4L53A

Crystal structure of (1r,4r)-4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)-3-chlorofuro[2,3-c]pyridin-4-yl]-1h-pyrazol-1-yl}cyclohexan-1-ol bound to tak1-tab1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
307
structure length
296
Chain Sequence
GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1: Optimization of kinase selectivity and pharmacokinetics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7, TGF-beta-a
total genus 91
structure length 296
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l53A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l53A01
5ANIA 4L67A 4FV7A 5E8UA 3ZXTA 1H26A 4CYJA 2C5OA 3LW0A 3PY3A 4IX6A 3CJFA 5AR2A 4HPUE 3FUPA 3QU0A 2WKMA 1UU7A 1Q41A 4O6LA 4A9RA 3LLAA 3CKXA 4EK3A 2B1PA 4LUDA 3EKKA 3LCKA 5JRQA 4XX9A 4PNIA 5KMOA 3EL7A 4UEUA 4OTWA 3FL5A 4F64A 3HMOA 3PLAE 2PUIA 2UZEA 4AT3A 1BL7A 2QD9A 1W7HA 2C5VA 4GFGA 1JAMA 5HE0A 4ZJJA 4HVDA 3KQ7A 1OL2A 3UYSA 3L9PA 5EM6A 4JBPA 4LGDA 2F7EE 4DGOA 3CY2A 3MFUA 3GEQA 3II5A 3BX5A 3MH3A 3KKVA 3P7AA 4DT8A 3WF8A 4ZLZA 2QOKA 3D7TA 5LCKA 5EHLA 2IVSA 3HV5A 4KSPA 4ZSEA 2G2FA 3OCGA 3Q52A 3L9LA 4PPCA 5F94A 4IAAA 4IWPA 3LM0A 3RK9A 5J79A 3G6GA 5TE0A 2I0EA 3RAIA 4JIKA 4WT6A 5IUIA 3GU5A 1FBNA 2VN9A 2UW0A 4FODA 5F4NA 5IA5A 4S33A 2HW6A 3A7GA 3DU8A 3WZUA 2BHEA 4TYJA 5LVLA 4F1OA 3OXZA 3S0OA 4AFJA 4XRJA 4A4LA 3AD6A 3DBDA 5AV3A 3QC4A 5HKMA 4EHZA 2OWBA 5CSHA 5FM3A 3PJ2A 2UVZA 3V51A 1UKHA 3WZJA 1F0QA 2JKKA 4F9CA 4I6FA 4YSMA 1H0VA 5DT0A 4F9WA 2FA2A 3G51A 4UXQA 4XLVA 5HVKA 4DA5A 3F5XA 5F9EA 5LMKA 3VUIA 4O2PA 4D4RA 4ID7A 4DBXA 2OZOA 4HNIA 4DINA 2PZ5A 5FP5A 4XG7A 3N4TA 4XV2A 2WQMA 3W2RA 4FKWA 3QD0A 2PL0A 3MSSA 4BCGA 4K8AA 5C03A 2ZJWA 1OKVA 2ONLA 3RGFA 1FPUA 1H00A 1SNUA 4MTAA 5IQCA 5DMZA 3KRRA 5HOAA 3I1AA 4O1PA 2PE2A 4NM7A 1V0BA 4RIWB 3ZFXA 3O50A 2ITOA 4J1RA 4J7BA 4ACDA 5AA9A 4IZAA 3PFQA 4W8EA 2X2LA 3IOKA 4NKSA 3QQKA 4C4JA 3KGAA 3OROA 4KIQA 3VJOA 4RWKA 4M0YA 4U3YA 2REIA 4Y95A 4FEWA 4MD9E 2QU6A 4FKIA 1YWNA 4JAIA 4LI5A 5FM2A 4R3PA 4I5MA 4E26A 2Z60A 3GUBA 2Q0NA 3MWUA 1PXOA 4JG7A 3W8QA 4E4NA 1YWRA 4MX9A 2OZAA 2HWPA 5IQHA 3M11A 5EW3A 2W17A 3FPMA 5AM7A 3Q2JA 4CQGA 3QCSA 4NCTA 4FG8A 2A1AB 3B8RA 4F70A 4YJUA 4ACMA 5CVFA 4X0MA 5FXRA 5HLPA 4G3FA 4UV0A 3NW7A 3NUUA 5D1JA 3ROCA 3D0EA 4MBIA 2I1MA 2BAQA 2GPHA 2BRMA 5DGZA 3UPZA 1Y57A 2VTHA 3QQUA 1PMNA 1M7QA 4S30A 4AGCA 2V62A 3ACJA 1PHKA 4GH2A 3QGWA 4YZ9A 2GSFA 2A2AA 2GNGA 3NNWA 4ALWA 2RIOA 4MQ1A 4F7NA 3CS9A 5EM7A 3V6RA 5CU6A 1AD5A 3VBWA 5M09A 5FUTA 3CIKA 4DFNA 2X7GA 1V1KA 4L45A 4UMPA 5GIOE 1ATPE 2VAGA 1PF8A 3L9NA 3Q4CA 4CRLA 4D2TA 2B55A 2OO8X 1W0XC 2CNUA 4C57A 1QPDA 3O71A 1OUYA 3C50A 4WOVA 3ZRLA 3T9IA 5ETFA 4W9XA 3C5UA 4FOBA 5FDPA 2OXXA 5L6WL 4G5JA 5K5NA 4Z16A 4FUXA 2XNBA 2BIYA 4FL3A 1Q8WA 1R39A 1Z57A 3HX4A 3LFEA 2YM7A 4FKGA 4FVQA 4GIIA 3S1HA 4EQUA 4ZLYA 3OWLA 4X2JA 1OPJA 2WELA 4M12A 4CZTA 4RVKA 3THBA 2VGOA 5J87A 1H28A 5ANEA 3COHA 5M55A 4UWBA 5KX8A 5M56A 3JPVA 3FYJX 4A4OA 3OW3A 4BDFA 2OK1A 3VULA 3RAWA 4YHTA 3QTQA 1FVTA 4E4LA 4RX9A 3PPJA 4XS2A 3VBVA 5HNIX 3QD4A 1F3MC 2QHMA 3QFVA 4J52A 4QOXA 5EHYA 5FEEA 4X2GA 3V8TA 2CN5A 1TQMA 4L6QA 4O96A 5AP4A 4LG4A 5EYDA 3HEGA 4OLIA 4CLJA 4M0ZA 3O2MA 3BGQA 3UVRA 2W4OA 2QG5A 3R6XA 2LAVA 4B8LA 3AGMA 4QQTA 3E3BX 3V5QA 3H3CA 1YI6A 3AC4A 2PVHA 2XMYA 1YDRE 2C4GA 4FV0A 5CF6A 5KMNA 4FK3A 2YIXA 5IU2A 4CFUA 4YJVA 3VS0A 5KO1A 3LFDA 3AC1A 2QVSE 3PWDA 3FLQA 4J8MA 5CI6A 3EYHA 2YERA 4I5CA 3UQGA 1K9AA 3PJ1A 4C3FA 3GCQA 4ERWA 4N70A 5JGAA 3BYVA 3EZRA 4M69B 3FJQE 3UODA 3N4VA 1OL6A 5DT4A 2XK4A 3F2RA 5EQYA 1GZOA 4CMUA 5IUHA 4FV4A 3VBYA 5CSXA 4DG0E 4IAFA 2NO3A 4AFEA 3R7OA 4QP4A 3UNKA 2PZRA 3GC0A 5GJGA 5GZ8A 2C6TA 4D58A 2VX1A 5I9WA 4U7ZA 4S32A 1Q4LA 2QOLA 2PUPA 1K2PA 3H0YA 4TWOA 2IZTA 4EHGA 3H9FA 3LOKA 4O27B 5DH3A 4Z3VA 4O7ZA 4DT9A 4AGWA 2XB7A 3C0GA 4J98A 3ZO1A 2ETKA 5B7VA 3QQLA 4FSZA 2RL5A 1L3RE 3CKWA 4NIFB 2OXYA 2QOCA 4OBOA 1IRKA 2UZTA 4QD6A 4C35A 5LVOA 4BI1A 2F49A 3FC2A 3FWQA 4O21A 3H9RA 2XK8A 4LRMA 2C3JA 1OB3A 3F6XA 3GC9A 3MH2A 1S9IA 2WMVA 1P4FA 3O8PA 1WBSA 1ZMVA 1Y6AA 5CVGA 2ZMCA 1G5SA 4TRLA 3RM7A 2WTIA 3ZHPC 4W9WA 4WNOA 2WMQA 5T3QA 4FOCA 3ULIA 1XR1A 2DYLA 5M53A 4EWHA 4BC6A 3FMDA 2UVXA 3FQEA 4BBFA 2B9FA 4TWPA 2ITXA 2ZV8A 4C59A 4F9BA 3V3VA 5I3RA 4F1TA 5IQEA 4EH5A 4NKAA 1ZYLA 3FY2A 4CXAA 4E20A 4L43A 2PU8A 3Q53A 3ZLXA 5GJFA 3QA8A 2QO9A 2YAAA 3VS6A 1Q3WA 2BILB 1W8CA 5D11A 5A14A 3SX9A 3NDMA 4FBXA 4DITA 2J0MB 2Z02A 2UW9A 5J1VA 2BDFA 2WGJA 3V5LA 4FSWA 1FMOE 4U80A 4I5HA 2H9VA 5EYKA 3DXNA 3LQ3A 3GENA 2UW8A 2XCKA 3LFBA 1BLXA 3EQFA 4B8MA 2RGPA 3ZU7A 5HTBA 3PYYA 4NJDA 5JZNA 1J7IA 4EKKA 5KBRA 3MFSA 5CWZA 1VYZA 5G1XA 2E9VA 2A27A 1OL7A 5CAOA 3E87A 5HD4A 3GNIB 3I5ZA 2H96A 4CYIA 1GY3A 4HW7A 3ORIA 3A8XA 5HU3A 1KE8A 5IMXA 4L53A 4IC8A 2ZV2A 3RCJA 4YSJA 2WTKC 4Q9SA 3I4BA 4P7EA 2UW5A 4AOJA 5A4EA 4C2WA 4DFBA 2VGPA 4O7WA 5JEBA 3ZRMA 2VX0A 5AR5A 4AQCA 2XZSA 1H1SA 2BRGA 2H6DA 2XH5A 3BELA 3I6WA 5LVMA 5AX9A 5HICA 1Q5KA 3W2QA 5IDNA 5M44A 3ATSA 2BPMA 2FSOX 3DQWA 5CVHA 4EH9A 4TKSA 5FXSA 5A46A 1WCCA 2OXDA 1E1XA 4AZVA 4C58A 5I5ZA 4FKOA 5CQUA 