA 2BAQA 3RCJA 5AIKA 3QTUA 2FO0A 3NRMA 3SLSA 5HTCA 4MD8E 3QQKA 4IAZA 5L2QA 4GK2A 4BCNA 3G0FA 4KIKA 5HZNA 3R9HA 5M57A 3D7TB 4TN6A 1IRKA 2QLQA 2W17A 2XRUA 5EI8A 3NUXA 1Q8TA 4AW0A 5D9HA 4KABA 4YC8A 3ZO2A 4D2SA 1BI7A 4H1JA 3ZUTA 1QPDA 5M09A 4EHZA 1CKIA 4Z9LA 2R3QA 3C4XA 5J9ZA 1KV1A 4LMNA 5AP1A 3TCPA 4EOLA 4MF1A 1ZARA 2R3NA 3DY7A 1UKHA 5AA8A 3DXNA 1KUTA 3SG8A 3MPTA 2GSFA 4WA9A 3KULA 3R28A 4RRVA 5DT4A 2W06A 5TKDA 4LL0A 4NWMA 5CZHA 3KXNA 3F6XA 5HVYA 4O0VA 3JY9A 4U40A 3MFRA 3VW8A 4LQMA 3UPZA 5HBHA 3VS4A 4E7WA 5KBQA 2YAKA 4O7NA 3CGFA 4O7LA 3DBDA 2JFMA 3QRJA 4CV8A 3HDMA 3QC4A 4WUAA 3VS1A 4BBEA 4C62A 4XG6A 3PJCA 3ANQA 2CKQA 4BIEA 2YABA 4O6EA 3V5WA 3OZ6A 4OT5A 4C59A 4DH3A 3VUGA 3KVXA 5M51A 3O7LB 4FKTA 3OXZA 2AC5A 3PWYA 4FT5A 4I93A 4P5QA 4QTAA 4RA5A 5AUXA 3FC2A 4F65A 2VTSA 2XB7A 4NTTA 2HZIA 3AC1A 4YZDA 4TYHA 5KMNA 3RM6A 3ZO3A 4J53A 1BX6A 5IA0A 1PMEA 3BE9A 3HECA 4KKGA 4W9WA 3UNKA 4X3JA 3EOCA 4O0XA 4S30A 3PRIA 4X2GA 4XLVA 5EM5A 3UJGA 4BC6A 4O7WA 4Q5HA 3I6WA 1A9UA 2FA2A 4TWNA 1AQ1A 4ERKA 5DNRA 4BCQA 4ZSJA 2C4GA 1OKVA 5BYLA 4BI1A 5CU6A 3PXFA 3TM0A 3IGOA 3MYGA 4AN2A 5CF6A 1VR2A 3UG2A 4AUAA 1WMKA 1UNHA 2VWXA 1G8AA 3OHTA 2Y4PA 4JL9A 4CFVA 3RK9A 2C0IA 3CSVA 3AOXA 1W84A 3PRFA 4NIFB 3HAVA 4FICA 4B6LA 4E6CA 2XCKA 4PPBA 4FG8A 5J9YA 3LCOA 4RC2A 3CKXA 3UZRA 5CEPA 5JZJA 4CLIA 4ZXTA 1GIHA 2YDKA 3MS9A 4GS6A 4IBMA 3DJ5A 5KMJA 5TF9A 3GFEA 5HLPA 1YDRE 1T46A 3ALOA 4FZ6A 5IUHA 1CKPA 4RA4A 4L6QA 3FDNA 4EK8A 2XK7A 1UWHA 4U44A 2YIQA 4TNBA 3QTZA 4XMOA 3LFAA 4APPA 4D2VA 3C13A 1JOWB 2JDVA 2OZAA 2VN9A 4G34A 5TOZA 3V8SA 5LMKA 2IZRA 2XKEA 4MXZA 5AUYA 4EORA 3HL7A 3KN6A 4RWKA 1IAHA 3UVPA 2OJGA 3C51A 1O6YA 3QZIA 3KREA 4R1YA 4BICA 5GINE 2OH0E 4KIKB 2ACXA 4X0MA 1SNXA 3NUUA 4ASXA 4K18A 4AU8A 1PRYA 1WBNA 4G16A 2O2UA 4Y85A 2X9EA 3FUPA 1FINA 5CX9A 4D2WA 5IMEA 3QYWA 2YM4A 2HCKA 3Q6WA 4MNFA 2PUPA 4ZTRA 4G3DA 2ERKA 4ITIA 3R8PA 4IB3A 2VV9A 4F9AA 3PTGA 2WMWA 3GCQA 4ZTNA 1OM1A 4F9WA 4M15A 2YA9A 4Y83A 2UW3A 3TZ7A 4E6DA 5EDQA 3KULB 2RGPA 4IEBA 4D4RA 