4JI9A

Jak2 kinase (jh1 domain) in complex with tg101209
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Amino-[1,2,4]triazolo[1,5-a]pyridines as JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ji9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ji9A01
1GZKA 1FPUA 4M67A 3QTWA 5LARA 2QLUA 2EUFB 3U87A 4FL1A 3CIKA 5DN3A 4KKEA 5DVRA 3ZFXA 2PUIA 2GMXA 2P55A 3A8WA 2XP2A 3Q4TA 4RA5A 5I9UA 5LXMA 2GQRA 5M4CA 5EQPA 1QPJA 4OTGA 5CEMA 4FMQA 3NSZA 4YJOA 2R64A 4X2NA 4MXAA 4IVDA 4AOIA 3SXSA 4PY1A 3CY3A 4GG5A 1L8TA 3G15A 4DFZE 2C3JA 1PW2A 2VO0A 3SOAA 1TQMA 4BCJA 3C0IA 4C38A 3D9VA 1JSTA 4KIQA 5GZAA 4RT7A 3OCSA 4LRKA 4X3FA 5JQ8A 4A07A 3MIAA 3UIXA 4Y5HA 4Q9SA 3MW1A 2J51A 2V7AA 3ENMA 3EQGA 4XBUA 5M4UA 4ERKA 1KE6A 2OICA 4EC8A 2W1CA 2ZV2A 3KXHA 3RM7A 4GK4A 5KUPA 3G2FA 4G31A 4YJPA 4HVSA 5BVWA 4PNKA 4Q5HA 1OKWA 4G3DA 5H3QA 2O65A 4MNEA 4C2WA 4LQMA 4FGRA 1UU9A 3KK9A 2DYLA 2GTMA 2WTVA 3BRBA 3JY9A 4XG9A 3HAMA 4I1ZA 4U6RA 4ZY4A 1K9AA 4YLKA 4R7HA 4AU8A 3VC4A 2BRBA 3V01A 3TV7A 4C4HA 2VU3A 3O8TA 4F9AA 3HX4A 3ZSHA 4F4PA 3OVVA 4RJ8A 3FMJA 2XB7A 2WMRA 4S33A 3EQBA 2PUUA 3OWJA 5L2QA 1WBWA 1YVJA 2EVAA 3UMXA 5CANA 4WNKA 3FMKA 3OOMA 4TWOA 2VTIA 1YDTE 4J97A 4RJ6A 4UB7A 2Z7LA 3MFTA 3OD6X 2OIDA 3SRVB 4QMWA 4O1OA 4LUDA 4DYMA 3F69A 5L4QA 1B38A 2G01A 3MS9A 4X2JA 3UC3A 1PXMA 2A27A 1V0BA 3MY5A 2O63A 2UW0A 3JVRA 3LCOA 3Q04A 3QTQA 3FUPA 3R1QA 4K18A 3WF8A 1NXKA 3QQJA 4FKQA 1UA2A 3QTIA 4CRLA 4EHVA 1STCE 4E3CA 5BYLA 3MY1A 5I9VA 4RLKA 3BEGA 3EZVA 1JNKA 3MA6A 3SVVA 3RAIA 3R22A 4FYNA 4QMZA 1XJDA 2R3OA 1UWJA 3R9OA 4QP8A 2W4OA 2XK6A 2VO7A 4FUXA 5TKDA 1PRYA 4PV0A 2HZ0A 2Y4PA 4FKWA 4KKGA 5AUUA 5FXQA 3V5JA 4XYFA 4BKZA 3HMMA 3SG8A 5LMBA 3HYHA 4RSSA 3QD3A 4UMQA 2UVYA 4CLIA 2E9PA 3K2LA 4TYGA 4C4EA 5HVYA 4Q9ZA 5HX8A 2ETRA 4BDJA 3VQUA 5HNIX 4EH4A 5IEVA 1A48A 3NYVA 2OZAA 3EQIA 1JKSA 5IH4A 4Y83A 4TYHA 2YIYA 5AEPA 3AD4A 2FSLX 1PHKA 3D83A 3CGOA 4IX5A 3SD0A 3VN9A 5CU4A 3VUIA 1WBNA 4JS8A 4JRNA 2W1IA 1CDKA 3PXQA 4XG3A 2WMVA 4D55A 5GZ8A 2ZV9A 1OUKA 4U79A 4DEAA 5M44A 4FT3A 4G34A 3DU8A 3QLGA 1RW8A 3PY1A 4QT1A 5AUXA 1WBSA 4JG6A 5IMXA 4H39A 3NNVA 1MQBA 2XYNA 2SRCA 3TCPA 4EWHA 2HZIA 4EBWA 2R3FA 2V55A 2RFNA 3EN6A 2B9IA 4WHZA 4O7VA 2YWVA 1PMUA 2PVMA 3DJ5A 3E92A 3LQ5A 4O0UA 4YPDA 3ZC6A 4GCJA 2PMIA 5HE0A 2CLQA 5CENA 3FV8A 4ID7A 4G5JA 4IJPA 5EDRA 3KXXA 2YACA 3P4KA 3LFEA 2OJFE 4DA5A 4FKUA 2WO6A 3DNEA 4MHAA 1KSWA 4TT7A 4OTQA 3WARA 5LWMA 2JBOA 4L68A 2PYWA 3LLAA 3HVCA 4O83A 1YI3A 4A9UA 5A4QA 5B0XA 2OIBA 3E8CA 4YZ9A 3ZO1A 1ND4A 4NL0A 4LRMA 3FZRA 4FK3A 3PRIA 4XRJA 2FYSA 4FE2A 2WELA 4QTDA 3ZTXA 3DBFA 4V04A 4JAIA 3HP5A 2GNGA 3BHVA 4G3GA 5CF4A 4LFIA 5CI7A 3FHRA 1H27A 3ORMA 4BCKA 5JGAA 4ZIMA 3UG1A 1UU7A 2ZB1A 1K3AA 2BDWA 1Q24A 3V5LA 3H30A 1KUTA 1YXSA 4FTMA 3HMPA 4V0GB 2W9FB 4AFEA 5C4LA 4YPSA 3H0ZA 4PF4A 4E6QA 1W7HA 1Z9XA 5EM7A 4RVTA 4O7YA 4ZTSA 3SAYA 3DS6A 2WMXA 1FBNA 3HLLA 1UKIA 3TTIA 4XNEA 4PL4A 3MJ2A 2V0DA 4IWPA 4BWXA 2ITOA 4WSYA 5HVJA 3WOWA 5JZJA 5LVPA 4RBLA 4W4YA 3UVRA 4U81A 4ARKA 4ZMEA 4WRSA 4FSRA 4JXFA 3NUPA 3ZZWA 4EYJA 2PULA 5DYJA 2CCIA 2IVTA 4FIEA 2QOCA 2ZV8A 2R3NA 3DK7A 3G0EA 4FR4A 4IXPA 4OTHA 4Y72A 1XKKA 3AT2A 4WUNA 5CY3A 1YWNA 4BHZA 4O0SA 2Q83A 1UU3A 5I9ZA 5HNBA 2GHLA 2QO9A 1H07A 2XNPA 3QC9A 3SW7A 3LFDA 1IR3A 1PXLA 3QYWA 5D9HA 5IQFA 4EH6A 4KIPA 3IOPA 2XK4A 4GG7A 4D4SA 3GUBA 3O17A 3NCZA 4U45A 5ANDA 3VBYA 3EQDA 4CZUA 4DH1A 3KVWA 5LCJA 4HPTE 2REIA 2WOUA 1QMZA 4F6WA 2A0CX 3LZBA 4YO4A 3GCUA 5ETFA 2BTRA 3DJ6A 3ITZA 4NIFB 2C6DA 3SXFA 1NVSA 4TW9A 2PPQA 3ALNA 4WG5A 4O0RA 3QZIA 5C26A 4EOIA 4ZTLA 3LCKA 4IB1A 1WBVA 3Q6UA 4U3YA 2C30A 5JFXA 4AACA 3AT3A 4A4LA 4NU1A 3KMUA 4FSNA 3PXYA 3FSFA 3CGFA 2HCKA 5CSXA 1PYEA 3OW4A 3ZMMA 2O3PA 4AW5A 4AOJA 3PE1A 3HKOA 3OY1A 4GT4A 3GCSA 3NNWA 3DNDA 3QCYA 3RWQA 1KE7A 2CGUA 2R0UA 2ZM4A 4CKIA 3RZBA 3ORIA 2IJMA 1UV5A 3QUEA 2XMYA 4C35A 4ZLYA 4CNHA 4UMUA 5F1ZA 5TF9A 1MQ4A 2X7GA 3FKOA 3NX8A 5CASA 4S31A 3RINA 2YHVA 3NWWA 2H96A 3OZ6A 5JMSA 4KSQA 2Z7QA 5AAFA 3VW6A 4BIDA 2JKOA 5G6VA 4ITJA 4BDFA 4D2PA 4HOKA 4CFXA 4F7LA 2C3IB 1XH5A 2X8DA 3MI9A 4X21A 4L7FA 1SZMA 3UBDA 5CAOA 3KF7A 4ITIA 4FKVA 5KMKA 1P4FA 3PP1A 2I0YA 2QOOA 4U8ZA 4W4WA 2VWWA 1IASA 3RPRA 4BYJA 2G2HA 5H8EA 2J50A 4EC9A 3CKXA 4L3LA 1XHAA 2QU6A 3GU5A 4EOPA 4FZDB 4BCNA 3UDBA 3OEZA 5BVOA 3SW4A 4NTTA 4EOLA 3KQ7A 4F08A 3DLSA 1AGWA 3V3VA 4D5HA 3OUKA 3CXWA 3RBWA 2C6TA 4EH7A 2J5EA 4DGNA 4XEYA 3R8PA 3ZUVA 4USEA 2PE1A 3NVMB 3BU5A 5DNRA 3E87A 4CEGA 1ZYDA 4J98A 5CSHA 4C8BA 1J7LA 1ZMUA 4B9DA 5CSWA 5AA9A 5AV0A 5EDQA 5J95A 3ZBXA 3KMWA 3R1SA 3R02A 3U6JA 2JEDA 4FSQA 2BTSA 4W9WA 4FV2A 5CNNA 3AXWA 3LAUA 1PXNA 1VYZA 2ONLC 3ROYA 5T68A 4ASDA 2HIWA 4BTFA 4C62A 5EQYA 5L6WL 3CS9A 3IOKA 4QQCA 3K5VA 5ACBC 3NGAA 3UO5A 3BWFA 5F20A 2X0GA 4XG7A 3OXIA 4BYIA 5HLWA 4MNFA 4GH2A 3QQLA 2B54A 2UZNA 3PPJA 1P14A 4FKOA 3KREA 4YGAA 4QMNA 3A7GA 3FYJX 4Z7HA 5J9LA 4F63A 3LMIA 4O7NA 1MRVA 4QNAA 4APPA 5IA3A 2I6LA 4C57A 5FM2A 4BR3A 4FV9A 2YFXA 1Q8WA 2WMSA 4PQNA 4TXCA 4YLLA 5F4NA 2ESMA 1YHWA 1CTPE 5AJQA 3QTZA 1UNHA 4XJ0A 2GNIA 4M69A 4I3ZA 2CMWA 