4USEA

Human stk10 (lok) with sb-633825
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
293
structure length
286
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKAEVME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Comprehensive Characterization of the Published Kinase Inhibitor Set.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 286
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4useA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4useA01
5HE0A 1SVEA 4MEDA 2QQ7A 4QTBA 4FGBA 2XYUA 4IAFA 4ALUA 3LCDA 3GC7A 3RBWA 1H08A 5GINE 4C2WA 2ESMA 2VTOA 3FI3A 4FV1A 4BDCA 5IA2A 4UMPA 5AV4A 2ERZE 4Q5HA 4BGGA 4GVJA 5DT4A 4DHFA 5HX8A 2YAAA 2BVAA 2A4LA 2C6EA 3MB7A 2YWPA 2C5VA 3LCOA 3R04A 1OIYA 5BVKA 4D2VA 4I92A 5FQDC 4GK3A 2V7AA 3R0TA 2YEXA 3BYMA 4L45A 5LMAA 3ULIA 4LM5A 1H8FA 3VS6A 3MA3A 4C4IA 1OUKA 4AACA 1YI3A 3KF4A 4XYFA 3LM5A 4EHGA 3OT3A 3OXZA 4MK0A 4U0IA 3QCSA 3R22A 5GZAA 5L8KA 2OIBA 2QU6A 4L3PA 4NW6A 5AV3A 4KABA 4ANQA 1Q8TA 4WO5A 4QP4A 4PP7A 3AD6A 4GU6A 3FC1X 5DI1A 2WTKB 1M7QA 1P4OA 5HG9A 3FPQA 5HOAA 3VS3A 1ATPE 4BFMA 3EFLA 2CN5A 5JRSA 2XRWA 4BCFA 3OWKA 3AC1A 4O7LA 4ASDA 2JKOA 3DNDA 3O8TA 1HOWA 2YFXA 1OI9A 3DXQA 4L52A 3DOGA 1JKKA 2CLQA 4IAAA 3HV3A 3RPRA 4EUTA 2X7OA 4KIPA 3TV7A 1CMKE 1PMNA 4BBMA 4C37A 4JBOA 1YI4A 2QKWB 4F9CA 1JNKA 1YXUA 4G3EA 1GZ8A 3DU8A 2YM7A 3FZTA 2RG6A 2O2UA 4O7TA 4FF8A 2XRUA 1BL6A 3OWLA 5HNGA 3RAWA 1LPUA 5HNIX 4D2SA 3KGAA 1ND4A 2FVDA 3ANQA 3BKBA 2YZLA 2HIWA 1PXLA 4RLKA 3S2PA 4LGHA 2P55A 4E6QA 5AP4A 3DY7A 4GRBA 5FM2A 3R83A 4F7JA 4FEUA 4R8QA 3C4EA 3BCEA 1XWSA 2JAVA 4DT9A 1L8TA 1J1BA 2FH9A 4ZTRA 3CKWA 4E73A 4WRSA 3EN4A 1XR1A 4ACCA 3ZLXA 2UZNA 3NWWA 4FT5A 5J79A 4XJ0A 1Q4LA 2CMWA 3E88A 4RWJA 3VQHA 4BCPA 4I21A 1QMZA 4AW0A 3T3UA 3ATTA 3OROA 4A06A 4E1ZA 3UBDA 2BKKA 3KREA 3UNKA 4XEYA 2QLQA 1KV1A 1ZARA 3QYWA 5AWMA 2PPQA 4G9RA 3VIDA 1PMUA 4MXYA 5JGDA 3TDVA 4FTCA 5C03A 2RG5A 2EUFB 2YN8A 2CGVA 5D10A 3TACA 3PLAE 4AE6A 4LV8A 3EJ1A 4WKQA 4BKJA 4NK9A 3LXPA 3QGWA 4YZBA 3VRYA 1GZNA 3HL7A 3CTHA 4FA2A 1QPCA 3F82A 4D1XA 3EN7A 3BU5A 3VC4A 4IAIA 5E9EA 4M7IA 4S31A 3DKGA 5EW9A 2XJ1A 2YCRA 4LYNA 2I6LA 2R9SA 3R9RA 4TTHB 5KKRC 1FVTA 2Z7LA 1FVVA 5H9BA 4QP8A 4Y73A 3KN5A 3KXNA 4FTMA 5E90A 3GOPA 3MV5A 2I0HA 2O3PA 4ZSAA 5ETFA 2YIWA 3NYNA 5GIPE 1CKIA 1YRPA 2NNWB 3ZC5A 4QTAA 3SG8A 1Y8YA 2UW7A 4U44A 4G6OA 2OW3A 5ICPA 5IMXA 2I0YA 4DGLC 4EQUA 2VTPA 1JPAA 5EYCA 4YHFA 2QODA 4JJRA 1FMKA 1Q3DA 2HWOA 3FYKX 3HAVA 4JBPA 3CPCA 3NVKI 4IFCA 4U9AA 4BTJA 4YSJA 3II5A 4U80A 3GEQA 4BCNA 1B38A 5CQWA 3ZYAA 3FDNA 4DGGA 1OPKA 3FJQE 2PZIA 3F5XA 4YTFA 5AR7A 3I0QA 4ITHA 3WZJA 4FZDB 5CT0A 3C7QA 3BGQA 3HA8A 4XP0A 4D2WA 5M09A 3OCBA 1JKTA 2RKUA 3H4JA 4FUXA 4C4GA 4PMMA 3QX2A 4K11A 4QNAA 1OIRA 3DTCA 4W8EA 3DBDA 2JGZA 1YXXA 1IA8A 2XNOA 3AQVA 3AXWA 3R6XA 4XCUA 4EWHA 3DLSA 1Z5MA 4QMVA 3QUPA 4LI5A 3F61A 2OFUA 3U4WA 3LHJA 3KRJA 4OBPA 4CLIA 1TKIA 4YTCA 5LJJA 4HVHA 2NRYA 4CFVA 4EEVA 4DH1A 4APPA 4PTGA 3C0HA 2BTSA 3SV0A 4CYJA 1ERKA 2R0UA 2HENA 3F3TA 2W1FA 3Q6UA 2QNJA 3O96A 3S95A 3G9NA 2PZRA 3DJ5A 4FTOA 3TT0A 2V5QA 4CMUA 5KBQA 5FWKK 4BWPA 1U4DA 3C4FA 5AP6A 4V05A 3CTQA 3PXQA 5IEVA 5IQDA 4J95A 3NYOA 4D0WA 2JFMA 4EKKA 4XV1A 4NUSA 4C33A 4G5PA 4FKRA 4HPTE 4U43A 5FLFA 2IW9A 4Q9ZA 4PPAA 3OC1A 2PZYA 5EKNA 3TIYA 4QPSA 1Q8ZA 5JQ8A 1K9AA 1NVRA 3FMNA 4I5MA 5LVOA 4JDKA 4JQ7A 3B8RA 3LFQA 2PHKA 2Z7QA 3LXLA 1OECA 1ZMWA 3OEFX 5LXMA 3ORTA 4JDHA 4HOKA 4IB1A 1Q8UA 4RQKA 4ZJVA 4RQVA 5HG8A 3MB6A 2ETRA 4K6ZA 4O0XA 3A61A 3UPZA 4DN5A 2FO0A 2QC6A 4RFYA 1TVOA 4ZXTA 2GNFA 2PMLX 3E7VA 4EC9A 2X0GA 4H39A 2R0IA 3FUPA 4NJDA 2HOGA 3UE4A 4JIAA 2W9ZB 4AOTA 4C61A 3UG2A 4QMPA 4GK2A 2HWPA 2I0VA 3AC3A 2IVTA 2WEIA 1WBPA 3HDNA 3C0IA 4JAIA 3C50A 4KIOA 5CF8A 4FTTA 1IAHA 2VX1A 1UVRA 2HXQA 2UW9A 4R3CA 2R3LA 1V0PA 3TWJA 4EOMA 3KL8A 3VS0A 3ZONA 1OBDA 2GCDA 3D94A 4Q9SA 3W10A 3HGKA 3F3WA 5IA1A 3A4OX 5CAUA 4HYIA 1W8CA 3C5IA 2O65A 3MY5A 2FSLX 3NAYA 1WZYA 3BQCA 3G51A 3HRBA 3I60A 4YZ9A 3MWUA 4DEHA 3R30A 5CAPA 4XLVA 3HRCA 4A9UA 3NR9A 3NGAA 4N6ZA 4FZAB 4TYGA 5DPVA 3KY2A 2Q0NA 2AC3A 3ZOSA 3SXFA 2FSMX 3ZUUA 3BX5A 3CJFA 4DGNA 3HUBA 3O8UA 3QKKA 4DINA 3FLWA 3QQFA 2QR8A 2IN6A 2IZTA 2XEZA 5CYIA 5CAQA 2HK5A 3OW3A 2VAGA 3TZ9A 4DEGA 1Q8WA 5FTQA 4C58A 4ENYA 3EHAA 3QC9A 5BPYA 5HIDA 5L2TA 4J97A 4MNFA 1IR3A 2C6TA 3A60A 2RFDA 3NNWA 4DE4A 4AXAA 3KXGA 4PDSA 2YM4A 4U81A 5HTBA 1JSVA 3O23A 1TQMA 5HVJA 3H9OA 2XIZA 3DK6A 5HX6A 3SVVA 4RJ8A 4C36A 5E4HA 2X8IA 3UOJA 3LPBA 3C51A 3QWJA 5AM6A 3V5LA 2FSOX 1VJYA 1DM2A 2J9MA 5CZIA 5HCZA 2WQEA 2PUPA 2PULA 4Y95A 1T46A 3F3VA 5KKRB 1BMKA 5AAEA 3FZSA 4F1TA 5M07A 3DQXA 2HZ4A 4PV0A 1UA2A 3FMMA 3E87A 5EG3A 4YO4A 5E8UA 4IQ6A 4F08A 1CKPA 2ITQA 3OBGA 3S1HA 2CGWA 3KN6A 3FHRA 3R01A 2BRHA 4K8AA 5KBRA 2BAKA 4L67A 1GIJA 4AX8A 3NUAA 4QP2A 4CT1A 2CSNA 5LVPA 1JSUA 3GVUA 4HZSA 3QL8A 4NJ3A 3W33A 4C34A 4CMTA 4OTIA 5C8KA 4CV9A 4G5JA 1WVWA 4F9YA 3HA6A 5I9ZA 5KHXA 3W2SA 4MXAA 5DBXA 4JIKA 2GNHA 2WTDA 3CXWA 2WTIA 4JBQA 5HVYA 3ZO4A 4IVDA 3SLSA 1OBGA 4B8MA 2QONA 3QALE 2R64A 4CZYB 5J1VA 3I0OA 1OGUA 2F57A 3JS2A 3ZFXA 