2WNTA 2I1MA 4EOPA 3CKWA 3PLAE 5JFSA 4NK9A 2RFEA 5E8XA 4AW5A 4X3FC 5DVRA 2YISA 3ITZA 5HE3A 1GAGA 2H34A 4QPMA 3R8MA 4EH4A 2X1NA 2WFYA 2WTJA 5EH0A 4CVAA 2VWWA 4GCJA 5FEEA 3ZXZA 5L6WL 4C8BA 3EN5A 1Y8GA 5LMKC 2XK3A 3RM7A 4DYMA 3IOPA 4D1XA 5CEQA 5ETIA 4O86A 4AGWA 4FVQA 2Y0AA 3QD2B 5AAFA 4CMTA 4C4FA 4FK6A 4MH7A 2R9SA 5TR6A 5AAGA 3QXPA 4QQJA 1JQHA 3DT1A 3ZXTA 5L2TA 3T8OA 2PHKA 3G51A 3PZEA 2ITVA 4P90A 5M4IA 3DNEA 5EQPA 1JKLA 3BHUA 4FKUA 4AA0A 3BIZA 1IA9A 3RJCA 1WBOA
chains in the Genus database with same CATH superfamily
5ANGA 4PQNA 1ZOHA 4FSWA 4YTHA 3QBNA 5C27A 4TTHB 1L3RE 2CDZA 4FSYA 4FT0A 2UVYA 4LGHA 5H9BA 4ZEGA 4D2RA 4DTBA 4O4DA 5IQHA 4MCVA 2YERA 4U9AA 4FV4A 4JRNA 4LGDA 4LOQA 3OCTA 2GNGA 4FSQA 3E88A 3LCDA 4H3BA 2J50A 4HCUA 5CI6A 5HCYA 4BTFA 4EH7A 3OC1A 2HYYA 4ANSA 4AP7A 2CMWA 5A6NA 2AQXA 1JPAA 1Q3WA 5CEKA 3BU5A 1K9AA 4RVMA 5EW9A 1TKIA 4ORKA 3VBXA 4FV3A 3NWWA 2OXYA 1BL7A 4F6SA 3ZLWA 1IEPA 2W9FB 4YJPA 5A4EA 2PVFA 3ORIA 4RSSA 1YHSA 5BV3A 4OAUC 4CSVA 3DK3A 2YHVA 3OBGA 3FKLA 5CT0A 4X3FB 3D0EA 4W4YA 3FMKA 3OXTA 3Q96A 2PVJA 1CTPE 3K54A 3VBTA 4AW2A 4EH3A 3TT0A 3A7FA 2OZAB 3DB8A 2E9UA 4LOPA 3GOKA 1BKXA 3CIKA 3A7IA 3NDMA 2J0MB 3G5DA 5CAQA 4CFWA 3F2RA 3KXGA 3QX4A 4I0TA 3O5AA 1S9IA 2GFCA 3V5PA 2GTMA 3WARA 3W2RA 2VTTA 3EJ1A 3LMGA 4GU6A 4I22A 4WSQA 2OJIA 2PK9A 3AMBA 4CEGA 4USFA 5BVNA 2LGCA 1BL6A 3CQEA 4OR5A 4K8AA 4CKIA 4DGLC 2YJSA 2I6LA 4D58A 3HNGA 4H3PA 2W1DA 4FKGA 3DJ6A 4CKJA 5DG5A 4EEVA 4NYEA 5HO6A 4M0ZA 4AXEA 2YACA 4IM3A 5IDPA 3COKA 4FV5A 1STCE 4FZFB 4RIWA 3HGKA 4OGRA 5HO8A 1RJBA 2BUJA 4PL4A 3G0EA 2I0VA 3PXQA 3SD0A 3NR9A 4NM5A 3Q4TA 2X7FA 2YCSA 4GSBA 3K2LA 4QTEA 3U8WA 1ZOGA 2Y4IC 2ZB1A 1IA8A 2X39A 3FPMA 3R02A 3R2YA 4KD1A 4YHTA 3POZA 2ZDTA 3QQUA 4YJOA 5DHJA 3RAKA 3O17A 3TJCA 5DRDA 5JN2A 3DAKA 1J1BA 5KHXA 4DGOA 5FLFA 2QNJA 4RX9A 4YLJA 5HTBA 5JFVA 1YXVA 2JC6A 3IS5A 1QL6A 2FSTX 3PIYA 3KXXA 4U5JA 4DH8A 2P3GX 2QQ7A 3F3TA 2Z7RA 4C02A 2RFDA 4FKRA 4IWPA 3RK5A 5CY3A 3EQFA 4WG3A 4YP8A 4B9DA 3KEXA 2ITPA 4CZTA 4J96A 