4JI9A

Jak2 kinase (jh1 domain) in complex with tg101209
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Amino-[1,2,4]triazolo[1,5-a]pyridines as JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ji9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ji9A01
3DV3A 3ZZWA 4YZCA 3GP0A 2UW0A 2QG7A 4KS7A 4QYEA 2YJSA 4MYGA 3I81A 3WI6A 3UNKA 4L00A 1GNGA 3QFVA 3R73A 4U45A 3QCSA 5LVLA 5L8LA 3E62A 4BDDA 3ATSA 4QNAA 4BDKA 4AWIA 1GZOA 1T46A 3LM5A 1GIJA 2XNMA 2ZM3A 4WKQA 5AUVA 5HI2A 3II5A 2WTKB 4QMMA 3ZSHA 4ZSAA 5DLSA 3UIMA 3UG1A 5BVEA 2XCKA 2FYSA 3GU6A 1KE8A 4FK6A 5E8WA 4EOMA 3DTCA 3QC9A 2PSQA 1XH4A 3B2TA 4ZSEA 3FY0A 3HGKA 3IOKA 1TQPA 3LQ5A 4KKEA 3RPYA 3BV3A 3L9NA 2WQMA 1CKPA 3T3UA 4L9IA 2X9FA 4K0YA 3BYUA 5TKDA 4PL5A 4FTUA 2F7EE 3FE3A 1JQHA 3MIAA 2C6KA 2OU7A 1CM8A 3OTUA 3CD8A 4MNEA 3UIUA 1Q8WA 4ANLA 4O84A 2C69A 2JBPA 4G31A 5CI6A 1WMKA 2E9PA 4ARKA 3Q3BA 4ASDA 2XKDA 3F3VA 2OGVA 2Y6OA 3PY3A 4FT3A 4WIHA 4TN6A 1OKVA 4FTCA 4D2TA 4Q9SA 5EM8A 2R3LA 5JGAA 1YHSA 4FTAA 4B8LA 4U0IA 4EH8A 1O6LA 2O0UA 4GFMA 5AV1A 5AUUA 5GZ9A 4TYEA 5JSMA 3MS9A 4E6QA 4BHZA 4MQ1A 4XNEA 4KIOA 2AUHA 2FVDA 3FMMA 3GCPA 3RCJA 2FO0A 2OKRA 2UW9A 4BIEA 2CMWA 2CGVA 4NWMA 1XBAA 4KBAA 4FSQA 4N4SA 4M84A 4FVQA 3MFRA 5FP5A 2XCHA 5HEZA 4D5HA 3FSKA 2R5TA 2YACA 4FUXA 4EOJA 4XH6A 4YBJA 3UQFA 5M53A 1VYWA 3DNEA 5BPYA 2JEDA 2YIWA 4JNWA 3AGMA 3F82A 4XG6A 5CANA 4I20A 3EJ1A 3F61A 5HE3A 3FMLA 3VS4A 4O7VA 2NO3A 2ZVAA 5JT2A 5HIEA 1BMKA 4RWLA 1AD5A 5EM7A 2ITWA 3EL7A 4HNFA 3W2PA 5TF9A 5TT7A 4FIJA 4E5AX 3BGZA 4W4XA 3HX4A 3TNWA 2O65A 4FG9A 3QTZA 3Q32A 4AN2A 2YA9A 2B55A 3OCSA 4BKJA 5IH6A 4FEUA 3KULA 3C0GA 4YZNA 5HCYA 3W1FA 5IEXA 4PPBA 4M8TA 4BCMA 1GIIA 4QYFA 2OICA 2PVJA 2F2UA 3PFQA 3UYTA 4DAWA 4JLCA 2VTRA 2XJ1A 2HZ0A 4OUCA 4C59A 3F3UA 4DITA 5DI1A 2BALA 3KXMA 4OGRA 4C3FA 5F94A 2GNIA 5LOHA 2JAMA 4BDHA 5ANOA 3BBTB 3ELJA 5DR6A 2WEIA 4RX8A 4V01A 4F6WA 3UZTA 2C6OA 3VUMA 5BVNA 2HWOA 4EWQA 2XK4A 5DHJA 1KUTA 2JLDA 4MXXA 4R5YA 1ZARA 4H36A 2P3GX 5K9IA 1ZXEA 4BDGA 4KKGA 4YO6A 4DEIA 3KGAA 3R00A 5IG1A 4AW1A 3JVSA 5CT0A 4U81A 4GYGA 4LUDA 5CENA 2SRCA 4C4EA 4I23A 2OXXA 4BCGA 2ERKA 3QRTA 2ZAZA 1YXVA 4UALA 5HNBA 3LXLA 2J0JA 4IVDA 2C0TA 4F09A 5CAPA 3PYYA 4NW6A 4FZDB 4WNPA 1HOWA 4DG0E 4W8DA 2UZTA 4KKHA 2PPQA 1KOBA 3GVUA 4IBMA 2Z60A 3ZLXA 1JKLA 