2YAKA 4MNEB 4RQVA 4JJRA 3AC8A 4P90A 2OI4X 1YKRA 4AT4A 2QKWB 1X8BA 3JPVA 4ZJJA 3ULIA 4EK3A 4QP6A 5KMMA 2UZTA 3MIYA 1FVTA 1NVQA 3NYNA 1Y91A 4IBMA 4ANOA 2XVDA 5AR8A 4FK6A 2JKKA 4GEOA 4O0XA 3ANRA 3A4OX 4FIGA 4XLVA 3R21A 1OIQA 1YXUA 3DGKA 4P5QA 3GU8A 3UYSA 5HCXA 4MWHA 4NW5A 3EWHA 2UZVA 3FWQA 1M7QA 4LOQA 3ZO4A 4CQGA 4CXAA 1PKDA 2BCJA 3ORKA 5AUTA 2HENA 3HP2A 3TI1A 4EKKA 2WEIA 4YJTA 5E8XA 3Q9WA 4ZMFA 3S0OA 3VUHA 4EQUA 5I9WA 5H8BA 3ZLYA 2JFMA 3NAXA 4KABA 3BGQA 4KSPA 3MVMA 3QZGA 3AC1A 1H00A 5AV3A 3QLFA 5K9IA 2R3IA 2E9VA 4KB8A 1WBPA 3VF9A 4I6QA 4E4XA 3I0OA 3O2MA 3OTUA 4MXXA 4LOPA 3Q3BA 3RVGA 2V62A 5TR6A 4KWPA 5DH3A 4ZJIA 3NLBA 3NEWA 2EB3A 4ZEGA 3RNIA 5EW3A 5LVOA 2XK9A 3QRJA 5CAPA 4EONA 5CNOA 4L52A 1JKTA 5A6OA 2J7TA 5IEXA 3HNGA 4XP0A 4XUFA 4L43A 5CEKA 4DGMA 1QPCA 3U9CA 2W1HA 3OBGA 1DI9A 3DDQA 4AN2A 3BBTB 3D14A 2H8HA 5HBEA 5K3YA 2F49A 2O2UA 2H9VA 4IWDA 4YURA 4RX9A 4BB4A 2ERZE 4S34A 2XNGA 4CKJA 5BUEA 2BUJA 3M1SA 4ASZA 2VWIA 4YZMA 1Y8YA 4R5YA 4E26A 1GAGA 5DA3A 4IAKA 3QTXA 2PUNA 4MH7A 5J7BA 4E4LA 2WU6A 3KEXA 3WYXA 1J7IA 3D7ZA 3T3VA 2UW9A 3SRVA 4DE4A 4O0YA 4GK3A 4FEUA 2V5QA 4Y85A 4QQ5A 4D2TA 4EK6A 1VJYA 2QOLA 1Y8GA 5H8GA 5L2TA 4KRCA 3IG7A 2F57A 5K0KA 3ZZEA 4B6LA 2WB8A 4C37A 4HJOA 4TL0A 3LOKA 4EJ7A 2VN9A 3EFWA 3PWDA 2ITYA 3IS5A 3Q2JA 4YNEA 3PIZA 4Q2AA 1IEPA 5AP2A 4ZY5A 4R78A 2ZB0A 4G6OA 3IW8A 3O7LB 4C3FA 2PVKA 3MFUA 4ASXA 5DR2A 3R8ZA 3HAVA 1XO2B 1YHVA 1OL1A 3UNJA 3UP2A 2OIQA 4D58A 2RGPA 4UEUA 1ZYJA 3ULZA 3ZRKA 4FIFA 4DH8A 1FVRA 2YCRA 4IB5A 5FDPA 3TACA 2PSQA 2GNHA 5K5NA 1GOLA 3K5UA 4FNYA 1QL6A 3TNIA 3RHXA 4HVHA 3TZ8A 4IACA 1OB3A 3O51A 4DH7A 3FPMA 3C7QA 1H26A 4O6EA 4AN3A 5EHLA 4O21A 3NCGA 3C4CA 5DR9A 4KNBA 4O0VA 5CQWA 4NFMA 2PK9A 1UU8A 1GIJA 3FQHA 5FTQA 5HCZA 4O96A 3VS7A 4EQMA 4QTBA 2FA2A 2OF2A 4WA9A 4W4VA 3WIGA 3EOCA 5KMIA 5KMNA 4V01A 3ZXTA 3DPKA 3QF9A 4KS7A 3EQFA 5E7RA 4O7RA 1G8SA 4BBEA 4BDEA 1OUYA 4QPMA 4TYEA 1E9HA 4UYAA 3R7YA 4G6NA 2QOQA 3JXWA 4I0TA 4YJRA 5CAUA 4MAOA 3Q4ZA 3QALE 4OTFA 2JIIA 5CT0A 4FX3A 5E8UA 4R5SA 3THBA 4CT2A 3MA3A 3FY2A 3LFQA 1QCFA 3OF0A 3QUPA 4AA4A 4BTJA 3FQEA 5FEEA 3SXRA 4BDHA 2IO6A 2OO8X 1JPAA 1H1RA 3D4QA 4BKJA 3LQ3A 4I93A 2QO2A 2YAAA 1Q41A 2P3GX 4FSUA 3TDVA 2H34A 3TDWA 4FKLA 2CKQA 4QMSA 3PZEA 4U0IA 4UMRA 4FKIA 2VWBA 4I94A 2HAKA 4CFNA 5HBJA 3HUBA 3A61A 3QQUA 3KY2A 4QYYA 3L9NA 4HPUE 5EDPA 4DEIA 5FTOA 5HG5A 3ODYX 3VHKA 3O0GA 4O38A 1Q4LA 3ZCLA 4O84A 2E9NA 3FI4A 3ZO2A 4EZ7A 5GHVA 3FY0A 4I20A 3WZKA 2QC6A 4TWNA 2C1AA 3NNUA 4MQ2A 4UWYA 3W10A 4V0GA 4MEDA 2XJ2A 5EFQA 1OBDA 3DKGA 2JAVA 4C4IA 2QR7A 1OIYA 2WOTA 5ANIA 1IAHA 4IAIA 4F9BA 4RVKA 3BGPA 3ACKA 1IA8A 1BUHA 3CC6A 3KGAA 5DPVA 3O7LD 4CMOA 3P78A 4EEVA 4CFVA 2Y6OA 3KXMA 4M97A 5TO8A 5DHJA 3I7CA 4IANA 5EM5A 4IFCA 4PDSA 2QONA 5JGBA 3EN9A 4BHNA 2WKMA 5CU0A 3C0HA 3RWPA 2BVAA 1J1CA 2BAKA 3UYTA 1PXKA 4KD1A 1BI8A 2B55A 5K4IA 3WF9A 2HK5A 5EKNA 3QWJA 3LXNA 1WVXA 2GS7A 4QP7A 4HVGA 2KTYA 4UXQA 5CZIA 3OMVA 4FF8A 5AMNA 4CT1A 3UGCA 4DG2E 4UWBA 3ALOA 4CSVA 3ACJA 4CYJA 4EOSA 5AUWA 3Q53A 3AC4A 1J3HA 3MPAA 4EHGA 1YXVA 1F5QA 2W7XA 3GB2A 2H6DA 4QYHA 3F3WA 4BZDA 2VO6A 3LQ8A 5A4EA 4IVCA 2CDZA 4NIFA 4U97A 5EK7A 2OZOA 4FTOA 2WNTA 3KULA 2F7XE 3GVUA 5GJFA 3SHEA 5JGDA 3COMA 3NUXA 5JSMA 3DJ7A 1R39A 1EH4A 3NR9A 5AP7A 5KE0A 1BKXA 4RRVA 4FVQA 4KINA 4BKYA 4EOMA 3CCNA 3EL8A 1XBAA 4GMYA 3JUHA 3WBLA 5FRIA 3QX2A 4CTCA 3L8XA 5JFSA 4C33A 3KC3A 2CKOA 2HWOA 3IK3A 4I6HA 5CU2A 3KU2A 4HCVA 4EH9A 4QP3A 2RF9A 3DFCB 3NPCA 3B2WA 3ZHPC 4PDPA 2RG5A 2ZMDA 1CSNA 2QI8A 3UJGA 4C0TA 4YTCA 3N4TA 4EHEA 3BYUA 2YJRA 4QMMA 4YTFA 2PZRA 2CNQA 4WNOA 4DF3A 1PMEA 2XNNA 1OGUA 2NNWB 4I5PA 5T3QA 4O7ZA 3Q2MA 2ITXA 4WNPA 3QA8A 3ENHA 3BCEA 3TNQB 3EQCA 1PKGA 4M0YA 4XBRA 4O7SA 1XH8A 2EB2A 4ACCA 2W1EA 3ORZA 3NZ0A 4BI0A 4GIHA 3GFWA 2NRYA 4J96A 4IM3A 5ANKA 1LR4A 1XH9A 3H3CA 3DB6A 3ZXZA 2YM4A 4J95A 1FVVA 3R2BA 4I5HA 5CT7A 3BX5A 4QMPA 3VBXA 1YRPA 2AC5A 1U46A 3LXKA 4EOJA 2OK1A 2CCHA 2QLQA 4ZSJA 3UE4A 3PYYA 1ZZ2A 4X0MA 4WSQA 3PJ3A 3W16A 3UTOA 5A14A 3F61A 4JL9A 3TIZA 3ZC5A 4BCHA 4ZZNA 4YU2A 4JQEA 1Y57A 4IAYA 2WD1A 2XBAA 3AD6A 2W5AA 4J52A 4M7IA 4O2PA 5EOLA 4ZTQA 5BMMA 5CEQA 2QOHA 3GOKA 4P7EA 4HYSA 1XBBA 2W1FA 1W0XC 2ITTA 5AP4A 5AR5A 4BF2A 3VUMA 4NCTC 3FLNC 4BRXA 2BMCA 4WT6A 4DHFA 5JT2A 3FZTA 2VTAA 2QQ7A 4I24A 3BGZA 3U51A 5LVMA 5AADA 3DBEA 5ANGA 2EU9A 2GU8A 3KVXA 3PPZA 5F95A 4YP8A 1L3RE 2Q0NA 4WG4A 4MVFA 2ITQA 3R83A 2QR8A 3VWAA 4I41A 4KA3A 3FMLA 2NP8A 3NNXA 3NUNA 4FI1A 4D1XA 4YC6A 4XP3A 2C69A 2R9SA 3FLZA 3KKVA 1H0WA 3SOCA 5EKOA 5IA1A 2VX1A 4L9IA 4GIIA 4EHZA 4XV3A 1GY3A 2GS2A 5HCYA 1JOWB 3GOPA 3F2AA 5IA5A 3V8TA 2R3KA 3VO3A 4U44A 3DV3A 4H58A 3LJ1A 2YDIA 4PDYA 4MBIA 2BAQA 4IEBA 4XV9A 3ZRMA 2BKZA 5HO8A 4J99A 1Q8TA 2WTIA 1DM2A 3D2KA 4B7TA 1FMOE 5I4NA 4L8MA 1WZYA 2BILB 3DB8A 5GIOE 4XG4A 5T6KA 3ZLXA 3P7BA 5I3OA 4B99A 4NWMA 2YERA 1YXTA 4G9RA 4E8AA 5IG1A 5I9YA 4GL9A 4CFMA 2P4IA 3UQCA 5KHWA 4EH5A 2XF0A 1O9UA 2VGPA 2C0TA 4DTKA 4FL3A 3NYOA 3I81A 3GP0A 4E6CA 3QRKA 3E8EA 2JBPA 4M68A 2X8IA 5AP3A 5AFVA 3LKMA 1CKJA 2P2IA 4LM5A 2UW5A 2XYUA 1YOJA 4O82A 4DEBA 