4NM7A

Crystal structure of gsk-3/axin complex bound to phosphorylated wnt receptor lrp6 e-motif
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
360
structure length
355
Chain Sequence
SMKVSRDSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords GSK3B protein
publication title Structural basis of GSK-3 inhibition by N-terminal phosphorylation and by the Wnt receptor LRP6.
pubmed rcsb
source organism Homo sapiens
total genus 104
structure length 355
sequence length 360
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nm7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nm7A01
3QFVA 5CT7A 3VF8A 4YC3A 3E8DA 5JZNA 3KRXA 4K11A 5CAUA 2ACXA 5HCYA 4UMTA 5JGAA 1YHWA 4XV3A 4GMYA 3K3IA 5AP1A 4ZOGA 4CKJA 3R0TA 5EH0A 4J7BA 3HNGA 2CPKE 4YNEA 2ZDUA 5I9XA 4LM5A 2E9UA 2BRBA 4HVSA 4DFLA 4OAUC 1GNGA 2BZHB 4D2PA 4IJ9A 5EM5A 3Q6WA 4DTKA 3EH9A 2QG5A 4YGAA 5AUVA 1JBPE 4I0TA 4E73A 2XJ1A 4NWMA 3UMXA 3VHEA 5LVOA 3ERKA 4N6ZA 3R7VA 2AC3A 1DI9A 1H1RA 3KXZA 1UVRA 4R3RA 4DEAA 4GFMA 3PXYA 4EEVA 3LIJA 2GFCA 5DEWA 4KINA 4RWJA 2YCFA 4DEIA 4IVBA 3IDBA 4DH8A 4IM2A 3CQEA 3CKXA 5C8KA 2O64A 4C61A 1V1KA 2UW5A 2XKFA 3BU6A 3VRYA 3ORLA 4GUEA 3DBFA 3R1YA 5M53A 3NVKI 1P4OA 2PY3A 2W7XA 4EYMA 3NS9A 5KKRB 5T68A 4CXAA 2Q83A 1OL6A 1DI8A 2O65A 4FTNA 4R7HA 3NGAA 5DHJA 5KZIA 3WYYA 5BUEA 3P23A 3UZRA 2XNBA 5E92A 5JRQA 3CQWA 3LAUA 2XVDA 4TKSA 2XNMA 3UVPA 4H1JA 5HBJA 4Q5HA 5CU4A 4DEEA 5FBOA 3SW4A 1J91A 5IMXA 1YDRE 4K77A 3EL8A 4RLLA 1ZYCA 1DAYA 2XF0A 2Z02A 4FX3A 1H00A 1OKZA 3RALA 2B1PA 2JFMA 3HX4A 4OT5A 2B9IA 3DK6A 3Q5ZA 4FNZA 3PP0A 3PPKA 5IG1A 2XMYA 5FGKA 3TEIA 1Q97A 3FHIA 4QTCA 2HENA 5K3YA 2J0IA 3LKMA 5EQEA 1SZMA 3NX8A 4QOXA 4I5HA 4ACCA 3HEGA 3AC8A 4RVKA 2A0CX 3HL7A 3HUCA 2H6DA 4X3JA 3TKHA 5KMMA 3HAMA 4TW9A 3A4OX 2WMAA 1ZZLA 3ZXTA 4JG6A 1IG1A 4CCUA 1YI4A 2ZB0A 3E5AA 3OTVA 5K0KA 4F65A 1RDQE 2C6TA 1L3RE 1ZYLA 2PVNA 4BTJA 2YM4A 3NPCA 4U43A 4EHEA 5B7VA 2HXLA 2BRMA 2OJ9A 1K2PA 4FZ6A 3HAVA 3IQ7A 2VTNA 3C51A 2VU3A 3MSSA 4C3RA 5M4FA 2FGIA 2JKMA 4M0YA 1YHVA 2R3OA 1Q4LA 3GCVA 3MFRA 1ZYDA 3ITZA 2ZAZA 4MXAA 5EYMA 5KE0A 3F82A 3FZSA 2ZJWA 5AM6A 4USEA 2R3MA 4JBPA 1FVRA 3E87A 3WZDA 2VWVA 5IKWA 4IX5A 4V04A 4YBJA 2E9PA 3U55A 3N9XA 4N0SA 2R3KA 5CY3A 3V5QA 2OJFE 2VRXA 4HOKA 4O84A 5AUUA 5A14A 5HG5A 3QHRA 3H0ZA 3QQLA 5M4CA 4DGOA 4A9YA 4I0SA 4KIKB 5IUIA 3MA6A 2HW7A 5M55A 4HPTE 2A4LA 5GJDA 3EOCA 2IW8A 5LWMA 1HOWA 1FBNA 3MH0A 2QLQA 5J9LA 2PK9A 3HMMA 3LFFA 4TWOA 3BLQA 3FLZA 3HKOA 3P7BA 4E8AA 2XIYA 3MGYA 4W4XA 4BI2A 4ALUA 2GU8A 4ORKA 3GU4A 3VUKA 5A4LA 1OIYA 5CALA 2F9GA 2X8EA 2XK6A 1M7NA 4BL1A 5K4IA 4X3FB 2YM5A 5CQWA 5AEPA 4D5KA 2J0KA 4MBLA 5JKGA 3BYVA 5J8IA 4X2FA 2YCQA 5L8LA 2GS6A 3OBJA 3DXPA 4KABA 3DCVA 3RZFA 4LOQA 4F9CA 4X7QA 4FKUA 3BI6A 5K4JA 2PE2A 4QQ5A 4PL3A 4FV2A 5EKNA 4ERWA 4I6FA 5LMKA 4J71A 3EQGA 2ZV2A 4EK5A 1ATPE 4HJOA 4YLKA 4FICA 2WQBA 2EXMA 5DYJA 2JC6A 4AX8A 4LOOA 3CJFA 4J53A 2G15A 4ZSGA 4RC2A 3EKNA 4RWLA 2IVSA 3QU0A 1PKGA 1XBBA 5ANKA 3HA6A 2F2UA 4BDDA 2ZMDA 2Z7QA 5D7AA 4U97A 1PMNA 4RIWB 5AIKA 3PVBA 3UOJA 1H0VA 2FSMX 4JX3A 4IB5A 4IJPA 4MBIA 4FTJA 4EHZA 2X0GA 3UIMA 2QO7A 2XP2A 3E7OA 3O0GA 4H05A 2AYPA 3GXLA 2GHMA 1H4LA 3KMWA 3NW6A 3TXOA 4ZTMA 2WMBA 3GU5A 3NYNA 1BI8A 4YJPA 5HESA 4CLIA 4PDOA 5I9UA 5C9CA 3D9VA 4ZTSA 4YZCA 3ZO1A 2W4OA 4NFNA 1UKHA 4IZ7A 4YJOA 4GJ2A 5TT7A 3ZO4A 3DJ5A 4D9TA 4DEGA 4E5WA 4FT3A 4XBUA 5L2QA 3SDJA 3DDQA 3VAPA 3C1XA 2W5HA 1KV1A 1SYKA 3E88A 3PXKA 4F4PA 1XR1A 3NLBA 3UJGA 5LXMA 2ZM1A 3FKNA 1IEPA 3BU5A 4BGHA 3UG2A 1SVEA 2QKWB 2VD5A 4NU1A 3MS9A 3UIBA 4JI9A 4XV1A 3TJCA 4AZEA 2P33A 4JBOA 2BAQA 4FSMA 2CGUA 4MF0A 4BWPA 4EK8A 3DTCA 5KCVA 4O91A 1W98A 5HKMA 4O81A 4U44A 3WILA 3G33A 4NFMA 3RPOA 4GFGA 1HCLA 4IMYA 4F64A 4X3FA 2UZTA 1J7LA 3W2OA 3N4UA 1WAKA 1FMOE 2UW8A 2WIPA 3LW0A 4XOYA 4F7LA 3NNUA 4BCHA 5BYLA 3TTIA 1LPUA 3ZONA 3Q9YA 4Y83A 3SW7A 1UWJA 3QUDA 4FIEA 5JFSA 4AN9A 3U8WA 4C02A 4D58A 5DE2A 5M57A 3MB6A 3ZBFA 5IA3A 3L8SA 3QD0A 2CN8A 2UW4A 2XA4A 4FNWA 4QRCA 1GZOA 4MTAA 1Z9XA 1CSNA 2XM8A 1YI6A 3BWJA 2RG5A 2WTIA 2WU6A 3LQ5A 3IDCA 1IA8A 4QMOA 5IQBA 2PVMA 3P5KA 2X2MA 4EH8A 1H1QA 2Y4IC 4WUAA 3V3VA 5L2IA 5HQ0A 4C4FA 3N51A 4YZNA 2VTLA 3D2KA 4UV0A 4C33A 3EQPA 4QNYA 2QU5A 3F5PA 2C6IA 4I20A 2XUUA 3PIYA 4ZY6A 3VBXA 2YDIA 4EUTA 1CTPE 3IW6A 1RQQA 1BL6A 4RIWA 3VS5A 4BI1A 4Z9LA 1XO2B 5J79A 3BHTA 4C4HA 3BLRA 3BE9A 3TNWA 4RFZA 4U42A 5AUXA 5EQYA 4OW8A 4GIIA 3S3IA 4BWKA 4I94A 2XK4A 3U6HA 4FKIA 3RPSA 2HXQA 3K5UA 3GT8A 4AZTA 4R78A 4YO6A 4L53A 2C6OA 2VV9A 5KX8A 1TQMA 5HEZA 5KUPA 3L9MA 4FYNA 3W2CA 2XJ2A 4TWCA 3W10A 4BTFA 5HU3A 1KV2A 3PRIA 4BYIA 2PL0A 4O22A 2IVVA 2IW9A 5I4NA 2HYYA 4DITA 3OTUA 2C3IB 3EQHA 2YZAA 5AAEA 4FT5A 2ZVAA 3UNKA 3GEQA 2Q0NA 4GSBA 3A2CA 2PMNX 4WG5A 5HG9A 4GUBA 4PTCA 3MTLA 5CEIA 5HNBA 4G34A 5E7RA 1VEBA 2PMOX 4NH1A 2CDZA 3H9RA 4NSTA 5CQUA 4WD5A 5CSVA 3TIYA 4O7LA 4FZAB 2PHKA 4QYFA 4TN6A 2GTMA 3ENMA 2GQSA 4G17A 1M2QA 4KB8A 4CLJA 4G5JA 4XG7A 4USDA 3KN6A 4FV0A 3NYOA 4YJRA 2VWWA 3BHYA 3Q96A 4NM3A 4FG7A 4ARKA 5EM8A 4M66A 4AW5A 1V0OA 4MWHA 3NVMB 1LEWA 3MH1A 2QONA 4OBOA 5AV1A 1W83A 5IQEA 1WBOA 