4Z7HA 5FBNC 2XBJA 3MVJA 4HZRA 1OM1A 4JBVA 4KWPA 3RZBA 4CTCA 3HAMA 4EORA 1UU9A 3AMBA 3EN5A 2BFYA 5LMAA 4AW1A 4R78A 2WMTA 3O96A 2C0OA 3KN6A 3I6UA 3LVPA 3A2CA 4H39A 4WUNA 3RJCA 4BDIA 3NYOA 4J71A 5E91A 3DZOA 4NIFA 3E92A 5HO6A 3TNWA 5I9ZA 5C4LA 3B2TA 4OTPA 3VS3A 3VHEA 2OKRA 2JFLA 2UW7A 3Q96A 5DR2A 4CKJA 5L2TA 4ALUA 4LGGA 3SVVA 2B9JA 3TZMA 4E8AA 4M68A 1DAWA 4C61A 3C4XA 4L7FA 4FTUA 2GS7A 3A7FA 1QPJA 4DC2A 1H1QA 3LCDA 5IDPA 2PVLA 3F7ZA 2W99B 4FKJA 2Y6MA 3R00A 4EK8A 5M4FA 2WB8A 2O65A 4U45A 2RG6A 4FSUA 4CEGA 5HU9A 2YZAA 3L9MA 4HYIA 4ZTSA 3R30A 4G6NA 4ANBA 1SVHA 4EH7A 1OIQA 4A07A 5CYIA 2FYSA 3T3UA 2CJMA 4GRBA 1H1WA 2R3LA 5AUWA 3RTPA 4K33A 5A6OA 3ZXZA 2B52A 5E7RA 3ZBXA 4CRSA 4H05A 3P7BA 4C4EA 3H0ZA 3CTJA 2W4JA 3DKCA 4ENXA 3MS9A 4RIYA 3BPRA 2O64A 4LYNA 5HBHA 4PRJA 4C62A 2QKWB 4RC4A 3VBTA 4IZYA 4E93A 4D2SA 3UP2A 3NUAA 3FE3A 3R02A 4WG3A 4EYJA 4A9YA 4QYHA 3QQJA 3NW5A 4BCPA 4F9AA 3DPKA 5AUZA 4LOOA 3D7ZA 4JBQA 5I9XA 2RG5A 1KE6A 1P2AA 4BHZA 2W1FA 1YDTE 3KN5A 2R3RA 3FZ1A 2B54A 4X2KA 1MUOA 2R3GA 4NUSA 1PW2A 3DKFA 3GXLA 2Y9QA 3WF5A 4EOIA 4FTCA 5A4LA 2HELA 4XYFA 3W8LA 3H9OA 3C4EA 4RWJA 2ITYA 4IX4A 3SHEA 1WBNA 1YHVA 3PRFA 3VS5A 4U43A 5HLNA 4FYNA 3C4FA 5EW8A 5I3OA 5LWMA 3EL8A 4R5YA 2IWIA 4YJOA 4EHVA 5BMMA 2VTLA 4GUEA 2W4KA 3ROYA 4C4GA 3UP7A 3V8WA 5HCYA 4Y46A 3PJ3A 3ZO3A 3KMUA 3ZSHA 3PG3A 2J5EA 3EN4A 3FLSA 4C8BA 5I9YA 3FMLA 5C01A 2H8HA 3OHTA 5TT7A 4IXPA 3E88A 4L8MA 4XUFA 3WZKA 4MXYA 4USDA 4PPAA 3R28A 5EOLA 1NVRA 1NT2A 2ESMA 4IVCA 5DI1A 4BWXA 2PVKA 4KBAA 4ARKA 3ORXA 3K3JA 3FL4A 1Q61A 5M4UA 3G2FA 4GVJA 2V22A 5DRDA 3H30A 2J0KA 2YIYA 4HPTE 4NK9A 4AW0A 2VWVA 3C1XA 3VWAA 3QHWA 4Y73A 4HCVA 3HV4A 4C4HA 4R8QA 4EOLA 3R2BA 2WOTA 2R3PA 4X3JA 1J7UA 4KBKA 3DK3A 4FTKA 4UZDA 3TI1A 2YEXA 2JIVA 2WU7A 2BAJA 1DI9A 5HIEA 4JNWA 2IZUA 3PRIA 4YHFA 3HV7A 3A99A 4RGJA 1YKRA 4M13A 4F0FA 3ZLSA 1BI7A 5HVJA 4WG4A 3E8EA 3REPA 1P5EA 4DF3A 3PPKA 4EK4A 3QCQA 3KVWA 3ZO4A 4UBAA 5LQFA 5D9HA 3FAAA 3OW4A 2XA4A 3QXPA 3ZDUA 1O6YA 2PVYA 4GK3A 1YW2A 4BVUA 3R0TA 5K5XA 2J0IA 3DLZA 3TNHA 3VAPA 3NYXA 3DXQA 2QOHA 3L1SA 1O6KA 3EFJA 4K1BA 5CAQA 3TT0A 1U54B 3R7GA 5K0XA 3FI8A 1CKPA 2ZDUA 4AE6A 2UZUE 2I6LA 4E1ZA 3BE9A 2IVTA 1W84A 3NAXA 4Q2AA 4S31A 3OBJA 3QC9A 4ANSA 2WAJA 4X3FB 4C0TA 3EMGA 3LZBA 3OVVA 4XG6A 5J7HA 3ZUTA 3MPAA 5HEZA 1LP4A 2HY81 3KU2A 3RPRA 3BYUA 4KKGA 4TXCA 3G0FA 4DCAA 1OMWA 4UWYA 1XH4A 5LARA 2PTKA 3ERKA 2ZM1A 4U44A 4ZSLA 3Q6UA 4HGLA 5M06A 4UMQA 4G3CA 3WILA 3QZHA 3DQXA 3L8PA 5L2SA 5KUPA 2PUNA 2AYPA 5ANDA 4DFXE 3KCFA 1ZLTA 5A54A 4FTNA 1YI4A 4FSMA 5E8WA 2ITUA 3PXYA 3MN3A 4L3LA 4YBJA 4DH8A 4CMTA 1XH9A 4GFMA 3KL8A 1ZOHA 5BVEA 2RFDA 4D2WA 3ELJA 3UC3A 3D94A 4YPDA 5D10A 5AP1A 3UNZA 4EZ5A 3GVUA 3RAKA 4YURA 4EOPA 3OY3A 4M66A 4WRGA 5KKRC 4BTKA 2HK5A 3Q32A 4IAZA 3BHTA 4IDTA 3ID6C 5LCJA 4BYIA 4JQ7A 3CJGA 4I0TA 3FXZA 2YWVA 4BB4A 2CCHA 3RWQA 4HOKA 4WNMA 4ERKA 1YDSE 4OW8A 3M2WA 5E90A 3OC1A 4P5QA 5AWMA 3R9HA 1FGIA 4UN0C 1VZOA 3PXKA 1Q99A 1T46A 2VWZA 3FZTA 4FX3A 4PTEA 5KZIA 3KEXA 2ZV7A 5E4HA 5KE0A 4E3CA 5IG1A 4E6AA 3DXPA 4Z9LA 3R73A 4YTFA 3P23A 1XKKA 1A48A 3W2OA 2PE0A 4JR3A 2QOIA 4TNDA 1UNGA 4O0RA 2FSTX 3FSFA 2W7XA 3ORZA 1PYEA 2F4JA 3QGYA 4I41A 2FVDA 1I09A 2VNWA 5CT0A 4XBUA 4IVAA 2P0CA 2BALA 3EOCA 4W4XA 5CU4A 4EOSA 1FVRA 2WFYA 3OT8A 4DEEA 2B53A 3L8VA 4F0GA 3R71A 1UV5A 4AAAA 2BHHA 4ALVA 3KXMA 2YAKA 4GV1A 2JLDA 3G0EA 2V0DA 3LXPA 1U4DA 3QZIA 3MY0A 2B0QA 4QQ5A 2V5QA 3BKBA 2WQNA 3EIDA 3ORPA 3EWHA 5E8ZA 3Q4ZA 4M15A 5KBQA 2QOBA 3CQEA 1W98A 2QKRA 4J95A 4G31A 4X3FA 4A9UA 2YIQA 3CBLA 3COIA 4O7SA 3BYSA 3TTIA 3NYVA 4FUYA 3CLYA 2YIWA 3FEGA 3GP0A 3POZA 2KULA 4DTBA 3BCEA 4CMOA 4XOZA 5IMEA 3OG7A 3RVGA 1BYGA 4NFNA 3WIGA 4ZLOA 2RF9A 2YLEA 3SQQA 4BWPA 5BNJA 3MYGA 3F3ZA 2AC3A 3ZMMA 4EZ7A 3ZFMA 4FV3A 3COKA 3UOLA 4BIBA 5H8EA 5GINE 4JS8A 1O9UA 3GCSA 2BR1A 5EFQA 3FZSA 2GQGA 2WMXA 2O63A 2YITA 3C4CA 3O0GA 3TJDA 4BTJA 3UQCA 4YLLA 2C6OA 3KRXA 3NW6A 3IG7A 4L42A 5AP7A 1P14A 1XQZA 2ITWA 3HMMA 4KS8A 3JR1A 3N51A 2BAKA 2PZIA 3LCSA 1J1BA 4MVFA 3AT4A 4PL5A 3ZTXA 3QUEA 4MF1A 3A7IA 4BDEA 3H4JA 2XCHA 4ITJA 4PDOA 1QL6A 2EVAA 2W1GA 5EHOA 4O82A 1RE8A 5CSVA 3C13A 4FK6A 3QRUA 2OIDA 3CTHA 4YJSA 3ALOA 5G6VA 3WF7A 4J8NA 4DFYA 3F69A 4JXFA 2CKEA 2XK9A 4ZSJA 5ICPA 4EBWA 2ITVA 2Z2WA 4MKCA 2X9FA 4FZFB 2WTVA 3TUCA 3LIJA 5KMIA 3UOJA 2AUHA 3K2LA 3RPOA 4GK4A 3ALNA 4Y5QA 1E1VA 4KABA 2OH4A 5IKWA 1B39A 4OTIA 4TYHB 5AUYA 5HIBA 2X0GA 4EOMA 2IZRA 3BHVA 4XBRA 4JQEA 2W5BA 3RINA 5K9IA 5DBXA 3PE1A 2J7TA 2Y4PA 4BKYA 3AD4A 5IPJA 4RVLA 2X2KA 1GNGA 5FLFA 4FV6A 3P79A 2OJIA 2Z7LA 4IX3A 4R7IA 2VTPA 4Y5HA 2XJ1A 3U9NA 1OIYA 2R7IA 1Z5MA 2YCQA 5D7AA 4JI9A 4FTQA 2XEYA 3RP9A 1VEBA 4D9UA 2GTMA 4D1XA 3NUXA 4F63A 3EN9A 2BUJA 3TUBA 1ZYJA 3KULA 4I21A 5CQWA 3HLLA 4BDKA 4EH3A 1XH8A 3NNUA 4I93A 4CV8A 3FYKX 1T45A 4OTRA 2OH0E 4FE2A 5M57A 4YP8A 5EK7A 2YJSA 2NPQA 4I0RA 4NTTA 3KFAA 3R8UA 1PXPA 1GZNA 4X6QC 3V5TA 1YXXA 2QO2A 3SDJA 3TWJA 4U8ZA 3RI1A 1U46A 4NCTC 5KMLA 4RRVA 2IW6A 5T68A 5DR6A 1YOLA 2X81A 5FQDC 1LPUA 3UMXA 4D4VA 4P90A 2E9OA 1H1RA 3R01A 4YR8A 2JDOA 3FY0A 3EQHA 5JFXA 3W18A 3NS9A 2WTDA 4FV1A 4H58A 