1GZ8A 1O6YA 2B9HA 2QOIA 4U40A 1TQPA 1YI4A 3FC2A 3OWPA 3ZSGA 3BE2A 4JBOA 4QYFA 2XCHA 4KIOA 2VZ6A 4QTAA 3JVSA 5H2UA 4HNFA 3QXOA 3QX4A 4ZY6A 2IW8A 5GINE 2BFXA 3OCBA 3QQHA 5DGZA 3QUDA 1YI6A 2GSFA 5EHYA 1YOLA 2PU8A 2XM9A 4ZP5A 5J79A 3BYVA 3QGWA 1NT2A 4BY9E 3GGFA 4JQ7A 3WZDA 3LHJA 4D4YA 5CAQA 4K11A 2B0QA 2Z60A 2XBJA 2WMUA 2Z2WA 4XRLA 1H0VA 2B9FA 4O0TA 4DLJA 2BZJA 4FNZA 3FDNA 4RIOA 4JBQA 4GJ3A 5KMLA 1XH7A 4C58A 3F9NA 3PVWA 5LWNA 2HOGA 2PHKA 3EYHA 3E3BX 3VS0A 4FTTA 3V04A 3HV5A 3CPCA 3KXZA 3LVPA 3VJNA 4EK4A 2A1AB 4OUCA 4LOOA 3REPA 2C5NA 4CLJA 1K2PA 3QD4A 1M2PA 2QD9A 4CKRA 3JY0A 3QCSA 2XJ1A 3BBWA 2O0UA 3MY0A 5C27A 2PZPA 3VAPA 4GFMA 4FV1A 2IZTA 3QTSA 4FZFB 2G9XA 5HTCA 4R1YA 4FIJA 4AUAA 3TNWA 5A9UA 4E5AX 3QHWA 3HV3A 3ZDIA 3TZ9A 5JKGA 3S2PA 4ACMA 4RX5A 5BMSA 3A7FA 1OL2A 3GCVA 4HVIA 3F88A 3W2PA 2AC3A 2GPHA 2I40A 5C03A 5KZ0A 1JKLA 4PNIA 2WIPA 4NUSA 3A7IA 3FKLA 5AX3A 3DQXA 3FZOA 2ITPA 5HO6A 4LMNA 2RG6A 4RZWA 3DAJA 2AUHA 2GDOA 2XZSA 5HEZA 4E5BA 4DCAA 5C8KA 5D1JA 3C50A 5CI6A 4F9YA 4W9XA 3O8UA 4O6LA 4N6YA 4WNMA 1B6CB 5L3AA 2PWLA 3EHAA 5AA8A 1MP8A 4M15A 1FGKA 4TY1A 3PJ1A 4N0SA 4C3PA 3FKNA 3PJCA 2X81A 3D94A 1XWSA 3QYZA 4FKSA 4DLIA 5L8LA 2JKQA 4EZ5A 1V0OA 3MGYA 2BROA 3P23A 4GVJA 1Q97A 1R1WA 4D4RA 2YLFA 2ACXA 4C4GA 2GQSA 3TL8A 3LCTA 2ERKA 1SYKA 2CGXA 4RFZA 4L7SA 4C59A 1W82A 2JD5A 5IPJA 1YW2A 3U6IA 4YJNA 3NUAA 2F2UA 3DOGA 3LFSA 2VTHA 3HGKA 3PRFA 4EORA 2G2IA 2UW4A 5CEOA 2NRUA 3ELJA 3VJOA 5AP6A 3W2SA 2WMAA 3PFQA 3CQWA 5DOSA 3NAYA 5KZIA 1E1VA 3OFMA 1YXXA 4Y8DA 5I9XA 1ZAOA 4JIAA 4HGLA 2PUPA 4DT8A 1NA7A 4ANSA 3PZHA 2WTDA 2OSCA 4YNOA 3RKBA 3QQFA 4ZTMA 1Q8YA 1YWVA 4GJ2A 4EJNA 4F65A 2RL5A 2Y0AA 4DTAA 3EFJA 1W83A 4RFMA 3CQEA 4ZS0A 2VNYA 5E8VA 3AT4A 5IDPA 3E8DA 4OTIA 4AZVA 3TZ7A 3UZPA 3UNKA 4A06A 2FGIA 4HCTA 3UO6A 3QC4A 2FVDA 2W17A 4RIWB 2JAMA 4FV6A 4O91A 3L9PA 4CZTA 1KOBA 4UWCA 2ZDTA 4E7WA 4JR3A 5JZNA 4F6SA 3TTJA 2BDFA 4HCUA 3I5ZA 3O96A 4PTCA 4H36A 2R4BA 2DUVA 3RJCA 5A4TA 5JH6A 3KULB 5LMKA 3NMUF 3RAHA 2R3MA 4YBJA 1URWA 2CSNA 3UPXA 2JFLA 2XNBA 5L2WA 4IWQA 4XMOA 4B0GA 2HZ4A 1DAWA 2YM7A 3FHIA 3IDCA 3UIBA 4I6FA 2WU7A 1WMKA 4LGHA 3FI8A 1YWRA 3OWLA 2BHHA 2XIRA 3C5UA 3RZFA 1RE8A 5D11A 3OG7A 1WBTA 4YJQA 4FICA 1G5SA 5CSPA 4OT6A 2VWZA 2CKEA 4XOYA 5FDXA 3U9NA 4YMJA 4EI4A 3EJ1A 4JG7A 4IDVA 4CG8A 2GNFA 2UW7A 4MYGA 4BFMA 4IDTA 4EH8A 2BPMA 3R28A 1A9UA 2J9MA 3BHYA 4XP2A 4DG3E 2XM8A 3IDBA 2ETMA 4RC2A 4MF1A 4FKPA 2X2MA 4BWKA 3JS2A 2UZDA 3RK7A 2WFYA 4TPTA 4RWIA 5HIDA 4CQEA 3PTGA 4MD7E 5ACKA 1WBOA 2C5XA 4BCFA 3CJGA 4RJ4A 4TKSA 4W8EA 3BV3A 4L00A 4LI5A 4HW7A 3HMNA 1VYWA 3FL4A 3HV4A 3EN7A 1QPEA 3OOGA 3PSDA 5M51A 4FNXA 4Z55A 4X6RA 2I7QA 2PVRA 4F6UA 4AAAA 3OCTA 4MK0A 3UOLA 2CNVA 2XUUA 3CP9A 4G16A 5ITAA 3DFAA 5BUIA 5CF6A 3PP0A 4C36A 4EYMA 3D15A 4NK9A 3OXZA 3FXZA 4FGBA 3UOHA 4PTGA 2YISA 4UXLA 2ZV7A 3P79A 4FL2A 3QU0A 4KBAA 2RFSA 5HLPA 4IFGA 3PJ2A 2C6OA 4LL5A 3SKCA 2UZBA 4WBBB 4U7ZA 2W05A 4M12A 1Y6AA 2VTMA 3WYYA 2EXCX 2Y4IC 2GS6A 4ZLZA 3TG1A 4CV8A 3A4PA 1OPLA 4FTAA 5AX9A 5J7HA 2WMTA 1T45A 3FLSA 4LGDA 4KBKA 4ZLOA 4BGGA 3Q5IA 4PTEA 3KFAA 5CF8A 3LFFA 5KBQA 2YM6A 3ETAA 3H9RA 4TWPA 1H08A 3DZQA 3HA8A 5FD2A 3UIUA 3UOJA 3KB7A 3UO4A 3H4JA 4PPBA 4FTJA 4AZWA 4Z7GA 2YWPA 2R3PA 4IW0A 4PMPA 2VTJA 4LG4A 3QD2B 4YHJA 1OZ1A 5DWRA 5EG3A 3NIEA 3DT1A 2UZOA 3DK3A 4LUEA 5IQIA 1H1QA 3F7ZA 1Q5KA 4GUBA 1R78A 4FEVA 1UWHA 2PMLX 4QP2A 4E4NA 5LOHA 5CEIA 5FG8A 4JBPA 3RI1A 4Z9LA 2ZDUA 5HKMA 4ALWA 4FSWA 3ODZX 4XS2A 3AC2A 2Y7JA 4AG8A 5L2SA 5LVLA 3TKUA 3BV2A 2HWPA 2QU5A 3MTFA 5B7VA 3D7TB 1SM2A 2PVLA 1OL5A 4FG8A 3MPTA 3QZHA 4FKJA 4R7IA 3T9TA 2HYYA 4CVAA 4O7LA 5I3RA 4RIXB 3OY3A 3MN3A 3E64A 4E73A 2IZSA 2X9FA 1O6LA 5B2LA 4FT5A 5AUZA 4BDGA 2HXLA 3TNPC 4BDKA 2E2BA 4X7QA 3VQHA 4D9UA 3PG1A 4AT5A 4LV8A 3IKAA 3KRRA 3EKKA 3S00A 2J90A 2VTTA 4APCA 2YIQA 4PP9A 4N4SA 3WF7A 3F5PA 3LFAA 4X2FA 1V1KA 4BCGA 2J0KA 4WG3A 5HD4A 4CGAA 3QTUA 4F1TA 5KMOA 3LJ0A 3ORTA 4UZDA 5CU6A 4QMXA 3C4WA 4AOTA 4JVGA 2J4ZA 3DKCA 3R6XA 4TTHB 3C13A 4J1RA 1OMWA 2OBJA 3AGLA 1HCKA 5C9CA 3PLAE 2R7BA 4K6ZA 3T8OA 3BQCA 4I0RA 4QYGA 5E8WA 3FYKX 3GNIB 3F66A 3L9MA 3ORLA 4AA0A 4DBNA 5IZFA 4DFUA 5IQHA 4D2RA 4PRJA 2P33A 2B4SB 1BYGA 3KRLA 5HORA 3QWKA 5BX0A 3EKNA 3PXZA 3IW7A 4RVMA 2YN8A 2FH9A 1IA9A 5IQBA 3EH9A 3GC8A 3MDYA 5KBRA 5IEYA 1DI8A 4ZAUA 3DBCA 3FJQE 4AZSA 2IVUA 4KS8A 2BRHA 1G8AA 3GXLA 2QOKA 3UQGA 2R3GA 4BGHA 3AG9A 4WIHA 3ATTA 5ANEA 2UZWE 4Y46A 3FXWA 4KRDA 3PY0A 5GNKA 3OHTA 3QHRA 2CKPA 2BZKB 2VAGA 2YCFA 4IM2A 2P0CA 4ZK5A 3V5WA 3VUGA 4EUUA 2WMWA 2IWIA 4DEGA 2B9JA 4NT4A 5AR2A 4OT5A 1U4DA 3MH2A 1OI9A 4GS6A 3DXNA 1ZYLA 3VUTA 5DBXA 2QURA 3LJ2A 4FTQA 1PF8A 5D10A 4HZRA 2XCKA 3G90X 2VRXA 4DC2A 5JRSA 4J71A 5JFVA 1SNUA 3FMEA 3PA4A 5M57A 5CLPA 4FODA 4U42A 2CPKE 4ONAA 1CKPA 4MXZA 5IH6A 3WE8A 3M11A 5FGKA 3DTWA 2ITNA 4MWIA 3O23A 3G9NA 1DS5A 4CFFA 2G2FA 1REKA 3F3TA 2YA9A 3HZTA 2W1ZA 2Z02A 3AQVA 4F0IA 4F1MA 3TUCA 4YSJA 4YSMA 5D41A 4AW0A 4I0SA 3BIZA 2YM5A 4M84A 5AV1A 2UVXA 1NY3A 2OH4A 2XKEA 2Z7RA 2A2AA 4K8AA 5HVKA 2XNOA 3L9LA 2BAJA 1IRKA 5IUIA 4D2VA 3DXQA 3D5VA 