3VBVA 4GG7A 4D1ZA 3VRZA 4B4LA 1O6YA 1ZWSA 2QKRA 1W82A 2BZJA 2W06A 3QWKA 4I92A 3DK7A 3ENHA 3EZVA 4LQMA 3VJOA 4ONAA 3GC7A 4PWNA 5E8VA 3W2SA 2VWIA 4AZWA 4QP3A 3GU6A 2P0CA 5KMLA 1NA7A 2CHLA 3POZA 4IACA 3HV6A 4K1BA 1SMHA 2Y0AA 4LI5A 4U40A 3OT3A 2W17A 4ZTRA 4AZVA 2XB7A 4RX9A 2C0TA 1H0WA 3EQFA 4FVRA 4KS7A 1MRUA 5AUYA 5IDPA 1UU3A 5K5XA 4Q2AA 2BZIB 2J0JA 4ANQA 4M13A 2ETKA 5FUTA 4EH3A 4YZMA 2QC6A 2YM8A 1XQZA 2JD5A 3AD4A 4NW5A 2WTKB 4K18A 2X6EA 4D1SA 4IWDA 4EOJA 3D7ZA 4LUEA 3NW5A 2G2FA 2YCRA 5HBEA 4D0WA 4FYOA 2WO6A 3MIYA 3LFDA 1KE8A 1KE7A 2PWLA 2R3LA 3HECA 3V51A 4A9UA 4CVAA 4O1OA 3L8PA 2PVYA 3OW3A 3MY0A 3OROA 4O1PA 3WF7A 1QPCA 4Z55A 4OAVB 3MV5A 3QYWA 4QYEA 1BUHA 3ROCA 4EH5A 1JOWB 3ZRLA 2VGOA 4YLJA 3HGKA 2HELA 4G3GA 2XIRA 3PJ2A 4G16A 3LFSA 4PNIA 5DI1A 2YM6A 3BLHA 1UU9A 3TZ8A 3QLFA 4IB0A 5CF8A 5HLPA 4O83A 1TKIA 2ERKA 2CJMA 5IA5A 2PPQA 2WQEA 3SOCA 4ALVA 2JLDA 4IQ6A 3AC2A 4JNWA 3RINA 4LRKA 5TO8A 1R0PA 4JAJA 4UXLA 4QP1A 2X2LA 4X6RA 3MFUA 3LCSA 4XG8A 5DBXA 4EHVA 2B54A 3QL8A 4ASDA 4JVGA 1PMVA 4ZY5A 5E9EA 4IX6A 5M56A 2Z7SA 4BDIA 2C3KA 3COIA 4L52A 4GL9A 2QOOA 4Z7GA 5EYKA 1U54B 3CY2A 4EC8A 4C4IA 3GFEA 3M42A 4RIXA 4CT1A 4GVJA 2ITPA 2IVUA 4BCMA 2QI8A 1P14A 3MPMA 5CVFA 3V5PA 5LVMA 2X8DA 5AUZA 3MYGA 3VS6A 2C0OA 4UB7A 4ANLA 4IFCA 4EK4A 4EOOA 2VTIA 3P7CA 4HNIA 1OI9A 5JRSA 4J1RA 3I7BA 5T3QA 4BYJA 4FV9A 1YXXA 4XG4A 2JIUA 2WTDA 2X9EA 3BHHA 4TRLA 4YJSA 5LMBA 4EQCA 4KIOA 5LVLA 4ITHA 3R7IA 1JSTA 2BRNA 4MX9A 5FEQA 3UVRA 3R9RA 4AN2A 4E5AX 3UQGA 2QD9A 3BELA 2GQRA 2OBJA 3DQWA 5D11A 4LL0A 4FT0A 1JAMA 4EORA 4EUUA 3DBQA 5HORA 3TV6A 4E4MA 3WI6A 1M52A 3L8VA 3OS3A 4IC8A 4MXXA 2WMVA 4FV7A 4NK9A 5FBNC 2YEXA 4HYUA 4D4YA 2R3HA 4XLIA 3D0EA 1H8FA 4D0XA 4ANNA 3R02A 1ZY4A 4I4FA 1JKTA 2BILB 4UWCA 5TKDA 3WZJA 1AQ1A 4AOIA 4QMQA 2OKRA 3PG3A 2Z7LA 1BL7A 5A4CA 1F0QA 4DH3A 4OTPA 1PMUA 3PVUA 2EB3A 3O7LB 3DY7A 3OP5A 3OMVA 4KKGA 4TXCA 4TYJA 1IA9A 2WTWA 3UZPA 4AA0A 4C3FA 4FVPA 4NJDA 4YZBA 4E20A 5J5SA 5GHVA 3TUDA 2XK3A 4YHFA 3WYXA 1Q5KA 5F95A 4ZJIA 5K5NA 4CSVA 5M44A 3GCQA 3T9TA 2QHMA 3CPBA 3H9FA 5EI2A 4I5CA 5A46A 3KGAA 2QNJA 3KRWA 2OFVA 3KXNA 3M1SA 4QMSA 1OIQA 3PPZA 1QL6A 2JDTA 2P55A 3FZ1A 4MXCA 4QMUA 2YIWA 3EL7A 5B2MA 3WF6A 2X8IA 4FKLA 3DKCA 4L9IA 2YLEA 4M69B 3I0QA 4YJNA 4AU8A 3PVWA 4F0GA 3DJ7A 4JDIA 4RG0A 3VBWA 2OG8A 4DGLC 2RF9A 3DFCB 3GFWA 5TR6A 4M3QA 3QTZA 1P2AA 4JDKA 3FLSA 5E8XA 4QQTA 4HYSA 5GIPE 3R9HA 1GZ8A 2VX1A 3DV3A 3K54A 5AUWA 5BMMA 3ZH8A 1LEZA 4YSJA 2CSNA 5HIBA 2QOIA 3Q4TA 4RSSA 4R6VA 3R2YA 4RQVA 4FGRA 4UWBA 5IMEA 2VO7A 1FVVA 5HX8A 1PYEA 1Q3WA 3R71A 5ANEA 2RFDA 5BPYA 3P4KA 3OUKA 1BI7A 4RVTA 5ITAA 2G9XA 4KIQA 4FNYA 4WSYA 4X2KA 3F2AA 5G6VA 5A3XA 3VUDA 5JGDA 1YOMA 1JSUA 1NXKA 3V5LA 4F0IA 2CKQA 5EQPA 1FOTA 4X0MA 3VC4A 4E6CA 2Y4PA 4IDVA 5JT2A 2BFXA 3OOGA 1VZOA 3BYSA 3A8XA 3EB0A 4PMSA 5DEYA 5E1SA 4IW0A 3UODA 5M4UA 1V0PA 3F5XA 2X7FA 4X2NA 1XH7A 3RWPA 4A4LA 3PDTA 5DWRA 4P5QA 4EOMA 2JKOA 4HGSA 1CKJA 5BVNA 3F2RA 2HIWA 3E62A 4BVUA 4IIRA 4CG9A 5M06A 3O71A 3Q32A 4OT6A 2OZAB 4RA4A 3KVXA 4DLIA 3LFQA 4KBAA 5DLSA 4F9WA 3UPXA 2XEZA 2FYSA 1YOLA 3AXWA 1XH6A 4JQEA 1ZARA 3R8PA 2UZNA 3LJ1A 3ODYX 5FTOA 4GK3A 3FY0A 3R83A 4GS6A 3EN6A 4EQUA 4R5SA 3FL5A 5K0XA 2HWPA 3VBTA 3TKIA 3FSKA 4LG4A 4U7ZA 4AOJA 2YDJA 3E7VA 3FUPA 4S32A 4OTIA 1PRYA 3PA3A 4ZMEA 3PPJA 4D4VA 4FNXA 5GZ8A 2WFYA 3VVHA 3A7JA 2HZIA 5DH3A 2ITYA 5H8EA 3AT3A 5DT4A 3W18A 1APME 1H07A 3KL8A 3PXZA 4O0TA 2E9NA 4QPMA 4Q9SA 3REPA 3VUIA 3BQCA 4M69A 5HD7A 5CXZA 3CJGA 3QBNA 1UNLA 3SG9A 3KMMA 2QOQA 2F2CB 1ZLTA 4GT5A 1VYZA 5CWZA 4BDAA 4E5BA 4UZHA 4RJ6A 3TG1A 4OUCA 2WMRA 4I23A 3R7GA 4IX3A 4LOPA 4R7IA 4KAOA 5F4NA 3D5WA 4YTFA 3EQRA 3R21A 1VYWA 2X81A 2BMCA 4CTBA 4NCTA 4M67A 3ROYA 4JXFA 5IA1A 1WBNA 5C1QB 3DA6A 4G3FA 2WMWA 4YHJA 4TNDA 3R8MA 5I9ZA 2YISA 4BDFA 3NYXA 3O8TA 4IAKA 3SKCA 4CQGA 1J7UA 4KKEA 1FMKA 4R8QA 1CKPA 5HVYA 4L8MA 5CVGA 3MI9A 5ACKA 3W32A 1ZOEA 3NUYA 4AA5A 5IUGA 3QX4A 5D41A 3NUUA 4JR3A 5C26A 2W0JA 2PUPA 3DOGA 3Q52A 4RC3A 2XIKA 1Q3DA 2QO2A 1YWNA 4M14A 3KKVA 3F3TA 3KMUA 3CLYA 5AP0A 4YJVA 4EH2A 3FE3A 3OC1A 4OTDA 4H39A 5EI6A 3N4TA 3MVLA 2IO6A 2XM9A 4RX7A 4U80A 2IZSA 3H0YA 3PJ3A 3WE4A 4ANSA 4HZSA 4GIHA 1FGKA 3L9PA 5JN2A 3PY1A 4XG3A 4IANA 4KA3A 1PXOA 1Y6BA 2XK8A 1Q8WA 2PZPA 5AP7A 3ZDIA 2IVTA 4QP2A 4UYNA 2OZAA 3NNXA 3ZCLA 4EZ3A 4DE4A 3RK9A 4D28A 4F9AA 4K33A 3ZM9A 1Y6AA 5EW8A 4CFNA 3R28A 4KWPA 4S2ZA 4BFMA 5AJQA 5JFVA 5CS6A 5EOLA 4ZZMA 2NNWB 4AN3A 4XRJA 4I6QA 3EYHA 4FTQA 4EI4A 5KMKA 4R7BA 4Y8DA 1JVPP 3WF8A 4XH6A 3DPKA 2W1EA 3A61A 3UO6A 2YAKA 3NAXA 4PPCA 5H8BA 4TYGA 4FT7A 5D1JA 1ERKA 1PYXA 5IEVA 5IQGA 3LOKA 4FIJA 3DK3A 5CXHA 2WTVA 5J7BA 5IH4A 3HP2A 3RWQA 1OUKA 5M07A 3Q4ZA 3RHXA 4JRVA 4AACA 5HICA 2Y6OA 3OEFX 4P90A 2QOCA 1XHAA 2P4IA 4U81A 4OTQA 4O7NA 3F5UA 5AP2A 4UZDA 1KWPA 2FSOX 5CI7A 4ASXA 3QUEA 3JR1A 4EOIA 1CKIA 4FSRA 4AW2A 4BGGA 3BIZA 4FTAA 4CMUA 3VBQA 3SG8A 3CD3A 4TYHB 2W1DA 3U4UA 4O7TA 3QA0A 4A06A 4AWIA 4DGGA 1G8SA 3A7FA 3B2WA 4OTHA 2C5YA 2PMIA 3PP1A 3EJ1A 3R8ZA 3UC3A 2Y6MA 2VTPA 2YWPA 3DKGA 3E64A 4M12A 4U3ZA 2ZM4A 4I0RA 5L2WA 3C4ZA 2WU7A 3ACJA 3BKBA 3MA3A 4MXOA 