3R7VA 4P90A 2XNBA 5F20A 3BKBA 4KIPA 5EDQA 1H27A 5ITAA 1FPUA 4ITHA 4YMJA 3W16A 1QL6A 4RVTA 2G1TA 3BRBA 3BWJA 5L2TA 2W06A 4IZ7A 1Q8YA 3BQRA 4B4LA 4E6CA 4M97A 1A06A 2C6TA 4MK0A 2QO9A 4FG7A 1PXJA 2QVSE 4BVUA 1AGWA 1I09A 4QPSA 3K5VA 3R1NA 5D1JA 3A7JA 3LJ1A 5TR6A 3TDWA 1TVOA 2E9NA 2X8EA 4YPSA 2YLEA 1M52A 5EOBA 1OIUA 3GFEA 4LMNA 4MHAA 4I4EA 5BYLA 3COMA 2FGIA 5E8VA 3VRYA 2V55A 2W5AA 4G6LA 2IVUA 3ZO1A 4D2PA 4ZEGA 3GEQA 4IIRA 4MEDA 4C61A 3KXNA 3RP9A 4XRLA 2UW5A 3U9NA 4DEDA 2QHNA 4FIIA 4EH2A 3O50A 3O8TA 3A62A 1GAGA 4UMUA 2KULA 3KCFA 2YZLA 1R3CA 3QGYA 4MNEB 2WTWA 3SOCA 2PTKA 1W84A 5LWNA 1B38A 4CFXA 1G3NA 3FUPA 2VTHA 4MWHA 2VGOA 4QP6A 4XX9A 3OD6X 5IQEA 4RX7A 3V6RA 2GNLA 2A0CX 1E1XA 2WKMA 5BNJA 4BGHA 4G3EA 2X2KA 4QP9A 2WQBA 4G9CA 5LVNA 1W83A 3PP0A 3VS6A 2PVHA 5LCJA 1HCKA 4U40A 4I6QA 3PZEA 4D9TA 2GNHA 3JYAA 4F6UA 3LPBA 4FKTA 4HZRA 4JVGA 1U4DA 4TNDA 5FDPA 3QX4A 4TRLA 3R9NA 3T3VA 3I5ZA 4FSNA 4U41A 2XIYA 3PJ2A 4A4XA 3BU6A 3DZOA 2BAQA 2QODA 2Y6MA 4AZTA 1WVYA 2C30A 4ZJVA 4BI2A 2EB2A 1ZLTA 3H3CA 3G33A 4JX3A 5FXSA 3KL8A 2J0MB 4I41A 3WF9A 3ZRLA 4ZAUA 5CXZA 2W0JA 3NW6A 4NM5A 5M4FA 3CGFA 1KV2A 2R3RA 1U46A 4P5QA 3BX5A 3VUHA 3QD0A 3NMUF 5A4TA 4GSBA 1OUKA 5A4CA 4JQ8A 4IM2A 3OG7A 3OEZA 1RE8A 2H34A 4CFFA 4DYMA 2ZM1A 2YHVA 4IC7A 5DG5A 3U6HA 2BCJA 1WFCA 3BU5A 2X7OA 3WOWA 4OTRA 2BIYA 4U80A 4YZMA 3U55A 4RIYA 2PZ5A 1GOLA 2VN9A 4KAOA 5K0KA 3FMHA 3CR0A 3E3BX 1UU8A 3IK3A 3CQUA 4UXLA 5BVWA 1UNHA 3V01A 3LQ3A 3O23A 5L3AA 2R0UA 5E92A 5FEDA 1YHWA 3OWPA 5ANEA 5HO8A 2C4GA 1H01A 2ESMA 3GC0A 4G3FA 4X6QC 1ZRZA 4CEGA 4NT4A 4EHVA 4TXCA 4IX5A 5BUJA 5FGKA 3C4CA 2ITYA 3VBQA 4O86A 4I93A 4CXAA 5T3QA 1XWSA 4TWPA 4DGGA 3K2LA 4WO5A 3PVUA 4AZEA 3UO6A 3FPQA 3TKHA 5IF1A 4O7SA 2WU6A 3KXXA 2I40A 3NYVA 3G9NA 3V5PA 5A4EA 3F2AA 4LGDA 4M3QA 5CSXA 4BY9E 5A4QA 4O7LA 4Y5QA 4LI5A 4DEBA 1OL5A 4HJOA 2J5FA 2UV2A 5HOAA 2P2HA 3P86A 1OIRA 3ZO3A 1R1WA 2YZAA 4AOTA 5FEEA 4GT5A 3HYHA 5DFPA 1P4FA 5C8MA 3UE4A 4QMZA 2BTRA 4Y83A 1WBVA 3QQKA 2CDZA 5F4NA 3VUGA 3RAWA 3FMJA 3QL8A 4KD1A 4M13A 4BCHA 3DDQA 3BU3A 3WIGA 5K0XA 3VQUA 3OBGA 3FXZA 4F9BA 3BBWA 3MTLA 4PP7A 1XH5A 3A7IA 4E73A 4NJ3A 2XP2A 2ZMCA 4YPDA 4CLJA 1XJDA 4W4VA 2PUUA 4PWNA 3ZXZA 4YJOA 2ITOA 4WNOA 1CDKA 3OT8A 4IE9A 3UODA 4MD9E 4E93A 1Y8YA 4KS8A 4A9RA 2C47A 3P23A 1NA7A 2ITQA 5HE1A 2VWZA 