3FMDA 4GU9A 3PVGA 2F9GA 4GT5A 2C6KA 3LE6A 5E8TA 5EI6A 3DLZA 4AW1A 2W1DA 3KN5A 4X3FC 4FT0A 3KXGA 4C4JA 4IH8A 5E1SA 4YZNA 4YZBA 5KCVA 3A2CA 3HMIA 4D5KA 5E8YA 3HDMA 5I0BA 4TZRA 4NH1A 4AE9A 5EW8A 5FQDC 3DAEA 4GW8A 5CXZA 1JBPE 5L8KA 2I0EA 2X2KA 5ANJA 2VO3A 3MWUA 1VR2A 2GNJA 4JIKA 4MX9A 4AZEA 4DGLC 2WQEA 4DTBA 3GQIA 4ZJVA 2R7IA 4U43A 3G6HA 3SA0A 3WZUA 3NRMA 4AA5A 2GHGA 4UZHA 3BPRA 3C51A 3PUPA 4FNWA 4FTIA 5CQUA 3NUYA 4OBOA 5M07A 4UBAA 4CRSA 4NSTA 2BHEA 1ERKA 4O86A 4L44A 3CEKA 4O27B 4BCQA 1ZZLA 3GT8A 3MVLA 3Q9YA 2CN5A 5CWZA 3ZRLA 4F99A 1TQIA 5EM6A 3AOXA 5AR7A 2C0IA 5GJGA 4FEQA 4OTRA 3WZEA 3I60A 4RC3A 4TWCA 2ITVA 1XH4A 4XLIA 5BNJA 3VIDA 2IN6A 3GCPA 3Q96A 4AGUA 3BZ3A 1H25A 2JGZA 3ET7A 3RK9A 3U54A 3HMOA 5B2KA 2ONLA 1WVYA 3KRWA 3PIXA 2J6MA 5CEPA 4KUJA 4L42A 1E1XA 2WTJA 3AC3A 4NEUA 4OGRA 4EL9A 3RPYA 3IGOA 4CMTA 4FV4A 4QYEA 4YJUA 5HO7A 4FTUA 4GVAA 2A4LA 2X9EA 5C8NA 4BTMA 3CSVA 4O0WA 1BI7A 2CNUA 5JK3A 1VZOA 3QZFA 5IA2A 3EFLA 3EZRA 2W1GA 4BGQA 2XNEA 1Z5MA 3ANQA 1PMNA 3Q4CA 4AGWA 1Y6BA 5GIPE 3AMBA 2OJJA 3A62A 3GU6A 3NVKI 1ZARA 1JSUA 2YIXA 4MD8E 4XHKB 3ORPA 2CGWA 4Y73A 3F82A 5DIAA 3TJCA 4AQCA 2BRNA 2UVZA 1O6KA 3COKA 4RIWA 2R2PA 5HI2A 3LCSA 4J7BA 4MBLA 3TV6A 5F9EA 3OXTA 2XJ0A 4D4VA 2BKKA 4L67A 1H1SA 3VBTA 3BYSA 4L45A 4LGGA 3B8QA 2XIXA 4WKQA 3VS1A 4QO9A 3C4XA 2JKMA 3E63A 3P08A 4RMZA 4USDA 2OU7A 4GYIA 3LLTA 3MB6A 3RNYA 4CG9A 2OJGA 4GUEA 2RFEA 1M17A 1U59A 2BRMA 3NW5A 4MBJA 3BE9A 3W32A 5K5XA 3ZYAA 4EK8A 5AP1A 3N51A 3R1NA 4OW8A 3CTHA 4CYIA 4H3QA 3G0FA 4RWLA 2OFVA 4D9TA 2XKDA 3PPKA 3PVBA 4FTCA 4F1OA 4ZSAA 4LRJA 3E93A 5FBNC 2X8EA 5IUGA 2UV2A 4TYJA 4AF3A 4FIHA 5C4KA 4C7TA 2PVJA 3PE2A 2OXXA 1DAYA 2PZIA 3R04A 1GZNA 2DQ7X 3FZSA 4K2RA 1ZYCA 4PX6A 2W06A 5HIEA 2F7ZE 3LM5A 3B2TA 1KE8A 2ZAZA 2VD5A 2AYPA 4BDCA 1W84A 2BIYA 4YO6A 3W2OA 2X4FA 3Q32A 4EOKA 4GKIA 3W18A 3WF6A 3LFBA 3BWJA 3VHEA 1Z57A 3FSKA 3MFRA 3QCXA 3GC0A 5HE1A 4OLIA 1FMKA 5HG9A 4F70A 5BVFA 5M4IA 1F3MC 3EYGA 5EQEA 4MXOA 1IAJA 3DY7A 2QNJA 3MTLA 1J91A 1UKHA 3K54A 4GRBA 5J5TA 1AQ1A 3BEAA 2XKFA 5J8IA 2ZYBA 4FBXA 3VS4A 3W33A 3PA5A 2ZMCA 3MBLA 5A3XA 4O7WA 1AD5A 3EB0A 4QPSA 4CFUA 2WAJA 4BICA 3U6HA 2UZLA 5AUVA 4NKAA 4ANBA 2Y8OA 2OJ9A 4BIEA 1ZWSA 5IF1A 5M4FA 5L8JA 2JITA 2XNMA 5DLSA 3I4BA 4NM3A 2PZ5A 3QL8A 5HICA 3WZJA 4JR7A 4G9CA 1PJKA 1FOTA 3R0TA 2WQBA 3OWKA 4N70A 4CD0A 3OCGA 4Y5QA 5FXSA 4DCEA 4EBVA 1GJOA 3DA6A 3HRCA 3Q6WA 1ZRZA 2HY0A 3Q9ZA 4QPAA 1SVHA 4QMYA 4DFLA 3AC5A 2WQMA 1M7NA 1PXPA 4LV5A 2WXVA 5LMAA 2Q0BA 4ZOGA 2C1BA 3R9RA 5IQAA 1YDSE 4EH2A 4FG7A 4ITHA 4UMTA 2X2LA 4WUAA 1JSVA 4S2ZA 4QOXA 3BQRA 2YM3A 4K33A 3EQPA 2P2HA 4FZAB 2XS0A 4FV0A 4A9RA 5JQ5A 2JDRA 2UZEA 1I44A 3DBQA 4QP4A 2VX0A 4CFWA 5LVNA 4A9TA 1S9JA 3ZUUA 5HX6A 3F3VA 3HECA 3TEIA 4PWNA 3OEFX 2PVYA 4XV1A 1BX6A 3BLHA 4FZ7A 5HQ0A 4E93A 4FG9A 4G1WA 1GIIA 1KE9A 3I5NA 4UN0C 5BYYA 5E4HA 4YJVA 3E3PA 4UALA 3VRZA 4F0FA 5AAEA 4WRGA 4FSTA 4MCVA 2C0OA 4S30A 5BVDA 5CZHA 1KV1A 3L1SA 3SDJA 3V8WA 3TJDA 3KK8A 2ZOQA 3TKIA 4UX9A 5D12A 3I7BA 4A9SA 3D7TA 3E5AA 5F94A 2C5VA 3VUDA 4F7SA 1F0QA 3RCDA 2CJMA 4I5CA 3RP9A 1H01A 1XBCA 4FV5A 3D5XA 3UQFA 4RIXA 4USFA 3W1FA 3LMHA 1MRYA 3TUBA 2VTPA 4FT7A 3HRBA 3EIDA 5H9BA 2IZRA 3SX9A 2PVHA 2OFUA 3E62A 4IZ5A 4AZTA 4QNYA 3JR1A 4OTPA 2J0JA 2UZUE 3Q9XA 1ZOEA 3QRTA 4YC3A 5KKRC 4FA2A 2I0HA 4RJ3A 5DT4A 3V6SA 2LAVA 2R3LA 3OC1A 2CGVA 3LMGA 4JDKA 3FXXA 4OTWA 4XH6A 4R7BA 1LEWA 3W2QA 1Q3WA 5GZ9A 4ZTHA 5EM8A 3VS3A 5KMJA 5J1WA 2CHLA 4PMTA 2XIYA 1MRUA 3QAME 3GQLA 5HLNA 2WTKC 3GC9A 4BCOA 3I1AA 4KIKB 3SV0A 1G3NA 5G1XA 4ACHA 4AP7A 3PJ8A 3M42A 2OXDA 4NYEA 2RKUA 5AR3A 3KMMA 3RPOA 4BBFA 2X7OA 3OROA 3ZM4A 1LP4A 4DITA 3G6GA 3R7OA 2J2IB 2C6EA 5TE0A 4LMUA 4AX8A 3EN4A 4D2SA 4ERWA 3KCFA 5CF5A 3WE4A 4QP9A 5FEDA 3N9XA 4ENYA 3OT8A 4YJSA 3HL7A 3F3ZA 3PIYA 5D7AA 3WILA 3E88A 4ALVA 4C3RA 4NM5A 3SLSA 3GBZA 4ANNA 4EOOA 1S9IA 4YUQA 3LPBA 1NW1A 5EYKA 3A8XA 4F7NA 1B39A 4DH3A 2BRGA 1PY5A 2F7EE 3G5DA 1OKZA 3LFCA 3B8RA 2VWYA 3GC7A 3HUCA 3IW6A 2PVFA 4YR8A 3FLYA 3MVHA 2YABA 4PDOA 4Q5EA 4QMVA 3COHA 2XK8A 1YOMA 4BBMA 3KL8A 4EKLA 3IDPA 3EQHA 2X1NA 2VTNA 3N4UA 4EOQA 4NJDA 2PE2A 2XRUA 3IO7A 3ZEPA 3CD3A 2BFYA 2OXYA 2WZJA 1J7UA 3MH3A 4FTLA 5BVNA 5EI8A 4IB0A 4PUZA 3KN6A 2F4JA 4ALUA 3CY2A 4I4FA 4B8LA 4DH5A 1FGIA 2V7OA 3QGYA 2RFDA 2R3HA 4DGOA 5FTGA 3C4ZA 1H4LA 2IW6A 5HD7A 3KCKA 3RPVA 3TT0A 5EH0A 1BLXA 5CS6A 4BL1A 3VS2A 5AV2A 5KX8A 4QRCA 3SQQA 4BIBA 2HELA 4BDDA 2PMNX 4ZZOA 3DXPA 4N6ZA 3KA0A 3R01A 3R71A 4G3CA 3CTJA 2PTKA 3ZO3A 1JQHA 3HV7A 3RPSA 5EI2A 1M14A 3FI2A 1KWPA 3AMAA 4D2WA 1H24A 2OJIA 3U4UA 1LPUA 2VTSA 5ETCA 5FP5A 3TZMA 4YZDA 2BALA 2WTWA 4RX8A 4IQ6A 4BN1A 2C6IA 4NZWB 3C4FA 2IPXA 4BDBA 4EUTA 3FLQA 3V5PA 3R30A 4GT3A 4AE6A 1URCA 2YDKA 1ZMWA 2Y4IB 3DQWA 4UV0A 1SNXA 4IWOA 2OKRA 4LYNA 2YEXA 2W99B 4XOZA 5DT3A 3IW4A 3FZPA 3C1XA 5HBHA 2GHMA 2JDSA 5DRDA 3H9FA 3L8PA 1OVEA 5CAVA 5ANOA 3FMMA 4I92A 3CLYA 3IECA 3ZBFA 2UW6A 3T9IA 3U55A 4MXYA 5HHWA 5DI1A 3QA0A 5D7VA 3KRXA 3T3UA 3LFNA 3PXRA 3DKOA 5EYMA 4BWPA 5ETIA 3TM0A 5E8SA 5HNGA 3F2RA 3P7CA 2JIUA 2IZUA 4G17A 4L6QA 4NTSA 