4PQNA 2F7EE 2C6MA 4DGOA 3W2OA 3R00A 4GEOA 4I6HA 5BX0A 2XVDA 4UWCA 1PMVA 3F3ZA 3NUYA 4ZLZA 4DTAA 5ANJA 2GQSA 3KK9A 5HTCA 4S34A 4WNMA 2JAMA 1MUOA 2J90A 2OK1A 2Z60A 3PJCA 1M2QA 3QQUA 4GVAA 5DEYA 3V8TA 4CD0A 3H30A 4U8ZA 3A7FA 2C68A 2R3MA 3A4PA 3FLSA 4AOJA 3PPJA 2BRNA 3OFMA 2WU7A 3TL8A 4RVMA 4YC6A 2QURA 1KOAA 3TDWA 5GNKA 3KRRA 3NW5A 1FPUA 2O64A 4CKJA 3U8WA 3VBYA 4HCTA 4E5AX 3BHVA 5AUVA 3MH3A 2GQRA 2X8EA 3D2IA 3R7YA 4CFNA 4ZAUA 2R3HA 3NNUA 2JIIA 3A7IA 4EZ3A 3R71A 1P4FA 2B53A 2PTKA 3Q53A 2WMSA 3RM7A 5IEXA 4AN3A 3I7BA 2B4SB 4QP9A 4TYHB 3ZRKA 3FHIA 2GNGA 1JBPE 4TWCA 4MQ1A 3DJ7A 4U45A 5AR4A 4ZLOA 2YITA 3OOMA 5KZIA 3L9LA 2OH4A 3DFAA 3KK8A 3U54A 3ETAA 2IW8A 1BLXA 1OMWA 3GNIB 1WFCA 4OT5A 3D9VA 2ITPA 4ZIMA 3DFCB 3PP1A 1G8SA 3QCXA 4FVQA 1U59A 4NFMA 2ZV2A 4ANBA 2VGOA 3MJ2A 3IQ7A 2VWXA 4L44A 4XH6A 4MXOA 5CZHA 2OKRA 2R3JA 5IA0A 2B52A 2QOFA 2OH0E 4G3FA 3CIKA 3PY3A 3QLGA 4RFZA 2PVYA 3G15A 3ZU7A 5CU6A 5E8SA 3TNWA 4QD6A 4EOIA 3GENA 4YSMA 4AWIA 2ONLA 2UUEA 2CCIA 1G8AA 4FK6A 3IG7A 4CGAA 1Q8YA 3OCTA 3HP5A 1Y57A 3MVLA 5HBHA 4C38A 1OM1A 1CSNA 2W4KA 3R1YA 4FSWA 4W4VA 4P4CA 4AT5A 2IVUA 4O1PA 3BHTA 2ZM4A 4S32A 3PE2A 3VRZA 4D1ZA 3V04A 3UP7A 5IZFA 4EOOA 5LMKA 1OL1A 2ZMDA 4QMUA 3PXYA 4MQ2A 3QTQA 4IHPA 4USFA 4HVSA 4UBAA 2C30A 5EYDA 3RK5A 5M4FA 5J9LA 2ETKA 1WMKA 5AV0A 1R78A 4W9WA 4XLIA 4KRCA 2OI4X 2YISA 2JFLA 4BZDA 4YMJA 4PY1A 3U9CA 1SVGA 5HI2A 4DFZE 4RZVA 4NU1A 3EQPA 4G17A 5C26A 4YZMA 4BWKA 3PVWA 5EQEA 2Y0AA 3M2WA 2BDJA 4U3YA 3T9IA 3GUBA 3HMNA 3Q9WA 1UKIA 3MH1A 4RA4A 1YWVA 4HGTA 2B9IA 4U6RA 4OTPA 2P0CA 5DOSA 5D11A 3JR1A 3BWFA 2WQOA 4EOQA 4QMSA 1H24A 2YCSA 1OKYA 1ZYDA 1UWJA 2GSFA 2C1AA 4RX8A 2H9VA 5LARA 2XCHA 3PZHA 3RHXA 2IWIA 4EOLA 1KSWA 3MVHA 3UOLA 2W4JA 3ID6C 2WMTA 3UIUA 3Q32A 4O2PA 4CZUA 3AMYA 3QRJA 1LEWA 4XRJA 4FKPA 4Z3VA 4WBBB 3FSKA 4QYHA 4X6RA 4EKLA 4A07A 3P9JA 4TYEA 3SKCA 2YLEA 3VS4A 4FTLA 4ACDA 3UP2A 3VBVA 2XK7A 4E4MA 4LGGA 4BDHA 3MPTA 1PYEA 4RIXA 3CSVA 3QTXA 4QQCA 2VWVA 2QD9A 2X81A 4GFOA 4ZTMA 1H00A 2PVRA 2UZLA 1YHVA 4UALA 3FKNA 5JZNA 2YIQA 2OICA 2C1BA 4QTDA 4D4RA 3LLAA 5KNJA 5JT2A 4QYYA 4O0RA 3QF9A 4L68A 4QRCA 2ZDUA 2BRMA 2UW3A 1FGIA 4ZMEA 2ITUA 2YIYA 3VBTA 5HVKA 1YQJA 2W5BA 3LVPA 4LUDA 4U3ZA 3QKLA 3VS2A 4BDGA 3H0ZA 3WILA 3FC2A 3KKVA 5B7VA 2HZIA 2XM9A 3NUUA 2FA2A 5DEWA 4FTIA 4WHZA 4C0TA 3Q2MA 1FOTA 1PXMA 4DFYA 3BHUA 3PVUA 4NM0A 3W2QA 3EFJA 2AUHA 3OCSA 2UW6A 2VZ6A 4GW8A 4NL0A 4IB3A 2PWLA 3MSSA 3VQUA 1PY5A 3ORKA 1MQBA 3R8PA 2R3KA 1KE5A 1QPDA 3FI4A 4PTEA 2DUVA 2CDZA 2H8HA 3ALNA 3U9NA 4N0SA 3P1AA 4AQCA 2ZJWA 3F7ZA 2UVZA 1XH5A 2XP2A 4QYEA 5TT7A 3HMPA 4KS7A 4ZY6A 3RM6A 4X0MA 3I4BA 3OS3A 4H36A 3BPRA 4ASZA 5BYYA 2IZUA 3QGYA 3R8ZA 2YABA 3EQFA 3ODZX 4YU2A 4O2ZA 2C0IA 5EM6A 4FKTA 1PF8A 5AADA 5FXSA 4XUFA 4YJRA 4BYIA 1RJBA 4ACGA 5GIOE 5FEEA 2W9FB 3VW6A 1R0PA 3G5DA 5ANKA 4APCA 1VEBA 4G2FA 4BICA 4EK8A 3NCGA 2KTYA 5H8BA 1H1RA 3EQDA 3WI6A 4DCAA 5HIEA 4UMQA 5JFSA 4OT6A 3F3UA 4KKEA 4R1YA 2WTVA 3UYTA 2OLCA 4GT3A 3TTIA 1DAWA 1OITA 3OXIA 2GTNA 4FIJA 3DPKA 4BCHA 3NS9A 5J87A 3W8LA 2O8YA 3M1SA 3Q5IA 4K0YA 3RPYA 1QCFA 4FV0A 5E1EA 3R7GA 2FUMA 2O0UA 3LQ5A 3EMGA 5BUEA 1VYZA 4DLJA 4K77A 3C0GA 2EB3A 3TV6A 4XNEA 4ZSJA 2QU5A 1PXJA 3QLFA 3Q9ZA 4RT7A 5D41A 5CI6A 4JAJA 5CS6A 2EXCX 3OWPA 5C1QB 2W1ZA 1QPJA 4YZCA 2CKQA 5IA5A 2VTLA 4BL1A 3FKLA 4FSTA 4OTRA 4U5JA 3RMFA 2Y6OA 4LUEA 4NFNA 3COIA 4OTDA 4NIFA 4USDA 3VO3A 5LCJA 2PY3A 4HGSA 3EB0A 3LKMA 4FEVA 3CKXA 1Q61A 4JDIA 5FP6A 4QTCA 4NKAA 3VF8A 3G33A 3GB2A 2QOOA 3VJNA 1H4LA 2OXXA 3F2NA 3F5GA 3F69A 3V5QA 4GYIA 4XG7A 4DBNA 4JG6A 1FBNA 2WFYA 2WEVA 2WMXA 4BI0A 2YWVA 3NIEA 5AIRA 3K2LA 4EYJA 2GQGA 3UC4A 1AGWA 1OVEA 2IZRA 5CASA 3CD3A 1PXNA 4F1OA 4BN1A 4F6WA 2V22A 4E8AA 3BWJA 4HW7A 3OP5A 3K5UA 2OJJA 4NM3A 2ZB0A 5FGKA 5LQFA 3ZM9A 3O71A 3ENHA 4AT3A 4FSUA 4EHEA 3ZLSA 3FSFA 4FIIA 3WZDA 2QOHA 5EI2A 3TKHA 4C3FA 4R3RA 5DRDA 3B2TA 4KSQA 2QHNA 4UN0C 5CENA 1W84A 3KU2A 4CFMA 3BBTB 4GSBA 3ULZA 2XK3A 4K1BA 3D5WA 4YJSA 4YBKA 4Z7GA 5IQBA 5I0BA 2QOLA 4AW5A 5IH5A 4IDTA 4UYNA 4OTGA 3F6XA 2XBAA 2IVVA 3I81A 2RFNA 5BVWA 2XZSA 1KV2A 4CFUA 5L6OA 2C4GA 4QMLA 2VWIA 2ZV8A 4MBJA 4M0YA 4UZDA 2X8DA 3TKIA 4AAAA 3ZLYA 4X2JA 4Z9LA 4E5BA 4JQ8A 2B9FA 4D55A 4YNOA 3AOXA 1REJA 4A4OA 3CGFA 2HXLA 2WZJA 3LAUA 5KE0A 5I9YA 4NW5A 5M57A 1KOBA 2FYSA 4V04A 4QOXA 1R39A 3QBNA 5EYKA 2PVNA 3G0EA 5E8TA 2UZOA 4HGLA 4WRGA 3HVCA 2GPHA 4IX5A 3AT2A 3BRBA 3MDYA 2X9FA 4FV8A 1M14A 3RKBA 4BDAA 4FMQA 2XK8A 3MIYA 5HBEA 3N51A 3V01A 4E4XA 2F7XE 2BR1A 3PJ8A 3QAME 3BIZA 3R63A 4N6YA 3UQCA 3PVBA 3KXXA 2B0QA 3IONA 2BPMA 2VTMA 3HV6A 3MY1A 4X3JA 3WF5A 3OT8A 3HAMA 5A9UA 4J71A 1XHAA 4IWPA 5M4UA 3TNPC 2H6DA 4FYNA 4WG4A 4I41A 3QRUA 3BEGA 3BYVA 3L8SA 1FQ1B 5HORA 3OXTA 3GCUA 3ZS5A 5L6PA 1WBSA 3ITZA 3ET7A 3EZVA 4L9IA 2RFSA 4JXFA 2F7ZE 3MVJA 4IC8A 2UW5A 1TQPA 2ZVAA 3PPZA 1F3MC 3G6HA 4ZY4A 1Y8GA 4FC0A 5J95A 5FP5A 4DG0E 2IJMA 5GZ8A 2PMOX 3DDPA 4G3DA 3IW8A 2C3IB 3R1QA 4BWXA 4PF4A 1Y6BA 2C6IA 2CCHA 4AGWA 4ZMFA 2PL0A 3GCVA 1YXVA 1YHWA 3N4VA 1OKVA 5F94A 5CTPA 5EW8A 1YWRA 2YM3A 4JOAA 3L9PA 4X2KA 4FL2A 4K9YA 5DE2A 3GFWA 4M15A 