4IJPA 5AAEA 3WYXA 3LFNA 3IW6A 5EDPA 1OUKA 3IKAA 4G1WA 4HPTE 4LRKA 4RMZA 5B0XA 4PDPA 3TI1A 4F1MA 4D9TA 1OZ1A 3KFAA 4AZSA 3AQVA 3IQ7A 3LFFA 4A9SA 3UDTA 4I4FA 3S0OA 3KIOC 4NM3A 3UGCA 4ZZMA 3ZZWA 4JVGA 4D55A 2C6TA 2XJ2A 3ANRA 2WQBA 3E62A 4QMOA 3TNWA 3V5TA 1H1PA 5CF4A 3MJ1A 4FV1A 4FBXA 2PZ5A 4AN9A 5JSMA 2JAVA 4DF3A 1G5SA 2E9NA 3OTVA 4I1ZA 3CY2A 4E5WA 1OL7A 3KRLA 4I6BA 3R21A 3VUKA 3BQCA 5E4HA 3O8UA 4DGGA 3VAPA 3WF8A 3G9NA 1M7NA 4ZJJA 4UALA 4I6QA 1JWHA 2QOBA 3O51A 3I0QA 4JBVA 1CMKE 1IASA 2EUFB 4V05A 3BWJA 4JLCA 1DI9A 4Y5QA 3D83A 2BIYA 2JBPA 3WI6A 5AV3A 2PZYA 2Y4IB 2W4OA 3A4OX 1V0BA 5AR5A 2QKRA 3GGFA 4HNIA 2PUUA 4CG9A 2E9OA 3SAYA 5G1XA 5IUIA 4BL1A 4D2PA 5C4LA 3KCKA 4NL0A 4I6LA 2W1GA 3PE1A 4MVFA 3FSKA 4UY9A 4AG8A 4CFUA 5DYJA 2PY3A 2W1HA 2FSMX 2BRBA 4UMQA 5LMBA 3C4ZA 2VWUA 3QALE 2V5QA 4PMSA 2BVAA 2X2KA 2X0PA 4QYHA 2HWOA 3UC4A 3R0TA 3W8QA 1F3MC 4OTIA 2UZBA 3QQLA 4O7ZA 2C6OA 1YDTE 4E20A 1S9JA 5KBRA 3DQXA 2GHMA 4C57A 4G3FA 1OIQA 5HLWA 5M53A 4BJJA 3QTXA 2VTOA 3EN6A 3O50A 2JIIA 2Z8CA 2YM3A 4F0IA 2JITA 1AGWA 3RZFA 3FMHA 2OXDA 2HELA 1ND4A 1B6CB 5HIEA 4PPCA 4IVCA 4WSYA 4YJSA 5IEVA 4J71A 1H00A 4I24A 3NMUF 1OITA 3R9OA 5BMMA 1XR1A 2GU8A 4G17A 2H8HA 1Y91A 3I7BA 4FK3A 2EXCX 5T68A 4K33A 3KU2A 4BI0A 3SG9A 4C2WA 2ZM4A 4IH8A 3DK7A 1YDSE 1XH7A 2J0LA 4QRCA 3NCZA 3F7WA 3R1YA 4M8TA 1PXMA 5CAPA 4DFUA 2XJ0A 3R7UA 5CAVA 3PXKA 2QOHA 4L67A 3F3WA 4MF0A 1ZYJA 5EQYA 5FDPA 2OSCA 4A9YA 4FZAB 3RKBA 3VWAA 2YAAA 5IEXA 1F0QA 4E6AA 3ENHA 2CGUA 1CM8A 4IJ9A 3ODYX 4B0GA 5CXZA 5DLSA 5E7RA 3TKIA 1OIUA 4IMYA 2YIXA 1TVOA 3LM5A 4C4IA 3G90X 5L8LA 4O96A 3K5VA 4OLIA 4Z3VA 3BHYA 3FI3A 4O84A 2B9HA 2P4IA 3RPSA 3ZRLA 5CF5A 2HZ4A 4IE9A 3PPKA 2WOTA 3ODZX 4FSMA 5KKRC 4CQGA 2CKOA 3COIA 5FGKA 1H08A 1QCFA 3C5UA 3C5IA 3IK3A 5A46A 3JS2A 3KN5A 4WNPA 3TWJA 3ERKA 5BPYA 4M69B 4NJ3A 4EOMA 3QU0A 3VJOA 4LUDA 4C4JA 4ZY4A 3NCGA 2DS1A 3R30A 1KE7A 3DBCA 3FI4A 4FIJA 4YZMA 5HICA 3W33A 2CNQA 4K11A 4MNEA 5LCKA 4YO4A 2YM6A 3CR0A 5JFXA 3U6IA 4IDTA 3NW7A 2JBOA 3W32A 5HD7A 5AV4A 