3ORMA 2YHVA 3U51A 2XNGA 3P08A 3O8UA 5BUJA 4V04A 1UA2A 3PSBA 5FP6A 5DEYA 5HG8A 4NEUA 4MXZA 4EC8A 2A4LA 3TIYA 4DFLA 4EZ3A 1L8TA 4BZNA 2R5TA 2BZJA 3DNEA 4G9CA 2VUWA 5DNRA 1WVWA 4E6CA 3FKNA 4BYJA 2R3OA 2Z8CA 4CKRA 4PV0A 5AUVA 1A06A 5HE3A 4RFYA 5HTCA 4CV9A 4YC3A 3OZ6A 4DTAA 2PVFA 4MK0A 1MQBA 5C9CA 4ZJVA 2G2HA 4KIPA 2UW6A 4QQCA 3F61A 4ITIA 3ZBFA 4FEXA 3HA6A 3HRCA 1PXKA 3QRJA 4YTIA 4YC8A 4E6DA 4R1VA 3QXOA 4YC6A 2J6MA 3E63A 2ITPA 5CF5A 5JN2A 4IEBA 2PMLX 3CTQA 2RFNA 1FMKA 3UTOA 3VS2A 4DH5A 3BV3A 3MJ1A 4RJ7A 4EONA 3MESA 3E7OA 4ACCA 3GFEA 2Y4IC 3G15A 5HG5A 4QP2A 3V6SA 3VHKA 4J53A 4YO4A 4PQNA 5M51A 1R3CA 3QTRA 4TZRA 4BDAA 3ZC6A 4I24A 2PVNA 3UNJA 3ZUVA 3KXXA 4TT7A 4RFMA 3CGFA 4CSVA 1QPCA 2WQOA 4RIXB 1QCFA 2UZWE 4D2RA 5L6OA 1OPLA 3I79A 3LCTA 4YJQA 2JIUA 3S95A 3EFWA 4DH1A 4RVMA 3TL8A 3TJCA 4D5KA 3JYAA 3OUKA 3P1AA 1Z9XA 5TOZA 4FSRA 1XH5A 3UOHA 4AA4A 3VRZA 3W33A 2WTJA 2GNIA 2WPAA 3RHXA 1YXVA 1KV2A 2OIQA 2FSLX 3QX4A 2PZPA 4EQCA 4FKUA 3WE4A 1UNLA 3B8QA 3KULB 4K9YA 4OUCA 4YO6A 4U97A 4P2KA 4MBJA 3A7HA 4ZTLA 3TV6A 2B4SB 5AV0A 2GNLA 4O6EA 2OG8A 3BHHA 3R7EA 2UUEA 2OJGA 3PG1A 4FZDB 2R0UA 4MWIA 3LMHA 3KRLA 4FMQA 4AG8A 3MH1A 4PDSA 3WF9A 2VTQA 5BVWA 3QHRA 1WBVA 5JQ5A 5EQPA 1RW8A 2YM5A 3ZO2A 4CT1A 1B6CB 1OUKA 3OXIA 3IW6A 4UMTA 1OL1A 4ASZA 5IH5A 4BBMA 2QCSA 4EQMA 2XP2A 3V8SA 3F82A 3Q4UA 3QL8A 3NVMB 3MY5A 3PPZA 4X7QA 4R1YA 3JVRA 5EKNA 1JOWB 3BGZA 1YWVA 3HRBA 5C1QB 1U5RA 4FEUA 4MNEB 2BDWA 4LV5A 3TTJA 4QTDA 5HESA 3BGPA 3BLQA 4CFXA 3Q04A 5HQ0A 5BVNA 3QZGA 1ZMWA 2JBPA 3QRIA 4RA4A 1BMKA 3NUYA 2DUVA 5AP3A 5GZAA 5L2WA 5HG7A 4BY9E 1R0EA 3BLRA 5JMSA 4BGGA 4AT4A 4XV1A 5BYZA 5IH4A 2HWOA 2NRYA 3PSCA 4NH1A 2BTSA 5D12A 1FINA 4FKTA 4IH8A 3OFMA 4IC7A 3GQIA 4F7JA 2V55A 4AZWA 3NNXA 2ZM3A 3RM6A 4PDYA 4Y72A 5E92A 4I4FA 4G3GA 3FLYA 3ORLA 3W32A 4D9TA 2ZOQA 2X2MA 3S4QA 4QTCA 1G8SA 4FYOA 3KF4A 3P86A 3UC4A 1JNKA 4BDGA 5C8NA 2WQBA 1REKA 1URCA 3PE2A 4FF8A 4O91A 5L4QA 5EG3A 5ETCA 3U8WA 4IAKA 3V5JA 3SD0A 2X8IA 5EDRA 3PDTA 2OF4A 4O0VA 3HVCA 3NX8A 4DGNA 1PXJA 4XLIA 3I0QA 2ZAZA 2ZVAA 3QTWA 4KBCA 3G5DA 3NGAA 3P0MA 3NPCA 4DHFA 4D1ZA 5HBJA 2J5FA 3IGGA 3RPVA 2R3JA 3EQRA 4ONAA 3P7CA 4IX5A 1ZAOA 5BUEA 3IGOA 4JX3A 5E8XA 4PMMA 3SXFA 5A9UA 4LV8A 5EQEA 4KD1A 1KSWA 1YI3A 4QMOA 3Q60A 4JBOA 3UIXA 2WO6A 3QTUA 1G8AA 3WARA 5CAPA 3FLNC 1PKGA 4EOQA 2IG7A 3BBTB 4QNYA 4EJ7A 2VZ6A 2ERKA 3IW5A 3V5WA 4GT3A 5KNJA 4FIIA 4LFIA 3KVXA 4K6ZA 5EI8A 4BHNA 4QMUA 5CAVA 3ZS5A 4C33A 1OECA 3D83A 4M3QA 3EB0A 4YZCA 5GNKA 4D5HA 5ACKA 3MY1A 3UVPA 3LCOA 4S2ZA 2C6LA 5I9UA 4F99A 2E2BA 2WMUA 5CLPA 3D5WA 5DIAA 4YZNA 4D2PA 2WTWA 3CGOA 2CKOA 4IFCA 2PULA 4JDKA 4BIDA 4IVBA 1JVPP 2XKCA 1WBTA 3R7IA 4DAWA 5C26A 5H3QA 3R22A 1P4OA 4DYMA 4E73A 2HXQA 2HZ0A 2ZM4A 5ACBC 4E7WA 4KSQA 5DRBA 3PIZA 4IACA 4MNEA 2C3KA 4ZJIA 1Q8UA 2B7AA 2O0UA 5CTPA 5C8MA 5HORA 4R3CA 3NNVA 2QC6A 3ZCLA 2PE1A 4DEDA 3R8LA 2FB8A 4M97A 2BROA 4ANQA 2IW8A 4O38A 4A9SA 3OOGA 1TQPA 4ZTNA 4F09A 1HOWA 4YU2A 2C69A 4OT6A 4IVDA 4FEVA 4F08A 3DFAA 5JSMA 5E1EA 4R6VA 3V5PA 2C47A 3IK3A 3QKKA 4GEOA 4ZTRA 5IA3A 1IG1A 3UE4A 4FNXA 4YZMA 2QODA 4FL2A 4NM0A 4IZ5A 3VIDA 4E6QA 2C3IB 2CN8A 3G9LX 4YHJA 3JY0A 5LJJA 3ORNA 4JX7A 1CDKA 4FTAA 4EUTA 4QMYA 2GQRA 3GOPA 2YZLA 4D0XA 1KV1A 4FVPA 4GG5A 4ZAUA 1JKSA 3R83A 4O0UA 5BQ0A 2XKFA 3FLZA 4RIXA 3EQBA 4NU1A 5DN3A 2I7QA 4R77A 4FZ7A 2XM8A 4GK2A 3SKCA 2XK7A 1RDQE 3E5AA 2OU7A 2PK9A 3LMIA 2YM3A 5CY3A 3CR0A 4RT7A 4C4IA 5EW9A 3ZSIA 3BYOA 3HZTA 5GJDA 3KMWA 2YM6A 5KMJA 4KUJA 1ZYSA 5HIDA 4EL9A 1H4LA 3VS4A 4HVIA 5AAGA 4PTCA 4XNEA 4PY1A 2Z7SA 4IAIA 5JFVA 1BI8A 2EB2A 2XIKA 3LAUA 4KKEA 5IA1A 4O7RA 2F57A 1GZKA 5HZNA 2WD1A 3BQRA 5JFWA 3Q5IA 4LQMA 3ETAA 3LPBA 3CPCA 3TACA 2ZYBA 3PVBA 4JR7A 4K18A 4MQ2A 4QMSA 2ZV9A 4TPTA 2VTOA 5A6NA 3VW8A 1OKZA 3MDYA 4XHKB 4OBPA 3UG2A 3KXHA 3QYZA 4FIJA 3NYNA 1KE5A 3CD8A 2BTRA 4R3RA 5F20A 4GKIA 3GU7A 4RJ3A 4HVHA 4F6WA 3GCVA 2NRUA 3AT3A 4IB3A 4TWNA 2WHBA 2EXEA 2XRWA 4USFA 3C4ZA 4MXAA 1NVSA 4HYHA 5EDQA 1H27A 3QWJA 4P5ZA 3TZ7A 5D41A 4DEHA 1ZOEA 4QMQA 3T8OA 5HE1A 2F2CB 3UDBA 3WIKA 5LOHA 2GTNA 1OZ1A 3PZHA 3FI4A 2ACXA 4AA5A 3E8DA 3EHAA 1OBDA 4QMZA 3UG1A 5I0BA 1STCE 1WMKA 2C0TA 2VWUA 4IE9A 4O0TA 1PMVA 3EFLA 2EXMA 4FG9A 3O23A 4L44A 3PIXA 2C30A 2P3GX 3D15A 3A8WA 1ND4A 3N4UA 2OSCA 2HZ4A 3LJ0A 4UY9A 3LFSA 2XUUA 3D5XA 2X39A 3O51A 3VN9A 4F9YA 2GFCA 1RJBA 3D7TB 4BR3A 4MXCA 4JG6A 3UO4A 3VC4A 2QHNA 4D4SA 3BEAA 4O84A 5T6KA 2ITTA 3FPQA 4OAVB 2PYWA 2VTJA 5CENA 5K4JA 2QR7A 4XP0A 1GIJA 1W83A 3L8SA 4YLKA 2V7AA 3E64A 4FA2A 3DTWA 4QT1A 5HCZA 3BRBA 5CEIA 2BKKA 3EQPA 1VYWA 4GJ3A 3A60A 4L3PA 1H07A 5L6PA 3BWJA 2CGVA 3GT8A 5DYJA 4BCOA 3SOAA 3FC1X 3TG1A 3KMMA 3VQUA 2W05A 3POOA 2XM9A 1UWJA 2HYYA 4HGSA 3SXRA 1PY5A 2CLXA 1NY3A 1XH7A 3FI2A 3WI6A 4ZZOA 2QOFA 2VTMA 3FZRA 3M1SA 2C0IA 4H3QA 4BCFA 4O0YA 1YXSA 3WE8A 4EK5A 4EOJA 4F7LA 1H8FA 4Y8DA 3FMEA 5ANGA 4CVAA 3SG9A 4ZSGA 4ZK5A 2R3QA 2BKZA 4F4PA 5M4IA 4MXOA 4J97A 2O2UA 3DDQA 2HAKA 4LOQA 1JWHA 1ZOGA 4QP7A 1XBCA 4UZHA 2GNJA 1M52A 3GFWA 3FLWA 4L9IA 4QQJA 1UNHA 4AGDA 3HP5A 4OBQA 2Y7JA 1GAGA 4O2ZA 2DS1A 3GC8A 3R04A 1VR2A 1WAKA 4H3BA 4IIRA 4HGTA 