3EQIA 2X8IA 3CKWA 4A9UA 3VW6A 5GNKA 4GV1A 4G5JA 3HA8A 3LCDA 4C2WA 4O0RA 3HECA 5C01A 4CRSA 5GJDA 4BDAA 3O71A 2C68A 3DCVA 2GQRA 2VX3A 3PRIA 3ENMA 3NNWA 5AV0A 2ETKA 4RFYA 4ZIMA 1Y57A 4UN0C 3OWLA 5LWMA 3QQHA 4YSMA 4FZ7A 4F64A 5LVMA 3UTOA 4MCVA 5DGZA 2JIVA 3R0TA 1H24A 4PY1A 2BMCA 2JFLA 4LV8A 3UOLA 3ANRA 4FIHA 3ZFXA 2YLFA 5D11A 4EK6A 5L8KA 2WMVA 4BHNA 4DEEA 5J8IA 1M2PA 3I1AA 2G2HA 5JFXA 4FL1A 4K1BA 4NM7A 4FL3A 4O0TA 3TNIA 3MJ1A 4IAIA 5AV4A 4XG8A 5B0XA 3IPHA 2JDVA 3G6HA 4QMUA 4RVMA 4PF4A 5CT7A 4EHGA 4F1TA 4U6RA 2VTJA 4C3RA 4FMQA 4ZY6A 4RLLA 4CVAA 3COKA 3IECA 2YCRA 4LOQA 4F7SA 3TI1A 2OJ9A 4RJ7A 4QTCA 5DR9A 3W2CA 3DAKA 3BGQA 2HENA 3POOA 1LPUA 2QOQA 4F0GA 2QLUA 3NW7A 1YW2A 5K5NA 2PUIA 4MWIA 3UIBA 4HCUA 4O1OA 1F0QA 3PJ3A 3A8WA 5T6KA 3KFAA 1G8AA 2WOTA 2YIRA 4UEUA 4YJSA 4GUEA 5DE2A 2QOBA 5EYCA 4AX8A 5DRBA 3ZONA 4ZY4A 3PXYA 2G2FA 3DBDA 5L8JA 4IM0A 4D4YA 2XB7A 4FBXA 4Y5HA 3OOMA 5JFSA 3W2RA 2JITA 3LFFA 4XLVA 5AEPA 4J71A 2I0HA 5I9ZA 3CPBA 3E8CA 2X81A 3EQGA 4P7EA 3V8SA 3AD4A 3IDCA 2FB8A 3QZGA 4TT7A 4OTQA 5EYDA 3F5UA 2ITVA 2XF0A 1JLUE 5KMIA 2EXMA 2XBAA 2JAVA 4QP1A 1URCA 2C3IB 1ZOGA 5EKOA 1VZOA 3QHRA 3FLNC 2IW8A 3RNYA 4F08A 5C26A 4FZAB 3DXQA 4RSSA 3LCOA 3LFEA 1MP8A 4A4OA 4BTJA 1YXXA 3DKCA 3HV4A 4L68A 4HVGA 2XK9A 1VJYA 1LR4A 4E7WA 2QNJA 5I9YA 3KXHA 3COIA 2HXLA 3UIXA 2VTQA 2YIXA 3LXPA 5J95A 2C6EA 4WHZA 4ZLYA 2OH4A 1H1PA 2C1AA 3NR9A 3K54A 3PIZA 4EH6A 3I6WA 4RA4A 1Q99A 3VQHA 4IX4A 5BVDA 2C1BA 2YM5A 5L6OA 1IA9A 1MQ4A 4FG8A 4EHZA 5BUEA 2C3JA 3TUBA 4ZJIA 2YJRA 1U5QA 1Y6BA 2WMWA 3GCSA 3QWKA 3BHUA 4HYUA 4RJ6A 4DEHA 4YURA 5C8NA 4B8MA 3VHEA 4PPAA 5J9LA 4AZSA 2EXEA 4NIFA 3PP1A 4TKSA 5C8KA 4FIEA 2UZWE 2CKQA 3A61A 2C5OA 4DC2A 4IANA 3D0EA 3PIYA 4L43A 3DU8A 3F7ZA 3L1SA 4WRGA 3WIKA 4CTBA 5EKNA 1GZNA 4G6OA 4BBEA 3PY1A 1XHAA 3EN7A 4O38A 3NVKI 3WZEA 2I0EA 3BLRA 3KMMA 5GZ8A 2WMXA 2O5KA 5LMBA 4GKHA 2B7AA 3R8LA 1PXIA 4O2ZA 4A4LA 2QU6A 4PQNA 1WBPA 4BTMA 3SGCA 5ETCA 4BDJA 4FTRA 1XH8A 2BZKB 2WU7A 3ZO2A 5IPJA 3CTHA 5HQ0A 3LFSA 2V7AA 3JVRA 4OBQA 3HMNA 1P2AA 3ID6C 4YP8A 1FVRA 2W4JA 2X2LA 3ZO4A 4A7CA 5KMNA 2R9SA 3EQBA 2PL0A 4RQKA 3LAUA 3G5DA 2BHHA 3MY1A 3OROA 3NUPA 4FEVA 4RC2A 4KABA 3NZ0A 3WF5A 2B4SB 4TTHB 4WG5A 5HTCA 4IB3A 2ONLA 4GS6A 1XQZA 3S95A 4YHFA 4R7IA 4EH7A 3GC8A 1F3MC 4E4XA 4ERWA 1WZYA 4IEBA 3CCNA 