2IZSA 3H9OA 2B1PA 3LXLA 2C6KA 4FV9A 1H4LA 3ELJA 3JVSA 4PTCA 4YJVA 3QD4A 5J8IA 4O81A 4GYGA 3VF9A 2YM7A 5BYYA 3G15A 4EYJA 2G2FA 3BU6A 4RIXB 4YPSA 1BMKA 5I9YA 1PXPA 5FM3A 5FM2A 3RNYA 5IKWA 4FG9A 5AUUA 3WZDA 2XZSA 3MA3A 2R3PA 3R6XA 5J87A 5DFPA 2PWLA 1H07A 1UNGA 4C7TA 4QMZA 4D1SA 3G33A 4DLJA 3ZOSA 1TQPA 4DEIA 4QDVA 3TACA 2PVMA 2X4FA 3MH2A 1FVRA 2WELA 2AYPA 3CS9A 4IIRA 3AT3A 2BRNA 2BROA 3UE4A 3BL9A 2XAMA 2R4BA 4MXAA 4BJJB 1FVVA 3HRBA 2ZV7A 3A7JA 5AJQA 4CD0A 3NVMB 3KK9A 2O5KA 4DITA 3LFEA 4TWPA 4L46A 4X6QC 5DPVA 5JZNA 2LAVA 4BYJA 5HQ0A 2UW9A 3PA5A 4M67A 5BUEA 5KKRB 3NYNA 4FKOA 4WNOA 5FEDA 3ALNA 3DA6A 3CCNA 5AEPA 1YOMA 4YC6A 4J95A 4R5SA 4IAIA 5C26A 4FIGA 4FKPA 4GEOA 4MQ1A 4E93A 3VUIA 4JNWA 3OEFX 1ZXEA 3BPRA 3VUHA 2W0JA 4UZHA 1Q99A 5IQBA 4PDSA 3E93A 3RALA 5KHWA 1NVQA 4TNDA 3DXQA 4D2TA 2PSQA 2EVAA 3FLZA 1GZOA 3N4VA 2G2IA 4JT3A 3KXMA 2QO9A 3FWQA 2BFXA 4TXCA 3ZM4A 4UMTA 5DE2A 5IQGA 3MW1A 4EWQA 3SQQA 3EQPA 4OTGA 3IW5A 5IDNA 3ACJA 4JDHA 5IU2A 1E1VA 3VS2A 2BIKB 4XV9A 3QTWA 3QD3A 3UMWA 2QHMA 3EFWA 5JKGA 5L2WA 2VO3A 2YJRA 4KS7A 2F49A 3BYUA 3QX2A 4AOIA 1WCCA 2V22A 2UW7A 2YITA 3MY0A 2WQNA 4GRBA 4RFYA 1H26A 1M14A 3E7VA 5AUZA 4BDBA 5HNBA 4GUBA 4BGHA 4D0WA 2PVNA 3K3IA 4GYIA 1NXKA 2W5BA 4BDGA 3FEGA 2BPMA 4QMSA 4QTDA 4XV1A 2RL5A 4FTLA 5K5XA 3NAXA 2R3JA 4BN1A 4I5CA 4DINA 1ZMUA 4FIHA 4Y8DA 4YGAA 4QMUA 3DXPA 4EH5A 4BHNA 3V6SA 4AE9A 4UWYA 1IR3A 4XYFA 4QP2A 3MPMA 2QONA 4FF8A 4UMUA 2C5YA 4QO9A 2BZHB 2CHLA 2ITYA 2W4JA 3TKHA 4EOSA 5CEOA 5I0BA 3PUFC 3DB6A 4JJRA 2X8IA 1ST4A 2C3JA 5JFWA 2X2LA 3SRVB 5KMMA 3WIGA 1B39A 3NUYA 4QMNA 3CQUA 2JD5A 2PE1A 3M1SA 4O0WA 5J9LA 3QKKA 2Z60A 2J51A 3W18A 3FLNC 3UO4A 3VHKA 2WU7A 4FIFA 2J5EA 3MVLA 4I41A 2OK1A 3MWUA 3DFAA 1MRVA 4TY1A 4R78A 4N4SA 4EL9A 2OWBA 1M2QA 2UW5A 4ZZOA 3D15A 5CVGA 5DR6A 4EH6A 5DMZA 4ZSGA 3HEGA 2OFVA 4DH5A 4E73A 3IDCA 3T3VA 5LXMA 4M68A 2YWPA 5AM7A 2C6DA 4DG3E 4FTCA 1OMWA 4I6FA 4ZTMA 2HXQA 1JVPP 2NRYA 3BYOA 3H0YA 3D5VA 4B8MA 4FOCA 4RX5A 3FMLA 3KMMA 3DBQA 5DT3A 4LI5A 5E8VA 4EWHA 