4CCBA 3W2RA 4QMLA 4A4XA 4AZFA 4YZCA 3HEGA 3TKHA 4JX3A 2YIRA 2UUEA 4BTKA 2KULA 4YHTA 3R00A 2VTQA 3DAKA 4C34A 5IMEA 3FEGA 3P0MA 4YTHA 3PSCA 1PYXA 3COIA 3I6UA 4XG6A 2FUMA 4PL3A 4UY9A 4AGDA 3FI3A 4IX3A 1JVPP 1OL7A 4IB3A 1FINA 4L3JA 2O5KA 4D1ZA 3EFKA 3I6WA 3ORXA 2X7FA 3FQSA 3UG2A 3TUDA 2QODA 4EZ3A 4DEEA 4E5WA 3FMNA 1Q61A 2WMQA 3WI6A 4E6DA 5AIKA 5DG5A 3P86A 4DFXE 2DWBA 4I4EA 3ZDUA 1NVRA 4R6VA 4AN9A 5HOAA 3NW7A 2GCDA 5J9ZA 2W96B 2JLDA 2C6MA 4E20A 3CR0A 5AR4A 4U3ZA 4FC0A 2WHBA 5IQDA 2XRWA 4UYNA 3TXOA 5JN2A 4LL0A 4NCTA 2FSMX 4FKGA 5C01A 3MVJA 4L3PA 4G2FA 3EQRA 4G6LA 4X6QC 4HNIA 4IC8A 1BMKA 2QOFA 2OW3A 5E8ZA 5HG7A 4IMYA 3R8VA 3WIKA 4P5ZA 5A4LA 2J0IA 2YM8A 3A7HA 4IC7A 4EH3A 2ITZA 2C6LA 2R3QA 3H9OA 3MPMA 4IVAA 2XA4A 5IDNA 1Q8ZA 4K77A 2WTCA 4KKHA 5HTIA 2YIWA 4ZSEA 2VWVA 4J8MA 4JG8A 4RJ7A 2XKCA 3R7IA 3PDTA 2GFCA 4IZAA 4U9AA 2IG7A 3BI6A 4FV8A 1PMVA 4DFYA 3GFEA 2FSTX 4L46A 3FAAA 1RDQE 2VX3A 5CSVA 3TN8A 4DGGA 4PP7A 1W8CA 4I22A 3CQUA 1H1PA 3UODA 4A7CA 4F9WA 2QG7A 2OG8A 5K0XA 1BL7A 2V22A 4PMMA 5CVFA 4B4LA 3OW3A 2B53A 2GQGA 4FUYA 5DR6A 3RHKA 5JEBA 2BZHB 1XH6A 4C4FA 1U54B 2ZM1A 3QFVA 3ZH8A 4L01A 4JAJA 3BELA 4JX7A 4A9YA 4QMQA 3VBWA 4RGJA 5AM6A 3E7OA 5IA4A 5KNJA 3D5UA 1JLUE 1Q8UA 3M2WA 3VUKA 2E9OA 2EWAA 4M13A 4GU6A 2X6EA 5DE2A 1ZOGA 1PXOA 3VVHA 4AS0A 5M09A 5FM3A 3AMYA 1ATPE 2Y6MA 3R9HA 3BU3A 4U5JA 3NYXA 4YC8A 4P2KA 5EYCA 4W4XA 3TIYA 3MB7A 3S3IA 1YQJA 2QOBA 3DDPA 1H8FA 2OWBA 3BHHA 5A4CA 4TYIA 5BPYA 2XEZA 4UMPA 2FB8A 3RAKA 4IADA 2XIKA 3GI3A 4RIYB 5DEWA 3QCQA 4RQKA 4AT3A 5C8MA 3ZLWA 4IE9A 3HV6A 4I6BA 3ZU7A 3DZOA 1M52A 1P4OA 4FIIA 4O2ZA 4XG2A 2HZNA 2WMBA 3R73A 2CLXA 2VWUA 4M8TA 2RIOA 3DBDA 1ZY4A 5AAGA 1PXJA 4RWJA 1I09A 2EXMA 3ZLSA 1LEZA 3NUSA 3EL7A 5HG8A 4BZOA 4F09A 5K4JA 4Z16A 5L6PA 3A99A 1OIRA 1T46A 4HGSA 2WEVA 3LXPA 5CTPA 3PA3A 3DCVA 4H1JA 3GEQA 4NFNA 4N57A 4WBOA 3EN5A 4FSZA 4AW2A 3FL5A 4W8DA 5C1QB 3VBQA 2HXQA 4L53A 3Q5ZA 2QHMA 4U41A 1SVGA 3UOKA 5HTBA 3A60A 2OH0E 4X3FB 2O8YA 2J0LA 4MXCA 4RG0A 5BYZA 1J1BA 3PSBA 4CZYB 4GFOA 1OKVA 5J9YA 4IJ9A 3POZA 1ZMVA 4QMOA 2YITA 4ACDA 2I0VA 2Y9QA 2XEYA 4BCIA 4D0XA 3UC4A 4BVUA 4NW6A 4JLCA 3D5WA 3QRUA 3O8PA 4PL5A 5AWMA 2VNWA 2ZJWA 5FP6A 3ROCA 3W8QA 1R0EA 5HZNA 4OAUC 4D1SA 4ORKA 5M06A 5AV4A 4O81A 4HZSA 4C2VA 4CTBA 5M56A 2OLCA 2QG5A 4Z3VA 4MKCA 3Q4UA 4M14A 4S32A 2R5TA 2YCSA 4EWQA 3D0EA 4TNBA 2X6DA 5IH5A 5EYDA 2VUWA 3MFSA 4R77A 2VTOA 2YZAA 3O71A 1H1WA 2ITUA 3P1AA 3QBNA 2C3LA 4HGTA 5FBOA 2HY81 5DFPA 3H10A 1ZYSA 4IAAA 4GK2A 4J8NA 3BLQA 4U80A 4FTNA 1CKIA 1BL6A 3F2NA 4RWKA 5E1EA 4BCMA 4FSYA 1WCCA 5J5SA 3NIZA 3O50A 4G3EA 2WIHA 2EXEA 3DK6A 3RCJA 1HCLA 2Z7SA 3R9DA 1KE5A 4BDAA 4FTRA 1GZOA 3VBVA 3UVQA 1H28A 4BZNA 5KO1A 4IVBA 4KAOA 4RZVA 3F5GA 4NJ3A 4XV2A 3V5QA 4AXAA 3QKLA 3CKWA 5E91A 3R8UA 3Q60A 4ZXTA 3IQ7A 5ETAA 4IZYA 3WF5A 3V6RA 1W98A 4JNWA 3VULA 4BDIA 3LXLA 3ATSA 3GU4A 5FLFA 3FMHA 1HOWA 1VEBA 4OTDA 2R0IA 3II5A 3S95A 3AD5A 4FZ6A 3MV5A 4GV1A 4K9YA 5E90A 3RAWA 2PL0A 4GYGA 2OZAB 4RPVA 5DRBA 3OS3A 3CE3A 4FOCA 4R3RA 4TYHB 4FKRA 3SG9A 1TVOA 4TNDA 3SGCA 4CMUA 5BQ0A 4HGEA 3RALA 4R3PA 1OKYA 5TT7A 2HW7A 3FZ1A 3E8NA 3H0YA 3IPHA 3ZS5A 3MJ1A 2I1MA 3QKMA 4I5MA 4KIKA 1OIUA 4JDJA 1YHSA 4O1PA 4IHPA 4O22A 4MF0A 2QHNA 1RJBA 4JOAA 4Y95A 3G51A 2XIZA 2ZM3A 4H3BA 5HGIA 2PVNA 5AUYA 3DKFA 5KHXA 4GKHA 5IUHA 2C47A 2B7AA 4FEXA 5HU9A 3F5XA 5EHOA 4RLLA 3W55A 3D2IA 5EOBA 2E9UA 3K3JA 3NUUA 3TNHA 4O7TA 2OGVA 4DT9A 1SMHA 3L8SA 3ERKA 3FLWA 4IIRA 2WQOA 4JI9A 4FEWA 2BIKB 2PY3A 3PXFA 2R3RA 1OL6A 3HRFA 4RC4A 4YLJA 5FXRA 3I0QA 1XQZA 3R9NA 1P5EA 4H05A 4C02A 1WFCA 1GIHA 4K0YA 4NM7A 3ZONA 3A7JA 3AGMA 4P4CA 1ZOHA 2JDVA 4ZTRA 2C5YA 3BLRA 3GCQA 3N4VA 3Q52A 4IAZA 3FE3A 3HDNA 4OBQA 3W8LA 4FT9A 2HW6A 4DAWA 4WO5A 5IQCA 3IGGA 4FSMA 4B8MA 4BCPA 3ZEWA 3KXNA 1REJA 3BKBA 5IA0A 3R8LA 4WD5A 3GENA 4E1ZA 2B52A 3GU7A 4DEHA 3C4EA 3BHTA 4YBKA 5JFWA 3PWYA 3MYGA 4H1MA 3RM6A 1JAMA 5LJJA 2W0JA 4HVDA 3KF4A 3LM0A 1LUFA 4GFGA 3ZFMA 4MTAA 3C9WA 4JBVA 5TOZA 3F5UA 3V51A 4ANQA 3QXPA 4ENXA 4NKSA 4FVPA 4J53A 5IKWA 4FTKA 4JDHA 4MD9E 5A54A 4E4MA 3VS6A 4A4OA 1P2AA 5FEQA 4QP1A 5CX9A 3VRYA 1WAKA 3F6XA 2YLEA 4V05A 5IQEA 1JWHA 2NPQA 2R3JA 1RQQA 4F7JA 5FUTA 2W9ZB 3BYMA 4R1VA 2Z8CA 3P7AA 3OUNB 2F2CB 3TWJA 5I5ZA 2UW3A 3QQKA 3KRJA 3UZRA 3MSSA 3ZM9A 4CV9A 4F64A 3QQGA 5LQFA 1R0PA 2ITWA 3RMFA 2GNLA 2XH5A 4DBXA 3C5IA 5AM7A 5IISA 4QMUA 5HESA 4JRVA 2BR1A 5L2IA 3FPQA 3E7VA 5EW9A 3VW8A 3R1YA 1MUOA 5B2MA 5DEYA 1KV2A 5BVEA 3UMWA 3LIJA 5BUJA 4PPCA 2WGJA 3C0GA 1UVRA 5GJDA 4C61A 4XCUA 2WPAA 5CALA 2VV9A 3F7WA 2O64A 1CMKE 2C5OA 3VNTA 4IAFA 5ICPA 2W4KA 3K3IA 5A46A 1YDRE 3JYAA 5HIBA 5E92A 1U5QA 2XK3A 3RTPA 2JC6A 1ZY5A 1PXIA 1U5RA 5JRQA 3UZTA 3TV4A 3NDMA 4ZS4A 4MQ1A 3S4QA 1Q62A 1QPDA 2GTNA 4ANMA 2G15A 3U4WA 3HA6A 5L6OA 4TN6A 4HYIA 2QO7A 4AWIA 3R7VA 3S1HA 2QVSE 2ZVAA 3ID6C 4BI1A 1V0PA 5LCKA 3MH1A 3FC1X 3ORNA 4GSBA 5M55A 4RJ5A 5DMZA 4JT3A 3G9LX 3R7UA 1UNGA 2UW8A 4XG8A 4OBPA 2VTLA 4OAVB 4CCUA 2A19B 3IW5A 3UNZA 4D28A 4QD6A 4X2GA 3V8SA 4BI2A 4DN5A 2W5HA 2B1PA 4F0GA 5IU2A 5IQGA 4I21A 4RX7A 5J87A 2YDJA 4R8QA 