4E6AA 3LPBA 2GNIA 4DT8A 2FVDA 3UE4A 4WNMA 1XBAA 1OB3A 3DZOA 4IVDA 2QLUA 2XNOA 2NPQA 4JG7A 4MCVA 2G01A 3LFCA 5CNNA 2J5FA 3KK9A 3W1FA 4BB4A 4F63A 2XK9A 4ZAUA 3FMNA 1YKRA 3PTGA 3R9OA 4R3CA 5EM6A 3WF5A 3DXNA 3FXZA 3PFQA 3RCDA 4ANMA 5HD4A 4G9CA 2C6LA 2VNWA 5LMAA 2EUFB 3BYOA 4XS2A 3W2QA 3T3VA 2Y4IB 4YURA 3S1HA 2NO3A 2HW6A 3OW4A 3QQJA 1OL2A 4MXZA 3FEGA 1J1BA 1T45A 2XIZA 3QCYA 4O7VA 3KRLA 3QKLA 4FKJA 4RPVA 3EFJA 4X6QC 3FQSA 3BHUA 3TJDA 4AZFA 4C2VA 4FKRA 5E8WA 1NVRA 4MH7A 4U5JA 2GS2A 3B8RA 3C0IA 5D7VA 5AR8A 5KMJA 2WIHA 3QA8A 4Y73A 3VUTA 4AGDA 3KCFA 2DUVA 2WEVA 3FMMA 3QTXA 3GUBA 4FTTA 3KY2A 4RZWA 2I0EA 4O0YA 4WOVA 4A9SA 1HCKA 4L46A 1JLUE 5JMSA 2W99B 3I6UA 3BRBA 2VN9A 4AW1A 5CSPA 3VS1A 4RGJA 5DNRA 4C35A 2V22A 3MVMA 1TVOA 4EBWA 2I7QA 5B2LA 1BKXA 3FV8A 4F0FA 2CNUA 3NDMA 3S4QA 3QRUA 5L2SA 4UBAA 4Y72A 1TQIA 3W55A 4BHZA 4GK2A 4FE2A 2W1IA 3CPCA 2CLXA 2VX0A 3DKOA 4IM0A 2C1BA 1OPKA 4YHTA 2G1TA 2UW6A 5HHWA 4G31A 3AC3A 4ASZA 4XJ0A 3RM6A 4TYHA 1OMWA 3FPQA 2J90A 2ETRA 3IW5A 2OIBA 3LXPA 4D4SA 2Y7JA 3N4VA 4E4XA 2QQ7A 1KOBA 2BDWA 4PDYA 4W8EA 4ZMFA 4DG3E 3QTSA 2BROA 3ZLYA 3QRJA 4PPAA 3OCSA 3ZYAA 4KBKA 4K2RA 4HVHA 2PZYA 4PV0A 3SXFA 4ACMA 2R3NA 3VN9A 4NTSA 5JSMA 3SC1A 4CZUA 4EHGA 2JFLA 3TZ7A 3M2WA 3GVUA 4DEHA 5J5TA 4WUNA 1DM2A 1PF8A 3AGLA 4MVFA 4DHFA 2UVYA 3E8NA 3JPVA 4RJ3A 3ORTA 3OHTA 3OF0A 3CGOA 4DFZE 3PY0A 5AUTA 4ZS4A 4W4WA 3COKA 2ZM3A 4L44A 4E1ZA 4F6WA 1CMKE 1YRPA 3TNHA 3DAEA 1UV5A 4C57A 4CQEA 2FUMA 3QALE 4IE9A 1LUFA 3LMGA 3O96A 3GCSA 3QAME 4FI1A 3ULIA 4BCKA 3R7UA 2X6DA 4E4NA 2BUJA 2PE1A 1RJBA 3CP9A 3MY1A 4JDJA 4WHZA 3HV4A 5GIOE 4L43A 5AR3A 3HDMA 4BN1A 2VTJA 4EOQA 4FKWA 2PULA 3CTJA 5JFXA 4QMLA 2FB8A 4QMPA 2QOLA 2ONLC 3LM0A 2PMLX 3NEWA 1YWVA 4ZZOA 4IH8A 1IR3A 4EKLA 2YITA 2OH4A 1RE8A 3NIZA 4K8AA 2Z2WA 1QCFA 1Q24A 1JPAA 5IQFA 1GZKA 4ZTQA 4TNBA 1MQ4A 5J7HA 4TYIA 4JX7A 2YZLA 4M8TA 5CENA 2O3PA 2VO3A 3D7TB 4FL1A 4IHPA 3PSCA 3ZZWA 2BDFA 3VJNA 3ZTXA 2XBAA 4CFWA 5AA9A 4NT4A 4G2FA 3EFWA 4YJTA 4NZWB 4ITJA 4BCFA 5HLNA 5LQFA 4AUAA 5C4KA 1Y8YA 4TZRA 1L8TA 4YO4A 4F1OA 2XKEA 5HO7A 2R7BA 3FL4A 3WIKA 2FH9A 4ACDA 1BLXA 4P7EA 4I22A 4U8ZA 3MJ2A 5CEMA 4E7WA 1PXJA 1OKYA 4J96A 3EFKA 3FZRA 3GQLA 2R2PA 4J8MA 1E1VA 3V04A 4F99A 1OKWA 4E26A 3SXRA 3RVGA 1OL5A 4CFFA 2BAJA 3S2PA 4F1TA 4BIBA 3AG9A 5D9HA 5EW3A 5CEPA 2GNGA 4ZTLA 3EYGA 3D94A 4YPSA 5AAGA 3I5NA 2H34A 3KCKA 3RAWA 1U4DA 2QOFA 1YXTA 4EK3A 5EM7A 3ZSHA 5A4TA 3DNEA 2W4JA 3DU8A 2VTTA 4MQ2A 3WZKA 4FV5A 2A2AA 2R64A 2EB2A 3NCGA 1O9UA 2X39A 3ORPA 4EWQA 3F6XA 3KXGA 4BCOA 3QGWA 4UN0C 4RMZA 4R1YA 1U59A 2X7OA 1H28A 4CZTA 4MKCA 2ITXA 3F88A 3W16A 2B7AA 3VWAA 4AQCA 4C58A 2WB8A 2IZTA 2J7TA 3FBVA 4HCTA 1OKVA 2GMXA 3FLWA 5BVFA 5FXSA 4FK6A 4DBXA 4DINA 5DRDA 5CI6A 4DTAA 2YM7A 2VTOA 4FKVA 4FZDB 2GFSA 4CKRA 3I0OA 3K2LA 1H08A 3PVGA 2XNNA 3UOKA 4DA5A 2VZ6A 2RKUA 3W8QA 3EZRA 4CFMA 3LQ3A 2PUUA 3FLNC 3KXHA 2YERA 1YDSE 2E9OA 3QF9A 3QUPA 4TWNA 5LMKC 4ZY4A 2W5BA 4S30A 3EMGA 4QQJA 3C4FA 3DGKA 2CKEA 3D7TA 4LV8A 1YVJA 3DFAA 5CF5A 2PU8A 3UQCA 3OEZA 4XEYA 4H3BA 4IB1A 4QPAA 4ZSEA 3FI8A 3HVCA 5T6KA 4EYJA 5AP4A 2BIKB 2YHVA 4GU6A 4D5HA 4MHAA 3LMIA 3JYAA 1W84A 3P0MA 4LV5A 3MPAA 4I1ZA 4U9AA 5JH6A 3CD8A 4USFA 3F3WA 3FQHA 4JRNA 5FRIA 3WOWA 4KS8A 5BYYA 2QO9A 3Q4UA 3QTUA 4L3PA 3IG7A 2CKPA 4Y5QA 4IWPA 1AGWA 3PIZA 2KTYA 2CKOA 3RPVA 3UYTA 5JFWA 4XV2A 5CSHA 2XYUA 5IU2A 5DVRA 2ITQA 2JDVA 1NW1A 2G2HA 1ZOGA 2J9MA 4GVAA 4YTHA 2XEYA 3BX5A 4IVAA 3RBWA 5IZFA 3C13A 1ND4A 5CZIA 5HVJA 5CVHA 1FQ1B 4FV8A 2WTCA 2I0YA 4JR7A 4H3QA 4PF4A 4ZS0A 4ZSLA 1KSWA 3FQEA 2PZRA 2JIVA 4NM0A 3B2TA 4I6HA 4I5MA 4CNHA 1ZYJA 3P08A 4GG5A 3G0FA 3CR0A 1ZMVA 4EL9A 3O8PA 3EQBA 3ZHPC 5JK3A 3COHA 2UZWE 2V55A 4HGEA 3TACA 3D14A 4MWIA 4BF2A 1URWA 5TF9A 2PUIA 4RIXB 3NWWA 3SHEA 3TI1A 4RFMA 5IDNA 1R3CA 2BRHA 2C3JA 4MYGA 3RK7A 4E6QA 2X4FA 5A9UA 3D83A 3G5DA 3D5XA 2CN5A 3ZO3A 4PDPA 2YM3A 1J1CA 5H9BA 3FPMA 2I1MA 4IAYA 5E8ZA 3D15A 4EQMA 3O50A 1Q61A 4O82A 5DT3A 3L8XA 2W05A 3FC1X 4DGNA 3U6JA 5DRBA 2ZDTA 4X21A 5CU2A 4FSNA 1VR2A 2OO8X 4B7TA 4IC7A 3UZTA 3P79A 5DMZA 3QQUA 2OJGA 3OG7A 2OJJA 4PP9A 4HYHA 4KIPA 1XH8A 3TM0A 5BX0A 4KSPA 4GFOA 1O6LA 1FPUA 3IW7A 3PE1A 4P4CA 3ZM4A 3QXPA 5CSXA 4PNKA 1J7IA 2QG7A 2YA9A 2GHGA 2BCJA 2W4KA 4FEXA 4O2PA 4EH9A 2W1GA 2WZJA 4G3CA 1P5EA 1NY3A 3JUHA 5J95A 3RM7A 2V62A 3VBYA 1H1WA 3ATTA 1JKKA 4A9RA 3V5WA 2OXDA 4H36A 4DFUA 4I4EA 4KRCA 3HUBA 4Z7HA 4DCAA 1XH4A 2VTMA 4JAIA 3NYVA 3OVVA 4ZP5A 2BIYA 4GKIA 4CCBA 4O7RA 3ZEPA 4LGGA 1A9UA 2ZMCA 5CTPA 3NNVA 3PLAE 5AIRA 2C6MA 4GYGA 2W9FB 2WQMA 2SRCA 1EH4A 4JDHA 4U41A 3CBLA 3R63A 3KK8A 4L42A 4FC0A 3VS4A 1Z57A 4HNFA 1H1SA 4EONA 3P78A 2PVLA 3A60A 4TYEA 3THBA 3NMUF 3PLSA 4WSQA 2J2IB 2YABA 3BCEA 4CFUA 3FKLA 1UKIA 3KRRA 5A4EA 4QQCA 2J50A 3H4JA 1B39A 5IEYA 4AT3A 3LE6A 5L2TA 5C8NA 1IASA 4PRJA 4ZTHA 5CAOA 4FV4A 2V7OA 3LZBA 3RPYA 2B9FA 4O0XA 5EDRA 2EXEA 1YXSA 4EJ7A 3H30A 3NUXA 4B6LA 5K9IA 3AD6A 3ZFMA 2BHHA 3UYSA 4GH2A 1H1PA 3LFAA 5FDXA 4BKZA 4FKQA 2PYWA 3PYYA 4IDTA 4LMUA 3FZPA 4NJ3A 5F94A 3TTJA 3BGQA 3DZQA 1AD5A 3R7YA 3LMHA 2OF4A 4OTWA 4F7NA 3PA4A 4RA5A 4JOAA 5HIDA 3FI2A 2YIRA 