4P2KA 4N0SA 4XG7A 3BX5A 3BYMA 4RT7A 3R1QA 5AFVA 5F4NA 4U7ZA 3P1AA 3VHEA 5CU2A 3SX9A 3VS3A 2F2CB 2C30A 3CQWA 2ZOQA 5F20A 4CRSA 4YZBA 4EK3A 1URWA 2QOFA 2VWYA 5BVWA 5KZIA 2UZTA 3RAIA 4EQCA 5KCVA 4L9IA 4QP3A 2YIWA 3PP1A 5CSHA 4AXAA 1OPJA 5L3AA 3OW4A 4C3FA 1JAMA 1WAKA 4HGLA 4MTAA 4AZTA 4FNYA 1QPEA 2G15A 4O7TA 3RCDA 4E4LA 3A99A 2WD1A 3NVKI 1OKWA 2PMIA 2WTVA 4OT6A 5AUWA 4RWLA 4AE6A 4EHGA 3L8VA 3Q9ZA 4FEUA 3FYKX 2WQOA 4BKYA 2ITNA 1QMZA 4GIHA 3D5UA 4UMPA 4DHIB 3RMFA 3H9RA 4Q9SA 4L3PA 3BHVA 3BE2A 5AR7A 4IFCA 5IQDA 4C4EA 3E3BX 3ZLSA 4EI4A 4FOBA 2RFSA 1A06A 2VTIA 3Q04A 3PIZA 4EH8A 4O21A 5AIRA 3R8ZA 3WF9A 2F7XE 5AV2A 4BFMA 4PMPA 5LWMA 4ZY5A 3L9MA 3S00A 2OG8A 5AADA 4PNKA 1ZYSA 4NKSA 5JRSA 4FTQA 4FJVA 4J8MA 2P0CA 1MRUA 3BHHA 3TKUA 4DGNA 1OUYA 4D0XA 3BBTB 5J5SA 5HE2A 2G2HA 1SM2A 3DNDA 2YZLA 4IC8A 5A4TA 1LUFA 4BTMA 4I0SA 5GZ8A 3P9JA 1VLRA 3NAYA 2XYNA 5IQIA 3FZOA 4JQ8A 4IANA 3H3CA 3BI6A 1TQMA 3PP0A 2YWVA 3RZBA 4EH9A 3MESA 5CI7A 3ZS5A 3NW6A 4DEDA 3CPBA 1FQ1B 2PPQA 3R1NA 1VYWA 4FV0A 3E5AA 4AZEA 2WMVA 2PU8A 3Q2JA 3R9RA 5EOLA 4ALVA 2GHLA 2R3MA 4JBPA 3R22A 2QR8A 4MQ2A 5HIDA 3PY3A 2OH4A 4ZTHA 4W4XA 4O1OA 3UYTA 4EONA 4MXCA 1Q8ZA 3V5QA 1A48A 3MY1A 1U54B 4B8LA 2H9VA 3AG9A 2OKRA 3QTIA 3EHAA 4YJQA 4DEHA 2JDSA 2FB8A 4I94A 3TNQB 3WE8A 4NKAA 4JI9A 3CY3A 3CTHA 3LQ8A 2VUWA 2B9FA 3JXWA 4AGCA 3NSZA 4FEWA 2Q83A 4XHKB 4EC8A 3OUKA 4KBAA 1PXLA 3O8PA 3SV0A 4G5PA 3O71A 4AA5A 4QMYA 4E3CA 2GQSA 3UO5A 4LGGA 2BDFA 4YTFA 3BRBA 1QPCA 3EN4A 4IWQA 4PRJA 1OI9A 2RF9A 2XYUA 4FSZA 3DQWA 4ZIMA 3W8LA 4U6RA 5H3QA 5M4UA 2IZTA 1XH9A 4W9XA 5AUTA 3VBQA 5KUPA 5L6OA 4BTJA 3AD4A 1BI8A 4F78A 4Y72A 3VQHA 4F99A 3GU5A 2WTKC 3R7VA 4AT4A 1XHAA 4XV3A 5G6VA 5DEYA 4L7FA 4MD9E 3L8XA 2W5HA 3HA8A 3TIZA 4N6YA 4MD7E 4C35A 4AGDA 1Z5MA 4USEA 2V0DA 3CXWA 1WBWA 2OIQA 2CN5A 4GFGA 4GKIA 2QU5A 2BALA 4CMOA 1PXKA 2ZVAA 3GC0A 5I9XA 2OXXA 5FTOA 4O6LA 4S2ZA 4FSTA 4JG6A 2AUHA 5GZ9A 4C3PA 2XM8A 4EJNA 5AR4A 5EYCA 3NUSA 4M0YA 2WEIA 4FKJA 5D7AA 5AP3A 4EQMA 5IA2A 5M07A 4ZSAA 4HOKA 