4MXXA 2W96B 3R7VA 4RLLA 1OKWA 3VBQA 5DE2A 4BZOA 3KK9A 3QTXA 3KY2A 5HVYA 4RIWA 4AOTA 4BDJA 4ANOA 4BDBA 1U54A 2QURA 1JSTA 2CLQA 2XK6A 3MB7A 2G15A 4KIKB 4LRKA 4YUQA 4RA5A 1M2QA 2GQSA 2RKUA 3BU5A 2HXLA 3A62A 5M07A 2PY3A 4TN6A 3KB7A 4ZP5A 5K4IA 4YZBA 1Y6BA 5IQAA 4D1SA 2QU5A 2UZOA 3NRMA 1JSVA 3R21A 4BTMA 2OZAB 5B2KA 4AXAA 5J5SA 3OWJA 2IO6A 3AQVA 3D9VA 2W1DA 2YN8A 5HO8A 3FMKA 2YIRA 2JKMA 4I20A 4IJPA 3DB8A 3U4WA 3DGKA 4AS0A 3PA3A 1OBGA 3T9TA 1WVYA 4C7TA 1M2RA 2O3PA 4FKQA 2BRBA 4K2RA 2YISA 4RQKA 5CXZA 1Q8YA 3U55A 3IW7A 4UMRA 3KRWA 2UZNA 4KB8A 4MHAA 1IEPA 3DAKA 3LJ2A 4TTHB 5FWKK 4AZFA 3TM0A 4B99A 3FKLA 3SAYA 3WZDA 2CSNA 3OTUA 4O81A 1HCLA 5E8VA 1KOAA 4GYGA 5KHXA 3ZFYA 3ZYAA 3R1NA 4XOYA 4D0WA 2H34A 3TUDA 1ZXEA 3RKBA 3CQWA 4I5PA 4O86A 3OP5A 1GJOA 3F2NA 3FMNA 2XS0A 3C7QA 4G17A 2VWWA 2YJRA 3DB6A 5CU2A 3TNPC 3VUMA 4QO9A 3WBLA 1PRYA 4PP9A 2C5XA 2FH9A 3SOCA 3IOPA 4BZDA 4PDPA 3SV0A 1JBPE 1O6LA 4OAUC 1DI8A 2QOQA 4U6RA 4Q9ZA 1JLUE 2XNEA 4NWMA 4G1WA 4PTGA 3VUHA 5IA4A 1IAJA 2J51A 3DK6A 2WQEA 3RCDA 1CTPE 4ZTQA 4JQ8A 4BCNA 4M14A 4FTTA 4NJ3A 4LL5A 2YDIA 2QI8A 4IQ6A 4L01A 2PZYA 3CE3A 4FV9A 4ASXA 5IUGA 2VTAA 3AD5A 4N0SA 5BYLA 1JSUA 4AWIA 4IM3A 5LVNA 4BCHA 4FTLA 1ZRZA 1LUFA 3CXWA 3PLSA 3QQGA 4RLKA 2G9XA 5CEKA 2GS2A 1DAYA 5EM5A 2PSQA 2OF2A 5DLSA 4TW9A 2PMOX 2WMSA 4ZZNA 1KE9A 1Y8GA 3ENHA 1H25A 3HRFA 4QTBA 2XYUA 5JZJA 4IB5A 4BCIA 2I0YA 4H3PA 5EDPA 3DV3A 1URWA 4WHZA 1GIHA 2PWLA 1Q3DA 4EUUA 2HY0A 4RWIA 3ZUUA 3OEZA 3TV4A 4JDJA 2QG7A 2C5NA 3SW7A 2C6KA 2YABA 5CANA 2JC6A 3HV6A 4FKVA 4I22A 3R8MA 4FV2A 3E8NA 3DZQA 4JIAA 4KIKA 4E5AX 1IASA 4M8TA 5CEPA 3NSZA 3VF9A 3OMVA 4QP1A 4I0SA 5AADA 3EFKA 3EN6A 2IVUA 3PXFA 4U81A 5F95A 4X3FC 2CKQA 3CP9A 4CZUA 4RJ6A 3U6HA 2BDJA 2NNWB 2BZKB 2P2HA 3FHRA 5AUTA 3JXWA 4RC3A 4L52A 3ZC5A 5IEYA 3DA6A 3F66A 5TO8A 3P9JA 1Y91A 2BRHA 4BCKA 4DEGA 3DT1A 5M08A 3DY7A 3P5KA 4LM5A 3MI9A 3RALA 4AA0A 1XJDA 4CCUA 2XIZA 4WD5A 4DCEA 4JT3A 3QUPA 2A19B 4LGHA 4RIOA 1I44A 5BUIA 4CFVA 5KMMA 4RWLA 2WIPA 3CEKA 3HAVA 4FV8A 2VX3A 3C4WA 2FUMA 2QOOA 3KXNA 4G34A 4JLCA 4OT5A 4ANLA 3IONA 4G16A 4IHPA 4JRNA 4GMYA 4I23A 2HCKA 4M7IA 4TYIA 5J8IA 1ZY4A 3Q6WA 2R64A 1B38A 3R1QA 3VJNA 3CCNA 1MRVA 4BICA 1PMEA 2G01A 3N9XA 4DEAA 5KHWA 4E5WA 3F3TA 2J0JA 4FT0A 4LRJA 4FSYA 4N6ZA 4NL0A 3HNGA 4EHEA 2VO7A 2R3FA 3QWKA 4IM0A 1YQJA 3QF9A 4FSNA 4QPSA 1SZMA 1PXLA 2XIXA 3QTZA 3L8XA 4QYFA 3DKGA 4CD0A 3HV3A 1JPAA 4ANNA 4BGHA 3OY1A 3Q3BA 2QQ7A 4GS6A 4BN1A 2SRCA 2JAMA 1APME 3EN7A 3SRVA 4L68A 2IW9A 2CDZA 2LGCA 3OD6X 2WMBA 4OGRA 4XCUA 4ZIMA 2YCFA 2RFEA 3R2YA 4I1ZA 4FNWA 5CI7A 4D28A 4OTFA 5BVDA 5ITAA 1WBOA 1OVEA 4GU9A 4TYHA 1OIUA 1UVRA 2R3IA 2QO7A 4DGLC 5ANKA 2QNJA 5DFPA 4OTGA 2BFXA 1NW1A 1TQIA 2X8EA 1XH6A 4IBMA 3LFCA 1UU8A 4PMPA 3MA6A 5L3AA 4O7LA 3FXXA 3KRJA 1WBPA 3C5IA 2PUUA 3PP0A 3PY1A 3C0IA 4UX9A 5A4QA 3UQFA 2JDVA 3K5VA 3AC8A 3ITZA 3UPXA 5EYMA 4HJOA 3VO3A 4DH3A 4P4CA 3MB6A 2J0LA 5K3YA 1R78A 4RVTA 3R7UA 3W10A 5M4CA 4HVGA 1RQQA 1CMKE 1W82A 3DBQA 4FI1A 4MH7A 1FOTA 4M84A 2R7BA 3H10A 3A4PA 4RZWA 2YCSA 4LMNA 3O17A 3NCGA 3QUDA 3E93A 3GGFA 4KA3A 4DLJA 3RNYA 3DJ6A 4GG7A 3F3WA 3IW4A 3BHUA 5DOSA 2VTRA 5DHJA 4GIHA 4RBLA 4AW5A 2HZNA 4GW8A 5KCVA 4M67A 2XIRA 4HCTA 2C6DA 4B4LA 5EOBA 3HMNA 3UBDA 5A4TA 3FBVA 4FTMA 2FSMX 3V04A 3FMJA 2PMNX 2GDOA 4BKZA 3A4OX 4EKLA 3FHIA 4ASEA 5ANJA 2F2UA 5CEOA 3OTVA 2P33A 4GCJA 4JAJA 5CNNA 2G1TA 2QLQA 4CZYB 2X8DA 2HIWA 4ZMEA 4XG9A 3W2PA 4AP7A 4BI0A 3NIZA 4IMYA 4FSTA 4HZSA 4LL0A 5HBEA 1ERKA 3QA0A 3C0HA 2ITZA 3DJ5A 4V0GA 4FGRA 4RX5A 2CGWA 1S9JA 2OJ9A 3D5VA 4QRCA 3RK7A 3GCPA 4FVRA 2JEDA 4ZY6A 3VW6A 1V0PA 2X4ZA 3HYHA 5B0XA 3T3VA 2EU9A 1ZMUA 2X4FA 5AEPA 2VNYA 4QP8A 3KCKA 5IZFA 2IPXA 3Q9XA 4WBOA 2XBAA 3PJCA 3WZEA 5IEVA 3OCTA 3P78A 4JDHA 4QP6A 3PA5A 4QPAA 3MH0A 3ORKA 4WSQA 4AF3A 4BTFA 5AA8A 5ETIA 5LMBA 4EWQA 3QQFA 2VO3A 5FTQA 2GMXA 4XJ0A 4JL9A 3SRVB 2V7OA 5AFVA 1M14A 2EXCX 2GNFA 3AC5A 3PP1A 3LKMA 5AP0A 3MTLA 2W1HA 3TKUA 2W5HA 3ODZX 3QBNA 2JAVA 4PNKA 4BFMA 1G3NA 2IJMA 3HP2A 4I3ZA 3PIYA 4IW0A 2VD5A 3LQ5A 2O5KA 2BRNA 4XEYA 3LMGA 2BMCA 4C3PA 3ZZEA 3ZONA 5H9BA 4F6UA 1JKKA 4I4EA 3D2KA 4MF0A 4B9DA 3UZRA 4I6BA 3BQCA 4FT3A 4O22A 3TKIA 2BIKB 2DQ7X 3BYMA 4X6RA 4G6LA 4RIYB 3BZ3A 5CF8A 1Q62A 1MP8A 3AC2A 2W9FB 1ZYCA 3QKLA 4BDHA 3ENMA 5AR7A 4DBNA 2DWBA 4GKHA 5KZ0A 3GU4A 4DFUA 4QMWA 4H1JA 2F7ZE 3DAJA 2XNPA 3OCBA 5IISA 4R5SA 5HG9A 2NP8A 4I94A 5JGBA 4GT5A 5E1SA 4C3RA 5JFSA 3PUPA 4EBVA 3A7JA 5CNOA 5LXMA 3W1FA 3CC6A 5AP5A 3QTSA 1LEZA 2WMRA 3R9DA 3AT2A 1SYKA 4B0GA 2CGUA 2XJ2A 4HCUA 4AE9A 3NLBA 3MVHA 4FC0A 4ANMA 4GUBA 4PX6A 4A06A 4C37A 3MGYA 5EKOA 4DLIA 2PVJA 4CTBA 4FIEA 3PTGA 1OITA 3ZH8A 3DJ7A 3ZM9A 3Q2MA 2CPKE 4JRVA 3BBWA 3TCPA 4EH2A 3D2IA 3TNQB 4TL0A 3A61A 2C68A 4GSBA 2WMAA 4GVAA 1XBAA 2VTIA 2JDRA 4AX8A 4KS7A 3VUTA 4RX7A 4RSSA 3TKHA 4CG8A 3RWPA 5K0KA 4N4SA 5HD7A 3LHJA 3R1YA 3EJ1A 3IO7A 3LFNA 3OS3A 3MA3A 4C02A 2PPQA 3BLHA 1PXNA 2X7OA 4FKLA 4BCMA 4FIGA 5L2QA 2CNQA 4FKPA 3OT3A 4MCVA 1CKJA 4MNFA 5AUXA 3KK8A 2VO0A 1FQ1B 4V05A 5DVRA 2E9PA 4KRCA 5IA0A 2YWPA 3CD3A 1YHSA 3RMFA 5CAUA 4K77A 5TR6A 2YFXA 4H1MA 3UZPA 1OL5A 