2ZV7A 1WBWA 3QHWA 4BCNA 3COMA 4MNFA 4TL0A 2UZOA 5L8KA 1NT2A 3AMAA 1REJA 2JBOA 1Q62A 4AOTA 3R01A 4BZOA 3ZFYA 5A4QA 4LFIA 4BWXA 5FDPA 3V5JA 4JIKA 3VS7A 2F49A 5AP3A 3OD6X 3NSZA 1SM2A 1VJYA 1WMKA 2UV2A 3Q60A 2OWBA 4RC4A 5FEEA 5A6OA 4L3LA 4EK6A 5EHYA 5LVPA 5M08A 3HYHA 4PP7A 3F66A 3FC2A 3I81A 3JS2A 3UBDA 2F7EE 3KF7A 3Q53A 4Q5EA 5AR7A 2JDRA 3KN5A 2HY81 4DTBA 3C4XA 3W2RA 4HW7A 3MN3A 4DGMA 3G90X 5EOBA 2UW0A 4PL5A 1KE6A 4ZTNA 3U87A 2REIA 3ODZX 4WNKA 5CEKA 3ZRMA 3U6IA 3R7OA 3DAJA 3RCJA 4UYAA 3C4CA 4TPTA 3U9CA 3G9NA 4FA2A 3QRIA 3RJCA 2OJIA 2R9SA 4DC2A 4ZJVA 5HTCA 4WKQA 5JGBA 2GTNA 2H9VA 2QCSA 4CKIA 1T46A 2RGPA 3PUPA 4II5A 4D2TA 2P3GX 2GNHA 5M51A 5EYDA 3ULZA 3NR9A 1UWHA 3NUPA 3P86A 1PW2A 3EQCA 5BVWA 4FTMA 4UALA 1K3AA 3EQIA 3IW8A 4U6RA 3F3VA 3ZEWA 4C4JA 1Q99A 5FLFA 1IAHA 3U54A 3G9LX 4IX4A 4L45A 4G6LA 4NL0A 5AP5A 3NIEA 2F7XE 3I1AA 4FV6A 1GAGA 5KMNA 4FIHA 2UVZA 3PJ1A 4FKOA 3ALNA 4PX6A 4W8DA 4DFNA 4EZ5A 3C5IA 1WZYA 4N6YA 4APCA 2XS0A 4YUQA 2JITA 2QVSE 3NRMA 3LCTA 3QZFA 4I5PA 4F9YA 4DF3A 4L67A 4FG9A 3P9JA 4GV1A 4UEUA 5CX9A 3L9NA 4A4OA 5HE0A 2W1CA 3A62A 1F3MC 3GCUA 5DR9A 3QD3A 2PVKA 3LJ0A 2HZ0A 4P5ZA 4U3YA 3SA0A 3BV2A 3EFLA 3QKMA 5CEQA 4B99A 2ITNA 5CAQA 3DB6A 4XP2A 4FOCA 4BBEA 3WIGA 5HGIA 4FTRA 2XNGA 4EOLA 3Q9ZA 4U79A 4FMQA 1MQBA 2NRUA 4U45A 3E3PA 1QPEA 2R3QA 2DYLA 3LFEA 3R9DA 3ACKA 5CSWA 2UZBA 2RG6A 2YIQA 1REKA 2PVRA 5FM3A 5JZJA 3RNYA 5KBRA 1GZNA 4H3PA 1URCA 4BDKA 4EH4A 3CEKA 4YLLA 1KUTA 2X7GA 3PSBA 4HCVA 4RFYA 2YJSA 2IZRA 4O0VA 3ATSA 2GPHA 4YZ9A 2R0UA 3R1QA 3C0GA 1FVTA 4IFGA 3LFNA 3MWUA 2R3JA 4BHNA 5LVNA 1ZMUA 2X2KA 5AA8A 2P2IA 2QODA 2R3RA 4GRBA 3G2FA 4R77A 3EHAA 3LHJA 3Q9XA 4L00A 4FTUA 1RW8A 3OWLA 4F7SA 2QR8A 2YAAA 1Q8ZA 3D5UA 4IXPA 5CNOA 4HVIA 3R8VA 1ZXEA 1ZYSA 4OTRA 1I44A 1Y57A 2XRWA 4RWKA 3ID6C 5FP5A 3HMOA 2YDKA 3Q4CA 4IAZA 3RMFA 3ZSGA 3KB7A 3DKFA 3R04A 3NAYA 5E1EA 4QD6A 4FT9A 3ORKA 4D2VA 3SRVB 4LGHA 1PXLA 3QC9A 4XRLA 4BI0A 5AV3A 4D1XA 5EHLA 4FSWA 5ETIA 4BIDA 5FTQA 5L6WL 5KHXA 1ZRZA 2WPAA 4EWHA 3FI4A 3A7GA 3UIXA 1MP8A 1PXIA 1ZAOA 2DS1A 4FIFA 2C5XA 2JDSA 2O5KA 5C8MA 5HCZA 2R3PA 3LLTA 4ITIA 4NM5A 4S33A 2DWBA 2GS7A 1MUOA 2RIOA 3QX2A 4M97A 5IISA 4I24A 3G15A 3DBCA 2QOBA 4OR5A 4LUDA 4IWQA 1JKSA 3LM5A 3CSVA 4XOZA 2XCKA 3GU7A 4QO9A 2JKKA 4ID7A 4FKPA 3GU8A 4CRSA 1WBVA 4XV9A 2VUWA 4YU2A 5CF6A 4XX9A 4AP7A 2QR7A 5HE3A 3IK3A 4D2WA 2O63A 3Q2MA 5CLPA 2ERZE 5KO1A 1H01A 3KXXA 1G8AA 3Q3BA 3VUGA 3SQQA 4XCUA 4ZK5A 2VTHA 2XYNA 3UP7A 4PMMA 3FMKA 1Q41A 3HV3A 4JIAA 2R3FA 3DJ6A 3ZLWA 3F3ZA 3UMWA 4JG8A 3JY0A 4DEBA 1GJOA 5I5ZA 5ICPA 2EWAA 3AQVA 3MH3A 4J8NA 3ZDUA 4FSZA 5JQ8A 3E92A 3VNTA 2B4SB 3KRJA 2C30A 4I93A 2YCSA 5DFPA 2VWBA 3T3UA 3U9NA 5M09A 4QMWA 4C8BA 3QRKA 2GDOA 3DTWA 3C0HA 4QNAA 4EOKA 3G6HA 5BQ0A 4FGBA 3UDBA 4A7CA 4CD0A 2OW3A 5IA2A 3HDNA 3FKOA 3SAYA 4IZAA 3ORZA 1OPJA 3POOA 3ORIA 4E3CA 1R0EA 1ZOHA 4MAOA 4J98A 3FYKX 4Y95A 3OFMA 3WE8A 4FEVA 3ZLXA 3BQRA 3ELJA 2R3IA 4D4RA 4NUSA 3Q9WA 5L4QA 2VTQA 5HCXA 2ZB1A 4RJ7A 3RGFA 4WRGA 4DG0E 3SRVA 5FXQA 4G6NA 4O27B 1WBTA 2JAVA 3AD5A 5IQDA 3I6WA 4DEDA 4RIOA 3AOXA 5H8GA 4QTAA 2GCDA 1BMKA 2HOGA 4B0GA 2ESMA 4GCJA 1SVGA 2WQNA 5TE0A 4OLIA 3LCDA 3MY5A 4MXYA 3S0OA 3NUNA 3H3CA 3UC4A 4BCIA 4HVGA 3FJQE 4O6EA 4QYYA 3F7ZA 4C7TA 3PE2A 2A19B 3P1AA 3D5VA 2B9HA 2BRGA 3MH2A 3LJ2A 5AR4A 2XCHA 5FP6A 2VWYA 2Z7RA 3U4WA 3NCZA 5HO6A 4RX8A 4ZEGA 4CFVA 4RZVA 2RL5A 4QYGA 1U46A 1YI3A 3OY3A 3I4BA 3PWDA 3TUCA 2WXVA 2R4BA 4WG4A 2Z60A 4O7WA 3DLZA 3TUBA 3OT8A 1G5SA 4WIHA 1PKDA 2OICA 4NCTC 4E4LA 3GBZA 3HMPA 5IPJA 3OZ6A 1M2RA 2G2IA 2XK7A 3BE2A 3BWFA 4DLJA 3Q5IA 3TDWA 4ALWA 5ETFA 1J3HA 4YPDA 4CMOA 3TL8A 1FGIA 3LXLA 2WQOA 2PVJA 2CCHA 2CLQA 2OSCA 3DDPA 4M0ZA 5HI2A 3VQUA 3CCNA 2ITOA 2C6KA 2RFSA 4L7FA 3ZBXA 1FINA 3GC0A 4LL5A 4ZIMA 3IS5A 3CTQA 4NYEA 2OLCA 4H58A 1M2PA 5IEXA 2O2UA 2V0DA 4BTMA 5IQAA 1ZZ2A 2ONLA 4QP8A 4G3DA 3SD0A 3LQ8A 2CNVA 4QT1A 4DT9A 3UGCA 3MFSA 3GGFA 3HRFA 3GP0A 3PXQA 5H3QA 1V0BA 3VW6A 3II5A 2YJRA 4RWIA 5J87A 5BVEA 2HAKA 3BYMA 4YTIA 4D9UA 5L6PA 2XIXA 4W9WA 3QCQA 5FWKK 2IW6A 5EDPA 3UOHA 1A48A 5CAVA 4I6BA 2XNPA 3AGMA 3DLSA 2IPXA 1NVQA 4CG8A 3ZXZA 4FTOA 3PJCA 1OBDA 5ETCA 2HZNA 2KULA 4KKHA 4BDHA 4DFXE 5E4HA 4WA9A 5HTIA 1E9HA 2IN6A 5HNGA 2YN8A 1KE9A 4MBJA 5J1WA 5EFQA 3QD2B 4LMNA 3F7WA 4MK0A 4TTHB 5DPVA 5J9ZA 4FR4A 1JQHA 5KMIA 4G6OA 2JDOA 3OCTA 4GEOA 5CYIA 1SNXA 5LOHA 1DS5A 4LYNA 2BTSA 2UZDA 5KNJA 3IECA 2C3LA 3QZGA 4N4SA 4EKKA 3O17A 4F6UA 4QP4A 3RPRA 2ITVA 5HVKA 5AWMA 3CQUA 1UA2A 2R0IA 2WMTA 3IPHA 1PXMA 2BDJA 4CZYB 4OTGA 4AE6A 4FEQA 4B8MA 4CT2A 4O7ZA 4IAAA 4N70A 1GY3A 2W1ZA 3Q04A 4A9TA 4FV3A 3F9NA 3EIDA 3G6GA 2WMUA 3TZ9A 3QC4A 5F1ZA 2WOTA 4BDJA 3WZEA 3ZO2A 3I79A 1OITA 4NTTA 2HWOA 4M7IA 3QQGA 3A99A 4PPBA 2OH0E 1OIUA 1U5QA 3C7QA 3KQ7A 3BHVA 4CMTA 2O0UA 3MESA 3PG1A 2X1NA 2WMSA 3R1SA 5CU3A 3FMDA 3ZFXA 2V7AA 2PVFA 4Y5HA 4AF3A 4KUJA 4H1MA 2I40A 4D2RA 2WD1A 2B53A 3EKKA 4Y46A 3V5TA 3LFBA 3W8LA 3LCOA 1YDTE 4FV1A 5TOZA 4BZNA 2XZSA 4BY9E 2OI4X 3R30A 4K9YA 3L9LA 1W7HA 4QMYA 2WHBA 3OWJA 1STCE 3DBEA 4EBVA 5IA4A 3U51A 3SOAA 5ACBC 3WARA 5IQCA 3VIDA 3VW8A 3JY9A 3FMHA 2A27A 3CY3A 