1W7HA 3JVRA 3QWKA 4XMOA 3DCVA 3VS5A 5BNJA 3D5XA 5CAVA 1ZRZA 4HZRA 2WTWA 5CXZA 4CG8A 4EORA 3GT8A 4UB7A 2QHMA 3I6WA 3P7CA 5IUHA 5EHYA 3ALOA 1SNUA 1BYGA 4TKSA 2ONLC 2WD1A 3LFCA 3UIBA 2G1TA 2P2HA 4C4FA 4DH3A 4L43A 3SDJA 2Y4PA 3QQLA 5AP3A 3VS7A 2XKCA 4EQCA 4UMTA 5CVGA 2YCQA 5CSVA 5IISA 3I7CA 5IU2A 2WU6A 1UWHA 3LCTA 4U41A 4AG8A 4G34A 1U46A 3M42A 3PY0A 4QYGA 5LMKC 2OGVA 3DKFA 3I79A 5F9EA 1VYWA 4A9SA 3LXNA 4KA3A 4FIGA 5EDPA 4D4YA 5EM8A 3RI1A 5J9ZA 3DDQA 4YGAA 2ZOQA 5A14A 5BMSA 5IDPA 3FY0A 4RWKA 4B8LA 3UO5A 3SOCA 3C4ZA 1ZYJA 2QOIA 3KEXA 3PUPA 5CVHA 4OGRA 2QCSA 3E8DA 3ZCLA 1WBWA 3DAEA 1FINA 5J7BA 2R7BA 3O7LD 2G2FA 4BHNA 4S2ZA 4F7SA 3ERKA 5KMNA 4FKGA 3QRTA 2IZSA 3PIZA 4L3LA 2NO3A 4NM5A 4U7ZA 4ZSGA 1BL7A 2X1NA 3PRIA 2Z7SA 3PXZA 1LEZA 2BDFA 3KFAA 4F4PA 5EQPA 1NVQA 1PKDA 3NNVA 2BFXA 3D7TA 5IUGA 4PPCA 4RWIA 5BYZA 5TE0A 3CJGA 3HECA 2V0DA 5CU4A 2CN8A 4BDFA 2VNWA 3ZO3A 5LWMA 2OZOA 4FYOA 4I6FA 5E8ZA 3C1XA 2HY0A 4LL5A 2HW6A 2ZYBA 5G1XA 4EOKA 3FQEA 3VUTA 2XBJA 3PXRA 3IGOA 1Y6AA 4LOOA 4I0TA 3JPVA 4MBIA 2XA4A 4J53A 3NUNA 4KBCA 4YJOA 4KIQA 3PPKA 1U54B 4F70A 5CALA 1PXIA 3COHA 2ITOA 2JKMA 4QP3A 2W7XA 4I22A 4BCMA 4L8MA 1KE8A 3VUDA 4ZTNA 4LMUA 4BYJA 4KRDA 4AGDA 1F0QA 3DKCA 3ORPA 5FXRA 5KMJA 3U6JA 2PYWA 4P5ZA 3TI1A 3THBA 2R3OA 5CEKA 3GQLA 2YDKA 2DQ7X 3U51A 4BTFA 2QO2A 4DFBA 3E8EA 4B7TA 3H10A 5AIKA 1WBNA 5CXHA 3WE8A 4C4EA 4EI4A 4FVRA 5E8WA 3D7ZA 4ZOGA 4ZTQA 5L3AA 4ZY5A 2RIOA 3LQ3A 1X8BA 1ZZLA 1XBCA 2PK9A 3NYXA 4FUYA 4IVCA 4UZHA 4D1SA 4U42A 1WBVA 5HBJA 3EN9A 4RX9A 3D0EA 1UU3A 2YIXA 2OZAA 5HE1A 5I9UA 2HZ0A 3MW1A 3PWYA 4OBQA 3TUCA 2YJRA 3HUCA 3ACJA 4L53A 4O0UA 4O0YA 5BMMA 2IPXA 2J5EA 2Y4IC 1JOWB 3P0MA 5HKMA 5LVNA 1UU8A 1XKKA 3H9RA 4FV9A 3UNZA 4B9DA 4ERWA 2J4ZA 4RIYA 2QOBA 4OUCA 3JY0A 4PTCA 4QMZA 3I5NA 1J7IA 5A4TA 3EFWA 4CCBA 5L2IA 5GJGA 4QMWA 5M08A 4BZNA 3ORNA 4RZWA 3IKAA 2XJ2A 3NYVA 4LGDA 5AR8A 3W32A 5I9WA 2I1MA 5ETAA 2P3GX 2WB8A 4OTFA 3QQKA 2BHHA 4AN9A 3PZEA 4AA0A 5BVOA 3I5ZA 2NRUA 3IECA 4IJ9A 3L1SA 3GXLA 4X21A 1ZMUA 4GFGA 2C5NA 2C0TA 2YHVA 3PIXA 3ZC6A 3BU3A 3SA0A 4PDPA 3P7AA 4PMTA 4LOPA 4LRKA 4V01A 5GJDA 4U97A 2ACXA 3T8OA 2VN9A 3DQWA 5EKOA 3PTGA 4DT8A 5K9IA 4M66A 2PVFA 3CY2A 4IFGA 1FGKA 4IEBA 3CQEA 4OTHA 4JS8A 5ETIA 2UZEA 4NTSA 4B0GA 2W1HA 4O0SA 5DVRA 5DT0A 5C01A 4EH3A 4XG9A 4BCQA 4TN6A 3RAIA 3R9DA 4M3QA 5J5TA 3NCZA 2XS0A 4J1RA 3VUIA 5IMEA 3QQHA 5HU3A 4A9YA 4FTJA 1M52A 4GV1A 4ONAA 3SXSA 4E5WA 4EK5A 5IEYA 1CTPE 2BZHB 3V5JA 3PA4A 4BDBA 3V5TA 4FKWA 4I6QA 3CP9A 4QMOA 3VWAA 4BF2A 3ORLA 3BE9A 4S30A 3EIDA 2YAKA 3CTJA 1PKGA 1W0XC 3HMIA 3NUSA 1J91A 3ZHPC 2XYNA 2B1PA 4GUEA 3BHHA 4D28A 4NYEA 1ZZ2A 5EOLA 3VF9A 2J0LA 3D83A 2E9UA 3AGMA 3C5UA 3FXWA 4YLKA 3UYSA 1IA9A 4I23A 4R7IA 4E93A 3SXRA 2ZM1A 4QMTA 2VTQA 3IDCA 2A2AA 4FIEA 5ACKA 4I4EA 5DR2A 4MKCA 3LLTA 1H07A 5JEBA 1REKA 4PRJA 4CRSA 3NMUF 4ANSA 1XO2B 5IQEA 2GS2A 2VNYA 2PVLA 1H1WA 3FXZA 4FIHA 4I24A 4IACA 3U4UA 1J3HA 3UVPA 5AA8A 2FB8A 1APME 1SMHA 4XG3A 2QLUA 3QQGA 4MTAA 4V0GA 3HDMA 4O7WA 3AC2A 3OD6X 4M0ZA 4W8DA 3D15A 5CF5A 4FL1A 3D4QA 3RAKA 2F9GA 4F99A 3OF0A 2P2IA 1U54A 3NNXA 3SAYA 4RIWA 3G6GA 2X2KA 3B8QA 5HEZA 3ZLWA 4EL9A 3NEWA 4D2PA 3PJ1A 1XBAA 1Y91A 4LMNA 5IQAA 5EM5A 4NTTA 2PUUA 1Q62A 3V3VA 5DIAA 5AAFA 4GK4A 5D7VA 4O7VA 1MRVA 5J8IA 4RIXB 2NPQA 3ROYA 5JKGA 2VO0A 4FOCA 3UPXA 2IG7A 4NT4A 1Z57A 3P7BA 2F2UA 4F7LA 4WG3A 1JQHA 2VTIA 5ANIA 4YTHA 5EQYA 5L8JA 4WA9A 4MX9A 2XNGA 5L2QA 3GC0A 2WMRA 2A19B 2WIHA 3LJ2A 4N4SA 3ZEPA 5IA4A 2SRCA 4N70A 3ZXZA 2PMIA 3L9NA 3O8PA 4PNKA 2GHGA 2G01A 3VN9A 1YDRE 2QO9A 4MF1A 3GU6A 5IUIA 4FTKA 3HZTA 2J2IB 4UYAA 5DA3A 2BDWA 5LCKA 1KUTA 5I5ZA 3R2BA 3QD2B 3OCGA 4QNYA 2OSCA 3BGPA 2PVMA 3HYHA 5FXQA 4QO9A 4BCOA 4IAZA 2WOTA 2OO8X 3HKOA 5K0KA 1W98A 4R77A 2GFCA 1FMOE 2J50A 5HNBA 3PXKA 3PJ3A 4E4NA 4ORKA 2WTJA 5F95A 4IX3A 2R2PA 2Y4IB 3C9WA 3UODA 4QQTA 3KA0A 4EK4A 3QCQA 2J6MA 3QTWA 3VNTA 3CCNA 3WYYA 4H3QA 4O7YA 5BVDA 3A7HA 3CY3A 3OTVA 2ZV7A 2BZKB 3RTPA 3TZMA 2UW0A 4ANOA 4MF0A 5IH4A 4FKSA 4TRLA 3BV3A 1XH9A 3MY0A 2C3JA 2BTRA 3A8WA 4BB4A 4RSSA 2PUIA 5IQHA 4C3RA 4J52A 3F7WA 3FMJA 5HIBA 3KRWA 3PY1A 1GNGA 1XJDA 4JX3A 5FBNC 3PA5A 3VHEA 4TWNA 3NW6A 3Q5ZA 4HYHA 4NM7A 2WGJA 2GHMA 2CJMA 4I6BA 3M11A 4CYIA 3KXMA 4DEEA 4UXLA 4X2FA 3WF9A 1Q97A 4D5HA 3UVRA 2VU3A 3FLNC 2VTRA 1CM8A 2YACA 3TXOA 4DLIA 4EUUA 3VS1A 3RJCA 1M17A 2E9PA 4DAWA 3ZXTA 3S00A 5C4LA 4ZJJA 2A1AB 4M13A 4HCUA 3ZSHA 4GKHA 1EH4A 3BLHA 3EZRA 3UG1A 2FGIA 4IB0A 4BIDA 2BZIB 1H26A 2J0MB 4FKUA 2XMYA 4F9BA 4C35A 4O7SA 1IG1A 4M12A 3GCQA 4L3JA 2Y6MA 4L42A 3BE2A 3OOGA 4L7FA 5BYLA 4FZ7A 2JEDA 4OTWA 4R7HA 1LUFA 4L7SA 2WQBA 4A9RA 2ITWA 2C69A 4RVKA 3DXPA 4BR3A 2ZDTA 5E7RA 4AZEA 4GU9A 1U5RA 4PMPA 4KIKA 5KCVA 2C0OA 2WNTA 1SM2A 2Z7RA 3BI6A 3WOWA 1O6YA 2R3PA 3RK9A 2G9XA 4MCVA 2BROA 3QZGA 4ITIA 4MVFA 4NIFB 3FEGA 2XNMA 4JVGA 2CKPA 5BUJA 3F2RA 4AA5A 3VW8A 4USEA 4OAVB 5AAGA 4YZDA 3F88A 4J8MA 4EJNA 3DB8A 3E62A 4RJ7A 3WIGA 3GBZA 5DLSA 3FI2A 3KULA 3KCKA 1H28A 4O22A 5CEMA 3P86A 3QTRA 5DRBA 3MESA 2CPKE 3TTJA 3Q2JA 4FKQA 5HD7A 3T3VA 2BKZA 3P5KA 4F65A 4FSQA 5HCYA 5AA9A 3AGLA 3DJ6A 