3Q96A 2Z8CA 4G2FA 4QOXA 4FTMA 3QKMA 1NT2A 4DH3A 3LCTA 3K3IA 1CMKE 2XEZA 4FTKA 3ZOSA 4CQGA 5AM6A 4JAJA 3ACKA 3NX8A 4WD5A 2UW8A 4RFMA 3QC4A 4EBWA 2R3MA 2B9FA 3I0QA 3TTJA 1PRYA 5AUXA 4CFMA 2IG7A 2OWBA 4HYIA 1MQBA 3W8LA 2W96B 3QD3A 5T68A 4LOPA 4FTOA 4ASXA 2I1MA 2W1DA 1VYZA 1NVSA 1ZMUA 4QP3A 4M7IA 1SVHA 4WG3A 4O0YA 1QPDA 3ETAA 3QCQA 4UMQA 3V5WA 5BYYA 4AOJA 3OEFX 3QBNA 4YHTA 3ZU7A 2BVAA 2Z7QA 4UYNA 4X2JA 3H0YA 5AR2A 1ZOHA 3BYVA 4FT0A 4O0XA 4BZNA 5M06A 5H8BA 1DAWA 4PP9A 5EW9A 1H00A 3BHHA 3I4BA 3P0MA 3PSBA 4MXZA 3BLQA 3OVVA 4UBAA 3TZMA 3H4JA 1PJKA 3E7VA 4CZTA 5DR2A 1IR3A 4QQTA 3DK6A 2PMNX 4C33A 3DBQA 4F9CA 1PXKA 5AP2A 4TYHB 3U4UA 1R78A 3O8PA 2PE0A 3ZLYA 4QPAA 1J7LA 3QZHA 2VTMA 1YI4A 2UZNA 4YJTA 4XV1A 2QOHA 5LQFA 4MVFA 3WYYA 2G2IA 1BKXA 4X6RA 3QXOA 2BZHB 1ZYSA 3AT4A 5AP5A 1M2QA 4R1VA 3PG1A 2WMQA 3EZVA 4FSZA 2J90A 5FUTA 3R1SA 3LVPA 1H8FA 4BN1A 5BUIA 3CEKA 3RNIA 2ZV8A 3DBFA 4DHFA 4G17A 4C34A 1J1CA 2BRMA 2C5XA 3RPSA 3SD0A 3FHRA 3VBWA 5IA0A 1UKHA 1K9AA 2EU9A 2X6EA 5AV2A 4JBPA 3NPCA 5EI2A 4M12A 2UVXA 4FEWA 3I60A 4DGMA 5CYIA 5B2MA 4GIHA 3U6JA 4F0FA 4WRSA 3NGAA 2O8YA 2YAKA 4FZ6A 4TWNA 4DGNA 2PVYA 3F7WA 2LAVA 4N6YA 3RAIA 3EN9A 3MDYA 2H8HA 3UDBA 3V8WA 4ALVA 3AT2A 4ZY5A 3L8PA 5DYJA 4EJ7A 4MXOA 3RHKA 2OIQA 4QTBA 4IACA 4D58A 2NPQA 4APPA 4P4CA 2JKKA 5CVHA 3AD6A 5KHWA 2GSFA 2VGPA 2C6IA 2DS1A 2XJ2A 4YJVA 3KEXA 3V6SA 5AR4A 1IAJA 4C02A 3WILA 4ZZNA 5DWRA 4DE4A 5BVOA 2WOUA 3DJ5A 3R8ZA 3DXPA 3LMIA 4II5A 3HAMA 4BDIA 3PVGA 4FTNA 3M11A 3CE3A 3KREA 1SVGA 2R3IA 5CAVA 3HKOA 4C58A 3R2BA 5AUZA 5JFWA 4DCAA 4EZ7A 4DH7A 3FXXA 2WMSA 2X39A 5H9BA 4MX9A 2ONLC 4WA9A 5JZNA 3HV6A 5CEQA 3SLSA 2UZDA 5F9EA 2PMOX 3FYJX 5EH0A 4GT3A 4ANOA 4KSPA 3E63A 3L8VA 4KRDA 3FMDA 3U87A 5I9UA 4G3DA 3QUEA 2XJ0A 4ERKA 4PPCA 3HRBA 2V62A 3JPVA 5HG5A 3MN3A 4LYNA 3TL8A 4UYAA 2I7QA 5CSPA 3FDNA 3PPZA 4YBKA 5CAOA 5KX8A 4RBLA 2WGJA 3B8RA 3IW6A 2WTKC 3VS0A 3PLAE 3EB0A 4G16A 3NCGA 5BYZA 2GTMA 2Z2WA 1BL7A 3NIZA 3K3JA 4IWDA 4YJPA 2EUFB 3PJ8A 4I24A 5I3RA 4I21A 2GHGA 1U54B 3KB7A 4YTHA 4EOKA 1JWHA 4H05A 2ETMA 3KY2A 4GH2A 1ZAOA 2HK5A 2OG8A 2CCHA 3AC3A 3LXNA 5CNOA 4R77A 4DTKA 5HX8A 2P2IA 2VD5A 3IONA 4K33A 2XNOA 4EH3A 5DT4A 3LFBA 5HCZA 4IADA 4BWPA 1OPJA 1H1RA 5DIAA 5AP7A 3RAKA 4CFVA 2XIKA 3GT8A 5GIPE 5E8YA 3MFTA 5CAQA 3A8XA 3PRFA 3MWUA 