4EQCA 2W5BA 4RVLA 5HU3A 2C68A 3ZFYA 3LCDA 3MESA 3SC1A 4M0ZA 1ZLTA 3R2YA 3R63A 4D0WA 1APME 2BDJA 4ZSLA 1OPKA 3OBJA 4RFYA 4PMSA 4E6AA 5KKRB 3BU6A 5HE3A 4BC6A 4HYHA 4FV3A 3DTCA 3RGFA 1OBGA 3BHUA 4ACGA 3PLSA 4NM0A 3CJFA 4FV7A 3IONA 3BYOA 4HYUA 4G5PA 2WTKB 2VTRA 3PG3A 3R8MA 4QQJA 1OITA 1UNLA 2IVVA 3CTQA 4FKTA 2BZIB 4M66A 4AGCA 5AP0A 4EK5A 3UIMA 2VGOA 1OM1A 4X2KA 5CYIA 5CVGA 3OP5A 4QMTA 2YZLA 3MH0A 4OR5A 4G3FA 1IG1A 1M2QA 4KBCA 2G1TA 2QCSA 3L8VA 4WOVA 5DT0A 4JDIA 4M3QA 2XK7A 4DFNA 4ZTNA 2C4GA 2JIVA 4YTIA 2X39A 2GFSA 3QD0A 3ZSIA 5AP5A 4RA4A 5CU3A 1XR1A 5M53A 1WVWA 2JDOA 1U54A 2QKRA 3PY3A 3QKKA 3QTRA 3UVPA 3NW6A 1OPJA 5AIRA 5FWKK 3G33A 4AFJA 2PE0A 3PVUA 2OF4A 3CBLA 4TRLA 2JDTA 1CM8A 1OECA 2NO3A 4PPAA 3OT3A 5CVHA 3UP7A 1KOAA 2LGCA 4ANLA 3RK5A 3R7GA 4II5A 1Q3DA 3EMGA 3LW0A 4ZSGA 2RSVA 2CN8A 1ZXEA 2YJSA 4IM0A 3UPZA 4ZZMA 1R3CA 2IVSA 4QTEA 2FSOX 4FVRA 3ZOSA 3P9JA 3OTVA 1Q99A 4M69B 2PMOX 4IX4A 1GNGA 5E9EA 4DEDA 2IW9A 4FYOA 4FOBA 2C3KA 2VWXA 1A06A 4H3PA 1M2RA 2PZYA 3R7EA 4DINA 4XX9A 2W4JA 2J0MB 3CPBA 4I23A 5LMKC 5J1VA 4F9CA 4ASEA 1TKIA 4RIYA 5A6NA 5M08A 1JKKA 2ETKA 3POOA 4IZ7A 4QTCA 4IX6A 3W2CA 3V5TA 1FQ1B 3F3UA 4X3JA 3PXKA 3P5KA 5HE2A 4YHFA 3VF8A 3ZUTA 4DG0E 4QQTA 3U8WA 3NS9A 2X4ZA 2YCQA 3I79A 4K1BA 5CXHA 4DFBA 2DS1A 3CD8A 3FBVA 4R3CA 4JQ8A 5BVKA 2FO0A 2J5FA 3QRIA 1SVEA 3VS5A 2WQNA
chains in the Genus database with same CATH superfamily
1GZKA 1FPUA 4M67A 3QTWA 5LARA 2QLUA 2EUFB 3U87A 4FL1A 3CIKA 5DN3A 4KKEA 5DVRA 3ZFXA 2PUIA 2GMXA 2P55A 3A8WA 2XP2A 3Q4TA 4RA5A 5I9UA 5LXMA 2GQRA 5M4CA 5EQPA 1QPJA 4OTGA 5CEMA 4FMQA 3NSZA 4YJOA 2R64A 4X2NA 4MXAA 4IVDA 4AOIA 3SXSA 4PY1A 3CY3A 4GG5A 1L8TA 3G15A 4DFZE 2C3JA 1PW2A 2VO0A 3SOAA 1TQMA 4BCJA 3C0IA 4C38A 3D9VA 1JSTA 4KIQA 5GZAA 1XMMA 4RT7A 3OCSA 4LRKA 4X3FA 5JQ8A 4A07A 3MIAA 3UIXA 4Y5HA 4Q9SA 3MW1A 2J51A 2V7AA 3ENMA 3EQGA 4XBUA 5M4UA 4ERKA 1KE6A 2OICA 4EC8A 2W1CA 2ZV2A 3KXHA 3RM7A 4GK4A 5KUPA 3G2FA 4G31A 4YJPA 4HVSA 5BVWA 4PNKA 4Q5HA 1OKWA 4G3DA 5H3QA 2O65A 4MNEA 4C2WA 4LQMA 4FGRA 1UU9A 3KK9A 2DYLA 2GTMA 2WTVA 3BRBA 3JY9A 4XG9A 3HAMA 4I1ZA 4U6RA 4ZY4A 1K9AA 4YLKA 4R7HA 4AU8A 3VC4A 2BRBA 3V01A 3TV7A 4C4HA 2VU3A 3O8TA 4F9AA 3HX4A 3ZSHA 4F4PA 3OVVA 4RJ8A 3FMJA 2XB7A 2WMRA 4S33A 3EQBA 2PUUA 3OWJA 5L2QA 1WBWA 1YVJA 2EVAA 3UMXA 5CANA 4WNKA 3FMKA 3OOMA 4TWOA 2VTIA 1YDTE 4J97A 4RJ6A 4UB7A 2Z7LA 3MFTA 3OD6X 2OIDA 3SRVB 4QMWA 4O1OA 4LUDA 4DYMA 3F69A 5L4QA 1B38A 2G01A 3MS9A 4X2JA 3UC3A 1PXMA 2A27A 1V0BA 3MY5A 2O63A 2UW0A 3JVRA 3LCOA 3Q04A 3QTQA 3FUPA 3R1QA 4K18A 3WF8A 1NXKA 3QQJA 4FKQA 1UA2A 3QTIA 4CRLA 4EHVA 1STCE 4E3CA 5BYLA 3MY1A 5I9VA 4RLKA 3BEGA 3EZVA 1JNKA 3MA6A 3SVVA 3RAIA 3R22A 4QDEA 4FYNA 4QMZA 1XJDA 2R3OA 1UWJA 3R9OA 4QP8A 2W4OA 2XK6A 2VO7A 4FUXA 1W2DA 5TKDA 1PRYA 4PV0A 2HZ0A 2Y4PA 4FKWA 4KKGA 5AUUA 5FXQA 3V5JA 4XYFA 4BKZA 3HMMA 3SG8A 5LMBA 3HYHA 4RSSA 3QD3A 4UMQA 2UVYA 4CLIA 2E9PA 3O5AA 3K2LA 4TYGA 4C4EA 5HVYA 4Q9ZA 5HX8A 2ETRA 4BDJA 3VQUA 5HNIX 4EH4A 5IEVA 1A48A 3NYVA 2OZAA 3EQIA 1JKSA 5IH4A 4Y83A 4TYHA 2YIYA 5AEPA 4JMQA 3AD4A 2FSLX 1PHKA 3D83A 3CGOA 4IX5A 3SD0A 3VN9A 5CU4A 3VUIA 1WBNA 4JS8A 4JRNA 2W1IA 1CDKA 3PXQA 4XG3A 2WMVA 4D55A 5GZ8A 2ZV9A 1OUKA 4U79A 4DEAA 5M44A 4FT3A 4G34A 3DU8A 3QLGA 1RW8A 3PY1A 4QT1A 5AUXA 1WBSA 4JG6A 5IMXA 4H39A 3NNVA 1MQBA 2XYNA 2SRCA 3TCPA 4EWHA 2HZIA 4EBWA 2R3FA 2V55A 2RFNA 3EN6A 2B9IA 4WHZA 4O7VA 2YWVA 1PMUA 2PVMA 3DJ5A 3E92A 3LQ5A 4O0UA 4YPDA 3ZC6A 4GCJA 2PMIA 5HE0A 2CLQA 5CENA 3FV8A 4ID7A 4G5JA 4IJPA 5EDRA 3KXXA 2YACA 3P4KA 3LFEA 2OJFE 4DA5A 4FKUA 2WO6A 3DNEA 4MHAA 1KSWA 4TT7A 4OTQA 3WARA 5LWMA 2JBOA 4L68A 2PYWA 3LLAA 3HVCA 4O83A 1YI3A 4A9UA 5A4QA 5B0XA 2OIBA 3E8CA 4YZ9A 3ZO1A 1ND4A 4NL0A 4LRMA 3FZRA 4FK3A 3PRIA 4XRJA 2FYSA 4FE2A 2WELA 4QTDA 3ZTXA 3DBFA 4V04A 4JAIA 3HP5A 2GNGA 3BHVA 4G3GA 5CF4A 4LFIA 5CI7A 3FHRA 1H27A 3ORMA 4BCKA 5JGAA 4ZIMA 3UG1A 1UU7A 2ZB1A 1K3AA 2BDWA 1Q24A 3V5LA 3AKJA 3H30A 1KUTA 1YXSA 4FTMA 3HMPA 4V0GB 2W9FB 4AFEA 5C4LA 4YPSA 3H0ZA 4PF4A 4E6QA 1W7HA 1Z9XA 5EM7A 4RVTA 4O7YA 4ZTSA 3SAYA 3DS6A 2WMXA 1FBNA 3HLLA 1UKIA 3TTIA 4XNEA 4PL4A 3W0SA 3MJ2A 2V0DA 4IWPA 4BWXA 2ITOA 4WSYA 5HVJA 3WOWA 5JZJA 5LVPA 4RBLA 4W4YA 3UVRA 4U81A 4ARKA 4ZMEA 4WRSA 4FSRA 4JXFA 3NUPA 3ZZWA 4EYJA 2PULA 5DYJA 2CCIA 2IVTA 4FIEA 2QOCA 2ZV8A 2R3NA 3DK7A 3G0EA 4FR4A 4IXPA 4OTHA 4Y72A 1XKKA 3AT2A 4WUNA 5CY3A 1YWNA 4BHZA 4O0SA 2Q83A 1UU3A 5I9ZA 5HNBA 2GHLA 2QO9A 1H07A 2XNPA 3QC9A 3SW7A 3LFDA 1IR3A 1PXLA 3QYWA 5D9HA 5IQFA 4EH6A 4KIPA 3IOPA 2XK4A 4GG7A 4D4SA 3GUBA 3O17A 3NCZA 4U45A 5ANDA 3VBYA 3EQDA 4CZUA 4DH1A 3KVWA 5LCJA 4HPTE 2REIA 2WOUA 1QMZA 4F6WA 2A0CX 3LZBA 4YO4A 3GCUA 5ETFA 2BTRA 3DJ6A 3ITZA 4NIFB 2C6DA 3SXFA 1NVSA 4TW9A 2PPQA 3ALNA 4WG5A 4O0RA 3QZIA 5C26A 4EOIA 4ZTLA 3LCKA 4IB1A 1WBVA 3Q6UA 4U3YA 2C30A 5JFXA 4AACA 3AT3A 4A4LA 4NU1A 3KMUA 4FSNA 3PXYA 3FSFA 3CGFA 2HCKA 5CSXA 1PYEA 3OW4A 3ZMMA 2O3PA 4AW5A 4AOJA 3PE1A 3HKOA 3OY1A 4GT4A 3GCSA 3NNWA 3DNDA 3QCYA 3RWQA 1KE7A 2CGUA 2R0UA 2ZM4A 4CKIA 3RZBA 3ORIA 2IJMA 1UV5A 3QUEA 2XMYA 4C35A 4ZLYA 4CNHA 4UMUA 