3DK7A 4B4LA 5AUYA 4CTCA 3PWDA 2B9HA 2WPAA 4FZFB 4HNIA 1YXTA 3CQUA 3EQCA 4JNWA 4RLLA 5HG5A 1R0EA 1V0BA 4GYGA 4E6CA 1CKJA 1XBBA 3TUBA 4F9WA 1YKRA 2HW7A 4F0GA 3RINA 3EKKA 3FMHA 2OJGA 5IQIA 3DLZA 3O17A 2XIKA 1QL6A 2F4JA 3IO7A 3ORIA 4QTEA 4TZRA 4BY9E 4GUBA 1A48A 1M2PA 4ZTSA 3DK3A 1ZY4A 4K18A 4JR3A 3HV4A 2XNEA 2RL5A 2BALA 3BEAA 3WARA 4FSZA 1J1CA 5IDNA 5E92A 3R7VA 3I6UA 4C57A 2VWWA 2YM5A 4G16A 4YHTA 1RQQA 4W4WA 2BAQA 4XX9A 4ZSEA 3D5UA 5KHWA 3AD4A 3DZOA 4BI1A 4FSRA 4J7BA 3FBVA 3LIJA 4Y83A 3RCDA 4BKZA 1GZKA 4IM0A 4K2RA 3W2PA 3BBWA 3R9HA 4O6EA 4FI1A 3Q04A 5DNRA 3HV5A 4CTBA 3LMIA 3E93A 2XK4A 5KO1A 1H0VA 3E64A 3MIAA 4DGMA 1YDSE 3UQGA 5A46A 2VD5A 3KXZA 3RZFA 4I20A 3UIMA 5AP7A 4LV5A 4R5YA 3NX8A 1TQIA 4CVAA 3UC3A 3V8WA 1B39A 1OB3A 5DHJA 2GHLA 2RSVA 4CKIA 5HLNA 4YP8A 1P14A 3MBLA 4L01A 4YO6A 5FD2A 5ITAA 4FSYA 2I40A 2X7FA 4FVPA 2OXYA 5KMLA 3IOKA 4EK3A 1H25A 5AUWA 1JVPP 3BLQA 4TWPA 2YM8A 5HLWA 4FEXA 3C13A 4YJQA 3W16A 3OHTA 4XRLA 4CSVA 4D2TA 2I7QA 1URCA 4FK3A 2VO7A 1ZLTA 2KULA 4CMOA 3PXFA 3R1NA 4G3CA 4J99A 4RJ4A 5D12A 3RGFA 2R3FA 3G90X 3KVXA 4CFXA 4XP3A 1VZOA 5FUTA 4EJ7A 4P5QA 1IEPA 4BC6A 2UVXA 2BIYA 3POZA 4LOQA 3R2YA 4RJ5A 1HCKA 5CAOA 5A6NA 4H1MA 2JDTA 1MRYA 4LRMA 4O86A 3HNGA 3R28A 3TKUA 4GKIA 4EWQA 4DF3A 4ERKA 3TZ7A 5JMSA 1YDTE 3VUKA 4BCJA 2R3NA 5IH6A 3P23A 1YHSA 4XOZA 3RPVA 4KBKA 4BDDA 2YIRA 3E7OA 3GU5A 4F6SA 4ZS4A 4DCEA 3WE4A 3G9LX 2OFVA 4JR7A 2C6KA 4IW0A 4YR8A 3L8XA 3QZIA 4YPDA 3LMHA 4UWYA 4DFLA 5A4QA 4WOVA 3AMAA 3DBQA 4FT7A 3KF7A 1UKHA 2E9NA 5AP1A 3UDBA 3NVMB 4FG8A 2XEYA 3ZZEA 5JN2A 3UZRA 4ZK5A 5M55A 4ZZMA 3FAAA 4FL3A 1UNGA 4G1WA 3FMEA 4I3ZA 1YOLA 1K2PA 4JX7A 4NSTA 4YJUA 3MTFA 5A4EA 5KMKA 4QMYA 5AR2A 5AFVA 4BDIA 3O50A 5DR9A 5C8NA 3EOCA 3CR0A 2V7OA 4CXAA 3TG1A 4RC3A 5IA3A 4XG2A 1WBOA 2UW8A 3OTUA 3FY2A 3QTZA 4XG4A 5E91A 3ACKA 5CF6A 3OWJA 2W06A 3G0FA 4C62A 4FE2A 4BCGA 4CQEA 5LVLA 1KE9A 2X4FA 3V5WA 2UV2A 3ORXA 5B2LA 4UV0A 4R78A 4IVBA 3RNIA 3KMMA 4TWOA 5AX3A 3QUEA 3EQIA 4EBWA 4HPUE 4FV4A 1SNXA 1YI6A 3A7GA 5FG8A 4EYMA 3EL8A 1H27A 2PVHA 3UO4A 1ZXEA 5D7AA 4O7NA 5FDXA 1H0WA 4A4LA 1I09A 3PG3A 3RHKA 1DAYA 3OUNB 2J51A 3BZ3A 4TW9A 3BYUA 5AJQA 4C59A 5DN3A 5EYMA 3MFUA 4S33A 5TR6A 2PE2A 3O51A 2CLXA 4F0IA 5A54A 2QOKA 2E9VA 2W5AA 4XV9A 4ZEGA 3SD0A 4YURA 5L6WL 4GG5A 2BZJA 4YZNA 1ZMVA 3ZTXA 5EH0A 4RX5A 3D7TB 2JIUA 4ASEA 4IWDA 5M56A 3GFEA 1P5EA 4I4FA 1UNHA 2HZNA 3DGKA 4O91A 4TYIA 2W96B 4L00A 4A4XA 2PZPA 4AZFA 3MPAA 1XH8A 3GU4A 4EBVA 2W1IA 4HNFA 4BI2A 5HZNA 1IRKA 2XKDA 2GDOA 4II5A 3JYAA 3FZRA 3PP0A 4R3PA 5FRIA 4BDKA 5BUIA 4FOBA 1CDKA 3MVMA 4HVIA 2PMNX 3ODYX 3ZUTA 2ITXA 4UEUA 4MD8E 4RX7A 3SQQA 5C8MA 3UOKA 2EWAA 3C4CA 3EQHA 5CNNA 4PDOA 3LCKA 1W83A 3K3IA 2RF9A 4FTRA 3QTUA 4MBLA 5FDPA 3E8NA 3MH2A 2X2MA 3Q4UA 5I4NA 4FBXA 1J7UA 4O82A 4IC7A 4RMZA 4H3BA 1OL2A 3AD5A 4LFIA 3KMUA 2P4IA 3UIXA 4GMYA 2QOCA 2CNVA 2YCFA 1KE7A 4MXCA 2V55A 3ELJA 1OKWA 4DTKA 1Q41A 3GI3A 5HO7A 3TUDA 1R3CA 4GJ2A 2PU8A 4WD5A 4EHVA 4ITJA 4GFMA 3A8XA 2OZAB 4F63A 2YDJA 3KQ7A 3OMVA 3QFVA 3ZO2A 4CT2A 3B2WA 4WNPA 3UJGA 4AFJA 3QD4A 3FZPA 3LFSA 3FPMA 2JKQA 4MD9E 4AW2A 3EYGA 4YBJA 3DT1A 1WBTA 4TT7A 5HE2A 2AC5A 2EVAA 4W4YA 1P2AA 2W17A 2Q0BA 4RIYB 5CX9A 3QRIA 3KRXA 5HD4A 2XF0A 2WMAA 4MH7A 1PMEA 5EHLA 4BTMA 3W2CA 4EONA 4FSNA 4G9CA 2EXEA 3Q9YA 4AZTA 1OPLA 3GGFA 3F5PA 3POOA 1YOMA 5EW3A 4ID7A 4DFXE 3TCPA 2UZVA 5AUUA 5TOZA 4CZTA 4OW8A 4CLJA 3FMKA 2C47A 3Q3BA 5LMBA 1PYXA 2F49A 2BCJA 3DKOA 5BVEA 3BYSA 4FGRA 4GG7A 3GCSA 2XUUA 4IXPA 3A99A 3VJOA 2W0JA 2B55A 4FV6A 3QTSA 2WTCA 3R8UA 2X6DA 3N4TA 4H58A 3P4KA 3NUXA 4UX9A 3BELA 1DI8A 4MYGA 1Q5KA 3GCPA 4ZS0A 4X3FA 5D9HA 5FM3A 1IASA 4DTBA 1PXPA 5T3QA 1BX6A 2BRGA 3O7LB 4IZ7A 4Q5EA 3GU8A 2JLDA 3F66A 2ITVA 5LWNA 1OUYA 1PJKA 4I93A 1OIUA 2CGUA 4XG6A 1W82A 3CEKA 4AZSA 2O63A 2Z8CA 2C6OA 4FKOA 3FI8A 3OVVA 2RFEA 3HP2A 2VUWA 4FV2A 3ZRMA 1YW2A 4Y5HA 4F7NA 2W1DA 3MI9A 2X7GA 3FZOA 4KWPA 2YERA 4DFUA 3ROCA 5E8VA 2VTTA 3QYZA 3R7UA 4MNEA 1WVYA 4XS2A 3DS6A 4IIRA 4NEUA 1OZ1A 4DBXA 1RW8A 4UWBA 2X4ZA 4IMYA 3CPBA 3TEIA 1BKXA 5AR3A 4EQMA 4HVGA 3PVGA 4WT6A 1ZYSA 1GIHA 3UO6A 5HGIA 5ACBC 4JL9A 3SRVA 5HCXA 5C27A 4R1VA 4EH2A 3QHRA 3G2FA 4OBOA 3R8MA 3QD0A 2GU8A 5JK3A 4JQEA 1U5QA 4L46A 4FODA 1YXSA 3Q6WA 3MFTA 3DBEA 1Q3WA 3K5VA 2PE0A 4IWOA 4F1MA 2QG5A 4OTQA 1O9UA 2VWUA 3NDMA 4QMQA 2CNQA 4FNWA 5A4LA 2W1GA 4GT5A 4TNBA 5EHOA 3P78A 4WUAA 4CFWA 2W5HA 2UZDA 3MN3A 2NP8A 4RJ3A 1OL6A 2HYYA 4D9UA 4M69A 4H3PA 4DITA 5L4QA 4PL4A 4M14A 1HCLA 4V0GB 1J7LA 4IM3A 5IPJA 4DH5A 2XCKA 5A3XA 4AA4A 3VAPA 1AQ1A 4MAOA 3UTOA 3I1AA 3V6SA 2JDSA 5L2WA 3CBLA 2OXDA 5J5SA 4CFFA 4M84A 2YA9A 3OG7A 4RIWB 4KNBA 4FKIA 3SOAA 3RP9A 4KAOA 4B99A 4E26A 4O0WA 1NT2A 5HESA 4N57A 4GIHA 4IWQA 2R3QA 4TXCA 4FICA 4QMNA 5LOHA 2A27A 3S3IA 4R7BA 4HCVA 5IQCA 3AG9A 4MWHA 1DS5A 2YLFA 4I5PA 4Q2AA 2W1CA 3TJDA 1ZYCA 1XH7A 4EH7A 5GJFA 4JRNA 2ITNA 4OR5A 3IDBA 3DB6A 3CE3A 3LFBA 4FV5A 1RDQE 3FV8A 4CG9A 1R1WA 4A9TA 3L8PA 2X6EA 2HCKA 5HE3A 2UZBA 3SW4A 5A6OA 3FKOA 5CANA 3QXOA 5K4JA 3E92A 5KMOA 4YJVA 3QD3A 4IX6A 1UU9A 4PDYA 5KMIA 3JXWA 3ZFMA 4X2GA 3EN5A 2YDIA 1STCE 