3DFAA 4ZS0A 4C2VA 3EFLA 3I6UA 2ZV9A 3TDVA 3TJDA 4IH8A 3VS3A 4I0RA 3ZTXA 4B6LA 1OBGA 2VWXA 3DK7A 5DEYA 3G90X 5FM2A 2HIWA 2C6DA 4OTFA 3MH3A 4U43A 3GBZA 4OTGA 2RIOA 1OB3A 2YITA 3BE2A 4X3JA 1K2PA 1ZMWA 2B1PA 1OITA 4NW5A 1FQ1B 3D5UA 2GFCA 3ZUUA 4KA3A 3G0EA 4C3PA 5IUGA 1AQ1A 4AGUA 3TCPA 4CYIA 4F65A 4EZ5A 4RFZA 3GU8A 3KMWA 4FZFB 3NUYA 4L53A 4AFEA 2R3OA 4MNFA 4U7ZA 4AZVA 2DYLA 2WMTA 4AT3A 2X6DA 4FOCA 4EQMA 4OLIA 1PW2A 3JS2A 3PXRA 3QCYA 4DBNA 4YU2A 2BDJA 1KE9A 3A7HA 4KWPA 2ZV7A 4IVAA 3TV6A 4HNIA 5IH5A 3GUBA 4H3PA 5BMMA 3AD5A 3V5LA 3Q6UA 3FXWA 4M0ZA 3ZYAA 4C7TA 4C57A 3NDMA 3P7CA 1CTPE 2YWVA 4FKIA 1OKYA 4F6SA 4HGEA 3I79A 1URWA 1M2RA 1ZYLA 4AF3A 4J96A 3DPKA 5JQ8A 4F70A 4CCBA 4PTGA 2J0KA 2J9MA 2QOLA 2XUUA 4MBLA 4NFNA 4E4MA 2CKOA 3W2QA 3W18A 2OFVA 4Q2AA 4X21A 4ZTHA 5E90A 3FL4A 3OFMA 3EH9A 4CMTA 1PXPA 5IKWA 4IW0A 3MY0A 3D7ZA 4CKIA 1BX6A 3F9NA 3WF6A 3W2SA 3R7GA 1U5RA 3THBA 1IRKA 4FV4A 5LMKA 5M4UA 2PMLX 2IJMA 2GTNA 3IKAA 4GG5A 4NFMA 5AAGA 3GB2A 4X3FB 1IASA 2VO3A 2HAKA 1KSWA 1R0EA 3HRFA 5EW8A 5HORA 3EIDA 3MFSA 1JKKA 2CGXA 5M55A 1P4OA 3VNTA 2X1NA 5LCKA 1SYKA 3UVRA 2CLXA 5A14A 2QO2A 5CAUA 4BYJA 4BGGA 4M66A 4GMYA 5KBRA 4DTAA 5AR8A 1UU9A 3PJCA 4N0SA 1YDRE 4MXCA 1XH6A 3HL7A 5AX3A 3C51A 4JS8A 2W5HA 4RWIA 4DINA 5HBJA 2AC3A 1WBNA 2XIZA 4Y85A 4IZYA 2OJFE 5GJFA 3R9RA 3DLSA 5IQCA 5HD4A 2R3QA 3CSVA 3DXNA 2WNTA 4H39A 2ETRA 2WIPA 3SKCA 3A4PA 3Q2MA 2J0IA 4BB4A 4R3PA 3CJGA 5HICA 2C0OA 5KMLA 1S9JA 2VX0A 3P7BA 4YZBA 3TXOA 3UO4A 4F9WA 1GJOA 1ZY5A 3FYKX 3R02A 5HD7A 3A7FA 3ROYA 4U79A 1BUHA 3VS1A 2B52A 1Q61A 1RJBA 2YWPA 4BCQA 4F7LA 4OAVB 1ZYJA 4BR3A 3G6GA 3ZUVA 4UMPA 3ZRMA 2HELA 2JGZA 3ACJA 3HMMA 4IC8A 4ZSJA 3ZM9A 3UMWA 4ANQA 4HZSA 2VAGA 3UOHA 3VUIA 2WQOA 4D28A 4R78A 3HDMA 4JG7A 4O81A 3COHA 2FUMA 2WFYA 4K8AA 4PV0A 3UYSA 4DEGA 1WCCA 5JQ5A 4CNHA 2XK6A 3UPZA 3K5UA 5IH4A 3PE1A 4PMTA 1YXUA 3DS6A 4FODA 4O96A 5DT3A 4Z7GA 5L2QA 3PUPA 4ONAA 4RIWA 4FNWA 4O2PA 4FT7A 3UG2A 4TWCA 2DWBA 3BHYA 3D4QA 3FZSA 4BL1A 4DT9A 4CTCA 4ALWA 3BLHA 3FL5A 3UJGA 2C3KA 1OL7A 5HBEA 3PXQA 3OXIA 4XG7A 4AQCA 4DA5A 3NUUA 2XS0A 3OCBA 1ZOEA 2ZOQA 5EOLA 2CHLA 5A54A 4XBRA 4DFLA 4M69B 3ZC6A 3U4WA 2VNYA 1SVEA 3ULIA 2XZSA 2F7ZE 4QTDA 4C4HA 1YI6A 4A07A 3MGYA 2VX1A 4IDTA 2VTIA 3FMKA 4J99A 3DT1A 3OCGA 4XS2A 4QP4A 3OTVA 5K4JA 3QQFA 1MRVA 2HYYA 