2IW8A 2O3PA 4U41A 2VX0A 2ITOA 4S32A 5EHLA 5BUJA 4DEGA 4U80A 1FMKA 2OLCA 5BNJA 2WMTA 3MFSA 3U51A 3W2SA 1YKRA 3OT3A 4AS0A 1TFFA 1P2AA 4WNKA 4D5HA 2A4LA 1FPUA 3HV4A 4DHFA 4CRLA 5LVPA 1LEZA 4F63A 4IADA 5EYKA 2VNYA 2ZM1A 4O38A 4Y46A 3ZFYA 2C68A 3C50A 3QF9A 3GT8A 3KF4A 2ZFYA 3UOKA 3THBA 1UVRA 4WHZA 3ZRKA 4CZYB 3F5XA 4KIQA 4EBWA 5K0XA 2WMAA 1NVRA 2KULA 1PXJA 3UYSA 4D9UA 2PVYA 2CN8A 5I5ZA 2IPXA 3O8TA 4QTBA 4YJTA 3ZC5A 5HBEA 1XO2B 4JAIA 4DFLA 3FXXA 3W1FA 3FI2A 1ZOEA 3NIEA 2BTSA 1GIJA 1J7UA 2I7QA 3W16A 2IN6A 2G9XA 2IW9A 3DKGA 3H9FA 1WVXA 2WTKB 3FLWA 3D2IA 2PMLX 3GFWA 4L7SA 4AW1A 5DA3A 4G9RA 4KS8A 4FRFA 1F5QA 1YHVA 1UU7A 2JDTA 5H2UA 3W2OA 2UW6A 4IB5A 4EUTA 2WTWA 4CT1A 5AV0A 3PVUA 5HLNA 3PXZA 2R3GA 3QUPA 4UYAA 4FE2A 2A0CX 2RSVA 2HZNA 4DFYA 1XH8A 1J7IA 2C5OA 3CTJA 3C0IA 5HVKA 3GC7A 4XLIA 3QQJA 3E3PA 3EQRA 5IH5A 4BVUA 3E64A 5HEZA 3DZOA 4FEQA 3OOMA 4BCFA 2ERZE 1NVSA 2QOOA 1DAWA 5IA5A 3A2CA 3QCSA 4DBNA 4F64A 4RJ3A 5HTIA 3ZBXA 2H96A 2IWIA 1H0VA 2X8EA 5AX9A 4AXFA 3VS5A 2W4KA 1SMHA 3AMAA 4DLIA 5HX8A 4O7YA 4RVTA 3BKBA 3HP2A 4CV9A 2HZ0A 2XJ1A 3QL8A 4A9TA 4JX7A 2XANA 1YWVA 3U4WA 4RJ7A 2RKUA 3A62A 5GIOE 4UMRA 3B8QA 3FAAA 3ATSA 3GCPA 1K2PA 1UV5A 4U42A 4FVRA 2GHGA 3KRWA 4Y5HA 4C4GA 3F82A 2R3HA 3FMMA 4ZMEA 1G8JA 2XK9A 4TYHB 2V55A 3LMHA 3N4UA 4KINA 1KV2A 4FIIA 4KIOA 5E8SA 4HYHA 3PPZA 2VWIA 4PNIA 3F7ZA 4EK6A 5ANJA 3TUBA 5EM7A 2WQMA 4IC7A 1JSVA 4ITHA 1Q97A 3V6RA 4EOQA 4PMMA 2BAJA 3GQLA 1GZKA 1W83A 3SOCA 5KX8A 4QP4A 2P55A 5HIBA 3BV3A 1M2PA 4IZ5A 4WKQA 3ENMA 4TKSA 4MXYA 4ALUA 3VRZA 4X21A 3ACKA 2F9GA 1R39A 4O27B 4E6QA 5CALA 4RZVA 1YXXA 4KSQA 3QHWA 3DTCA 3DDPA 4BZOA 4XRLA 1U46A 4R3RA 5CT7A 4EUUA 1Q4LA 5BYZA 2YM8A 1KE5A 2IW6A 4BHZA 2V7AA 3DK6A 4MAOA 3F61A 3OS3A 3PYYA 2OW3A 3LCTA 3IDBA 1X8BA 3E7OA 2CLQA 3NYOA 4OBPA 4S33A 4IACA 3ZUUA 5B2LA 3R04A 4YPDA 5LVMA 1E1XA 4UV0A 3QQGA 1PF8A 1RW8A 3IDPA 4JDKA 2Y6MA 2GS2A 3OFMA 3V04A 1FBNA 3R8VA 1XH4A 2OIBA 4UXLA 2BZKB 2ITZA 3HZTA 2VNWA 3NNUA 3HMNA 4RJ5A 3EFJA 3EN9A 3C0GA 5E8UA 4AFEA 4M13A 