4RJ4A 1H25A 4KSQA 5BVOA 2H96A 2CNQA 4RBLA 4HGTA 4WT6A 4YJUA 1PXKA 3BV3A 3ANRA 3QGYA 3DNDA 3LVPA 3CE3A 3OCBA 2Z8CA 5LCKA 3BU3A 4AW0A 3I5ZA 3VUMA 3UP2A 2VWZA 4GU9A 1P4FA 3MFTA 3QCXA 4K0YA 5E8UA 1UNHA 3UNJA 4FIGA 1I09A 3BBTB 2VWXA 3R8LA 4FUXA 5I9YA 5E90A 3MVJA 3P7AA 4UX9A 4KD1A 1Y8GA 2HY0A 2LGCA 1W8CA 2IJMA 2WMXA 4FF8A 4DH1A 4F7JA 3W33A 5BUJA 2BR1A 2W5AA 5LARA 4UMQA 3UOLA 2JGZA 3R9NA 2ITZA 4O0WA 4RQKA 4PMPA 1Q8TA 1Y91A 1IRKA 2H8HA 2F4JA 3Q6UA 3UQFA 3OUNB 3AT4A 2C5NA 4S31A 5AX9A 4UMUA 1BX6A 4NEUA 4D55A 3GC8A 4BICA 3ZC6A 4FKSA 2YFXA 1R1WA 2BZKB 3TCPA 4I41A 3TZMA 3LLAA 4KIKA 3UO4A 4YNOA 4AT5A 4O86A 5HZNA 2VWUA 3MW1A 1W0XC 4W9XA 3WBLA 3E8CA 3EN9A 4FL3A 4C34A 2OU7A 3A7IA 1PY5A 3CTHA 3GOKA 3E3BX 3F61A 4E93A 5ANDA 1YWRA 4L01A 5IF1A 3MIAA 4YBKA 3DB8A 5DT0A 3K3JA 3QWJA 2J0MB 2Q0BA 3S95A 5KKRC 4ASEA 2OZOA 4J95A 5FD2A 1YXUA 3VF9A 2WGJA 5J9YA 2IWIA 4QMVA 5JQ5A 4RVMA 4QP9A 3BEAA 3VQHA 2ITTA 2F7ZE 3HRBA 3HV7A 5LWNA 2ZOQA 1PHKA 4YC6A 5AMNA 5ETAA 5DR6A 1GIIA 4IBMA 1OVEA 2ZYBA 3ZMMA 3ZZEA 3SV0A 4CGAA 5GINE 4JLCA 1SNUA 4TT7A 4FEUA 1WBPA 4O0SA 3I7CA 1JNKA 3MVHA 1KOAA 3NUSA 5I3RA 5HG8A 3QTWA 4OBPA 3O7LD 3ZS5A 2GNFA 4CFXA 1YW2A 4AGCA 4DFYA 3BZ3A 4LRJA 5JEBA 3R6XA 3QLGA 4G1WA 3PA5A 3TN8A 2W1FA 1U5RA 2YWVA 3ORNA 3ZU7A 4EOSA 3E93A 3FZTA 2VGPA 3FXXA 2UZUE 3KF4A 3R2BA 4O2ZA 5EI8A 4GK4A 5F20A 2UZVA 3QCSA 1OM1A 5ANIA 3SXSA 1QMZA 2DQ7X 4GYIA 5BYZA 3RHKA 4IZ5A 4XBRA 4UMRA 4GT3A 4W4VA 3ZUUA 4WBOA 4CEGA 4MF1A 4B9DA 4CRLA 2A1AB 3FDNA 4P2KA 3EN4A 2HK5A 3MB7A 3KEXA 4FTIA 3OOMA 4EOPA 2XNEA 4DAWA 4WBBB 2YACA 3ZUTA 4APPA 5CASA 2BTRA 1SVHA 2WKMA 4PMTA 3RI1A 4C36A 5AM7A 1WVXA 3ALOA 2F57A 4KBCA 5DG5A 2UVXA 4XUFA 5ANGA 2GNJA 1G3NA 3JVRA 2XJ0A 3WZUA 5HE1A 4CV8A 4MEDA 2B9JA 4QP6A 3L1SA 2OF2A 1OIRA 4NKAA 2I0VA 4R1VA 5GJFA 4AT4A 3TV4A 5KBQA 3PY3A 4ACHA 1WVYA 3CS9A 2B0QA 1GIHA 4DH5A 4KNBA 3TNQB 2YIYA 5FEDA 2C5VA 2JIIA 3AMYA 5LCJA 2BHEA 1K9AA 2C6EA 2V5QA 4AFJA 3FSFA 5F9EA 1OL7A 3VULA 2J4ZA 3QTIA 4HZRA 3DXQA 5ANJA 3SVVA 2QOKA 3T8OA 4ZZNA 4N57A 3GCPA 3UG1A 5DN3A 5E8YA 4E6DA 2CMWA 2YLFA 2I6LA 4JT3A 3ZSIA 4ENYA 1R39A 2ETMA 4LRMA 5AV4A 5A54A 2IZUA 3QKKA 4BCGA 3PZHA 4L68A 5FXRA 4X3FC 2BKZA 4OGRA 3HV5A 4FSQA 2BPMA 3RAIA 3V6RA 4F9BA 2JEDA 5EK7A 2OXYA 3RKBA 3W2PA 3NW7A 4Z3VA 5IH6A 4PDSA 3FHRA 3HP5A 1XKKA 3PSDA 1QPJA 2JBPA 4AG8A 4MD7E 3HMIA 3C4WA 3BEGA 3EN7A 4I21A 3UNZA 3ET7A 2CGVA 2UZEA 5KHWA 4DG2E 2VO0A 3KA0A 4AGUA 1H26A 1JWHA 4JBQA 4C2WA 3HMNA 4IADA 4BDBA 4MQ1A 3IGGA 5BUIA 4QMTA 4Z16A 2PZIA 2PUNA 2XRUA 3K5VA 5G1XA 4BKJA 4AGWA 4ZJJA 5H2UA 1UU8A 3IDPA 3RAHA 4FEWA 2BFYA 4WO5A 3JXWA 2O8YA 5EYCA 2UZLA 4M68A 3SLSA 5EG3A 4O21A 3IKAA 1XWSA 1IAJA 3PJ8A 3CXWA 3DBDA 3PXRA 2BKKA 2JAMA 4DYMA 5HU9A 3QQKA 4BDGA 4C62A 3R73A 3AMBA 4V0GB 2ZV8A 4CV9A 3TV7A 2LAVA 4FG8A 1YOJA 4QTBA 5B2KA 3VS0A 4RLKA 4O7YA 2W96B 5HLWA 5D12A 3HA8A 3PIXA 4GKHA 4F09A 4TY1A 4JQ8A 3VS3A 3CGFA 4UY9A 3ZC5A 1JKLA 3IGOA 5M4IA 5GNKA 4FVQA 5GZ9A 5L3AA 4XG9A 1ZY5A 4ANBA 5CT0A 3OXIA 4FTCA 3OWKA 3QD4A 4GJ3A 5AP6A 2RFEA 3TWJA 3Q2JA 1WFCA 3FMEA 5BVKA 5E8SA 3MPTA 3TNIA 4NKSA 4BZDA 3EWHA 4XG2A 4O6LA 1GOLA 2VNYA 4QTDA 4ZSJA 3VO3A 5KZ0A 5I0BA 2WMQA 5AX3A 2UW9A 4FBXA 1Q8UA 2B52A 3MTFA 4RJ5A 5IH5A 4FSTA 5FQDC 3FZOA 5FG8A 5HOAA 5IQIA 5EHOA 3F69A 1OBGA 1OPLA 5FM2A 3PWYA 4I3ZA 3FMJA 3O51A 3C4EA 3TNPC 4RRVA 3TKUA 5BMSA 1WBSA 2VTSA 3OBGA 1BYGA 3HZTA 4R3PA 4YMJA 3ANQA 3E8EA 3DT1A 5CU6A 3H10A 3I60A 3EN5A 4QP7A 3ZRKA 3BGPA 2YIXA 5E8TA 4PTGA 4RVLA 3MJ1A 3HLLA 3FMLA 3M11A 1QPDA 4UMPA 4GT4A 3CIKA 4C37A 4Q9ZA 4AA4A 1H24A 3O23A 2W9ZB 5C27A 5AV0A 3TIZA 3GI3A 4BDEA 1YQJA 4J99A 4DH7A 3PZEA 4WNOA 4RIYB 2UW7A 5CAPA 4F70A 1KE5A 2AC5A 4IB3A 1PJKA 3OCGA 4BCQA 1O6KA 3BPRA 4JL9A 2E2BA 5L8JA 3MBLA 4WG3A 4YSMA 4ZXTA 4EC9A 2C68A 4JBVA 2VX3A 4FZ7A 4K6ZA 4O96A 5BNJA 4FTKA 4YTCA 4TWPA 5DGZA 3FWQA 4V0GA 3FAAA 4BDCA 4FUYA 4F6SA 3OXZA 1MRYA 4HVDA 3B8QA 3IOPA 3QQFA 4OTFA 4DCEA 2PTKA 4FTLA 4BR3A 4C4EA 4PY1A 3BGZA 3LXNA 4IAFA 3O2MA 3R00A 4EJNA 1NVSA 2NP8A 3ZLSA 5IUHA 2XKDA 2VTAA 2BALA 2JKQA 1UNGA 4NIFB 4ZLOA 4OBQA 5C01A 1OUYA 2EVAA 4C38A 5CU0A 5IA0A 4C0TA 4QMMA 3E63A 1A06A 4J52A 3V01A 4BBFA 2OGVA 1XH5A 4EZ7A 3KULB 3IO7A 5IQHA 5CF4A 4LGDA 2QURA 3ZOSA 5L6OA 4PQNA 4QMXA 3IOKA 2VO6A 2C5OA 4YJQA 2BVAA 2FA2A 3LXKA 2CCIA 4QTEA 2C4GA 2XH5A 2UUEA 2C69A 3CKWA 4JQ7A 5EW9A 4XP3A 1OECA 5HG7A 3VHKA 4DBNA 3S00A 1WCCA 4XLVA 1M7QA 2PZ5A 2GSFA 5ANOA 1R78A 4ENXA 2CGWA 2IG7A 3ETAA 4B8LA 3QZIA 3QRTA 5I3OA 3JVSA 1XJDA 3F3UA 3D2IA 4W4YA 3R8UA 4EH7A 5HTBA 5BVDA 3RP9A 1M17A 1PXPA 4AE9A 3KREA 3OY1A 3KVWA 5CEOA 5AR2A 4PL4A 3C9WA 3QXOA 4ERKA 4YR8A 5LJJA 5FTGA 1UU7A 4MD8E 4XG6A 1PMEA 4L6QA 1WVWA 3ORMA 2P2HA 2OIQA 5I9WA 1U54A 3IW4A 4IZYA 3UIUA 5HIEA 4V05A 4HCUA 4R5YA 4RIYA 5AAFA 4J97A 3BYUA 4O0UA 2VAGA 5HE2A 4XYFA 4FSUA 4FL2A 5C4LA 4QMNA 3AC4A 4MNEB 4M84A 4G5PA 3KXMA 4V01A 4BRXA 3F2NA 3R22A 4YP8A 4RX5A 2OFUA 4IWOA 4QYHA 3KFAA 3V8SA 5A6NA 3SX9A 3GOPA 1GIJA 2Y9QA 3H9OA 4DFBA 4FZFB 3V6SA 4M15A 4C59A 3EQDA 4FKTA 1OGUA 4ZSAA 2QHNA 3AC1A 3NNWA 2CGXA 3GENA 1X8BA 4X2GA 1XBCA 4O38A 3VS2A 5I9VA 5AADA 2WTKC 5AR5A 4ACGA 5J1VA 