4QD6A 4AN3A 2BROA 5GINE 2CGUA 3Q9XA 2GCDA 3E5AA 4JBOA 1W0XC 1KE7A 1JPAA 3BQCA 3LFNA 5KCVA 4PX6A 2I0VA 3Q04A 2UZUE 3G0FA 4GIIA 4HCTA 5CNNA 3QA8A 3HRCA 3LXKA 3HAVA 3DBEA 3T9IA 3MBLA 3CTJA 3E64A 4IZ5A 3WE8A 3SA0A 2QLQA 4F1MA 4AUAA 4E6AA 4FKOA 2W99B 3FC2A 4DH8A 1OKZA 5M57A 3R04A 4D1ZA 5CU3A 3QHWA 5GIOE 4I6BA 2A27A 3AOXA 4XP0A 2C0IA 4EYJA 3D5XA 2GNFA 3DZQA 3RPVA 1V0OA 1Q4LA 4CFNA 4N57A 3RPOA 3E8EA 4D9UA 5CSHA 2B9HA 3BYOA 5LMKC 2BRGA 3D5WA 4D0WA 3MIYA 1YXSA 4EH5A 3JR1A 3DKGA 3Q5ZA 4AG8A 4YR8A 5AAEA 4FTLA 5A9UA 1FGIA 1GY3A 5KHXA 3RWQA 3W8QA 1NVRA 2X7GA 2XNNA 3CBLA 4NKSA 4XEYA 5DOSA 4ZZOA 1BI8A 3E93A 4C8BA 4ZZMA 2XKFA 1EH4A 5CF6A 3P5KA 3R7OA 2OK1A 3BZ3A 3CC6A 1Y91A 3WE4A 3R8UA 5C4KA 3IW7A 1YWNA 4FR4A 3F66A 3FKNA 4FKLA 1X8BA 4I5MA 3CS9A 5AP6A 1M14A 4CSVA 4FKVA 3CQWA 4JJRA 5IQFA 4LM5A 2DQ7X 4CZYB 2GMXA 2IZSA 2XRUA 2Z7SA 1YVJA 4NKAA 4W4YA 5CU0A 3CXWA 4L67A 4FSRA 3E92A 2H6DA 3PTGA 4QPMA 4YGAA 1RDQE 3KCKA 3VS5A 3HZTA 4DH1A 2O64A 4RQVA 2IW6A 3EKNA 4Z3VA 5AA9A 4EH4A 5FDXA 1IEPA 2WTJA 3RWPA 2W4KA 3S2PA 2CKPA 1OMWA 5E1SA 5F95A 5KNJA 1NVQA 2YM8A 1ND4A 3VBTA 4BYIA 3QA0A 1J3HA 4DT8A 3PZHA 1GZKA 4PTCA 3SOAA 4C4GA 4Z9LA 4R7BA 2YABA 3L8XA 3H0ZA 3NYOA 4EC8A 2PU8A 3DY7A 3QTXA 3R6XA 5DA3A 3WF8A 4DGLC 2QOCA 2VTAA 3KK8A 3P1AA 3UPXA 4JBVA 2V0DA 3DKOA 4OTIA 4JQ7A 1H1WA 4V05A 5HVJA 2FSMX 5AUTA 2Z7LA 5E8SA 2IWIA 1PYEA 4J53A 2VWBA 4F0IA 4EI4A 4JX7A 2G01A 2F9GA 2OJJA 5IA1A 3FLQA 2YIQA 4XV9A 3KRWA 3QUDA 4UWYA 1OPLA 3OUKA 3Q60A 4ACGA 4FK3A 4WSYA 3R7IA 3RAHA 4IAZA 2YDKA 1P14A 4EH9A 4CRLA 2FA2A 3Q4CA 4DG2E 3B8QA 4RIWB 2BKZA 3TV4A 5AA8A 4O7TA 5E8UA 3RINA 3PPKA 2PUNA 4DFBA 2BR1A 5C27A 5JMSA 3ORLA 3V5JA 3OWJA 2OFUA 3ET7A 4XLIA 4C38A 3VJNA 5FEQA 5IDPA 4GK3A 4FUYA 4QMOA 1J7UA 4RZVA 3HV5A 4BCJA 4LOOA 5HU9A 4U5JA 5EYKA 1RQQA 4B99A 3VW8A 4JI9A 5HE0A 4J98A 4RC4A 5EYMA 4LMUA 3KKVA 4CG9A 2WD1A 2JDRA 3I0OA 5D12A 2UW7A 5EDPA 4M0YA 1H26A 1BI7A 5KBQA 2IZUA 4I3ZA 4AA5A 3UVPA 5L2WA 1PMEA 4DG3E 4EEVA 3G2FA 4WOVA 5C03A 4FC0A 1PMUA 3OXZA 3VUTA 5BVFA 3AC4A 2VU3A 3DJ6A 4TYIA 2PYWA 3VBVA 4Y95A 4X2KA 3QALE 3NW5A 3UBDA 4UV0A 4AP7A 4RIXB 5I9WA 4ACHA 2ZYBA 2GNJA 4PNIA 3MB7A 4M15A 4ENXA 4L3LA 3R22A 4EHEA 2ZV2A 4UMTA 4O6EA 4D2SA 2X2MA 5HO6A 1Q24A 2XYNA 2WPAA 1SM2A 3O96A 2QURA 2OXYA 3VF9A 4TYHA 2JFMA 3Q9ZA 4X0MA 4QT1A 3TT0A 