3CP9A 3KXHA 5ANDA 5FTQA 4QP8A 1H1SA 4AFJA 5LJJA 5LVNA 2UZOA 4RWIA 3EQIA 1J1CA 3Q2MA 2CPKE 3DGKA 4U3YA 1Z9XA 3OCSA 1LP4A 3NEWA 4HZRA 2R3FA 5ACKA 4F7NA 4MXXA 5H8BA 1P4FA 3G9LX 3CGOA 1YI6A 4XV2A 4O83A 2XNPA 4L53A 4XRJA 3Q5ZA 2G1TA 4I21A 3QRUA 4RQKA 2C3LA 4V0GA 3FZTA 3U9CA 2I0EA 3FMNA 4F7JA 2XIKA 1J3HA 3C0HA 4G5JA 2XH5A 4IW0A 3LXKA 2I40A 4GMYA 3AMYA 4CTCA 3PY0A 1PW2A 2V62A 2R7BA 2XIYA 5BVKA 2WOUA 4C33A 5C03A 2Q0NA 4IB0A 4EQUA 4IDVA 4TYGA 5C8MA 4YR8A 3IG7A 4LV8A 3ZEPA 5CANA 3OEZA 2WMSA 3DKCA 5LVLA 1B38A 2IO6A 4DG0E 4XG2A 5A4CA 3NUAA 4H05A 3G2FA 2CCHA 1L8TA 4F0FA 1NA7A 5C4KA 3DFCB 4BZNA 4FR4A 3OW3A 4HGTA 4XG4A 4XNEA 4AWIA 4EBVA 3W0QA 5JT2A 1PYEA 3EN7A 4WD5A 2Y8OA 3QRKA 3NIZA 3W0RA 2OJFE 1P5EA 3HRCA 4LG4A 5KZ0A 4JDIA 4D4SA 1G3NA 4XBRA 4EZ3A 2YCQA 3W2CA 4Z16A 3KQ7A 3OXIA 3NUNA 3OWPA 5CVFA 3TXOA 4FGBA 4LRJA 3SW7A 4PPAA 4QMWA 3SXRA 3P86A 1FMOE 3UMXA 1UNLA 4F6WA 2A1AB 1KOBA 4GT3A 5GJFA 2VTLA 3EMGA 3EFLA 4F7SA 3AD5A 4E5AX 5HX6A 3R7GA 3TNIA 3FMJA 2BCJA 4BI2A 4E5BA 2GNFA 1OGUA 4RPVA 4PMTA 3RAWA 1GJOA 4ACGA 5K5NA 3FKNA 4IWDA 3KA0A 3BGQA 3ZZEA 3LFBA 3DPKA 3P79A 3TN8A 5M4CA 5LWNA 3LJ0A 4IWOA 4NH1A 4XH6A 5K3YA 4Q9ZA 2QO7A 4MWHA 4TZRA 5E8TA 4IVDA 5EHOA 1FGKA 4IAAA 5KE0A 3SOAA 3ZFMA 4F9BA 2ETKA 5AR8A 3S2PA 5AP4A 1UKIA 2C47A 4QYGA 2PMOX 1RQQA 2W1EA 4JDJA 3ZSHA 2Q0BA 1KE9A 1ZYLA 4QEBA 3C4WA 4E8AA 1JKSA 4YZ9A 2RFNA 2CKEA 4EOOA 3HV7A 5C9CA 4ZLZA 3IW7A 3MIYA 4CXAA 3COMA 4KKEA 2R7IA 2VO6A 2VTHA 4PX6A 5EYDA 2XRWA 2PVLA 2Z2WA 4I23A 4RIWB 4R7BA 2FUMA 3DV3A 4JQEA 4PTEA 1OBDA 2GNIA 5JGDA 2C5NA 2ONLA 3FE3A 3S95A 2ZYBA 3Q60A 5CSXA 4CCUA 1JSUA 3L9LA 3MH0A 3ZDUA 5J7HA 4KBKA 4ALWA 3ML1A 5ETFA 3HLLA 4MYGA 3T9TA 3W0SA 3SW4A 4BKZA 3EYGA 4P5ZA 2PL0A 2QHNA 3PVWA 4GVAA 2EB2A 3PVBA 5H8EA 3L1SA 5HG9A 2VO7A 4ARKA 3I1AA 4QMXA 3EL8A 3QTRA 4C34A 2YCFA 4RWJA 3CC6A 2X7GA 3PDTA 4DT9A 3AXWA 3ZFXA 4FYNA 4AACA 5CAUA 2OJJA 1VYZA 3MGYA 4NEUA 2X7OA 4B4LA 4KRDA 4AZWA 4R3CA 4L3JA 2UW8A 1M7QA 2CLXA 4HVIA 5KNJA 2XALA 3QCYA 4JQ7A 4YU2A 3H30A 4ZS4A 