5F1ZA 5TF9A 1MQ4A 2X7GA 3FKOA 3NX8A 5CASA 4S31A 3RINA 2YHVA 3NWWA 2H96A 3OZ6A 5JMSA 4KSQA 2Z7QA 5AAFA 3VW6A 4BIDA 2JKOA 5G6VA 4ITJA 4BDFA 4D2PA 4HOKA 4CFXA 4F7LA 2C3IB 1XH5A 2X8DA 3MI9A 4X21A 4L7FA 1SZMA 3UBDA 5CAOA 3KF7A 4ITIA 4FKVA 5KMKA 1P4FA 3PP1A 2I0YA 2QOOA 4U8ZA 4W4WA 2VWWA 1IASA 3RPRA 4BYJA 2G2HA 5H8EA 2J50A 4EC9A 3CKXA 4L3LA 2AEGA 1XHAA 2QU6A 3GU5A 4EOPA 4FZDB 4BCNA 3UDBA 3OEZA 5BVOA 3SW4A 4NTTA 4EOLA 3KQ7A 4F08A 3DLSA 1AGWA 3V3VA 4D5HA 3OUKA 3CXWA 3RBWA 2C6TA 4EH7A 2J5EA 4DGNA 4XEYA 3R8PA 3ZUVA 4USEA 2PE1A 3NVMB 3BU5A 5DNRA 3E87A 4CEGA 1ZYDA 4J98A 5CSHA 4C8BA 1J7LA 1ZMUA 4B9DA 5CSWA 5AA9A 5AV0A 5EDQA 5J95A 3ZBXA 3KMWA 3R1SA 3R02A 3U6JA 2JEDA 4FSQA 2BTSA 4W9WA 4FV2A 5CNNA 3AXWA 3LAUA 1PXNA 1VYZA 2ONLC 3ROYA 5T68A 4ASDA 2HIWA 4BTFA 4C62A 5EQYA 5L6WL 3CS9A 3IOKA 4QQCA 3K5VA 5ACBC 3NGAA 3UO5A 3BWFA 5F20A 2X0GA 4XG7A 3OXIA 4BYIA 5HLWA 4MNFA 4GH2A 3QQLA 2B54A 2UZNA 3PPJA 1P14A 4FKOA 3KREA 4YGAA 4QMNA 3A7GA 3FYJX 4Z7HA 5J9LA 4F63A 3LMIA 4O7NA 1MRVA 4QNAA 4APPA 5IA3A 2I6LA 4C57A 5FM2A 4BR3A 4FV9A 2YFXA 1Q8WA 2WMSA 4PQNA 4TXCA 4YLLA 5F4NA 2ESMA 1YHWA 1CTPE 5AJQA 3QTZA 1UNHA 4XJ0A 2GNIA 4M69A 4I3ZA 2CMWA 2YAKA 4MNEB 4RQVA 4JJRA 3AC8A 4P90A 2OI4X 1YKRA 4AT4A 2QKWB 1X8BA 3JPVA 4ZJJA 3ULIA 4EK3A 4QP6A 5KMMA 2UZTA 3MIYA 1FVTA 1NVQA 3NYNA 1Y91A 4IBMA 4ANOA 2XVDA 5AR8A 4FK6A 2JKKA 4GEOA 4O0XA 3ANRA 3A4OX 4FIGA 4XLVA 3R21A 1OIQA 1YXUA 3DGKA 4P5QA 3GU8A 3UYSA 5HCXA 4MWHA 4NW5A 3EWHA 2UZVA 3FWQA 1M7QA 4LOQA 3ZO4A 4CQGA 4CXAA 1PKDA 2BCJA 3ORKA 5AUTA 2HENA 3HP2A 3TI1A 4EKKA 2WEIA 4YJTA 5E8XA 3Q9WA 4ZMFA 3S0OA 3VUHA 4EQUA 5I9WA 5H8BA 3ZLYA 2JFMA 3NAXA 4KABA 3BGQA 4KSPA 3W0MA 3MVMA 3QZGA 3AC1A 1H00A 5AV3A 3QLFA 5K9IA 2R3IA 2E9VA 4KB8A 1WBPA 3VF9A 4I6QA 4E4XA 3I0OA 3O2MA 3OTUA 4MXXA 4LOPA 3Q3BA 3RVGA 2V62A 5TR6A 4KWPA 5DH3A 4FRFA 4ZJIA 3NLBA 3NEWA 2EB3A 4ZEGA 3RNIA 5EW3A 5LVOA 2XK9A 3QRJA 5CAPA 4EONA 5CNOA 4L52A 1JKTA 5A6OA 2J7TA 5IEXA 3HNGA 4XP0A 4XUFA 4L43A 5CEKA 4DGMA 1QPCA 3U9CA 2W1HA 3OBGA 1DI9A 3DDQA 4AN2A 3BBTB 3D14A 2H8HA 5HBEA 5K3YA 2F49A 2O2UA 2H9VA 4IWDA 4YURA 4RX9A 4BB4A 2ERZE 4S34A 2XNGA 4CKJA 5BUEA 2BUJA 3M1SA 4ASZA 2VWIA 4YZMA 1Y8YA 4R5YA 4E26A 1GAGA 5DA3A 4IAKA 3QTXA 2PUNA 4MH7A 5J7BA 4E4LA 2WU6A 3KEXA 3WYXA 1J7IA 3D7ZA 3T3VA 2UW9A 3SRVA 4DE4A 4O0YA 4GK3A 4FEUA 2V5QA 4Y85A 4QQ5A 3TYKA 4D2TA 4EK6A 1VJYA 2QOLA 1Y8GA 5H8GA 5L2TA 4KRCA 3IG7A 2F57A 5K0KA 3ZZEA 4B6LA 2WB8A 4C37A 4HJOA 4TL0A 3LOKA 4EJ7A 2VN9A 3EFWA 3PWDA 2ITYA 3IS5A 3Q2JA 4YNEA 3PIZA 4Q2AA 1IEPA 5AP2A 4ZY5A 4R78A 2ZB0A 4G6OA 4AQKA 3IW8A 3O7LB 4C3FA 2PVKA 3MFUA 4ASXA 5DR2A 3R8ZA 3HAVA 1XO2B 1YHVA 1OL1A 3UNJA 3UP2A 2OIQA 4D58A 2RGPA 4UEUA 1ZYJA 3ULZA 3ZRKA 4FIFA 4DH8A 1FVRA 2YCRA 4IB5A 5FDPA 3TACA 2PSQA 2GNHA 5K5NA 1GOLA 3K5UA 4FNYA 1QL6A 3TNIA 3RHXA 4HVHA 3TZ8A 4IACA 1OB3A 3O51A 4DH7A 3FPMA 3C7QA 1H26A 4O6EA 4AN3A 3BL9A 5EHLA 4O21A 3NCGA 3C4CA 5DR9A 4KNBA 4O0VA 5CQWA 4NFMA 2PK9A 1UU8A 1GIJA 3FQHA 5FTQA 5HCZA 4O96A 3VS7A 4EQMA 4QTBA 2FA2A 2OF2A 4WA9A 4W4VA 3WIGA 3EOCA 5KMIA 5KMNA 4V01A 3ZXTA 2IF8A 3DPKA 3QF9A 4KS7A 3EQFA 5E7RA 4O7RA 1G8SA 4BBEA 4BDEA 1OUYA 4QPMA 4TYEA 1E9HA 4UYAA 3R7YA 4G6NA 2QOQA 3JXWA 4I0TA 4YJRA 5CAUA 4MAOA 3Q4ZA 3QALE 4OTFA 2JIIA 5CT0A 4FX3A 5E8UA 4R5SA 3THBA 4CT2A 2XAOA 3MA3A 3FY2A 3LFQA 1QCFA 3OF0A 3QUPA 4AA4A 4BTJA 3FQEA 2ZFYA 5FEEA 3SXRA 4BDHA 2IO6A 2OO8X 1JPAA 1H1RA 3D4QA 4BKJA 3LQ3A 4I93A 2QO2A 2YAAA 1Q41A 2P3GX 4FSUA 3TDVA 2H34A 3TDWA 4FKLA 2CKQA 4QMSA 3PZEA 4U0IA 4UMRA 4FKIA 2VWBA 4I94A 2HAKA 4CFNA 5HBJA 3HUBA 3A61A 4AXEA 3QQUA 3KY2A 4QYYA 3L9NA 4HPUE 5EDPA 4DEIA 5FTOA 5HG5A 3ODYX 3VHKA 3O0GA 4O38A 1Q4LA 3ZCLA 4O4DA 4O84A 2E9NA 3FI4A 3ZO2A 4EZ7A 5GHVA 3FY0A 4I20A 3WZKA 2QC6A 4TWNA 2C1AA 3NNUA 4MQ2A 4UWYA 4DHIB 3W10A 4V0GA 4MEDA 2XJ2A 5EFQA 1OBDA 3UDSA 3UDZA 3DKGA 2JAVA 4C4IA 2QR7A 1OIYA 2WOTA 5ANIA 1IAHA 4IAIA 4F9BA 4RVKA 3BGPA 3ACKA 1IA8A 1BUHA 3CC6A 3KGAA 5DPVA 3O7LD 4CMOA 3P78A 4EEVA 4CFVA 2Y6OA 3KXMA 4M97A 5TO8A 5DHJA 3I7CA 4IANA 5EM5A 4IFCA 4PDSA 2QONA 5JGBA 3EN9A 4BHNA 2WKMA 5CU0A 3C0HA 3RWPA 2BVAA 1J1CA 2BAKA 3UYTA 1PXKA 4KD1A 1BI8A 2B55A 5K4IA 3WF9A 2HK5A 5EKNA 3QWJA 3LXNA 1WVXA 2GS7A 4QP7A 4HVGA 2KTYA 4UXQA 5CZIA 3OMVA 4FF8A 5AMNA 4CT1A 3UGCA 4DG2E 4UWBA 3ALOA 4CSVA 3ACJA 4CYJA 4EOSA 5AUWA 4QEBA 3Q53A 3AC4A 1J3HA 3MPAA 4EHGA 1YXVA 1F5QA 1W2FA 2W7XA 2H6DA 3GB2A 3F3WA 4QYHA 4BZDA 2VO6A 3LQ8A 5A4EA 4IVCA 2CDZA 4NIFA 4U97A 5EK7A 4DHZA 2OZOA 4FTOA 2WNTA 3KULA 2F7XE 3GVUA 5GJFA 3SHEA 5JGDA 3COMA 3NUXA 5JSMA 3DJ7A 1R39A 1EH4A 3NR9A 5AP7A 5KE0A 1BKXA 4RRVA 4FVQA 4KINA 4BKYA 4EOMA 3CCNA 3EL8A 1XBAA 4GMYA 3JUHA 3WBLA 5FRIA 3QX2A 4CTCA 3L8XA 5JFSA 4C33A 3KC3A 2CKOA 2HWOA 3IK3A 4I6HA 5CU2A 3KU2A 4HCVA 4EH9A 4QP3A 2RF9A 3DFCB 3NPCA 3B2WA 3ZHPC 4PDPA 2RG5A 2ZMDA 1CSNA 2QI8A 3UJGA 4C0TA 4YTCA 3N4TA 4EHEA 3BYUA 2YJRA 4QMMA 4YTFA 2PZRA 2CNQA 4WNOA 4DF3A 1PMEA 2XNNA 1OGUA 2NNWB 4I5PA 5T3QA 4O7ZA 3Q2MA 2ITXA 4WNPA 3QA8A 3ENHA 3BCEA 3TNQB 3EQCA 1PKGA 4M0YA 4XBRA 4O7SA 1XH8A 2EB2A 4ACCA 2W1EA 3ORZA 3NZ0A 4BI0A 4GIHA 3GFWA 