4GL9A 2OW3A 5BMSA 4AACA 3LFQA 3PXZA 4JG8A 2HENA 3QX2A 5AAFA 4YLJA 4FL1A 4AU8A 4FTIA 1ZZLA 5HLWA 4HYSA 4IADA 4U0IA 5AV4A 5AR3A 5DT3A 2OFVA 3EKNA 4IB0A 4S34A 3U9CA 5HTIA 3MFTA 2ITNA 4FSQA 1MQ4A 4TWCA 5CEQA 1BKXA 3QYWA 4QMPA 4W4YA 2I0HA 3IECA 4O1OA 2EB3A 3MIYA 4DEBA 5IEXA 4KAOA 4ORKA 3PA4A 4OR5A 3NVKI 4ZTHA 4WA9A 3PVGA 3ZZWA 3MIAA 3R9NA 4AN3A 5IQDA 4BCQA 2B9IA 4G6OA 3TN8A 4EOOA 4PPBA 2C3LA 3PSDA 4YTHA 5J95A 4BCJA 3HGKA 2Y4IB 4B6LA 2CKPA 4ACGA 3VF8A 5DG5A 3ORTA 4QPMA 3QRKA 3IS5A 5E8SA 3S2PA 2GHGA 3GCUA 4G3EA 4CQEA 1LR4A 5GIPE 1J7LA 4BBEA 4WBBB 3LE6A 4RFZA 5HE2A 4QTEA 4D2VA 4PL4A 4MAOA 2RSVA 1XHAA 1JKLA 3OBGA 3ZM4A 4CT2A 3NIEA 2EUFB 4C36A 4W4WA 3R8ZA 4YNEA 3I7CA 1UWHA 3FV8A 3IKAA 1GIIA 3NWWA 4FKSA 5D7VA 5A4CA 5CEMA 4CG9A 3U6IA 3OXTA 2HZIA 4E4XA 1YOJA 2FGIA 4APCA 3FQSA 2YM8A 1AQ1A 3LJ1A 3O7LD 1J3HA 4FIFA 2BCJA 2R9SA 3TIZA 2HOGA 5L8LA 2R3KA 2JKOA 2WTKB 5BVKA 3SXSA 3ZEWA 4U9AA 4FR4A 2PVRA 5FGKA 4ZMFA 5BVFA 4FNYA 4U41A 4NFMA 3ZOSA 3QQHA 4FIHA 4M69A 1JKTA 2XEZA 1KOBA 1XO2B 4EEVA 5J9YA 1OIRA 3G90X 3ANQA 3UOKA 2GHLA 2CGXA 3ZRKA 3GI3A 2BZIB 3Q9ZA 5AJQA 3MVLA 2YDJA 3TNIA 5J1WA 4EC9A 1R1WA 4NW6A 2QLUA 4V01A 1V0OA 2UZLA 2WNTA 2WEIA 3IPHA 3PZEA 4CFFA 4V0GB 3WYYA 4WO5A 3E3PA 3NR9A 2X6DA 4QMTA 2XIYA 4RC2A 3W2SA 3DTCA 5IQGA 5FEDA 5AIKA 1ZZ2A 3BHYA 4K0YA 3GC7A 2F9GA 2UZDA 1F5QA 4JJRA 1M7NA 4O0SA 2J9MA 3FQHA 3HL7A 5AX3A 5JGDA 4L46A 2CNVA 5FTOA 3BWFA 4FV5A 3UYTA 1K3AA 5KMKA 1NA7A 1YRPA 1BUHA 4NW5A 4MBLA 1OPKA 4XP3A 1PYXA 3K5UA 1YXTA 4KKHA 1H0WA 3BU3A 5FBOA 4ACHA 5HGIA 5J7BA 2GHMA 3UJGA 5L8KA 3Q5ZA 4FTRA 1WFCA 3Q4TA 2GU8A 4QTAA 4EOKA 5CZHA 1U59A 2W1CA 4ITHA 2J50A 2JBOA 3R8PA 3WF6A 4OTDA 3OCSA 5AV1A 4Q5EA 4ZTMA 3UZTA 5IQIA 1FGKA 3R7YA 2UW4A 1U5QA 4YNOA 1TKIA 3SLSA 3R9OA 3U4UA 4WNKA 5IQBA 4N57A 4OTQA 3QD2B 1FVVA 1YXUA 2P4IA 4NM5A 5H8BA 3EH9A 2IZSA 3K54A 4G9RA 4IDVA 4TYGA 5EI6A 4ZXTA 2C1BA 3FSKA 2WMWA 2OGVA 3IDBA 2FO0A 2Z7QA 2UZVA 4D55A 4H36A 4O0XA 1SMHA 3S3IA 4GYIA 3VS7A 4J99A 2UVYA 4MEDA 1CSNA 4A9TA 3U6JA 5TKDA 4LOPA 4WSYA 3DCVA 3DFCB 2OI4X 1M17A 2OICA 3UMWA 1H08A 3BE2A 1Q8TA 2OIBA 3SA0A 4XG8A 3QALE 5L8JA 3O8TA 5JRSA 4QMMA 2W0JA 1SVEA 4ZOGA 2YLFA 4QP3A 4G5PA 2ETMA 5CASA 1WZYA 4ZSAA 5CU0A 5GHVA 4WUAA 4E4MA 3EYGA 4PP7A 5IH6A 3ZSGA 3Q9WA 3AOXA 2R0IA 3NUSA 4Z7GA 5JH6A 1ZYDA 5B2MA 3KC3A 2X6EA 1MRUA 3PXRA 4OTHA 3UIUA 5FXQA 3F2AA 3UO5A 3ZLYA 3DK7A 3NAYA 3F7WA 2WEVA 5AP2A 4CLIA 3HUBA 5HO7A 3GQLA 4NZWB 4JVGA 5AV2A 5GZ9A 3HDNA 2VO6A 3MW1A 4IFGA 4CFWA 3QD3A 1OI9A 5JT2A 3MVMA 3MPMA 3W16A 3MPTA 5HHWA 2BZHB 3QRTA 4DH7A 5AAEA 3SW4A 3NUNA 4EI4A 4U5JA 2QONA 4G2FA 3UO6A 1GZ8A 4BKJA 1REJA 4MYGA 3DBFA 1J91A 1ZARA 3G33A 4TYEA 3JY9A 2WOUA 3DOGA 4RMZA 3SC1A 3LQ8A 3CQUA 3K3IA 3LFFA 3RPSA 4F0IA 5BPYA 4O7VA 1J1CA 3DKOA 3HKOA 2PHKA 1VJYA 4RPVA 4RG0A 4IWQA 3NEWA 2C6MA 3COMA 4Y83A 3EQDA 3QZFA 4KNBA 4HYUA 3BU6A 3I60A 2ZMDA 4XP2A 3FMMA 2XJ0A 3R8VA 1XWSA 3RZFA 3AG9A 3TV7A 3VBXA 5IA2A 5A3XA 4QYYA 2XKEA 4FTJA 3FDNA 1CM8A 1CKIA 3DBCA 4LMUA 4BRXA 4QNAA 3UVQA 1PKDA 5CXHA 2HW7A 4AUAA 2XVDA 4FNZA 2G2IA 4IWOA 4XH6A 2CCIA 3VQHA 3DAEA 4IJ9A 4QMXA 2C6IA 2ETRA 3BIZA 2J2IB 3F3VA 4JOAA 4XRLA 4F1MA 4ZS0A 1AGWA 5EI2A 3UGCA 4B7TA 3KXGA 1UU3A 4L7SA 4ZEGA 2OJFE 4C38A 4YJPA 4PMTA 5DR9A 4I6HA 5FG8A 3KXZA 3TDVA 3HDMA 2GFSA 2R3NA 4KINA 3FZPA 1KE7A 1DS5A 4RX8A 4U42A 4W4VA 3ACKA 4CFMA 5JK3A 4AT5A 3FI3A 5CALA 3ODYX 3KF7A 4AOIA 3OOMA 4PUZA 4L3JA 3SG8A 1ZY5A 3QKMA 2UV2A 4O7NA 3D5UA 5EM8A 4TY1A 3B2WA 1NXKA 4KRDA 5EH0A 1XBBA 5AP6A 4IB1A 2XRUA 5I9VA 2XNMA 3PY0A 4A4XA 4FT7A 3NZ0A 4YJRA 4AN2A 3EQCA 3LXKA 4CFNA 4HVSA 4FEQA 2VV9A 3F9NA 5HCXA 2C1AA 3LM5A 3ATTA 4DGGA 2GS6A 4E5BA 2X9EA 3RK5A 3MV5A 3JUHA 2QR8A 3NUPA 5C8KA 4XMOA 4CNHA 2OFUA 3C9WA 4YZDA 4AW2A 2P55A 2B9HA 2IVVA 4C2VA 4AZSA 3OUNB 2J90A 2R3MA 4AN9A 3D4QA 1NVQA 3Q9YA 4UXLA 4RQVA 4U40A 3R63A 5I4NA 3RBWA 5J9ZA 1OKYA 2O8YA 5FD2A 3AXWA 1R0PA 3HUCA 1BL6A 3QLGA 2ITQA 3QLFA 4I6QA 2WTCA 2Z7RA 2CHLA 3PWYA 3RAHA 3I0OA 2JKQA 2VTTA 3LXNA 5ANOA 4EH6A 3EQGA 4APPA 5TF9A 2XF0A 4YJNA 3O7LB 4ENYA 4R7BA 4BL1A 2ZB1A 5HNGA 3ANRA 1LEWA 1MRYA 1WVXA 4EJNA 5CSPA 3PVWA 4FT9A 4R7HA 5H8GA 3VUDA 5J5TA 1IA9A 2EWAA 3QAME 3BEGA 4WNPA 3W2CA 1JQHA 3I5NA 5B2LA 3EZVA 5KKRB 2ZB0A 4K11A 3FMHA 2C6EA 4FICA 5CX9A 1PXIA 4G3DA 4KIOA 4FGBA 4MWHA 2I0VA 4YJTA 3AGLA 3RHKA 5LWNA 4WKQA 1QMZA 3V01A 4EH8A 2Y6OA 4BIEA 4QYGA 2W5AA 3VS1A 1TVOA 3KREA 3EQIA 5BYYA 1UKIA 4GFOA 5CSWA 3GB2A 5CS6A 1ZWSA 3PJ8A 5HNBA 4F7SA 4PWNA 4C4FA 3NMUF 1H01A 5DEWA 2WIHA 4L00A 4DG3E 4EK6A 4O7TA 1YOMA 3JVSA 3HMIA 1EH4A 5IF1A 5IQFA 1Y8YA 2OJJA 4RJ5A 2R3HA 3QCYA 1IA8A 3OF0A 5FRIA 5J9LA 1SVGA 5ETAA 4O0WA 1QPEA 3NCZA 3M42A 3DLSA 4LUEA 3VNTA 4ZY4A 3AC3A 2VTNA 4QMLA 2VWBA 1DM2A 2Y0AA 5E8TA 5AR8A 5JQ8A 4UMUA 2XK3A 2VU3A 4DTKA 3JS2A 1Q24A 2JD5A 1SNXA 4YTCA 2C5YA 4FTOA 3SGCA 4U3ZA 4I92A 3S00A 3TZ8A 2WU6A 4O7YA 3GU6A 3FXWA 4J96A 4FT5A 4DN5A 5AR4A 3FKOA 4PMSA 2PMIA 4X21A 3VUGA 2YACA 4GJ2A 4CKIA 2GNHA 1HCKA 3R1SA 4FZAB 3ET7A 2F7XE 1PXMA 2YCRA 4A7CA 2Y8OA 4RJ4A 3TEIA 2VWYA 2VRXA 1Q97A 3MTFA 1YHWA 4GU6A 3HMPA 5DWRA 5DPVA 2OLCA 3OEFX 4C34A 2WZJA 3IQ7A 4XG4A 