3RMFA 3WZJA 3TACA 4DFUA 4ANMA 3GCVA 3OBJA 2VZ6A 3GC7A 1PHKA 1QPCA 3D2IA 2BAKA 2I0YA 3Q6WA 3R1YA 1Q97A 3KXZA 2BRHA 3EFWA 4KUJA 1O9UA 4QMXA 4WG4A 3D9VA 3D5VA 5IQBA 2Y4PA 3FKLA 3E8NA 3KRRA 3QD2B 3C0IA 4IJPA 3NNVA 4ZK5A 3R7YA 5CALA 4NH1A 5HX6A 2ACXA 5AUWA 3VN9A 3C4WA 1NXKA 4D5KA 3I7BA 2WHBA 3RI1A 4EKLA 3D15A 5B2LA 3NS9A 1ERKA 3LIJA 4QYGA 4EK5A 5IMEA 4MQ2A 1FGKA 4AW5A 5J9ZA 1IG1A 3LW0A 2HZNA 2W7XA 3RJCA 2ZB1A 1JSVA 3CPCA 5AM7A 3GU5A 1QPJA 3NNXA 4IAAA 5HNGA 3RALA 3TZ8A 3CD3A 4BFMA 3QYZA 3DQXA 3PWDA 1APME 2IW9A 2C5YA 3ZBFA 5HZNA 3MSSA 2R3NA 2WTIA 3ORZA 4J7BA 1Y8GA 3GU4A 3U9CA 3LQ8A 4USEA 3TNPC 1YWRA 2A2AA 4Q5HA 1DS5A 1JBPE 1LEZA 4GT4A 4EWHA 2XIXA 3F69A 4J95A 4QMVA 3CLYA 4APCA 2W1GA 2OXDA 4FV1A 4I5CA 3PWYA 4ZSLA 3HMPA 4JG8A 3ORIA 4O6LA 4GCJA 4QYHA 5CLPA 3PDTA 2EXCX 2VTPA 1ATPE 2HY0A 3ZHPC 4PDYA 4F63A 5E8XA 5CQUA 3QD4A 2Z02A 3ALNA 3NUNA 5D9HA 4BCKA 3H9FA 2CSNA 2ZB0A 3MJ2A 3ORXA 5ANGA 3MFUA 4DGOA 2XNEA 3GENA 4AA4A 4FIGA 4Y8DA 3EOCA 4GG7A 3ZZEA 3BGPA 3IW4A 5DPVA 3V04A 5J7HA 3RZBA 4YSJA 3GU7A 4AN9A 1BL6A 1YOJA 2E9UA 2YCQA 3BIZA 4AE6A 2HW7A 5HU3A 1V0PA 4AGCA 4HVSA 3MH2A 4ENYA 3D7TA 4HYSA 4NU1A 5JRQA 3EQDA 1WBOA 4W4WA 5K3YA 3IO7A 4BDEA 3QRIA 2CCIA 3FMEA 5GJGA 3QTUA 2XH5A 4IM3A 4CYJA 1H25A 1XBCA 2HZIA 2JBOA 4TZRA 4AW2A 4M14A 4MH7A 1TKIA 4FYOA 3UQGA 5JK3A 4QMSA 2UW6A 2BDWA 4UX9A 1U54A 4BCPA 1G8SA 4R3CA 4I5PA 4FKUA 3HA6A 4IQ6A 4QP8A 3KVWA 3NIEA 2W17A 4YNOA 3W55A 3ZH8A 4AGDA 4CFWA 4EQCA 4ITJA 4UZDA 1ZY4A 4Y46A 3TIYA 2W1HA 3E87A 3DAEA 1FVVA 2XVDA 2EWAA 3FZOA 4BIDA 4CT2A 3WYXA 1FVTA 5HG9A 4EOLA 2BFYA 2BFXA 3HMIA 1V1KA 3HMOA 4MKCA 4YC6A 4USFA 2CGWA 4X2NA 4JOAA 5HKMA 1VR2A 2WO6A 3T9TA 2CNVA 5CEMA 3L9LA 1JSUA 3QRKA 3ORMA 2UVYA 4FEQA 4TW9A 4J52A 4XCUA 2VTNA 4FV6A 4MTAA 4N6ZA 4XP3A 5E8ZA 4NCTA 2IVSA 3FPMA 3S0OA 3L9PA 3F5PA 3C0HA 5D41A 3DJ7A 4DCEA 3EQFA 5HTIA 3FQHA 2OW3A 5DEWA 4GEOA 1OIYA 5DBXA 3V51A 4UB7A 5DT0A 2UZLA 3ATTA 5TO8A 5EQPA 4ITIA 4L3PA 3M42A 3GQIA 5BVKA 3PA5A 3ZFMA 1PKGA 4QP2A 5GHVA 3PXZA 4BTFA 2PWLA 4BWKA 4D4SA 2IVTA 5KUPA 4R3RA 5IDNA 3N4VA 5FD2A 5EQEA 4H58A 4YLKA 3HLLA 4EOOA 3GXLA 2ITNA 3R30A 4ZTLA 2NRYA 3IG7A 5ACBC 3AGLA 3LFQA 3FKOA 1OL2A 4IB1A 1PXNA 2E2BA 1ZWSA 2JD5A 4YJUA 4D1XA 5AAFA 5L6PA 3C7QA 4ORKA 4GUBA 1YKRA 2P0CA 3NNUA 3QTSA 4GVJA 3PE2A 2BDFA 4ASZA 4CD0A 5AJQA 