4A4XA 4F1MA 5EDQA 4WNPA 4IVCA 3QQHA 5C03A 4BBMA 2PVHA 4L7SA 4NIFA 1B38A 4U0IA 4AS0A 3WF9A 3PXFA 4C3PA 4MD9E 4AAAA 2HCKA 2AUHA 2I0HA 2J0LA 2WAJA 4NM7A 4XNEA 3RTPA 2BAKA 4EH6A 4F08A 3OXTA 4BC6A 4BIEA 4FIIA 2GQGA 3KULA 4BGQA 2HZ4A 2XKCA 3RNIA 1E1XA 4G9RA 4XP0A 4BTKA 4JJRA 1S9IA 4YC8A 1Z5MA 2FSLX 2WOUA 2FSTX 3NUAA 3R7EA 4FKGA 4O0RA 5AV2A 2R5TA 3O8UA 3A8WA 4AFEA 5EKOA 3UPZA 3CC6A 3FY2A 3TDVA 3BBWA 4X2JA 3V8WA 2X9FA 4HGLA 2OIDA 4YZDA 3F5GA 1F5QA 3C5UA 4XMOA 3VUHA 3ZUVA 3UTOA 2WTJA 4BCJA 5GZAA 4FSYA 4NW6A 3FXWA 3QYZA 5DA3A 4DN5A 4QMZA 4RJ8A 3FLYA 1LR4A 5DOSA 1LP4A 2GNLA 2Y8OA 2C1AA 5KMOA 2WNTA 5HO8A 1MRVA 3OWPA 4AZSA 3G51A 2R3GA 2C0IA 3MDYA 3NZ0A 3SGCA 3IONA 3GQIA 1OL1A 3LCKA 2OK1A 3UVQA 4S34A 3TT0A 4FOBA 1TQPA 4C4GA 2E9VA 2ITWA 3QZHA 4MNEA 4Y85A 3FI3A 3QTQA 3FLQA 3DQXA 2ZV9A 4FODA 4RT7A 2J51A 2RFNA 3UO5A 2PSQA 2C6DA 2W1HA 2X4ZA 3AT2A 3QTRA 3V8TA 3GB2A 1S9JA 4HPUE 1Q8YA 5HBHA 1M14A 2WELA 5D10A 1ZMWA 4IM3A 4ZLYA 3D4QA 3C50A 4JS8A 4CYJA 2WEIA 1B6CB 5E91A 3DAKA 4WRSA 1YHSA 4O7SA 3KU2A 4PTEA 3RZBA 3RAKA 5HNIX 2C47A 1OZ1A 3DS6A 1JSVA 4QPSA 2QOHA 4L3JA 4AXAA 2NRYA 3RK5A 2R7IA 3HRCA 3GNIB 2J6MA 3G0EA 2ITUA 2J5EA 5CANA 5CZHA 1DAWA 1YXVA 3PRFA 5DIAA 3T9IA 4HYIA 4D2SA 1CDKA 3KC3A 4PUZA 2EU9A 2FO0A 4ZLZA 2VTRA 4KRDA 4XHKB 4ANOA 4FK3A 1XH9A 3R1NA 2QU6A 4A07A 4IAIA 2XBJA 4UWYA 5GJGA 5HX6A 4CTCA 3GC9A 3AC5A 3A4PA 2UW3A 3FYJX 4BCPA 4G3EA 5DR2A 5B0XA 4CYIA 2EXCX 4IEBA 1CM8A 2OXXA 4UXQA 2RSVA 1PXNA 3ORXA 4GW8A 2B55A 1H27A 3A7HA 5AFVA 4BKYA 2GHLA 2PE0A
chains in the Genus database with same CATH superfamily
3QFVA 5CT7A 3VF8A 4YC3A 3E8DA 5JZNA 3KRXA 4K11A 5CAUA 2ACXA 5HCYA 4UMTA 5JGAA 1YHWA 4XV3A 4GMYA 3K3IA 5AP1A 4ZOGA 4CKJA 3R0TA 5EH0A 4J7BA 3HNGA 2CPKE 4YNEA 2ZDUA 5I9XA 4LM5A 2E9UA 2BRBA 4HVSA 4DFLA 4OAUC 1GNGA 2BZHB 4D2PA 4IJ9A 5EM5A 3Q6WA 4DTKA 3EH9A 2QG5A 4YGAA 5AUVA 1JBPE 4I0TA 4E73A 2XJ1A 4NWMA 3UMXA 3VHEA 5LVOA 3ERKA 4N6ZA 3R7VA 2AC3A 1DI9A 1H1RA 3KXZA 1UVRA 4R3RA 4DEAA 4GFMA 3PXYA 4EEVA 3LIJA 2GFCA 5DEWA 4KINA 4RWJA 2YCFA 4DEIA 4IVBA 3IDBA 4DH8A 4IM2A 3CQEA 3CKXA 5C8KA 2O64A 4C61A 1V1KA 2UW5A 2XKFA 3BU6A 3VRYA 3ORLA 4GUEA 3DBFA 3R1YA 5M53A 3NVKI 1P4OA 2PY3A 2W7XA 4EYMA 3NS9A 5KKRB 5T68A 4CXAA 2Q83A 1OL6A 1DI8A 2O65A 4FTNA 4R7HA 3NGAA 5DHJA 5KZIA 3WYYA 5BUEA 3P23A 3UZRA 2XNBA 5E92A 5JRQA 3CQWA 3LAUA 2XVDA 4TKSA 2XNMA 1XMLA 3UVPA 4H1JA 5HBJA 4Q5HA 5CU4A 4DEEA 5FBOA 3SW4A 1J91A 5IMXA 1YDRE 4K77A 3EL8A 4RLLA 1ZYCA 1DAYA 2XF0A 2Z02A 4FX3A 1H00A 1OKZA 3RALA 2B1PA 2JFMA 3HX4A 4OT5A 2B9IA 3DK6A 3Q5ZA 4FNZA 3PP0A 3PPKA 5IG1A 2XMYA 5FGKA 3TEIA 1Q97A 3FHIA 4QTCA 2HENA 5K3YA 2J0IA 3LKMA 5EQEA 1SZMA 3NX8A 4QOXA 4I5HA 4ACCA 3HEGA 3AC8A 4RVKA 2A0CX 3HL7A 3HUCA 2H6DA 4X3JA 3TKHA 5KMMA 3HAMA 4TW9A 3A4OX 2WMAA 1ZZLA 3ZXTA 4JG6A 1IG1A 4CCUA 1YI4A 2ZB0A 3E5AA 3OTVA 5K0KA 4F65A 1RDQE 2C6TA 1L3RE 1ZYLA 2PVNA 4BTJA 2YM4A 3NPCA 4U43A 4EHEA 5B7VA 2HXLA 2BRMA 2OJ9A 1K2PA 4FZ6A 3HAVA 3IQ7A 2VTNA 4FJVA 3C51A 2VU3A 3MSSA 4C3RA 5M4FA 2FGIA 2JKMA 4M0YA 3BL7A 1YHVA 2R3OA 1Q4LA 3GCVA 3MFRA 1ZYDA 3ITZA 2ZAZA 4MXAA 5EYMA 5KE0A 3F82A 3FZSA 2ZJWA 5AM6A 4USEA 2R3MA 4JBPA 1FVRA 3E87A 3WZDA 2VWVA 5IKWA 4IX5A 4V04A 4YBJA 2E9PA 3U55A 3N9XA 4N0SA 2R3KA 5CY3A 3V5QA 2OJFE 2VRXA 4HOKA 4O84A 5AUUA 5A14A 5HG5A 3QHRA 3H0ZA 3QQLA 5M4CA 4DGOA 4A9YA 4I0SA 4KIKB 5IUIA 3MA6A 2HW7A 5M55A 4HPTE 2A4LA 5GJDA 3EOCA 2IW8A 5LWMA 1HOWA 1FBNA 3MH0A 2QLQA 5J9LA 2PK9A 3HMMA 3LFFA 4TWOA 3BLQA 3FLZA 3HKOA 3P7BA 4E8AA 2XIYA 3MGYA 4W4XA 4BI2A 4ALUA 2GU8A 4ORKA 3GU4A 3VUKA 5A4LA 1OIYA 5CALA 2F9GA 2X8EA 2XK6A 1M7NA 4BL1A 5K4IA 4X3FB 2YM5A 5CQWA 5AEPA 4D5KA 2J0KA 4MBLA 5JKGA 3BYVA 5J8IA 4X2FA 2YCQA 5L8LA 2GS6A 3OBJA 3DXPA 4KABA 3DCVA 3RZFA 4LOQA 4F9CA 4X7QA 4FKUA 3BI6A 5K4JA 2PE2A 4QQ5A 4PL3A 4FV2A 5EKNA 4ERWA 4I6FA 5LMKA 4J71A 3EQGA 2ZV2A 4EK5A 1ATPE 4HJOA 4YLKA 4FICA 2WQBA 2EXMA 5DYJA 2JC6A 4AX8A 4LOOA 3CJFA 4J53A 2G15A 4ZSGA 3UDTA 4RC2A 3EKNA 4RWLA 2IVSA 3QU0A 1PKGA 1XBBA 5ANKA 3HA6A 2F2UA 4BDDA 2ZMDA 2Z7QA 5D7AA 4U97A 1PMNA 4RIWB 5AIKA 3PVBA 3UOJA 1H0VA 2FSMX 4JX3A 4IB5A 4IJPA 4MBIA 4FTJA 4EHZA 2X0GA 3UIMA 2QO7A 2XP2A 3E7OA 3O0GA 4H05A 2AYPA 3GXLA 2GHMA 1H4LA 3KMWA 3NW6A 3TXOA 4ZTMA 2WMBA 3GU5A 3NYNA 1BI8A 4YJPA 5HESA 4CLIA 4PDOA 5I9UA 5C9CA 3D9VA 4ZTSA 4YZCA 3ZO1A 2W4OA 4NFNA 1UKHA 4IZ7A 4YJOA 4GJ2A 5TT7A 3ZO4A 3DJ5A 4D9TA 4DEGA 4E5WA 4FT3A 4XBUA 5L2QA 3SDJA 3DDQA 3VAPA 3C1XA 2W5HA 1KV1A 1SYKA 3E88A 3PXKA 4F4PA 1XR1A 3NLBA 3UJGA 5LXMA 2ZM1A 3FKNA 1IEPA 3BU5A 4BGHA 3UG2A 1SVEA 2QKWB 2VD5A 4NU1A 3MS9A 3UIBA 4JI9A 4XV1A 3TJCA 4AZEA 2P33A 4JBOA 2BAQA 4FSMA 2CGUA 4MF0A 4BWPA 4EK8A 3DTCA 5KCVA 4O91A 1W98A 5HKMA 4O81A 4U44A 3WILA 3G33A 4NFMA 3RPOA 4GFGA 1HCLA 4IMYA 4F64A 4X3FA 2UZTA 1J7LA 3W2OA 3N4UA 1WAKA 1FMOE 2UW8A 2WIPA 3LW0A 4XOYA 4F7LA 3NNUA 4BCHA 5BYLA 3TTIA 1LPUA 3ZONA 3Q9YA 4Y83A 3SW7A 1UWJA 3QUDA 4FIEA 5JFSA 4AN9A 3U8WA 4C02A 4D58A 5DE2A 5M57A 3MB6A 3ZBFA 5IA3A 3L8SA 3QD0A 2CN8A 2UW4A 2XA4A 4FNWA 4QRCA 1GZOA 4MTAA 1Z9XA 1CSNA 2XM8A 1YI6A 3BWJA 2RG5A 2WTIA 2WU6A 3LQ5A 3IDCA 1IA8A 4QMOA 5IQBA 2PVMA 3P5KA 2X2MA 