2UZBA 4RJ8A 3CPBA 5AUUA 1PJKA 3WYXA 1SM2A 4NSTA 3F3UA 4MD7E 2IN6A 4WG5A 4ZS4A 3D14A 5LVPA 3C51A 4WRSA 2W9ZB 4DGMA 4NTSA 4HNFA 2P2IA 4AZEA 3PVUA 3F5UA 1PMUA 4XG3A 4BWKA 1H1PA 3GOKA 4XG2A 5AM6A 3UIBA 2VWIA 5BVOA 4FKRA 5HX8A 4N6YA 5FEQA 4BGQA 2AC5A 4DFZE 4CGAA 3TDWA 2W1ZA 2BVAA 2XYNA 2W1EA 2X1NA 3U87A 3OWPA 4X2FA 1A9UA 4AGUA 3AMAA 2JIIA 5CU3A 4ZZMA 4D4YA 4JDIA 4W8DA 4PL3A 4NM3A 2XKDA 3LXLA 4UALA 4EH4A 4Y85A 2JFMA 4FZ6A 3AMYA 5E9EA 4NT4A 3TZ9A 4IAYA 2ERZE 4NYEA 3GBZA 2VTSA 2CMWA 3IW8A 4RZVA 2E9UA 4HGEA 3F5PA 3PXQA 5BX0A 2JDTA 2R2PA 4Z55A 3VUKA 3HECA 2JDSA 4YBKA 3TXOA 3UIMA 1BX6A 2OBJA 1M2PA 3VRYA 4F65A 1KWPA 3FZOA 3G6HA 1KUTA 4MD8E 4Q5HA 4CCBA 4U79A 4WIHA 4QP9A 5E8YA 5FTGA 4UB7A 3ZDIA 3CY3A 1Q8ZA 3I81A 5H2UA 2R4BA 4EYMA 2W1IA 4UYNA 5HI2A 4II5A 4F6SA 4IANA 3MJ2A 4PF4A 2PVMA 1X8BA 3E8CA 2W06A 3U54A 5JKGA 2I40A 2Q83A 3VVHA 5C27A 2KTYA 5F1ZA 4ASDA 5CZIA 2X7FA 4YGAA 4IZ7A 3DBEA 3MFRA 4ZY5A 4QYEA 2GCDA 3GU8A 4X2NA 1YVJA 3OWKA 4BI2A 5AMNA 5CT7A 4DEIA 5CF4A 3HA8A 3LLTA 2A0CX 2JGZA 2WXVA 4BDDA 1E9HA 3LFAA 4BDCA 4BF2A 3E62A 3DS6A 3F5GA 1IAHA 3P4KA 5AIRA 2Q0BA 3BV2A 3DNDA 4UYAA 5EYCA 4XV3A 3F88A 4UWCA 3CSVA 4DG2E 3RNIA 3KA0A 1WBWA 2JITA 3DDPA 4GT4A 4XV9A 2E9NA 5DA3A 4QMVA 3ULZA 3ZEPA 1OGUA 4O83A 2YA9A 3ZLWA 1IR3A 3MBLA 3QCXA 3R9RA 2ZDTA 5C4KA 3W55A 3IDPA 4QMNA 3WOWA 4IWDA 5LMKC 4YMJA 2ONLC 3E7VA 4USEA 2YM4A 5FDXA 3I7BA 4YPSA 2UW3A 5HX6A 3G9NA 4TNBA 2RFSA 4AZTA 1GOLA 3RPYA 2J4ZA 4FG7A 4DE4A 2XNNA 1H24A 2YDKA 4IM2A 5L2IA 2XNOA 3BI6A 3QTIA 3IDCA 2VWXA
chains in the Genus database with same CATH superfamily
5ANIA 4L67A 4FV7A 5E8UA 3ZXTA 1H26A 4CYJA 2C5OA 3LW0A 3PY3A 4IX6A 3CJFA 5AR2A 4HPUE 3FUPA 3QU0A 2WKMA 1UU7A 1Q41A 4O6LA 4A9RA 3LLAA 3CKXA 4EK3A 2B1PA 4LUDA 3EKKA 3LCKA 5JRQA 4XX9A 4PNIA 5KMOA 3EL7A 4UEUA 4OTWA 3FL5A 4F64A 3HMOA 3PLAE 2PUIA 2UZEA 4AT3A 1BL7A 2QD9A 1W7HA 2C5VA 4GFGA 1JAMA 5HE0A 4ZJJA 4HVDA 3KQ7A 1OL2A 3UYSA 3L9PA 5EM6A 4JBPA 4LGDA 2F7EE 4DGOA 3CY2A 3MFUA 3GEQA 3II5A 3BX5A 3MH3A 3KKVA 3P7AA 4DT8A 3WF8A 4ZLZA 2QOKA 3D7TA 5LCKA 5EHLA 2IVSA 3HV5A 4KSPA 3BL9A 4ZSEA 3NFGB 2G2FA 3OCGA 3Q52A 3L9LA 4PPCA 5F94A 4IAAA 4IWPA 3LM0A 3RK9A 5J79A 3G6GA 5TE0A 4FJVA 2I0EA 3RAIA 4JIKA 4WT6A 5IUIA 3GU5A 1FBNA 2VN9A 2UW0A 4FODA 5F4NA 5IA5A 4S33A 2HW6A 3A7GA 3DU8A 3WZUA 2BHEA 4TYJA 5LVLA 4F1OA 3OXZA 3S0OA 1ST4A 4AFJA 4XRJA 4A4LA 3AD6A 3DBDA 5AV3A 3QC4A 5HKMA 4EHZA 2OWBA 5CSHA 5FM3A 3PJ2A 2UVZA 3V51A 1UKHA 3WZJA 1F0QA 2JKKA 4F9CA 4I6FA 4YSMA 1H0VA 5DT0A 4F9WA 2FA2A 3G51A 4UXQA 4XLVA 5HVKA 4DA5A 3F5XA 5F9EA 5LMKA 3VUIA 4O2PA 4D4RA 4ID7A 4DBXA 2OZOA 4HNIA 4DINA 2PZ5A 5FP5A 2AQXA 4XG7A 3N4TA 4XV2A 2WQMA 3W2RA 4FKWA 3QD0A 2PL0A 3MSSA 4BCGA 4K8AA 5C03A 2ZJWA 1OKVA 2ONLA 3RGFA 1FPUA 1H00A 1SNUA 4MTAA 5IQCA 5DMZA 3KRRA 5HOAA 3I1AA 4O1PA 2PE2A 4NM7A 1V0BA 4RIWB 3ZFXA 3O50A 2ITOA 4J1RA 4J7BA 4ACDA 5AA9A 4IZAA 3PFQA 4W8EA 4BJJA 2X2LA 3IOKA 4NKSA 3QQKA 4C4JA 3KGAA 3OROA 4KIQA 3VJOA 4RWKA 4M0YA 4U3YA 2REIA 4Y95A 4FEWA 4MD9E 2QU6A 4FKIA 1YWNA 4JAIA 4LI5A 5FM2A 4R3PA 4I5MA 4E26A 2Z60A 3GUBA 2Q0NA 3MWUA 1PXOA 4JG7A 3W8QA 4E4NA 1YWRA 4MX9A 2OZAA 2HWPA 5IQHA 3M11A 5EW3A 2W17A 3FPMA 5AM7A 3Q2JA 4DHJA 4CQGA 3QCSA 4NCTA 4FG8A 2A1AB 3B8RA 4F70A 4YJUA 4ACMA 5CVFA 4X0MA 5FXRA 5HLPA 4G3FA 1TZDA 4UV0A 3NW7A 3NUUA 5D1JA 3ROCA 3D0EA 4MBIA 2I1MA 2BAQA 2GPHA 2BRMA 5DGZA 3UPZA 1Y57A 2VTHA 3QQUA 1PMNA 1M7QA 4S30A 4AGCA 2V62A 3ACJA 1PHKA 4GH2A 3QGWA 4YZ9A 2GSFA 2A2AA 2GNGA 3NNWA 4ALWA 2RIOA 4MQ1A 4F7NA 3CS9A 5EM7A 3V6RA 5CU6A 1AD5A 3VBWA 5M09A 3BL7A 5FUTA 3CIKA 4DFNA 2X7GA 1V1KA 4L45A 4UMPA 5GIOE 1ATPE 2VAGA 1PF8A 3L9NA 3Q4CA 4CRLA 4D2TA 2B55A 2OO8X 1W0XC 2CNUA 4C57A 1QPDA 3O71A 1OUYA 3C50A 4WOVA 3ZRLA 3T9IA 5ETFA 4W9XA 3C5UA 4FOBA 5FDPA 2OXXA 5L6WL 4G5JA 5K5NA 4Z16A 4FUXA 2XNBA 2BIYA 4FL3A 1Q8WA 1R39A 1Z57A 3HX4A 3LFEA 2YM7A 4FKGA 4FVQA 4GIIA 3S1HA 4EQUA 4ZLYA 3OWLA 4X2JA 1OPJA 2WELA 4M12A 4CZTA 4RVKA 3THBA 2VGOA 5J87A 1H28A 5ANEA 3COHA 5M55A 4UWBA 5KX8A 5M56A 3JPVA 4JMQA 3FYJX 4A4OA 3OW3A 4BDFA 2OK1A 3VULA 3RAWA 4YHTA 3QTQA 1FVTA 4E4LA 4RX9A 3PPJA 4XS2A 3VBVA 5HNIX 3QD4A 1F3MC 2QHMA 3QFVA 4J52A 4QOXA 5EHYA 5FEEA 4X2GA 3V8TA 2CN5A 1TQMA 4L6QA 4O96A 5AP4A 4LG4A 5EYDA 3HEGA 4OLIA 4CLJA 4M0ZA 3O2MA 3BGQA 3UVRA 2W4OA 2QG5A 3R6XA 2LAVA 4B8LA 3AGMA 4QQTA 3E3BX 4LDTA 3V5QA 3H3CA 1XMLA 1YI6A 3AC4A 2PVHA 2XMYA 1YDRE 2C4GA 4FV0A 5CF6A 5KMNA 4FK3A 2YIXA 5IU2A 4CFUA 4YJVA 3VS0A 5KO1A 3LFDA 3AC1A 2QVSE 3PWDA 3FLQA 4J8MA 5CI6A 3EYHA 2YERA 4I5CA 3UQGA 1K9AA 3PJ1A 4C3FA 3GCQA 4ERWA 4N70A 5JGAA 3BYVA 3EZRA 4M69B 3FJQE 3UODA 3N4VA 1OL6A 4LV7A 5DT4A 2XK4A 3F2RA 5EQYA 1GZOA 4CMUA 5IUHA 4FV4A 3VBYA 5CSXA 4DG0E 4IAFA 2NO3A 4AFEA 3R7OA 4QP4A 3UNKA 2PZRA 3GC0A 5GJGA 5GZ8A 2C6TA 4D58A 2VX1A 5I9WA 4U7ZA 4S32A 1Q4LA 2QOLA 2PUPA 1K2PA 3H0YA 4TWOA 2IZTA 4EHGA 3H9FA 3LOKA 4O27B 5DH3A 4Z3VA 4O7ZA 4DT9A 4AGWA 2XB7A 3C0GA 4J98A 3ZO1A 2ETKA 5B7VA 3QQLA 4FSZA 2RL5A 1L3RE 3CKWA 4NIFB 2OXYA 2QOCA 4OBOA 1IRKA 2UZTA 4QD6A 4C35A 5LVOA 4BI1A 2F49A 3FC2A 3FWQA 4O21A 3H9RA 2XK8A 4LRMA 2C3JA 1OB3A 3F6XA 3GC9A 3MH2A 1S9IA 2WMVA 