4A7CA 3EFKA 5E8XA 4BVUA 4NH1A 2UZWE 3JY9A 1LR4A 2C3KA 4FG7A 5CT7A 2JBOA 2R3IA 3R7OA 1GY3A 5HTIA 5AUXA 3W1FA 1ZOEA 1NY3A 4KBAA 3SGCA 3T9TA 4FEWA 1JSTA 3IW7A 2VX3A 3Q4CA 2GS6A 3QC4A 4YJPA 3ORZA 4E6AA 4TNDA 3LJ1A 1DI9A 2HY81 1B6CB 4CV8A 3LFEA 5JFXA 1PHKA 3R02A 4AT4A 2ETMA 3TNIA 2OWBA 5HHWA 3RWPA 4QMMA 3BGZA 3IGGA 5FTOA 5AP5A 2OJIA 3TM0A 4FV3A 3WZEA 5KUPA 2R3GA 5I3OA 3E8CA 3F5UA 2XK9A 2WELA 4C7TA 1ZWSA 4O7RA 2EB2A 4X7QA 3R1SA 4FTAA 1GZOA 3QQJA 3R8LA 4P7EA 4J8NA 4LL0A 2JDOA 3VULA 3K54A 2Y8OA 4PUZA 3TNQB 1FVRA 2JD5A 2J0KA 2WKMA 2VWZA 4ZZOA 3IW6A 2B9JA 3HEGA 4TY1A 2ITZA 3VBWA 4FV7A 2XNPA 4E6DA 2G2HA 5TO8A 4BZOA 2OJFE 3LFDA 3NUPA 2E9OA 2BRBA 4ZLYA 5K4IA 4FG9A 4FKLA 3ZEWA 4E20A 1MRUA 2XKFA 1IAJA 4W9XA 3RWQA 3EKNA 4XHKB 2UZTA 2JITA 5H2UA 4AP7A 1RE8A 1UNLA 3LMGA 3CGOA 4I5CA 4X2NA 3ATSA 4WUNA 5AM7A 4WNOA 3ZM4A 4DEIA 1WCCA 3TN8A 1JKLA 2WHBA 4KSPA 2WAJA 3FQSA 3P79A 2WMWA 4G6NA 1O6KA 4HYSA 4IZ5A 4ZTHA 2BUJA 4IANA 2Y7JA 4HYUA 2JBPA 1SVHA 3E63A 2W4OA 3W8QA 5H3QA 3VUHA 3EH9A 4KIKB 5JQ5A 4GH2A 5CSWA 4TL0A 2EU9A 4MD7E 3HRFA 4TYJA 2E2BA 3ZBFA 1E1VA 4RIOA 4Y46A 2Y9QA 4EOPA 4AGCA 4IX4A 3H0YA 4FT0A 5TF9A 3RAHA 2C6LA 2WMQA 3EYHA 3PSBA 4NKSA 2OF2A 5IKWA 3KULB 3HMOA 4NWMA 2G15A 5B0XA 3D5VA 2B7AA 3WIKA 4D58A 2ERKA 1NW1A 2IVSA 4O7ZA 1XQZA 3E3BX 3VUGA 3ZO1A 2VX0A 3W55A 5G6VA 4IM2A 4Z7HA 4RBLA 3QKMA 4DH7A 1M2RA 1NA7A 5AUZA 2DWBA 1Q24A 4D4VA 4NZWB 3VHKA 2OU7A 1H1PA 2H34A 5CWZA 3BU6A 3QU0A 4JG8A 5DFPA 4CRLA 3TZ8A 4EH8A 5JZJA 4D5KA 4QP1A 5DGZA 5AMNA 3FXXA 4C4HA 2JC6A 3COKA 3EQBA 4LRJA 4DG3E 1OKZA 2W99B 4AN2A 3R9OA 4BCKA 1UV5A 1H1QA 3LQ8A 5DH3A 5KZ0A 3PE1A 4KINA 3RZBA 5AX9A 1PRYA 3ANRA 2OBJA 4PL3A 5CU3A 1H1SA 2QOQA 4QT1A 4BGQA 3PFQA 2BHEA 2ZV9A 4IAKA 4FX3A 5ANDA 2QVSE 2VTNA 4RVTA 4Y72A 2XK6A 4AW1A 4C2VA 3NIZA 5K5NA 3COMA 3C4XA 4IADA 3NRMA 4AS0A 3IK3A 3IDPA 3DBCA 4NCTA 2YJSA 2P33A 5FEQA 3WF7A 5IG1A 3D14A 3LOKA 2IW6A 1XH6A 2XM8A 4JLCA 4UXQA 4BDJA 3N9XA 4IJPA 2CNUA 1JKSA 1S9IA 2BIKB 3IW5A 3MJ1A 4J96A 4JDJA 3OY1A 5CVFA 4DC2A 4FSMA 5E1SA 2CHLA 3ZDIA 3NPCA 4UMRA 5AP2A 4H05A 5CSPA 4MWIA 2H96A 4Y85A 4ALVA 5HQ0A 3PSDA 2BILB 5CEPA 3RK7A 4IDVA 5F4NA 4O21A 2X39A 4FNYA 2CKOA 4XOYA 3MFSA 4YJTA 4FIFA 5HU9A 2REIA 2UZUE 2BAJA 3LXKA 5CI7A 5D1JA 4D2RA 4QYFA 1V0OA 3KC3A 4EHZA 4E3CA 1F5QA 4IBMA 4FZ6A 4FEQA 3GU7A 1WVXA 2A0CX 1SZMA 3NSZA 3OEZA 5CSXA 4DEBA 4WSQA 2C5OA 3KCFA 4ZSLA 3QA8A 1PXOA 1G5SA 4YC8A 2C3LA 3PRFA 5JH6A 1BUHA 3SG9A 4ENXA 2ZAZA 4IVAA 4D0XA 4RG0A 3DA6A 3TJCA 1MQ4A 4GJ3A 3U55A 5CNOA 4IB5A 4KKHA 5EOBA 2W1EA 3QCYA 4G3GA 4QP7A 4EH6A 4IH8A 1URWA 4ZTLA 3PG1A 3RCJA 3QA0A 3A2CA 2PVKA 4GS6A 3LFNA 3R8VA 4M68A 2ZMCA 4O27B 3RALA 4BTKA 4F0FA 2VGPA 5GZ9A 1A9UA 4DFNA 4CEGA 4F6UA 3BV2A 3CC6A 4RFMA 4QPMA 5K3YA 5M06A 3KXHA 3LFFA 5CU2A 2XNNA 2BMCA 1S9JA 3Q52A 4GIIA 1ZOGA 5ETCA 5CEQA 3RNYA 5M4CA 5DMZA 2IO6A 5B2KA 1YWNA 5HO8A 4Y5QA 3ZH8A 5H8EA 4X3FC 3BYOA 2VTAA 2QO7A 2GS7A 4XG8A 2C5YA 4Y8DA 4YHJA 1PXKA 3DBFA 4AZWA 4B6LA 5FTGA 4EZ7A 3R21A 4BIEA 4CNHA 4DEAA 4R6VA 1I44A 2PSQA 2QKRA 4F64A 4FKJA 5IF1A 3DTWA 3MPMA 3CQWA 4DG2E 4AU8A 2C5XA 5DR6A 1T45A 3ZDUA 3A7JA 4EK6A 2FSTX 4RC2A 4XBUA 3BHYA 2I0EA 2WMUA 3JUHA 4PMSA 4YLLA 3WF8A 4OAUC 1H01A 3N4UA 3NLBA 4XV2A 4TPTA 3MS9A 3A62A 5CU0A 2GNJA 4O1OA 4BIBA 3OY3A 3IS5A 4UY9A 5L2SA 4O83A 4GL9A 5ANEA 3FWQA 1V1KA 2GTMA 4JG7A 1BI8A 4MHAA 4M67A 4QP6A 1YVJA 4YJNA 5HO6A 3PYYA 4OLIA 2LGCA 3UMXA 2Q83A 3CLYA 2G2IA 4IAYA 3VBXA 5A4CA 4P2KA 2R7IA 3E3PA 4W4XA 4WNKA 4PX6A 5T6KA 3GP0A 5AUTA 3D2KA 3PIYA 5EM7A 3IPHA 3W18A 4ANLA 3FL5A 1QPEA 3Q96A 2J7TA 4M97A 1A06A 2W05A 3LW0A 4AFEA 3RPOA 3O0GA 5J7HA 5LVMA 3UZPA 2JDRA 2F2CB 3K3JA 3Q4TA 2GNIA 3DV3A 3UMWA 4CQGA 4ZZNA 1GJOA 4RRVA 4AUAA 2J0IA 4E4LA 5CQUA 4EH5A 3PSCA 3Q9XA 4LQMA 3VVHA 2VTJA 3OW4A 3FMLA 2XIXA 3V6RA 5HICA 3RPSA 3VUMA 2AYPA 5K5XA 3NAXA 4YC3A 3V51A 3ZFYA 4C4JA 1E9HA 5EK7A 4Z16A 1VR2A 2BFYA 4M8TA 3FLQA 4RGJA 3QZHA 3WBLA 3FLYA 4D4SA 3ZSIA 1ZOHA 3H9FA 1OL7A 3U6IA 4RC4A 1ZAOA 3QX4A 4HJOA 2OIQA 1SYKA 2WMVA 3WZUA 4ARKA 2GFSA 3ZBXA 4PWNA 4AE9A 5TKDA 4JRVA 3Q4ZA 3QXPA 3RVGA 2PVJA 1KE6A 2UVYA 5CY3A 3DZQA 1LP4A 2X2LA 1Z9XA 2B54A 2OIDA 3PLSA 3GOKA 3R73A 4RWLA 5AP0A 3TNHA 3PDTA 2JIVA 3NZ0A 2J5FA 4QPAA 4Z55A 4EOJA 2YM6A 3WYXA 1MP8A 5DG5A 4ASXA 3FE3A 4EZ5A 4MXXA 2J0JA 3AT3A 4XV3A 4DH8A 4BBEA 2QG7A 5BVNA 5AR5A 3S4QA 3EWHA 2VV9A 4K33A 4ZP5A 4FTNA 4R5SA 3ZUVA 4O0TA 4E7WA 4O0VA 2QR7A 3IW4A 2CGXA 4AF3A 2ITTA 3JVSA 5HG7A 4KD1A 3BLRA 2UW4A 5EDQA 3FYJX 3SX9A 4BKYA 4FT9A 3ZSGA 3UZTA 4KUJA 3MYGA 3U6HA 1G3NA 4RVLA 3E5AA 2RGPA 3IOPA 1YOJA 2GNLA 4DEDA 5K0XA 2WIPA 3HV7A 3AMBA 5C4KA 2XKEA 4PNIA 4EC8A 4BCIA 4DA5A 4ANMA 3KVWA 4GCJA 3OBJA 1XH4A 2R4BA 3MGYA 1E1XA 4JI9A 3QRKA 5KX8A 2PE1A 5CEOA 4YPSA 2OJ9A 1OPJA 5CLPA 5M51A 4ANNA 4IZYA 3PA3A 3LFAA 1BI7A 4IZAA 5EFQA 3R9NA 4F9AA 2HELA 4O81A 5JSMA 1JLUE 2Z2WA 4PL5A 3HX4A 3HMMA 4O38A 2VTSA 3F9NA 4PP9A 3ZRLA 1NVSA 2VRXA 2WTKC 5J1WA 3MFRA 5AEPA 5J9YA 2EXMA 3EN6A 4BBFA 5E8YA 4HVDA 4O84A 1OL5A 5I9VA 3VBQA 3KMWA 5JRQA 3TV4A 5FEDA 5EI8A 2OG8A 4H1JA 2WMBA 3MA6A 3S0OA 2WOUA 3MH0A 4BDEA 4ALWA 1KWPA 3L9MA 