4EH8A 1H1QA 2Y4IC 4WUAA 3V3VA 5L2IA 5HQ0A 4C4FA 3N51A 4YZNA 2VTLA 3D2KA 4UV0A 4C33A 3EQPA 4QNYA 2QU5A 3F5PA 2C6IA 4I20A 2XUUA 3PIYA 4ZY6A 3VBXA 2YDIA 4EUTA 1CTPE 3IW6A 1RQQA 1BL6A 4RIWA 3VS5A 4BI1A 4Z9LA 1XO2B 5J79A 3BHTA 4C4HA 3BLRA 3BE9A 3TNWA 4RFZA 4U42A 5AUXA 5EQYA 4OW8A 4O4CA 4GIIA 3S3IA 4BWKA 4I94A 2XK4A 3U6HA 4FKIA 3RPSA 2HXQA 3K5UA 3GT8A 4AZTA 4R78A 4YO6A 4L53A 2C6OA 2VV9A 5KX8A 1TQMA 3AKKA 5HEZA 5KUPA 3L9MA 4FYNA 3W2CA 2XJ2A 4TWCA 3W10A 4BTFA 5HU3A 1KV2A 3PRIA 4BYIA 2PL0A 4O22A 2IVVA 2IW9A 5I4NA 2HYYA 4O4BB 4DITA 3OTUA 2C3IB 3EQHA 2YZAA 5AAEA 4FT5A 2ZVAA 3UNKA 3GEQA 2Q0NA 4GSBA 3A2CA 2PMNX 4WG5A 5HG9A 4GUBA 4PTCA 3MTLA 5CEIA 5HNBA 4G34A 5E7RA 1VEBA 2PMOX 4NH1A 4QEBA 2CDZA 3H9RA 4NSTA 5CQUA 4WD5A 5CSVA 3TIYA 4O7LA 4FZAB 2PHKA 4QYFA 4TN6A 2GTMA 3ENMA 2GQSA 4G17A 1M2QA 4KB8A 4CLJA 4G5JA 4XG7A 4USDA 3KN6A 4FV0A 3NYOA 4YJRA 2VWWA 3BHYA 3Q96A 4NM3A 4FG7A 4ARKA 5EM8A 4M66A 4AW5A 1V0OA 4MWHA 3NVMB 1LEWA 3MH1A 2QONA 4OBOA 5AV1A 1W83A 5IQEA 1WBOA 3VBVA 4GG7A 4D1ZA 3VRZA 4B4LA 1O6YA 1ZWSA 2QKRA 1W82A 2BZJA 2W06A 3QWKA 4I92A 3DK7A 3ENHA 3EZVA 4LQMA 3VJOA 4ONAA 3GC7A 4PWNA 5E8VA 3W2SA 2VWIA 4AZWA 4QP3A 3GU6A 2P0CA 5KMLA 1NA7A 2CHLA 3POZA 4IACA 3HV6A 4K1BA 1SMHA 2Y0AA 4LI5A 4U40A 3OT3A 2W17A 4ZTRA 4AZVA 2XB7A 4RX9A 2C0TA 3O5AA 1H0WA 3EQFA 1ST4A 4FVRA 4KS7A 1MRUA 5AUYA 5IDPA 1UU3A 5K5XA 4Q2AA 2BZIB 2J0JA 4ANQA 4M13A 2ETKA 5FUTA 4EH3A 4YZMA 2QC6A 2YM8A 1XQZA 2JD5A 3AD4A 4NW5A 2WTKB 4MUQA 4K18A 2X6EA 4D1SA 4IWDA 4EOJA 3D7ZA 4LUEA 3NW5A 2G2FA 2YCRA 5HBEA 4D0WA 4FYOA 2WO6A 3MIYA 3LFDA 1KE8A 1KE7A 2PWLA 2R3LA 3HECA 3V51A 4A9UA 4CVAA 4O1OA 3L8PA 2PVYA 3OW3A 3MY0A 3OROA 4O1PA 3WF7A 1QPCA 4Z55A 4OAVB 3PFYA 3MV5A 3QYWA 4QYEA 1BUHA 3ROCA 4EH5A 1JOWB 3ZRLA 2VGOA 4YLJA 3HGKA 2HELA 4G3GA 2XIRA 3PJ2A 1TFFA 4G16A 3LFSA 4PNIA 5DI1A 2YM6A 3BLHA 1UU9A 3TZ8A 3QLFA 4IB0A 5CF8A 5HLPA 4O83A 1TKIA 2ERKA 2CJMA 5IA5A 2PPQA 2WQEA 3SOCA 4ALVA 2JLDA 4IQ6A 3AC2A 4JNWA 3RINA 4LRKA 5TO8A 1R0PA 4JAJA 4UXLA 4QP1A 2X2LA 4X6RA 3MFUA 3LCSA 4XG8A 5DBXA 4EHVA 2B54A 3QL8A 4ASDA 4JVGA 1PMVA 4ZY5A 5E9EA 4IX6A 5M56A 2Z7SA 4BDIA 2C3KA 3COIA 4L52A 4GL9A 2QOOA 4Z7GA 5EYKA 1U54B 3CY2A 4EC8A 4C4IA 3GFEA 3M42A 4RIXA 4CT1A 4GVJA 2ITPA 2IVUA 4BCMA 2QI8A 1P14A 3MPMA 5CVFA 3V5PA 5LVMA 2X8DA 5AUZA 3MYGA 3VS6A 2C0OA 4UB7A 4ANLA 4IFCA 4EK4A 4EOOA 2VTIA 3P7CA 4HNIA 1OI9A 5JRSA 4J1RA 3I7BA 5T3QA 4BYJA 4FV9A 1YXXA 4XG4A 2JIUA 2WTDA 2X9EA 3BHHA 4TRLA 4YJSA 5LMBA 4EQCA 4KIOA 5LVLA 4ITHA 3R7IA 1JSTA 2BRNA 4MX9A 5FEQA 3UVRA 3R9RA 4AN2A 4E5AX 3UQGA 2QD9A 3BELA 2GQRA 2OBJA 3DQWA 5D11A 4LL0A 4FT0A 1JAMA 4EORA 4EUUA 3DBQA 5HORA 3TV6A 4E4MA 3WI6A 1M52A 3L8VA 3OS3A 4IC8A 4MXXA 2WMVA 4FV7A 4NK9A 5FBNC 2YEXA 4HYUA 4D4YA 2R3HA 4XLIA 3D0EA 1H8FA 4D0XA 4ANNA 3R02A 1ZY4A 4I4FA 1JKTA 2BILB 4UWCA 5TKDA 3WZJA 1AQ1A 4AOIA 4QMQA 2OKRA 3PG3A 2Z7LA 1BL7A 5A4CA 1F0QA 4DH3A 4OTPA 1PMUA 3PVUA 2EB3A 3O7LB 3DY7A 3OP5A 3OMVA 4KKGA 4TXCA 4TYJA 1IA9A 2WTWA 3UZPA 4AA0A 4C3FA 4FVPA 4NJDA 4YZBA 4E20A 5J5SA 5GHVA 3TUDA 2XK3A 4YHFA 3WYXA 1Q5KA 5F95A 4ZJIA 5K5NA 4CSVA 5M44A 3GCQA 3T9TA 2QHMA 3CPBA 3H9FA 5EI2A 4I5CA 5A46A 3KGAA 2QNJA 3KRWA 2OFVA 3KXNA 3M1SA 4QMSA 1OIQA 3PPZA 1QL6A 2JDTA 2P55A 3FZ1A 4MXCA 4QMUA 2YIWA 3EL7A 5B2MA 3WF6A 2X8IA 4FKLA 3DKCA 4L9IA 2YLEA 4M69B 3I0QA 4YJNA 4AU8A 3PVWA 4F0GA 3DJ7A 4JDIA 4RG0A 3VBWA 2OG8A 4DGLC 2RF9A 3DFCB 3GFWA 5TR6A 4M3QA 3QTZA 1P2AA 4JDKA 3FLSA 5E8XA 4QQTA 4HYSA 5GIPE 3R9HA 1GZ8A 2VX1A 3DV3A 3K54A 5AUWA 5BMMA 3ZH8A 1LEZA 4YSJA 2CSNA 5HIBA 2QOIA 3Q4TA 4RSSA 4R6VA 3R2YA 4RQVA 4FGRA 4UWBA 5IMEA 2VO7A 1FVVA 5HX8A 1PYEA 1Q3WA 3R71A 5ANEA 2RFDA 5BPYA 3P4KA 3OUKA 1BI7A 4RVTA 5ITAA 2G9XA 4KIQA 4FNYA 4WSYA 4X2KA 3F2AA 5G6VA 5A3XA 3VUDA 5JGDA 1YOMA 1JSUA 1NXKA 3V5LA 4F0IA 2CKQA 5EQPA 1FOTA 4X0MA 3VC4A 4E6CA 2Y4PA 4IDVA 5JT2A 2BFXA 3OOGA 1VZOA 3BYSA 3A8XA 3EB0A 4PMSA 5DEYA 5E1SA 4IW0A 3UODA 5M4UA 1V0PA 3F5XA 2X7FA 4X2NA 1XH7A 3RWPA 4A4LA 3PDTA 5DWRA 4P5QA 4EOMA 2JKOA 4HGSA 1CKJA 5BVNA 3F2RA 2HIWA 3W0NA 3E62A 4BVUA 4IIRA 4CG9A 5M06A 3O71A 3Q32A 4OT6A 2OZAB 4RA4A 3KVXA 4DLIA 3LFQA 4KBAA 5DLSA 4F9WA 3UPXA 2XEZA 2FYSA 1YOLA 3AXWA 1XH6A 4JQEA 1ZARA 3R8PA 2UZNA 3LJ1A 3ODYX 5FTOA 4GK3A 3FY0A 3R83A 4GS6A 3EN6A 4EQUA 4AXDA 4R5SA 3FL5A 5K0XA 2HWPA 3VBTA 3TKIA 3FSKA 4LG4A 4U7ZA 4AOJA 2YDJA 3E7VA 3FUPA 4S32A 4OTIA 1PRYA 3PA3A 4ZMEA 3PPJA 4D4VA 4FNXA 5GZ8A 2WFYA 3VVHA 3A7JA 2HZIA 5DH3A 2ITYA 5H8EA 3AT3A 5DT4A 3W18A 1APME 1H07A 3KL8A 3PXZA 4O0TA 2E9NA 4QPMA 4Q9SA 3REPA 3VUIA 3BQCA 4M69A 5HD7A 5CXZA 3CJGA 3QBNA 1UNLA 3SG9A 3KMMA 2QOQA 2F2CB 1ZLTA 4GT5A 1VYZA 5CWZA 4BDAA 4E5BA 4UZHA 4RJ6A 3TG1A 4OUCA 2WMRA 4I23A 3R7GA 4IX3A 4LOPA 4R7IA 4KAOA 5F4NA 3D5WA 4YTFA 3EQRA 3R21A 1VYWA 2X81A 2BMCA 4CTBA 4NCTA 4M67A 3ROYA 4JXFA 5IA1A 1WBNA 5C1QB 3DA6A 4G3FA 2WMWA 4YHJA 4TNDA 3R8MA 5I9ZA 2YISA 4BDFA 3NYXA 3O8TA 4IAKA 3SKCA 4CQGA 1J7UA 4KKEA 1FMKA 4R8QA 1CKPA 5HVYA 3AKJA 4L8MA 5CVGA 3MI9A 5ACKA 3W32A 1ZOEA 3NUYA 4AA5A 5IUGA 3QX4A 5D41A 3NUUA 4JR3A 5C26A 2W0JA 2PUPA 3DOGA 3Q52A 4RC3A 2XIKA 1Q3DA 2QO2A 1YWNA 4M14A 3KKVA 3F3TA 3KMUA 