1P4FA 3O8PA 1WBSA 1ZMVA 1Y6AA 5CVGA 2ZMCA 1G5SA 4TRLA 3RM7A 2WTIA 3ZHPC 4W9WA 4WNOA 2WMQA 5T3QA 4FOCA 3ULIA 1XR1A 2DYLA 5M53A 4EWHA 4BC6A 3FMDA 2UVXA 3FQEA 4BBFA 2B9FA 4TWPA 2ITXA 2ZV8A 4C59A 4F9BA 3V3VA 5I3RA 4F1TA 5IQEA 4EH5A 4NKAA 1ZYLA 3FY2A 4CXAA 4E20A 4L43A 2PU8A 3Q53A 3ZLXA 5GJFA 3QA8A 2QO9A 2YAAA 3VS6A 1Q3WA 2BILB 1W8CA 5D11A 5A14A 3SX9A 3NDMA 4FBXA 4DITA 2J0MB 2Z02A 2UW9A 5J1VA 2BDFA 2WGJA 3V5LA 4FSWA 1FMOE 4U80A 4I5HA 2H9VA 5EYKA 3DXNA 3LQ3A 3GENA 2UW8A 2XCKA 3LFBA 1BLXA 3EQFA 4B8MA 2RGPA 3ZU7A 5HTBA 3PYYA 4NJDA 5JZNA 1J7IA 4EKKA 5KBRA 3MFSA 5CWZA 3W0MA 1VYZA 5G1XA 2E9VA 2A27A 1OL7A 5CAOA 3E87A 5HD4A 3GNIB 3I5ZA 2H96A 4CYIA 1GY3A 4HW7A 3ORIA 3A8XA 5HU3A 1KE8A 5IMXA 4L53A 4IC8A 2ZV2A 3RCJA 4YSJA 2WTKC 4Q9SA 3I4BA 4P7EA 2UW5A 4AOJA 5A4EA 4C2WA 4DFBA 2VGPA 4O7WA 5JEBA 3ZRMA 2VX0A 5AR5A 4AQCA 2XZSA 1H1SA 2BRGA 2H6DA 2XH5A 3BELA 3I6WA 5LVMA 5AX9A 5HICA 1Q5KA 3W2QA 5IDNA 5M44A 3ATSA 2BPMA 2FSOX 3DQWA 5CVHA 4EH9A 4TKSA 5FXSA 5A46A 1WCCA 2OXDA 1E1XA 4AZVA 4C58A 5I5ZA 4FKOA 5CQUA 4Z7HA 5FBNC 2XBJA 3MVJA 4HZRA 1OM1A 4JBVA 4KWPA 3RZBA 4CTCA 3HAMA 4EORA 1UU9A 3AMBA 3EN5A 2BFYA 5LMAA 4AW1A 4R78A 2WMTA 3O96A 2C0OA 3KN6A 3I6UA 3LVPA 3A2CA 4H39A 4WUNA 3RJCA 4BDIA 3NYOA 4J71A 5E91A 3DZOA 4NIFA 3E92A 5HO6A 3TNWA 5I9ZA 5C4LA 3B2TA 4OTPA 3VS3A 3VHEA 2OKRA 2JFLA 2UW7A 3Q96A 5DR2A 4CKJA 5L2TA 4ALUA 4LGGA 3SVVA 2B9JA 3TZMA 4E8AA 4M68A 1DAWA 4C61A 3C4XA 4L7FA 4FTUA 2GS7A 3A7FA 1QPJA 4DC2A 1H1QA 3LCDA 5IDPA 2PVLA 3F7ZA 2W99B 4FKJA 2Y6MA 3R00A 4EK8A 5M4FA 2WB8A 2O65A 4U45A 2RG6A 4FSUA 4CEGA 5HU9A 2YZAA 3L9MA 4HYIA 4ZTSA 3R30A 4G6NA 4ANBA 1SVHA 4EH7A 1OIQA 4A07A 5CYIA 2FYSA 3T3UA 2CJMA 4GRBA 1H1WA 2R3LA 5AUWA 3RTPA 4K33A 5A6OA 3ZXZA 2B52A 5E7RA 3ZBXA 4CRSA 4H05A 3P7BA 4C4EA 3H0ZA 3CTJA 2W4JA 3DKCA 4ENXA 3MS9A 4RIYA 3BPRA 2O64A 4LYNA 5HBHA 4PRJA 4C62A 2QKWB 4RC4A 3VBTA 4IZYA 4E93A 4D2SA 3UP2A 3NUAA 3FE3A 3R02A 4WG3A 4EYJA 4A9YA 4QYHA 3QQJA 3NW5A 4BCPA 4F9AA 3DPKA 5AUZA 4LOOA 3D7ZA 4JBQA 5I9XA 2RG5A 1KE6A 1P2AA 4BHZA 2W1FA 1YDTE 3KN5A 2R3RA 3FZ1A 2B54A 4X2KA 1MUOA 2R3GA 4NUSA 1PW2A 3DKFA 3GXLA 2Y9QA 3WF5A 4EOIA 4FTCA 5A4LA 2HELA 4XYFA 3W8LA 3H9OA 3C4EA 4RWJA 2ITYA 4IX4A 3SHEA 1WBNA 1YHVA 3PRFA 3VS5A 4U43A 5HLNA 4FYNA 3C4FA 5EW8A 5I3OA 5LWMA 3EL8A 4R5YA 2IWIA 4YJOA 4EHVA 5BMMA 2VTLA 4GUEA 2W4KA 3ROYA 4C4GA 3UP7A 3V8WA 5HCYA 4Y46A 3PJ3A 3ZO3A 3KMUA 3ZSHA 3PG3A 2J5EA 3EN4A 3FLSA 4C8BA 5I9YA 3FMLA 5C01A 2H8HA 3OHTA 5TT7A 4IXPA 3E88A 4L8MA 4XUFA 3WZKA 4MXYA 4USDA 4PPAA 3R28A 5EOLA 1NVRA 1NT2A 2ESMA 4IVCA 5DI1A 4BWXA 2PVKA 4KBAA 4ARKA 3ORXA 3W0SA 3K3JA 3FL4A 1Q61A 5M4UA 3G2FA 4GVJA 2V22A 5DRDA 3H30A 2J0KA 2YIYA 4HPTE 4NK9A 4AW0A 2VWVA 3C1XA 3VWAA 3QHWA 4Y73A 4HCVA 3HV4A 4C4HA 4R8QA 4EOLA 3R2BA 2WOTA 2R3PA 4X3JA 1J7UA 4KBKA 3DK3A 4FTKA 4UZDA 3TI1A 2YEXA 2JIVA 2WU7A 2BAJA 1DI9A 5HIEA 4JNWA 2IZUA 3PRIA 4YHFA 3HV7A 3A99A 4RGJA 1YKRA 4M13A 4F0FA 3ZLSA 1BI7A 5HVJA 4WG4A 3E8EA 3REPA 1P5EA 4DF3A 3PPKA 4EK4A 3QCQA 3KVWA 3ZO4A 4UBAA 5LQFA 5D9HA 3FAAA 3OW4A 2XA4A 3QXPA 3ZDUA 1O6YA 2PVYA 4GK3A 1YW2A 4BVUA 3R0TA 3VONA 5K5XA 2J0IA 3DLZA 3TNHA 3VAPA 3NYXA 3DXQA 2QOHA 3L1SA 1O6KA 3EFJA 4K1BA 5CAQA 3TT0A 1U54B 3R7GA 5K0XA 3FI8A 1CKPA 2ZDUA 4AE6A 2UZUE 2I6LA 4E1ZA 3BE9A 2IVTA 1W84A 3NAXA 4Q2AA 4S31A 3OBJA 3QC9A 4ANSA 2WAJA 4X3FB 4C0TA 3EMGA 3LZBA 3OVVA 4XG6A 5J7HA 3ZUTA 3MPAA 5HEZA 1LP4A 2HY81 3KU2A 3RPRA 3BYUA 4KKGA 4TXCA 3G0FA 4DCAA 1OMWA 4O4FA 4UWYA 1XH4A 2IF8A 5LARA 2PTKA 3ERKA 2ZM1A 4U44A 4ZSLA 3Q6UA 4HGLA 5M06A 4UMQA 4G3CA 3WILA 3QZHA 3DQXA 3L8PA 5L2SA 5KUPA 2PUNA 2AYPA 5ANDA 4DFXE 3KCFA 1ZLTA 5A54A 4FTNA 1YI4A 4FSMA 5E8WA 2ITUA 3PXYA 3MN3A 4L3LA 4YBJA 4DH8A 4CMTA 1XH9A 4GFMA 3KL8A 1ZOHA 5BVEA 2RFDA 4D2WA 3ELJA 3UC3A 3D94A 4YPDA 5D10A 5AP1A 3UNZA 4EZ5A 3GVUA 3RAKA 4YURA 4EOPA 3OY3A 4M66A 4WRGA 5KKRC 4BTKA 2HK5A 3Q32A 4IAZA 3BHTA 4IDTA 3ID6C 5LCJA 4BYIA 4JQ7A 3CJGA 4I0TA 3FXZA 2YWVA 4BB4A 2CCHA 3RWQA 4HOKA 4WNMA 4ERKA 1YDSE 4OW8A 3M2WA 5E90A 3OC1A 4P5QA 5AWMA 3R9HA 1FGIA 4UN0C 1VZOA 3PXKA 1Q99A 1T46A 2VWZA 3FZTA 4FX3A 4PTEA 5KZIA 3KEXA 2ZV7A 5E4HA 5KE0A 4E3CA 5IG1A 4E6AA 3DXPA 4Z9LA 3R73A 4YTFA 3P23A 1XKKA 4AQKA 1A48A 3W2OA 2PE0A 4JR3A 2QOIA 4TNDA 1UNGA 4O0RA 2FSTX 3FSFA 2W7XA 3ORZA 1PYEA 2F4JA 3QGYA 4I41A 2FVDA 1I09A 2VNWA 5CT0A 4XBUA 4IVAA 2P0CA 2BALA 3EOCA 4W4XA 5CU4A 4EOSA 1FVRA 2WFYA 3OT8A 4DEEA 2B53A 3L8VA 4F0GA 3R71A 1UV5A 4AAAA 2BHHA 4ALVA 3KXMA 2YAKA 4GV1A 2JLDA 3G0EA 2V0DA 3LXPA 1U4DA 3QZIA 3MY0A 2B0QA 4QQ5A 2V5QA 3BKBA 2WQNA 3EIDA 3ORPA 3EWHA 5E8ZA 3Q4ZA 4M15A 5KBQA 2QOBA 3CQEA 1W98A 2QKRA 4J95A 4G31A 4X3FA 4A9UA 2YIQA 3CBLA 3COIA 3ML1A 4O7SA 3BYSA 3TTIA 3NYVA 4FUYA 3CLYA 2YIWA 3FEGA 3GP0A 3POZA 2KULA 4DTBA 3BCEA 4CMOA 4XOZA 5IMEA 3OG7A 3RVGA 1BYGA 4NFNA 3WIGA 4ZLOA 2RF9A 2YLEA 3SQQA 4BWPA 5BNJA 3MYGA 3F3ZA 2AC3A 3ZMMA 4EZ7A 3ZFMA 3O5AA 4FV3A 3COKA 3UOLA 4BIBA 5H8EA 5GINE 4JS8A 1O9UA 3GCSA 2BR1A 5EFQA 3FZSA 2GQGA 2WMXA 2O63A 2YITA 3C4CA 3O0GA 3TJDA 4BTJA 3UQCA 3KIOC 4YLLA 2C6OA 3KRXA 3NW6A 3IG7A 4L42A 5AP7A 1P14A 1XQZA 2ITWA 3HMMA 4KS8A 3JR1A 3N51A 2BAKA 2PZIA 