2NRYA 4J96A 4IM3A 5ANKA 1LR4A 1XH9A 3H3CA 3DB6A 3ZXZA 2YM4A 4J95A 1FVVA 3R2BA 4I5HA 5CT7A 3BX5A 4QMPA 3VBXA 1YRPA 2AC5A 1U46A 3LXKA 4EOJA 2OK1A 2CCHA 2QLQA 4ZSJA 3UE4A 3PYYA 1ZZ2A 4X0MA 4WSQA 3PJ3A 3W16A 3UTOA 2A98A 3F61A 4JL9A 3TIZA 3ZC5A 4BCHA 4ZZNA 5A14A 4YU2A 4JQEA 1Y57A 4IAYA 2WD1A 2XBAA 3AD6A 2W5AA 4J52A 4M7IA 4O2PA 5EOLA 4ZTQA 5BMMA 5CEQA 2QOHA 3GOKA 4P7EA 4HYSA 1XBBA 2W1FA 1W0XC 2ITTA 5AP4A 5AR5A 4BF2A 3VUMA 4NCTC 3FLNC 4BRXA 2BMCA 4WT6A 4DHFA 5JT2A 3FZTA 2VTAA 2QQ7A 4I24A 3BGZA 3U51A 5LVMA 1OGYA 5AADA 3DBEA 5ANGA 2EU9A 2GU8A 3KVXA 3PPZA 5F95A 4YP8A 1L3RE 2Q0NA 4WG4A 4MVFA 2ITQA 3R83A 2QR8A 3VWAA 4I41A 4KA3A 3FMLA 2NP8A 3NNXA 3NUNA 2IEWA 4FI1A 4YC6A 4XP3A 2C69A 4D1XA 2R9SA 3FLZA 3KKVA 1H0WA 3SOCA 5EKOA 5IA1A 2VX1A 4L9IA 4GIIA 4EHZA 4XV3A 1GY3A 2GS2A 5HCYA 1JOWB 3GOPA 3F2AA 5IA5A 3V8TA 2R3KA 3VO3A 4U44A 3DV3A 4H58A 3LJ1A 2YDIA 4PDYA 4MBIA 2BAQA 4IEBA 4XV9A 3ZRMA 2BKZA 5HO8A 4J99A 1Q8TA 2WTIA 1DM2A 3D2KA 4B7TA 1FMOE 5I4NA 4L8MA 1WZYA 2BILB 3DB8A 5GIOE 4XG4A 5T6KA 3ZLXA 3P7BA 5I3OA 4B99A 4NWMA 2YERA 1YXTA 4G9RA 4E8AA 5IG1A 5I9YA 4GL9A 4CFMA 2P4IA 3UQCA 5KHWA 4EH5A 2XF0A 1O9UA 2VGPA 2C0TA 4DTKA 4FL3A 3NYOA 3I81A 3GP0A 4E6CA 3QRKA 3E8EA 2JBPA 4M68A 2X8IA 5AP3A 5AFVA 3LKMA 1CKJA 2P2IA 4LM5A 2UW5A 2XYUA 1YOJA 4O82A 4DEBA 1GZ8A 1O6YA 2B9HA 2QOIA 4U40A 1TQPA 1YI4A 3FC2A 3OWPA 3ZSGA 3BE2A 4JBOA 4QYFA 2XCHA 4KIOA 2VZ6A 4QTAA 3JVSA 5H2UA 4HNFA 3QXOA 3QX4A 4ZY6A 2IW8A 5GINE 2BFXA 3OCBA 3QQHA 5DGZA 3QUDA 1YI6A 2GSFA 5EHYA 1YOLA 2PU8A 2XM9A 3NFFB 4ZP5A 5J79A 3BYVA 3QGWA 1NT2A 4BY9E 3GGFA 4JQ7A 3WZDA 3LHJA 4D4YA 5CAQA 4K11A 2B0QA 2Z60A 1ST4A 2XBJA 2WMUA 2Z2WA 4XRLA 1H0VA 2B9FA 4O0TA 4DLJA 2BZJA 4FNZA 3FDNA 4RIOA 4JBQA 4GJ3A 5KMLA 1XH7A 4C58A 3F9NA 3PVWA 5LWNA 2HOGA 2PHKA 3EYHA 3E3BX 3VS0A 4FTTA 3V04A 3HV5A 3CPCA 3KXZA 3LVPA 3VJNA 4EK4A 2A1AB 4OUCA 4LOOA 3REPA 2C5NA 4CLJA 1K2PA 3QD4A 1M2PA 2QD9A 4CKRA 3JY0A 3QCSA 2XJ1A 3BBWA 2O0UA 3MY0A 5C27A 2PZPA 3VAPA 4GFMA 4FV1A 2IZTA 3QTSA 4FZFB 2G9XA 5HTCA 4R1YA 4FIJA 4AUAA 3TNWA 5A9UA 4E5AX 3QHWA 3HV3A 3ZDIA 3TZ9A 5JKGA 3S2PA 4ACMA 4RX5A 5BMSA 3A7FA 1OL2A 3GCVA 4HVIA 3F88A 3W2PA 2AC3A 2GPHA 2I40A 5C03A 5KZ0A 1JKLA 4PNIA 2WIPA 4NUSA 3A7IA 3FKLA 5AX3A 3DQXA 3FZOA 2ITPA 5HO6A 4LMNA 2RG6A 4RZWA 3DAJA 2AUHA 2GDOA 2XZSA 5HEZA 4E5BA 4DCAA 5C8KA 5D1JA 3C50A 5CI6A 4F9YA 4W9XA 3O8UA 4O6LA 4N6YA 4WNMA 1B6CB 5L3AA 2PWLA 3EHAA 5AA8A 1MP8A 1ST0A 4M15A 1FGKA 4TY1A 3PJ1A 4N0SA 4C3PA 3FKNA 3PJCA 2X81A 3D94A 1XWSA 3QYZA 4FKSA 4DLIA 5L8LA 2JKQA 4EZ5A 1V0OA 3MGYA 2BROA 3P23A 4GVJA 1Q97A 1R1WA 4D4RA 2YLFA 2ACXA 4C4GA 2GQSA 3TL8A 3LCTA 2ERKA 1SYKA 2CGXA 4RFZA 4L7SA 4C59A 1W82A 2JD5A 5IPJA 1YW2A 3U6IA 4YJNA 3NUAA 2F2UA 3DOGA 3LFSA 2VTHA 3HGKA 3PRFA 4EORA 2G2IA 2UW4A 5CEOA 2NRUA 3ELJA 3VJOA 5AP6A 3W2SA 2WMAA 3PFQA 3CQWA 5DOSA 3NAYA 5KZIA 1E1VA 3OFMA 1YXXA 4Y8DA 5I9XA 1ZAOA 4JIAA 4HGLA 2PUPA 4DT8A 1NA7A 4ANSA 3PZHA 2WTDA 2OSCA 4YNOA 3W0NA 3RKBA 3QQFA 4ZTMA 1Q8YA 1YWVA 4GJ2A 4EJNA 4F65A 2RL5A 2Y0AA 4DTAA 3EFJA 1W83A 4RFMA 3CQEA 4ZS0A 2VNYA 5E8VA 3AT4A 5IDPA 3E8DA 4OTIA 4AZVA 3TZ7A 3UZPA 3UNKA 4A06A 2FGIA 4HCTA 3UO6A 3QC4A 2FVDA 2W17A 4RIWB 2JAMA 4FV6A 4O91A 3L9PA 4CZTA 1KOBA 4UWCA 2ZDTA 4E7WA 4JR3A 5JZNA 4F6SA 3TTJA 2BDFA 4HCUA 3I5ZA 3O96A 4PTCA 4H36A 2R4BA 2DUVA 3RJCA 5A4TA 5JH6A 3KULB 5LMKA 2XANA 3RAHA 2R3MA 4YBJA 1URWA 2CSNA 3UPXA 2JFLA 2XNBA 5L2WA 4IWQA 4XMOA 4B0GA 2HZ4A 1DAWA 2YM7A 3FHIA 3IDCA 3UIBA 4I6FA 2WU7A 1WMKA 4LGHA 3FI8A 1YWRA 3OWLA 2BHHA 2XIRA 3C5UA 3RZFA 1RE8A 5D11A 3OG7A 1WBTA 4YJQA 4FICA 1G5SA 5CSPA 4OT6A 2VWZA 2CKEA 4XOYA 5FDXA 3U9NA 4YMJA 4EI4A 3EJ1A 4JG7A 4IDVA 4CG8A 2GNFA 2UW7A 4MYGA 4BFMA 4IDTA 4EH8A 2BPMA 3R28A 1A9UA 2J9MA 3BHYA 4XP2A 4DG3E 2XM8A 3IDBA 2ETMA 4RC2A 4MF1A 4QDVA 4FKPA 2X2MA 4BWKA 3JS2A 2UZDA 3RK7A 2WFYA 4TPTA 4RWIA 5HIDA 4CQEA 3PTGA 4MD7E 5ACKA 1WBOA 2C5XA 4BCFA 3CJGA 4RJ4A 4TKSA 4W8EA 3BV3A 4L00A 4LI5A 4HW7A 3HMNA 1VYWA 3FL4A 3HV4A 3EN7A 1QPEA 3OOGA 3PSDA 5M51A 4FNXA 4Z55A 4X6RA 2I7QA 3VONA 2PVRA 4F6UA 4AAAA 3OCTA 4MK0A 3UOLA 2CNVA 2XUUA 3CP9A 4G16A 5ITAA 3DFAA 5BUIA 5CF6A 3PP0A 4C36A 4EYMA 3D15A 4NK9A 3OXZA 3FXZA 4FGBA 3UOHA 4PTGA 2YISA 4UXLA 2ZV7A 3P79A 4FL2A 3QU0A 4KBAA 2RFSA 5HLPA 4IFGA 3PJ2A 2C6OA 4LL5A 3SKCA 2UZBA 4WBBB 4U7ZA 2W05A 4M12A 1Y6AA 2VTMA 3WYYA 2EXCX 2Y4IC 2GS6A 4ZLZA 3TG1A 4CV8A 3A4PA 1OPLA 4FTAA 5AX9A 5J7HA 2WMTA 1T45A 3FLSA 4LGDA 4KBKA 4ZLOA 4BGGA 3Q5IA 4PTEA 3KFAA 5CF8A 3LFFA 5KBQA 2YM6A 3ETAA 3H9RA 4TWPA 1H08A 3DZQA 3HA8A 5FD2A 3UIUA 3UOJA 3KB7A 3UO4A 3H4JA 4PPBA 4FTJA 4AZWA 4I6LA 4Z7GA 2YWPA 2R3PA 4IW0A 4PMPA 2VTJA 4LG4A 3QD2B 4YHJA 1OZ1A 5DWRA 5EG3A 3NIEA 3DT1A 2UZOA 3DK3A 4LUEA 5IQIA 1H1QA 3F7ZA 1Q5KA 4GUBA 1R78A 2XARA 4FEVA 1UWHA 2PMLX 4QP2A 4E4NA 5LOHA 5CEIA 5FG8A 4JBPA 3RI1A 4Z9LA 2ZDUA 5HKMA 4ALWA 4FSWA 3ODZX 4XS2A 3AC2A 2Y7JA 4AG8A 5L2SA 5LVLA 3TKUA 3BV2A 2HWPA 2QU5A 3MTFA 5B7VA 3D7TB 3PUFC 1SM2A 2PVLA 1OL5A 4FG8A 3MPTA 3QZHA 4FKJA 4R7IA 3T9TA 2HYYA 4CVAA 1W2CA 4O7LA 5I3RA 4RIXB 3OY3A 3MN3A 3E64A 4E73A 2IZSA 2X9FA 1O6LA 5B2LA