5JGAA 2OF4A 5DWRA 5I9XA 4TYHA 4I0RA 5ANOA 1NXKA 4QQJA 4GT4A 5M53A 1ZYLA 4FTQA 4RPVA 3R7IA 4CCUA 3W2RA 3EL7A 3LJ0A 3PJ2A 5JGBA 4G6LA 5EDRA 4J98A 5CF4A 4X3FB 3LCSA 2VTHA 5DT3A 4RJ6A 4WBOA 2ZM3A 5ANGA 5GHVA 5CSHA 4UMUA 3QUDA 3AT4A 2VO3A 5H8GA 1GOLA 5F20A 3GQIA 3FMDA 2DS1A 5B2MA 3UOHA 2XJ0A 4X6QC 1WAKA 3Q60A 4I1ZA 2V62A 2YZAA 4FT3A 3AC8A 4KB8A 2PZ5A 4AZVA 4I94A 4FR4A 5KMMA 3FL4A 4G31A 3QHWA 4I0SA 2QI8A 2X9EA 3GC9A 4FNZA 3OUKA 3C4WA 4MNEB 4BHZA 4HGEA 2GMXA 4QMXA 5F1ZA 4D9TA 1GIIA 4LG4A 3MTLA 2PUNA 1O6LA 4BGHA 4RA5A 3EQRA 4P90A 4O96A 2ITYA 2XB7A 2VWBA 3F2AA 3O2MA 5DYJA 3FQHA 3FZ1A 3QZFA 4YTIA 4FNXA 4MXZA 4C3PA 4JBVA 3KRLA 1JWHA 4JT3A 2XH5A 3SRVB 2VWYA 2R5TA 3HLLA 3LE6A 4EH4A 4XBRA 4L6QA 4AOIA 1GAGA 2ZB1A 4KS8A 3CD8A 4ZJIA 5FBOA 5M4IA 2XIRA 2JKKA 3BQRA 3V8SA 4QQ5A 4AGUA 1M7NA 5IQGA 1Q99A 1ZY5A 3ZMMA 3OZ6A 4FTUA 5AV2A 3SHEA 5L8LA 5JFWA 2CKEA 3DXNA 2WQNA 3AC5A 3QTIA 4U40A 3UVQA 4WIHA 5BVFA 3R7EA 2LAVA 3SW7A 4M69B 4FKVA 1OIQA 3UNJA 3P08A 4ACMA 4F09A 3ZZWA 3ENMA 1UU7A 2WXVA 3CS9A 4XP2A 3TIZA 4YLJA 3DNEA 1AD5A 3UQFA 5IQFA 2Z02A 5JFVA 4BRXA 1K3AA 2XIYA 4I5HA 5I3RA 3GC8A 2VO6A 4WSYA 3WZKA 4C8BA 4EOSA 3DAJA 3DAKA 3FLZA 3L8VA 4NCTC 4YNEA 5EI6A 5T68A 3REPA 3V5PA 4YUQA 2O5KA 4IE9A 2WQMA 4PPBA 2DYLA 4CKRA 5C9CA 3UGCA 2C6DA 1JAMA 1L3RE 3H3CA 4KKGA 2R3RA 4WG5A 3AC4A 3LM0A 4ACHA 4C02A 1PW2A 3WF6A 2XNBA 3NW7A 3U87A 2HAKA 4DYMA 4U79A 4EH9A 3EQGA 3ORMA 5BQ0A 5AV1A 5HLPA 3KB7A 2JDVA 3SC1A 5CEIA 3LZBA 4O6LA 5M44A 2WO6A
chains in the Genus database with same CATH superfamily
5HE0A 1SVEA 4MEDA 2QQ7A 4QTBA 4FGBA 2XYUA 4IAFA 4ALUA 3LCDA 3GC7A 3RBWA 1H08A 5GINE 4C2WA 2ESMA 2VTOA 3FI3A 4FV1A 4BDCA 5IA2A 4UMPA 5AV4A 2ERZE 4Q5HA 4BGGA 4GVJA 5DT4A 4DHFA 5HX8A 2YAAA 2BVAA 2A4LA 2C6EA 3MB7A 2YWPA 2C5VA 3LCOA 3R04A 1OIYA 5BVKA 4D2VA 4I92A 5FQDC 3VONA 4GK3A 2V7AA 3R0TA 2YEXA 3BYMA 4L45A 5LMAA 3ULIA 4LM5A 1H8FA 3VS6A 3MA3A 4C4IA 1OUKA 4AACA 1YI3A 3KF4A 4XYFA 3LM5A 4EHGA 3OT3A 3OXZA 4MK0A 4U0IA 3QCSA 3R22A 5GZAA 5L8KA 2OIBA 4F78A 3W0PA 2QU6A 4L3PA 4NW6A 5AV3A 4KABA 4ANQA 1Q8TA 4WO5A 4QP4A 3NFFB 4PP7A 3AD6A 4GU6A 3FC1X 5DI1A 2WTKB 1M7QA 1P4OA 5HG9A 3FPQA 5HOAA 3VS3A 1ATPE 4BFMA 3EFLA 2CN5A 5JRSA 2XRWA 4BCFA 3OWKA 3AC1A 4O7LA 4ASDA 2JKOA 3DNDA 3O8TA 1HOWA 2YFXA 1OI9A 3DXQA 4L52A 3DOGA 1JKKA 2CLQA 4IAAA 3HV3A 3RPRA 4EUTA 2X7OA 4KIPA 3TV7A 1CMKE 1PMNA 4BBMA 4C37A 4JBOA 1YI4A 2QKWB 4F9CA 1JNKA 1YXUA 4G3EA 1GZ8A 3DU8A 2YM7A 3FZTA 2RG6A 2O2UA 4O7TA 4FF8A 2XRUA 1BL6A 3OWLA 5HNGA 3RAWA 1LPUA 5HNIX 4D2SA 3KGAA 1ND4A 2FVDA 3ANQA 3BKBA 2YZLA 2HIWA 1PXLA 4RLKA 3S2PA 4LGHA 2P55A 4E6QA 5AP4A 3DY7A 4GRBA 5FM2A 3R83A 4F7JA 4FEUA 4R8QA 3C4EA 3BCEA 1XWSA 2JAVA 4DT9A 1L8TA 1J1BA 2FH9A 4ZTRA 3CKWA 4E73A 4WRSA 3EN4A 1XR1A 4ACCA 3ZLXA 2UZNA 3NWWA 4FT5A 5J79A 4XJ0A 1Q4LA 2CMWA 3E88A 4RWJA 3VQHA 4BCPA 4I21A 1QMZA 4AW0A 3T3UA 3ATTA 3OROA 4A06A 4E1ZA 3UBDA 2BKKA 3KREA 3UNKA 4XEYA 2QLQA 1KV1A 1ZARA 3QYWA 5AWMA 2PPQA 4G9RA 3VIDA 1PMUA 4MXYA 5JGDA 3TDVA 4FTCA 5C03A 2RG5A 2EUFB 2YN8A 2CGVA 5D10A 3TACA 3PLAE 4AE6A 4LV8A 3EJ1A 4WKQA 4BKJA 4NK9A 3LXPA 3QGWA 4YZBA 3VRYA 1GZNA 3HL7A 3CTHA 4FA2A 1QPCA 3F82A 4D1XA 1TZDA 3BU5A 3EN7A 4IAIA 3VC4A 5E9EA 4M7IA 4S31A 3DKGA 5EW9A 2XJ1A 2YCRA 4LYNA 2I6LA 2R9SA 3R9RA 4TTHB 5KKRC 1FVTA 4AXEA 2Z7LA 1FVVA 5H9BA 4QP8A 4Y73A 3KN5A 3KXNA 4FTMA 5E90A 3GOPA 3MV5A 2I0HA 2O3PA 4ZSAA 2A98A 5ETFA 2YIWA 3NYNA 5GIPE 1CKIA 1YRPA 2NNWB 3ZC5A 4QTAA 3SG8A 1Y8YA 2UW7A 4U44A 4G6OA 2OW3A 5ICPA 5IMXA 2I0YA 4DGLC 4EQUA 2VTPA 1JPAA 5EYCA 4YHFA 2QODA 4JJRA 1FMKA 1Q3DA 2HWOA 3FYKX 3HAVA 4JBPA 3CPCA 3NVKI 4IFCA 4U9AA 4BTJA 4YSJA 3II5A 4U80A 3GEQA 4BCNA 1B38A 5CQWA 3ZYAA 3FDNA 4DGGA 1OPKA 3FJQE 2PZIA 3F5XA 4YTFA 5AR7A 3I0QA 4ITHA 3WZJA 4FZDB 5CT0A 3C7QA 3BGQA 3HA8A 4XP0A 4D2WA 5M09A 3OCBA 1JKTA 2RKUA 3H4JA 4FUXA 4C4GA 4PMMA 3QX2A 4K11A 4QNAA 1OIRA 3DTCA 4W8EA 3DBDA 2JGZA 1YXXA 1IA8A 2XNOA 3AQVA 3AXWA 3R6XA 4XCUA 4EWHA 3DLSA 1Z5MA 4QMVA 3QUPA 4LI5A 3F61A 2OFUA 3U4WA 3LHJA 3KRJA 4OBPA 4CLIA 1TKIA 4YTCA 5LJJA 4HVHA 2NRYA 4CFVA 4EEVA 4DH1A 4APPA 4PTGA 3C0HA 2BTSA 3SV0A 4CYJA 1ERKA 2R0UA 2HENA 3F3TA 2W1FA 3Q6UA 2QNJA 3O96A 3S95A 3G9NA 2PZRA 3DJ5A 4FTOA 3TT0A 2V5QA 4CMUA 5KBQA 5FWKK 4BWPA 1U4DA 3C4FA 5AP6A 4V05A 3CTQA 3PXQA 5IEVA 2ZFYA 4J95A 5IQDA 3NYOA 4D0WA 2JFMA 4EKKA 4XV1A 4NUSA 4C33A 4G5PA 4LV7A 4FKRA 4HPTE 4U43A 5FLFA 2IW9A 4Q9ZA 1ST0A 4PPAA 3OC1A 2PZYA 5EKNA 3TIYA 4QPSA 1Q8ZA 5JQ8A 1K9AA 1NVRA 3FMNA 4I5MA 5LVOA 4JDKA 4JQ7A 3B8RA 3LFQA 2PHKA 2Z7QA 3LXLA 1OECA 1ZMWA 3OEFX 5LXMA 3ORTA 4JDHA 4HOKA 4IB1A 1Q8UA 4RQKA 4ZJVA 4RQVA 5HG8A 3MB6A 2ETRA 4K6ZA 4O0XA 3A61A 3UPZA 4DN5A 2FO0A 2QC6A 4RFYA 1TVOA 4ZXTA 2GNFA 2PMLX 3E7VA 4EC9A 2X0GA 4H39A 2R0IA 3FUPA 4NJDA 2HOGA 3UE4A 4JIAA 2W9ZB 4AOTA 4C61A 3UG2A 4QMPA 4GK2A 2HWPA 2I0VA 3AC3A 2IVTA 2WEIA 1WBPA 3HDNA 3C0IA 4JAIA 3C50A 4KIOA 5CF8A 4FTTA 1IAHA 2VX1A 1UVRA 2HXQA 2UW9A 1G8JA 4R3CA 2R3LA 1V0PA 3TWJA 4EOMA 3KL8A 3VS0A 3ZONA 1OBDA 2GCDA 3D94A 4Q9SA 3W10A 3HGKA 3F3WA 5IA1A 3A4OX 5CAUA 4HYIA 1W8CA 3C5IA 2O65A 3MY5A 2FSLX 3NAYA 1WZYA 3BQCA 