4A07A 3PE2A 2E9PA 3QLFA 4CKRA 4KSPA 4BIDA 3LHJA 5HO7A 1WFCA 2QVSE 5HG7A 5HG5A 3VUMA 1YOLA 4I4EA 4A06A 3ORTA 2C1BA 3R7YA 2BILB 2XVDA 4O4BB 5EHYA 3HV5A 4K6ZA 4NJDA 1H1RA 1Q61A 2JEDA 3SXFA 3VC4A 4DTKA 4YMJA 4WG5A 4ZJIA 2HY0A 1HCLA 1P14A 3ORPA 4FI1A 3TEIA 2YZAA 4YSMA 4MKCA 2R3KA 3LZBA 3DLSA 3KK8A 3KL8A 3FSFA 4FZ7A 3PSCA 4FTRA 3HV3A 2RG6A 4XP3A 4ZSEA 5JK3A 1FGIA 5DR2A 4BCJA 2OGVA 3VN9A 4RVLA 3MH3A 4F1TA 4BRXA 4N57A 1K3AA 3SKCA 3L8PA 2QU6A 4RBLA 4GVJA 1DI8A 3UZTA 4XUFA 3KRRA 3W0OA 4F9YA 3PFYA 2WZJA 2XK4A 2XIRA 2QD9A 4YNOA 2EXMA 4FV6A 4J99A 4I5MA 4QTCA 4QQCA 4YTIA 4NW6A 1SZMA 4GIIA 3I5NA 5FD2A 1OL5A 4GG7A 4GK4A 4EZ5A 4AOTA 4HYSA 3U6HA 3OWJA 1CDKA 3LXNA 3QTQA 3FL4A 3HVCA 3WZUA 5J1WA 4DA5A 4DHJA 4CZUA 3HRFA 3U55A 2BKKA 3FQEA 3Q9WA 3BGPA 3AGLA 1Q8WA 3WIKA 2VWBA 2O64A 1KSWA 3C1XA 3Q4UA 4FKLA 4FTTA 3RPVA 3ZUVA 4GT4A 4M84A 2XNGA 3HV6A 2JKOA 2JDRA 2UZEA 2XK6A 3B2WA 3JUHA 4APCA 5DN3A 4ERWA 2PUNA 1G8KA 3TG1A 3A61A 5EFQA 3RGFA 4I3ZA 3FBVA 4EKLA 5BVOA 4ZTLA 3FQHA 2R5TA 2IVUA 3SXSA 3UIMA 2HENA 4C38A 4YC3A 5AWMA 3HDNA 3PXYA 3CJFA 3WBLA 2VTPA 3ORNA 2ITQA 3GU8A 4HW7A 1ATPE 5AR2A 5DRBA 2XS0A 4S34A 4YLKA 3SC1A 5HE1A 2R3LA 5CEIA 2JKMA 2CKPA 3NPCA 4IZAA 2VX1A 4QPAA 4XBUA 1QPJA 4BYIA 1REJA 2B55A 3UVRA 4TWOA 3R73A 2C5VA 2BAKA 4M14A 4BR3A 4ANQA 4R7HA 4H3QA 4FTKA 2J2IB 2OJ9A 4D28A 4I92A 4ENXA 3VNTA 5A14A 3A4PA 4MWIA 2XBJA 3H10A 4PL3A 3EQHA 5D1JA 1SVHA 1YI3A 5AV1A 3TZ9A 4G3CA 3V8TA 1OL2A 2VD5A 4FSNA 3IGGA 1TQIA 5HG8A 3CD8A 3BWFA 5F9EA 3RNIA 3PIXA 3QUEA 1M2RA 4S31A 1OIRA 2VTMA 3ORKA 3R7IA 2OZOA 1APME 1SNUA 2W1IA 3D7ZA 5GJDA 3QQFA 4O2PA 5K0KA 1R1WA 3D5WA 1OL1A 5TE0A 3P78A 1REKA 4JX3A 2E9VA 2O0UA 1WVWA 3TDWA 2C3KA 4A4XA 2C0TA 3Q4ZA 3DLZA 5GJGA 2WU6A 2X9FA 1YXUA 3LPBA 5CZIA 1R0EA 1ZMWA 2AC3A 4QMQA 1OB3A 1M52A 1YVJA 3B8RA 3SVVA 3OY1A 3PLSA 2FSLX 2IVTA 3EWHA 3EYHA 3M11A 4MNEB 2HW6A 4NW5A 1MUOA 4RLLA 4BBMA 3QZFA 3ZTXA 2VZ6A 3AKJA 4A9UA 4LYNA 2OBJA 5B2KA 2PVKA 3PSBA 2HAKA 4P4CA 4BDJA 3AT4A 3MFUA 3HP5A 1I44A 3D94A 3RAHA 4WT6A 4JG8A