3CLYA 5AP0A 4YJVA 4EH2A 3FE3A 3OC1A 4OTDA 4H39A 5EI6A 3N4TA 3MVLA 2IO6A 2XM9A 4RX7A 4U80A 2IZSA 3H0YA 3PJ3A 3WE4A 4ANSA 4HZSA 4GIHA 1FGKA 3L9PA 5JN2A 3PY1A 4XG3A 4IANA 4KA3A 1PXOA 1Y6BA 2XK8A 1Q8WA 2PZPA 5AP7A 3ZDIA 2IVTA 4QP2A 4UYNA 2OZAA 3NNXA 3ZCLA 4EZ3A 4DE4A 3RK9A 4D28A 4F9AA 4K33A 3ZM9A 1Y6AA 5EW8A 4CFNA 3BLAA 3R28A 4KWPA 4S2ZA 4BFMA 5AJQA 5JFVA 3NFGB 5CS6A 5BV3A 5EOLA 4ZZMA 2NNWB 4AN3A 4XRJA 4I6QA 3EYHA 4FTQA 4EI4A 5KMKA 4R7BA 4Y8DA 1JVPP 3WF8A 4XH6A 3DPKA 2W1EA 3A61A 4FRFA 3UO6A 2YAKA 3NAXA 4PPCA 5H8BA 4TYGA 4FT7A 5D1JA 1ERKA 1PYXA 5IEVA 5IQGA 3LOKA 4FIJA 3DK3A 5CXHA 2WTVA 5J7BA 5IH4A 3HP2A 3RWQA 1OUKA 5M07A 3Q4ZA 3RHXA 4JRVA 4AACA 5HICA 2Y6OA 3OEFX 4P90A 2QOCA 1XHAA 2P4IA 3VONA 4U81A 4OTQA 4O7NA 3F5UA 5AP2A 4UZDA 1KWPA 2FSOX 5CI7A 4ASXA 3QUEA 3JR1A 4EOIA 1CKIA 4FSRA 4AW2A 4BGGA 3BIZA 4FTAA 4CMUA 3VBQA 3SG8A 2IEWA 3CD3A 4TYHB 2W1DA 3U4UA 4O7TA 3QA0A 4A06A 4AWIA 4DGGA 1G8SA 3A7FA 3B2WA 4OTHA 2C5YA 2PMIA 3PP1A 3EJ1A 3R8ZA 3UC3A 2Y6MA 3W0QA 2VTPA 2YWPA 3DKGA 3E64A 4M12A 4U3ZA 2ZM4A 4I0RA 5L2WA 3C4ZA 2WU7A 3ACJA 3BKBA 3MA3A 4MXOA 4E6AA 2XAOA 3LPBA 2GNIA 4DT8A 2FVDA 4F78A 3UE4A 4WNMA 1XBAA 1OB3A 3DZOA 4IVDA 2QLUA 2XNOA 2NPQA 4JG7A 4MCVA 2G01A 3LFCA 5CNNA 2J5FA 3KK9A 3W1FA 4BB4A 4F63A 2XK9A 4ZAUA 3FMNA 1YKRA 3PTGA 3R9OA 4R3CA 5EM6A 3WF5A 3DXNA 3FXZA 3PFQA 3RCDA 4ANMA 5HD4A 4G9CA 2C6LA 2VNWA 5LMAA 2EUFB 3BYOA 4XS2A 3W2QA 3T3VA 2Y4IB 4YURA 3S1HA 2NO3A 2HW6A 3OW4A 3QQJA 1OL2A 4MXZA 3FEGA 1J1BA 1T45A 2XIZA 3QCYA 4O7VA 3KRLA 3QKLA 4FKJA 4RPVA 3EFJA 4X6QC 3FQSA 3BHUA 3TJDA 4AZFA 4C2VA 4FKRA 5E8WA 1NVRA 4MH7A 4U5JA 2GS2A 3B8RA 3C0IA 5D7VA 5AR8A 3BL9A 5KMJA 2WIHA 3QA8A 4Y73A 3VUTA 4AGDA 3KCFA 2DUVA 2WEVA 3FMMA 3QTXA 3GUBA 4FTTA 3KY2A 4RZWA 2I0EA 4O0YA 4WOVA 4A9SA 1HCKA 4L46A 1JLUE 5JMSA 2W99B 3I6UA 3BRBA 2VN9A 4AW1A 5CSPA 3VS1A 4RGJA 5DNRA 4C35A 2V22A 3MVMA 1TVOA 4EBWA 2I7QA 5B2LA 1BKXA 3FV8A 4F0FA 2CNUA 3NDMA 3S4QA 3QRUA 5L2SA 4UBAA 4Y72A 1TQIA 3W55A 4BHZA 4GK2A 4FE2A 2W1IA 3CPCA 2CLXA 2VX0A 3DKOA 4IM0A 2C1BA 1OPKA 4YHTA 2G1TA 2UW6A 5HHWA 4G31A 3AC3A 4ASZA 4XJ0A 3RM6A 4TYHA 1OMWA 2AQXA 3FPQA 2J90A 2ETRA 3IW5A 2OIBA 3LXPA 4D4SA 2Y7JA 3N4VA 4E4XA 2QQ7A 1KOBA 2BDWA 4PDYA 4W8EA 4ZMFA 4DG3E 3QTSA 2BROA 3ZLYA 3QRJA 4PPAA 3OCSA 3ZYAA 4KBKA 4K2RA 4HVHA 2PZYA 4PV0A 3SXFA 4ACMA 2R3NA 3VN9A 4NTSA 5JSMA 2AEGA 3SC1A 4CZUA 4EHGA 2JFLA 3TZ7A 3M2WA 3GVUA 4DEHA 5J5TA 4WUNA 1DM2A 1PF8A 3AGLA 4MVFA 4DHFA 2UVYA 3E8NA 3JPVA 4RJ3A 3ORTA 3OHTA 3OF0A 3CGOA 4DFZE 3PY0A 5AUTA 4ZS4A 4W4WA 3COKA 2ZM3A 4L44A 4E1ZA 4F6WA 1CMKE 1YRPA 3TNHA 3DAEA 1UV5A 4C57A 4CQEA 2FUMA 3QALE 4IE9A 1LUFA 3LMGA 3O96A 3GCSA 3QAME 4FI1A 3ULIA 4BCKA 3R7UA 2X6DA 4E4NA 4AQKA 2BUJA 2PE1A 1RJBA 3CP9A 3MY1A 4JDJA 4WHZA 3HV4A 5GIOE 4L43A 5AR3A 3HDMA 4BN1A 2VTJA 4EOQA 4FKWA 2PULA 3CTJA 5JFXA 4QMLA 2FB8A 4QMPA 2QOLA 2ONLC 3LM0A 2PMLX 3NEWA 1YWVA 4ZZOA 4IH8A 4JMQA 1IR3A 4EKLA 2YITA 2OH4A 1RE8A 3NIZA 4K8AA 2Z2WA 1QCFA 1Q24A 1JPAA 5IQFA 1GZKA 4ZTQA 4TNBA 1MQ4A 5J7HA 4TYIA 4JX7A 2YZLA 4M8TA 5CENA 2O3PA 2VO3A 3D7TB 4FL1A 4IHPA 3PSCA 3ZZWA 2BDFA 3VJNA 3ZTXA 2XBAA 4CFWA 5AA9A 4NT4A 4G2FA 3EFWA 4YJTA 4NZWB 4ITJA 4BCFA 5HLNA 5LQFA 4AUAA 5C4KA 1Y8YA 4TZRA 1L8TA 4YO4A 4F1OA 2XKEA 5HO7A 2R7BA 3FL4A 3WIKA 2FH9A 4ACDA 1BLXA 4P7EA 4I22A 4U8ZA 3MJ2A 5CEMA 4E7WA 1PXJA 1OKYA 4J96A 3EFKA 3FZRA 3GQLA 2R2PA 4J8MA 1E1VA 3V04A 4F99A 1OKWA 4E26A 3SXRA 3RVGA 1OL5A 4CFFA 2BAJA 3S2PA 4F1TA 4BIBA 3AG9A 5D9HA 5EW3A 5CEPA 2GNGA 4ZTLA 3EYGA 3D94A 4YPSA 5AAGA 3I5NA 2H34A 3KCKA 3RAWA 1U4DA 2QOFA 1YXTA 4EK3A 5EM7A 3ZSHA 5A4TA 3DNEA 2W4JA 3DU8A 2VTTA 4MQ2A 3WZKA 4FV5A 2A2AA 2R64A 2EB2A 3NCGA 1O9UA 2X39A 3ORPA 4EWQA 3F6XA 3KXGA 4BCOA 3QGWA 4UN0C 4RMZA 4R1YA 1U59A 2X7OA 1H28A 4CZTA 4MKCA 2ITXA 3F88A 3W16A 2B7AA 3VWAA 4AQCA 4C58A 2WB8A 2IZTA 1G8KA 2J7TA 3FBVA 4HCTA 1OKVA 2GMXA 3FLWA 5BVFA 5FXSA 4FK6A 4DBXA 4DINA 5DRDA 5CI6A 4DTAA 2YM7A 2VTOA 4FKVA 4FZDB 2GFSA 4CKRA 3I0OA 3K2LA 1H08A 3PVGA 2XNNA 3UOKA 4DA5A 1G8JA 2VZ6A 2RKUA 3W8QA 3EZRA 4CFMA 3LQ3A 2PUUA 3FLNC 3KXHA 2YERA 1YDSE 2E9OA 3QF9A 3QUPA 4TWNA 5LMKC 4ZY4A 2W5BA 4S30A 3EMGA 4QQJA 3C4FA 3DGKA 2CKEA 3D7TA 4LV8A 1YVJA 3DFAA 5CF5A 2PU8A 3UQCA 3OEZA 4XEYA 4H3BA 4IB1A 4QPAA 4ZSEA 3FI8A 3HVCA 5T6KA 4EYJA 5AP4A 2BIKB 2YHVA 4GU6A 4D5HA 4MHAA 3LMIA 3JYAA 1W84A 3P0MA 4LV5A 3MPAA 4I1ZA 4U9AA 5JH6A 3CD8A 4USFA 3F3WA 3FQHA 4JRNA 5FRIA 3WOWA 4KS8A 5BYYA 2QO9A 3Q4UA 3QTUA 4L3PA 3IG7A 2CKPA 4Y5QA 4IWPA 1AGWA 3PIZA 2KTYA 2CKOA 3RPVA 3UYTA 5JFWA 4XV2A 5CSHA 2XYUA 5IU2A 4I6LA 5DVRA 2ITQA 2JDVA 1NW1A 2G2HA 1ZOGA 2J9MA 4GVAA 4YTHA 2XEYA 3BX5A 4IVAA 3RBWA 5IZFA 3C13A 1ND4A 5CZIA 5HVJA 5CVHA 1FQ1B 4FV8A 2WTCA 2I0YA 4JR7A 4H3QA 4PF4A 4ZS0A 4ZSLA 1KSWA 3FQEA 2PZRA 2JIVA 4NM0A 3B2TA 4I6HA 4I5MA 4CNHA 1ZYJA 3P08A 3TYKA 4GG5A 3G0FA 3CR0A 4AAYA 1ZMVA 4EL9A 3O8PA 3EQBA 3ZHPC 5JK3A 4DDGA 3COHA 2UZWE 2V55A 4HGEA 3TACA 3D14A 4MWIA 4BF2A 1URWA 5TF9A 2PUIA 4RIXB 3NWWA 3SHEA 3TI1A 4RFMA 5IDNA 1R3CA 2BRHA 2C3JA 4MYGA 3RK7A 4E6QA 2X4FA 5A9UA 3D83A 3G5DA 3D5XA 2CN5A 3ZO3A 4PDPA 2YM3A 1J1CA 5H9BA 3FPMA 2I1MA 4IAYA 5E8ZA