3G51A 3HRBA 3I60A 4YZ9A 3MWUA 4DEHA 3R30A 5CAPA 4XLVA 3HRCA 4A9UA 3NR9A 3NGAA 4N6ZA 4FZAB 4TYGA 5DPVA 3KY2A 2Q0NA 2AC3A 3ZOSA 3SXFA 2FSMX 3ZUUA 3BX5A 3CJFA 4DGNA 2XALA 3HUBA 3O8UA 3QKKA 4DINA 3FLWA 3QQFA 2QR8A 2IN6A 2IZTA 2XEZA 5CYIA 5CAQA 2HK5A 3OW3A 2VAGA 3TZ9A 4DEGA 1Q8WA 5FTQA 4C58A 4ENYA 3EHAA 3QC9A 5BPYA 5HIDA 5L2TA 4J97A 4MNFA 1IR3A 2C6TA 3A60A 2RFDA 3NNWA 4DE4A 4AXAA 3KXGA 4PDSA 2YM4A 4U81A 5HTBA 1JSVA 3O23A 1TQMA 5HVJA 3H9OA 2XIZA 3DK6A 5HX6A 3SVVA 4RJ8A 4C36A 5E4HA 2X8IA 3UOJA 3LPBA 3C51A 3QWJA 5AM6A 3V5LA 2FSOX 1VJYA 1DM2A 2J9MA 5CZIA 5HCZA 2WQEA 2PUPA 2PULA 4Y95A 1T46A 3F3VA 5KKRB 1BMKA 3KIOC 5AAEA 3FZSA 4F1TA 5M07A 3DQXA 2HZ4A 4PV0A 1UA2A 3FMMA 3E87A 5EG3A 4YO4A 5E8UA 4IQ6A 4F08A 1CKPA 2ITQA 3OBGA 3S1HA 2CGWA 3KN6A 3FHRA 3R01A 2BRHA 4K8AA 5KBRA 2BAKA 4L67A 1GIJA 4AX8A 3NUAA 4QP2A 4CT1A 2CSNA 5LVPA 1JSUA 3GVUA 4HZSA 3QL8A 4NJ3A 3W33A 4C34A 4CMTA 4OTIA 5C8KA 4CV9A 4G5JA 1WVWA 4F9YA 3HA6A 5I9ZA 5KHXA 3W2SA 4MXAA 5DBXA 4JIKA 2GNHA 2WTDA 3CXWA 2WTIA 4JBQA 5HVYA 3ZO4A 4IVDA 3SLSA 1OBGA 4B8MA 2QONA 3QALE 2R64A 4CZYB 5J1VA 3O5AA 3I0OA 1OGUA 2F57A 3JS2A 3ZFXA 4PQNA 2F7EE 2C6MA 4DGOA 3W2OA 3R00A 4GEOA 2XAOA 4I6HA 5BX0A 2XVDA 4UWCA 1PMVA 3F3ZA 3NUYA 4ZLZA 4DTAA 5ANJA 2GQSA 3KK9A 5HTCA 4S34A 4WNMA 2JAMA 1MUOA 2J90A 2OK1A 2Z60A 3PJCA 1M2QA 3QQUA 4GVAA 5DEYA 3V8TA 4CD0A 3H30A 4U8ZA 3A7FA 2C68A 2R3MA 3A4PA 3FLSA 4AOJA 3PPJA 2BRNA 3OFMA 2WU7A 3TL8A 4RVMA 4YC6A 2QURA 1KOAA 3TDWA 5GNKA 3KRRA 3NW5A 1FPUA 2O64A 4CKJA 3U8WA 3VBYA 4HCTA 4O4CA 4E5AX 3BHVA 5AUVA 3MH3A 2GQRA 2X8EA 3D2IA 3R7YA 4CFNA 4ZAUA 2R3HA 3NNUA 2JIIA 3A7IA 4EZ3A 3R71A 1P4FA 2B53A 2PTKA 3Q53A 2WMSA 2X0QA 3RM7A 5IEXA 4AN3A 3I7BA 2B4SB 4QP9A 4TYHB 3ZRKA 3FHIA 2GNGA 1JBPE 4TWCA 4MQ1A 3DJ7A 4U45A 5AR4A 4ZLOA 2YITA 3OOMA 5KZIA 3L9LA 2OH4A 3DFAA 3KK8A 3U54A 3ETAA 2IW8A 4DHIB 1BLXA 1OMWA 3GNIB 1WFCA 4OT5A 3D9VA 2ITPA 4ZIMA 3DFCB 3PP1A 1G8SA 3QCXA 4FVQA 1U59A 4NFMA 2ZV2A 4FJVA 4ANBA 2VGOA 3MJ2A 3IQ7A 2VWXA 4L44A 4XH6A 4MXOA 5CZHA 2OKRA 2R3JA 5IA0A 2B52A 2QOFA 2OH0E 4G3FA 3CIKA 3PY3A 3QLGA 4RFZA 2PVYA 3G15A 3ZU7A 5CU6A 5E8SA 3TNWA 2IF8A 4QD6A 4EOIA 3GENA 4YSMA 4AWIA 2ONLA 2UUEA 2CCIA 1G8AA 4FK6A 3IG7A 4CGAA 1Q8YA 3OCTA 3HP5A 1Y57A 3MVLA 5HBHA 4C38A 1OM1A 1CSNA 2W4KA 3R1YA 4FSWA 4W4VA 3W0NA 4P4CA 4AT5A 2IVUA 4O1PA 3BHTA 2ZM4A 4S32A 3PE2A 3VRZA 4D1ZA 3V04A 3UP7A 5IZFA 4EOOA 5LMKA 1OL1A 2ZMDA 4QMUA 3PXYA 4MQ2A 3QTQA 4IHPA 4USFA 4HVSA 4UBAA 2C30A 5EYDA 3RK5A 5M4FA 5J9LA 2ETKA 1WMKA 5AV0A 1R78A 4W9WA 4XLIA 4KRCA 2OI4X 2YISA 2JFLA 4BZDA 4YMJA 3PFYA 4PY1A 3U9CA 1SVGA 5HI2A 4DFZE 4RZVA 4NU1A 3EQPA 4G17A 5C26A 4YZMA 4BWKA 3PVWA 5EQEA 2Y0AA 3M2WA 2BDJA 4U3YA 3T9IA 3GUBA 3HMNA 3Q9WA 1UKIA 3MH1A 4RA4A 1YWVA 4HGTA 2B9IA 4U6RA 4OTPA 2P0CA 5DOSA 1W2CA 5D11A 3JR1A 3BWFA 2WQOA 4EOQA 4QMSA 1H24A 2YCSA 1OKYA 4O4BB 1ZYDA 1UWJA 2GSFA 2C1AA 4RX8A 2H9VA 5LARA 2XCHA 1XMLA 3PZHA 3RHXA 2IWIA 4EOLA 1KSWA 3MVHA 3UOLA 2W4JA 3ID6C 2WMTA 3UIUA 3Q32A 4O2PA 4CZUA 3AMYA 3QRJA 1LEWA 4XRJA 4FKPA 4Z3VA 4WBBB 3FSKA 4QYHA 4X6RA 4EKLA 4A07A 3P9JA 4TYEA 3SKCA 2YLEA 3VS4A 4FTLA 4ACDA 3UP2A 3VBVA 2XK7A 4E4MA 4LGGA 4BDHA 3MPTA 1PYEA 4RIXA 3CSVA 3QTXA 4QQCA 2VWVA 2QD9A 2X81A 4GFOA 4ZTMA 1H00A 2PVRA 2UZLA 1YHVA 4UALA 3FKNA 5JZNA 2YIQA 2OICA 2C1BA 4QTDA 4D4RA 3LLAA 5KNJA 5JT2A 4QYYA 4O0RA 3QF9A 4L68A 4QRCA 2ZDUA 2BRMA 2UW3A 1FGIA 4ZMEA 2ITUA 2YIYA 3VBTA 5HVKA 1YQJA 2W5BA 3AKLA 3LVPA 4LUDA 4U3ZA 3QKLA 3VS2A 4BDGA 3H0ZA 3WILA 3FC2A 3KKVA 5B7VA 2HZIA 1G8KA 2XM9A 3NUUA 2FA2A 5DEWA 4FTIA 4WHZA 4C0TA 3Q2MA 1FOTA 1PXMA 4DFYA 3BHUA 3PVUA 4NM0A 3W2QA 3EFJA 2AUHA 3OCSA 2UW6A 2VZ6A 4GW8A 4NL0A 4IB3A 2PWLA 3MSSA 3VQUA 1PY5A 3ORKA 1MQBA 3R8PA 2R3KA 1KE5A 1QPDA 3FI4A 4PTEA 2DUVA 2CDZA 2H8HA 3ALNA 3U9NA 4N0SA 3P1AA 4AQCA 2ZJWA 3F7ZA 2UVZA 1XH5A 2XP2A 4QYEA 5TT7A 3HMPA 4KS7A 4ZY6A 3RM6A 4X0MA 3I4BA 3OS3A 4H36A 3BPRA 4ASZA 5BYYA 2IZUA 3QGYA 3R8ZA 2YABA 3EQFA 3ODZX 4YU2A 4O2ZA 2C0IA 5EM6A 4FKTA 1PF8A 5AADA 5FXSA 4XUFA 4YJRA 4BYIA 1RJBA 4ACGA 5GIOE 5FEEA 2W9FB 3VW6A 1R0PA 3G5DA 5ANKA 4APCA 1VEBA 4G2FA 4BICA 4EK8A 3NCGA 2KTYA 5H8BA 1H1RA 3EQDA 3WI6A 4DCAA 5HIEA 4UMQA 5JFSA 4OT6A 3F3UA 4KKEA 4R1YA 2WTVA 3UYTA 2OLCA 4GT3A 3TTIA 1DAWA 1OITA 3OXIA 2GTNA 4FIJA 3DPKA 4BCHA 3NS9A 5J87A 3W8LA 2O8YA 3M1SA 3Q5IA 3UDZA 4K0YA 3RPYA 1QCFA 4FV0A 5E1EA 3R7GA 2FUMA 2O0UA 3LQ5A 3EMGA 5BUEA 1VYZA 4DLJA 4K77A 3C0GA 2EB3A 3TV6A 4XNEA 4ZSJA 2QU5A 1PXJA 3QLFA 3Q9ZA 4RT7A 5D41A 5CI6A 4JAJA 5CS6A 2EXCX 3OWPA 5C1QB 4DDGA 2W1ZA 1QPJA 4YZCA 2CKQA 5IA5A 2VTLA 4BL1A 3FKLA 4FSTA 4OTRA 4U5JA 3RMFA 2Y6OA 4LUEA 4NFNA 3COIA 4OTDA 4NIFA 4USDA 3VO3A 5LCJA 2PY3A 4HGSA 3EB0A 3LKMA 4FEVA 3CKXA 1Q61A 4JDIA 5FP6A 4QTCA 4NKAA 3VF8A 3G33A 3GB2A 2QOOA 3VJNA 1H4LA 2OXXA 3F2NA 3F5GA 3F69A 3V5QA 4GYIA 4XG7A 4DBNA 4JG6A 1FBNA 2WFYA 2WEVA 2WMXA 4BI0A 2YWVA 3NIEA 5AIRA 3K2LA 4EYJA 2GQGA 3UC4A 1AGWA 1OVEA 2IZRA 5CASA 3CD3A 1PXNA 4F1OA 4BN1A 4F6WA 2V22A 4E8AA 3BWJA 4HW7A 3OP5A 3K5UA 2OJJA 4NM3A 2ZB0A 5FGKA 5LQFA 3ZM9A 3O71A 3ENHA 4AT3A 4FSUA 4EHEA 3ZLSA 3FSFA 4FIIA 3WZDA 2QOHA 5EI2A 