3LCSA 1J1BA 4MVFA 3AT4A 4PL5A 3ZTXA 3QUEA 4MF1A 3A7IA 4BDEA 3H4JA 2XCHA 4ITJA 4PDOA 1QL6A 2EVAA 2W1GA 5EHOA 4O82A 1RE8A 5CSVA 3C13A 4FK6A 3QRUA 2OIDA 3CTHA 4YJSA 1W2FA 3ALOA 5G6VA 3WF7A 4J8NA 4DFYA 3F69A 4JXFA 2CKEA 2XK9A 4ZSJA 5ICPA 4EBWA 2ITVA 2Z2WA 4MKCA 2X9FA 4FZFB 2WTVA 3TUCA 3LIJA 5KMIA 3UOJA 2AUHA 3K2LA 3RPOA 4GK4A 3ALNA 4Y5QA 1E1VA 4KABA 2OH4A 5IKWA 1B39A 4OTIA 4TYHB 5AUYA 5HIBA 2X0GA 4EOMA 2IZRA 3BHVA 4XBRA 4JQEA 2W5BA 3RINA 5K9IA 5DBXA 3PE1A 2J7TA 2Y4PA 4BKYA 3AD4A 5IPJA 4RVLA 2X2KA 1GNGA 5FLFA 4FV6A 3P79A 2OJIA 2Z7LA 4IX3A 4R7IA 2VTPA 4Y5HA 2XJ1A 3U9NA 1OIYA 2R7IA 1Z5MA 2YCQA 5D7AA 4JI9A 4FTQA 2XEYA 3RP9A 1VEBA 4D9UA 2GTMA 4D1XA 3NUXA 4F63A 3EN9A 2BUJA 3TUBA 1ZYJA 3KULA 4I21A 5CQWA 3HLLA 4BDKA 4EH3A 1XH8A 3AKKA 3NNUA 4I93A 4CV8A 3FYKX 1T45A 4OTRA 2OH0E 4FE2A 5M57A 4YP8A 5EK7A 1XMMA 2YJSA 2NPQA 4I0RA 4NTTA 3KFAA 3R8UA 1PXPA 1GZNA 4X6QC 3V5TA 1YXXA 2QO2A 3SDJA 3TWJA 4U8ZA 3RI1A 1U46A 4NCTC 5KMLA 4RRVA 2IW6A 5T68A 5DR6A 1YOLA 2X81A 5FQDC 1LPUA 3UMXA 4D4VA 4P90A 2E9OA 1H1RA 3R01A 4YR8A 2JDOA 3FY0A 3EQHA 5JFXA 3W18A 3NS9A 2WTDA 4FV1A 4H58A 3ORMA 2YHVA 3U51A 2XNGA 3P08A 3O8UA 5BUJA 4V04A 1UA2A 3PSBA 5FP6A 5DEYA 5HG8A 4NEUA 4MXZA 4EC8A 2A4LA 3TIYA 4DFLA 4EZ3A 1L8TA 4BZNA 2R5TA 2BZJA 3DNEA 4G9CA 2VUWA 5DNRA 1WVWA 4E6CA 3FKNA 4BYJA 2R3OA 2Z8CA 4CKRA 4PV0A 5AUVA 1A06A 5HE3A 4RFYA 5HTCA 4CV9A 4YC3A 3OZ6A 4DTAA 2PVFA 4MK0A 1MQBA 5C9CA 2NYAA 4ZJVA 2G2HA 4KIPA 2UW6A 4QQCA 3F61A 4ITIA 3ZBFA 4FEXA 3HA6A 3HRCA 1PXKA 3QRJA 4YTIA 4DHZA 4YC8A 4E6DA 4R1VA 3QXOA 4YC6A 2J6MA 3E63A 2ITPA 5CF5A 5JN2A 4IEBA 2PMLX 3CTQA 2RFNA 1FMKA 3UTOA 3VS2A 4DH5A 3BV3A 3MJ1A 4RJ7A 4EONA 3MESA 3E7OA 4ACCA 3GFEA 2Y4IC 1ST0A 5HG5A 3G15A 4QP2A 3V6SA 3VHKA 4J53A 4YO4A 4PQNA 5M51A 1R3CA 3QTRA 4TZRA 4BDAA 3ZC6A 4I24A 2PVNA 3UNJA 3ZUVA 3KXXA 4TT7A 4RFMA 3CGFA 4CSVA 1QPCA 2WQOA 4RIXB 1QCFA 2UZWE 4D2RA 5L6OA 1OPLA 3I79A 3LCTA 4YJQA 2JIUA 3S95A 3EFWA 4DH1A 4RVMA 3TL8A 3TJCA 4D5KA 3JYAA 3OUKA 3P1AA 1Z9XA 5TOZA 4FSRA 1XH5A 3UOHA 4AA4A 3VRZA 3W33A 2WTJA 2GNIA 2WPAA 3RHXA 1YXVA 1KV2A 2OIQA 2FSLX 3QX4A 2PZPA 4EQCA 4FKUA 3WE4A 1UNLA 3B8QA 3KULB 4K9YA 4OUCA 4YO6A 4U97A 4P2KA 1G8KA 4MBJA 3A7HA 4ZTLA 3TV6A 2B4SB 5AV0A 2GNLA 4O6EA 2OG8A 3BHHA 3R7EA 2UUEA 2OJGA 3PG1A 4FZDB 2R0UA 4MWIA 3LMHA 3KRLA 4FMQA 4AG8A 3MH1A 4PDSA 3WF9A 2VTQA 5BVWA 3QHRA 1WBVA 5JQ5A 5EQPA 1RW8A 2YM5A 3ZO2A 4CT1A 1B6CB 1OUKA 3OXIA 3IW6A 4UMTA 1OL1A 4ASZA 5IH5A 4BBMA 2QCSA 4EQMA 2XP2A 3V8SA 3F82A 3Q4UA 3QL8A 3NVMB 3MY5A 3PFYA 3PPZA 4X7QA 4R1YA 3JVRA 5EKNA 1JOWB 3BGZA 1YWVA 3HRBA 5C1QB 1U5RA 4FEUA 4MNEB 2BDWA 4LV5A 3TTJA 4QTDA 5HESA 3BGPA 3BLQA 4CFXA 3Q04A 5HQ0A 5BVNA 3QZGA 1ZMWA 2JBPA 3QRIA 4RA4A 1BMKA 3NUYA 2DUVA 5AP3A 5GZAA 5L2WA 5HG7A 4BY9E 1R0EA 3BLRA 5JMSA 4BGGA 4AT4A 4XV1A 5BYZA 5IH4A 2HWOA 2NRYA 3PSCA 4NH1A 2BTSA 5D12A 1FINA 4FKTA 4IH8A 3OFMA 4IC7A 3GQIA 4F7JA 3TYKA 2V55A 4AZWA 3NNXA 2ZM3A 3RM6A 4PDYA 4Y72A 5E92A 4I4FA 4G3GA 3FLYA 3ORLA 3W32A 4D9TA 2ZOQA 2X2MA 3S4QA 4QTCA 1G8SA 4FYOA 3KF4A 3P86A 3UC4A 1JNKA 4BDGA 5C8NA 2WQBA 1REKA 1URCA 3PE2A 4FF8A 4O91A 5L4QA 3UDZA 5EG3A 5ETCA 3U8WA 4IAKA 3V5JA 3SD0A 2X8IA 5EDRA 3PDTA 2OF4A 4O0VA 3HVCA 3NX8A 4DGNA 1PXJA 4XLIA 3I0QA 2ZAZA 2ZVAA 3QTWA 4KBCA 3G5DA 3NGAA 3P0MA 3NPCA 4DHFA 4D1ZA 5HBJA 2J5FA 3IGGA 3RPVA 2R3JA 3EQRA 4ONAA 3P7CA 4IX5A 1ZAOA 5BUEA 3IGOA 4JX3A 5E8XA 4PMMA 3SXFA 5A9UA 4LV8A 5EQEA 4KD1A 1KSWA 1YI3A 4QMOA 3Q60A 4JBOA 3UIXA 2WO6A 3QTUA 1G8AA 3WARA 5CAPA 3FLNC 1PKGA 4EOQA 2IG7A 3BBTB 4QNYA 4EJ7A 2VZ6A 2ERKA 3IW5A 3V5WA 4GT3A 5KNJA 4FIIA 4LFIA 3KVXA 4K6ZA 5EI8A 4BHNA 4QMUA 5CAVA 3ZS5A 4C33A 1OECA 3D83A 4M3QA 3EB0A 4YZCA 5GNKA 4D5HA 5ACKA 3MY1A 3UVPA 3LCOA 4S2ZA 2C6LA 5I9UA 4F99A 2E2BA 2WMUA 5CLPA 3D5WA 5DIAA 4YZNA 4D2PA 2WTWA 3CGOA 2CKOA 4IFCA 2PULA 4JDKA 4BIDA 4IVBA 1JVPP 2XKCA 1WBTA 3R7IA 4DAWA 5C26A 5H3QA 3R22A 1P4OA 4DYMA 4E73A 2HXQA 2HZ0A 2ZM4A 3PUFC 5ACBC 4E7WA 4KSQA 5DRBA 3PIZA 4IACA 4MNEA 2C3KA 4ZJIA 1Q8UA 2B7AA 2O0UA 5CTPA 5C8MA 5HORA 4R3CA 3NNVA 2QC6A 3ZCLA 2PE1A 4DEDA 3R8LA 2FB8A 4QDEA 4M97A 2BROA 4ANQA 2IW8A 4O38A 4DDGA 4A9SA 3OOGA 1TQPA 4ZTNA 4F09A 1HOWA 4YU2A 2C69A 4OT6A 4IVDA 4O4DA 4FEVA 4F08A 3DFAA 5JSMA 5E1EA 4R6VA 3V5PA 2C47A 3IK3A 3QKKA 4GEOA 4ZTRA 5IA3A 1IG1A 3UE4A 4FNXA 4YZMA 2QODA 4FL2A 4NM0A 4IZ5A 3VIDA 4E6QA 2C3IB 2CN8A 3G9LX 4YHJA 3JY0A 5LJJA 3ORNA 4JX7A 1CDKA 4FTAA 4EUTA 4QMYA 2GQRA 3GOPA 2YZLA 4D0XA 1KV1A 4FVPA 4GG5A 4ZAUA 1JKSA 3R83A 4O0UA 5BQ0A 2XKFA 3FLZA 4RIXA 3EQBA 4NU1A 5DN3A 2I7QA 3W0NA 4R77A 4FZ7A 2XM8A 4GK2A 3SKCA 2XK7A 1RDQE 3E5AA 2OU7A 2PK9A 3LMIA 2YM3A 5CY3A 3CR0A 4RT7A 4C4IA 3TMOA 5EW9A 3ZSIA 3BYOA 3HZTA 5GJDA 3KMWA 2YM6A 5KMJA 2IEWA 1ZYSA 5HIDA 4EL9A 1H4LA 4KUJA 3VS4A 4HVIA 5AAGA 4PTCA 4XNEA 4PY1A 2Z7SA 4IAIA 5JFVA 1BI8A 2EB2A 2XIKA 3LAUA 4KKEA 5IA1A 4O7RA 2F57A 1GZKA 5HZNA 2WD1A 3BQRA 5JFWA 3Q5IA 4LQMA 3ETAA 3LPBA 3CPCA 3TACA 2ZYBA 3PVBA 4JR7A 4K18A 4MQ2A 4QMSA 2ZV9A 4TPTA 2VTOA 5A6NA 3VW8A 1OKZA 3MDYA 4XHKB 4OBPA 3UG2A 3KXHA 3QYZA 4FIJA 3NYNA 1KE5A 3CD8A 2BTRA 4R3RA 5F20A 4GKIA 3GU7A 4RJ3A 4HVHA 4F6WA 3GCVA 2NRUA