3TKHA 4C3FA 4R3RA 5DRDA 3B2TA 4KSQA 2QHNA 4UN0C 5CENA 1W84A 3KU2A 4CFMA 3BBTB 4GSBA 3ULZA 2XK3A 4K1BA 3D5WA 4YJSA 4YBKA 4Z7GA 5IQBA 5I0BA 2QOLA 4AW5A 5IH5A 4IDTA 4UYNA 4OTGA 3F6XA 2XBAA 2IVVA 3I81A 2RFNA 5BVWA 2XZSA 1KV2A 4CFUA 5L6OA 2C4GA 4QMLA 2VWIA 2ZV8A 4MBJA 4M0YA 4UZDA 2X8DA 3TKIA 4AAAA 3ZLYA 4X2JA 4Z9LA 4E5BA 4JQ8A 2B9FA 4D55A 4YNOA 3AOXA 1REJA 4A4OA 3CGFA 2HXLA 2WZJA 3LAUA 5KE0A 5I9YA 4NW5A 5M57A 1KOBA 2FYSA 4V04A 4QOXA 1R39A 3QBNA 5EYKA 2PVNA 3G0EA 5E8TA 2UZOA 4HGLA 4WRGA 3HVCA 2GPHA 4IX5A 3AT2A 3BRBA 3MDYA 2X9FA 4FV8A 1M14A 3RKBA 4BDAA 4FMQA 2XK8A 3MIYA 5HBEA 3N51A 3V01A 4E4XA 2F7XE 2BR1A 3PJ8A 3QAME 3BIZA 3R63A 4N6YA 3UQCA 3PVBA 3KXXA 2B0QA 3IONA 2BPMA 2VTMA 3HV6A 3MY1A 4X3JA 3WF5A 3OT8A 3HAMA 5A9UA 4J71A 1XHAA 4IWPA 5M4UA 3TNPC 2H6DA 4FYNA 4WG4A 4AAYA 4I41A 3QRUA 3BEGA 3BYVA 3L8SA 1FQ1B 5HORA 3OXTA 3GCUA 3ZS5A 5L6PA 1WBSA 3ITZA 3ET7A 3EZVA 4L9IA 2RFSA 4JXFA 2F7ZE 3MVJA 4IC8A 2UW5A 1TQPA 2ZVAA 3PPZA 1F3MC 3G6HA 4ZY4A 1Y8GA 4FC0A 5J95A 5FP5A 4DG0E 2IJMA 5GZ8A 2PMOX 3DDPA 4G3DA 3IW8A 2C3IB 3R1QA 4BWXA 4PF4A 1Y6BA 2C6IA 2CCHA 4AGWA 4ZMFA 2PL0A 3GCVA 1YXVA 1YHWA 3N4VA 1OKVA 5F94A 5CTPA 5EW8A 1YWRA 2YM3A 4JOAA 3L9PA 4X2KA 4FL2A 4K9YA 5DE2A 3GFWA 4M15A 1W7HA 3JVRA 3QWKA 4XMOA 3DCVA 3VS5A 5BNJA 3D5XA 5CAVA 1ZRZA 4HZRA 2WTWA 5CXZA 4CG8A 4EORA 3GT8A 4UB7A 2QHMA 3I6WA 3P7CA 5IUHA 5EHYA 3ALOA 1SNUA 1BYGA 4QEBA 4TKSA 2ONLC 2WD1A 3LFCA 3UIBA 2G1TA 2P2HA 4C4FA 4DH3A 4L43A 3SDJA 2Y4PA 3QQLA 5AP3A 3VS7A 2XKCA 4EQCA 4UMTA 5CVGA 2YCQA 5CSVA 5IISA 3I7CA 5IU2A 2WU6A 1UWHA 3LCTA 4U41A 4AG8A 4G34A 1U46A 3M42A 3PY0A 4QYGA 5LMKC 2OGVA 3DKFA 3I79A 5F9EA 1VYWA 4A9SA 3LXNA 4KA3A 4FIGA 5EDPA 4D4YA 5EM8A 3RI1A 5J9ZA 3DDQA 4YGAA 2ZOQA 5A14A 5BMSA 5IDPA 3FY0A 4RWKA 4B8LA 3UO5A 3SOCA 3C4ZA 1ZYJA 2QOIA 3KEXA 3PUPA 5CVHA 4OGRA 2QCSA 3E8DA 3ZCLA 1WBWA 3DAEA 1FINA 5J7BA 2R7BA 3O7LD 2G2FA 4BHNA 4S2ZA 4F7SA 3ERKA 5KMNA 4FKGA 3QRTA 2IZSA 3PIZA 4L3LA 2NO3A 4NM5A 4U7ZA 4ZSGA 1BL7A 2X1NA 3PRIA 2Z7SA 3PXZA 1LEZA 2BDFA 3KFAA 4F4PA 5EQPA 1NVQA 1PKDA 3NNVA 2BFXA 3D7TA 5IUGA 4PPCA 4RWIA 5BYZA 5TE0A 3CJGA 3HECA 2V0DA 5CU4A 2CN8A 4BDFA 2VNWA 3ZO3A 5LWMA 2OZOA 4FYOA 4I6FA 5E8ZA 3C1XA 2HY0A 4LL5A 2HW6A 2ZYBA 5G1XA 4EOKA 3FQEA 3VUTA 2XBJA 3PXRA 3IGOA 1Y6AA 4LOOA 4I0TA 3JPVA 4MBIA 2XA4A 4J53A 3NUNA 4KBCA 4YJOA 4KIQA 3PPKA 1U54B 4F70A 5CALA 1PXIA 3COHA 2ITOA 2JKMA 4QP3A 2W7XA 4I22A 4BCMA 4L8MA 1KE8A 3VUDA 4ZTNA 4LMUA 4BYJA 4KRDA 4AGDA 1F0QA 3DKCA 3ORPA 5FXRA 5KMJA 3U6JA 2PYWA 4P5ZA 3ML1A 3TI1A 3THBA 2R3OA 5CEKA 3GQLA 2YDKA 2DQ7X 3U51A 4BTFA 2QO2A 4DFBA 4O4FA 3E8EA 4B7TA 3H10A 5AIKA 1WBNA 5CXHA 3WE8A 4C4EA 4EI4A 4FVRA 5E8WA 3D7ZA 4ZOGA 4ZTQA 5L3AA 4ZY5A 2RIOA 3LQ3A 1X8BA 1ZZLA 1XBCA 2PK9A 3NYXA 4FUYA 4IVCA 4UZHA 4D1SA 4U42A 1WBVA 5HBJA 3EN9A 4RX9A 3D0EA 1UU3A 2YIXA 2OZAA 5HE1A 5I9UA 2HZ0A 3MW1A 3PWYA 4OBQA 3TUCA 2YJRA 3HUCA 3ACJA 4L53A 4O0UA 4O0YA 5BMMA 2IPXA 2J5EA 2Y4IC 1JOWB 3P0MA 5HKMA 5LVNA 1UU8A 1XKKA 3H9RA 4FV9A 3UNZA 4B9DA 4ERWA 2J4ZA 4RIYA 2QOBA 4OUCA 2AQXA 3JY0A 4PTCA 4QMZA 3I5NA 1J7IA 5A4TA 3EFWA 1W2DA 4CCBA 4AXDA 5L2IA 5GJGA 4QMWA 5M08A 4BZNA 3ORNA 4RZWA 3IKAA 2XJ2A 3NYVA 4LGDA 5AR8A 3W32A 5I9WA 2I1MA 5ETAA 2P3GX 2WB8A 4OTFA 3QQKA 2BHHA 4AN9A 3PZEA 4AA0A 5BVOA 3I5ZA 2NRUA 3IECA 4IJ9A 3L1SA 4DHZA 3GXLA 4X21A 1ZMUA 4GFGA 2C5NA 2C0TA 2YHVA 3PIXA 3ZC6A 3BU3A 3SA0A 4PDPA 3P7AA 4PMTA 4LOPA 4LRKA 4V01A 5GJDA 4U97A 2ACXA 3T8OA 2VN9A 3DQWA 5EKOA 3PTGA 4DT8A 5K9IA 4M66A 2PVFA 3CY2A 4IFGA 1FGKA 4IEBA 3CQEA 4OTHA 4JS8A 5ETIA 2UZEA 4NTSA 4B0GA 2W1HA 4O0SA 5DVRA 5DT0A 5C01A 4EH3A 4XG9A 4BCQA 4TN6A 3RAIA 3R9DA 4M3QA 5J5TA 3NCZA 2XS0A 4J1RA 3VUIA 5IMEA 3QQHA 5HU3A 4A9YA 4FTJA 1M52A 4GV1A 4ONAA 3SXSA 4E5WA 4EK5A 5IEYA 1CTPE 2BZHB 3V5JA 3PA4A 4BDBA 3V5TA 4FKWA 4I6QA 3CP9A 4QMOA 3VWAA 4BF2A 3ORLA 3BE9A 4S30A 3EIDA 2YAKA 3CTJA 1PKGA 1W0XC 3HMIA 3NUSA 1J91A 3ZHPC 2XYNA 2B1PA 4GUEA 3BHHA 4D28A 4NYEA 1ZZ2A 5EOLA 3VF9A 2J0LA 3D83A 2E9UA 3AGMA 3C5UA 3FXWA 4YLKA 3BL7A 3UYSA 1IA9A 4I23A 4R7IA 4E93A 3SXRA 2ZM1A 4QMTA 2VTQA 3IDCA 3W0OA 2A2AA 4FIEA 5ACKA 4I4EA 5DR2A 3TMOA 4MKCA 3LLTA 1H07A 5JEBA 1REKA 4PRJA 4CRSA 3NMUF 4ANSA 1XO2B 5IQEA 2GS2A 2VNYA 2PVLA 1H1WA 3FXZA 4FIHA 4I24A 4IACA 3U4UA 1J3HA 3UVPA 5AA8A 2FB8A 1APME 1SMHA 4XG3A 2QLUA 3QQGA 4MTAA 4V0GA 3HDMA 4O7WA 3AC2A 3OD6X 4M0ZA 4W8DA 3D15A 5CF5A 4FL1A 3D4QA 3RAKA 2F9GA 4F99A 3OF0A 2P2IA 1U54A 3NNXA 3SAYA 4RIWA 3G6GA 2X2KA 3B8QA 5HEZA 3ZLWA 4EL9A 3NEWA 4D2PA 3PJ1A 1XBAA 1Y91A 4LMNA 5IQAA 1TFFA 5EM5A 4NTTA 2PUUA 1Q62A 3V3VA 5DIAA 5AAFA 4GK4A 5D7VA 4O7VA 1MRVA 5J8IA 4RIXB 2NPQA 3ROYA 5JKGA 2VO0A 4FOCA 3UPXA 2IG7A 4NT4A 1Z57A 3P7BA 2F2UA 4F7LA 4WG3A 1JQHA 2VTIA 5ANIA 4YTHA 5EQYA 5L8JA 4WA9A 4MX9A 2XNGA 5L2QA 3GC0A 2WMRA 2A19B 2WIHA 3LJ2A 4N4SA 3ZEPA 5IA4A 2SRCA 4N70A 3ZXZA 2PMIA 3L9NA 3O8PA 4PNKA 2GHGA 2G01A 3VN9A 1YDRE 2QO9A 4MF1A 3GU6A 5IUIA 4FTKA 3HZTA 2J2IB 4UYAA 5DA3A 2BDWA 5LCKA 1KUTA 5I5ZA 3R2BA 3QD2B 3OCGA 4QNYA 2OSCA 3BGPA 2PVMA 3HYHA 5FXQA 4QO9A 4BCOA 4IAZA 2WOTA 2OO8X 3HKOA 5K0KA 1W98A 4R77A 2GFCA 1FMOE 2J50A 5HNBA