3SQQA 2OF4A 4OT6A 5GZAA 3HUCA 3LFDA 3PY0A 3Q4UA 4O0UA 5AP3A 4PTEA 3VULA 2RFEA 3R71A 3ENHA 4KB8A 1UVRA 3RZFA 4IJ9A 4G6NA 2X4ZA 4TY1A 5G6VA 5TE0A 3VWAA 3FY2A 2FSOX 2HCKA 3R28A 3V3VA 1REKA 2HZ4A 4GW8A 4XV2A 4AAAA 3FLWA 2YERA 3N4UA 4S33A 4MBIA 3AC1A 5H8EA 4QNYA 2WQNA 3TUDA 3QQJA 4XUFA 3LOKA 4L45A 4EK8A 3TNHA 2H9VA 1OPKA 4PL3A 3MVLA 4I5HA 4E6DA 3QLGA 2GQGA 4LGGA 4GRBA 5J87A 4RX5A 3OXTA 3F3TA 2UVZA 3QX2A 4EQUA 1L3RE 2GS2A 4PL4A 4NM3A 4RMZA 2PMIA 4J8MA 4L01A 2W1CA 2P4IA 3PSDA 4ZP5A 5J5TA 2RFDA 5E7RA 4D55A 2OJGA 4YLJA 2RG6A 3SC1A 3PA3A 2OSCA 1JNKA 2IPXA 2F2CB 5M09A 4YLLA 3EWHA 3VAPA 4J1RA 3H10A 4UZHA 2WXVA 1H07A 1ZZ2A 2YAAA 4YHJA 4KNBA 4X3FA 5CEKA 1FINA 2IO6A 3MYGA 4PDSA 2BHEA 2VWWA 5HESA 5AMNA 3LM0A 3AC8A 1V0BA 4ZLOA 1H0WA 1Q8TA 4F7NA 3N9XA 3UMXA 4ANSA 3OF0A 4PDPA 2NRUA 3FZTA 3R7EA 4DN5A 3R63A 3EHAA 3FLZA 3V5QA 4EK3A 2F57A 4AZWA 5KMJA 3UQCA 1NY3A 2IZRA 2RG5A 3IDBA 4RVLA 3QGWA 4HVIA 3VC4A 4BCIA 5EK7A 3TJCA 3EN4A 4NYEA 4RJ4A 3OZ6A 3NEWA 1WBSA 5JFVA 3RVGA 3CQEA 5CZIA 5CQWA 4PNKA 5IQDA 3PVWA 3RCDA 3F3ZA 3UOKA 3E7OA 3NCZA 5DMZA 5I5ZA 4JQEA 2JIIA 4OTPA 3OT3A 4FL2A 2UZBA 1W98A 4XBUA 3LHJA 1OI9A 4WNMA 2IVVA 3D7TB 5CS6A 4JBQA 4FKPA 5ANDA 3KN5A 3VBYA 4O7ZA 3WARA 3ZM4A 4CZUA 3NYNA 4O0VA 2VO0A 2V22A 2RL5A 5IUIA 5J1VA 3JY0A 3EN5A 2BRBA 4IDVA 4HVHA 3MH1A 4OT5A 1OKWA 4FV2A 3RK9A 3F2RA 5M51A 5FTOA 3NLBA 4LL0A 1Q41A 3CGOA 3IQ7A 3AC2A 1GIHA 3QZFA 5J7BA 4RZWA 3DDPA 2W9ZB 2YCFA 2YDIA 3FBVA 4NCTC 5AV3A 5ICPA 3MA6A 4L52A 5HGIA 3SHEA 3Q5IA 5FM3A 3JUHA 4YUQA 5AADA 5HVKA 3D83A 3QUPA 4ZXTA 2B53A 3CY2A 4CMUA 4F4PA 1YI3A 2FSLX 4LQMA 4QMLA 4E3CA 5I4NA 2J6MA 3UGCA 4FA2A 3LE6A 4RG0A 2QHMA 5JN2A 3CIKA 1OIQA 1U59A 3PPJA 3DBCA 5HHWA 2ZDTA 3UP2A 1JAMA 2YISA 5C4LA 1CKIA 2QI8A 4MXYA 1H4LA 4OBOA 2PVMA 4O27B 2Q83A 4F99A 1Q5KA 5HVYA 5LVOA 3KK9A 4M69A 5EFQA 5L6WL 2BZIB 3KN6A 4BRXA 3PVBA 5AIKA 4FTIA 4CGAA 3BELA 3P78A 2WAJA 3TN8A 4JDJA 4I94A 5HG7A 1SNXA 2BIKB 3EL8A 1PYXA 2X4FA 5AR5A 3VS7A 4FKRA 3QYWA 4IB0A 4IVBA 4ALUA 2YFXA 4NSTA 5CZHA 5CVFA 4QO9A 3TUCA 3KMUA 1QMZA 2B9JA 3CY3A 4H3BA 3KRJA 4TNBA 3SX9A 3WZUA 4D0XA 3I5NA 4G3CA 4XOZA 3QF9A 3R83A 1FOTA 2WMAA 2V7OA 3P9JA 1REJA 4XV3A 2JC6A 2QC6A 4RGJA 3RM7A 4FSYA 4S31A 4IHPA 2ERZE 4R1YA 4EYMA 2W05A 4CMOA 3ZUTA 4BI0A 1UA2A 5DH3A 3H30A 3V5TA 3CKXA 1KE6A 2X7FA 3TEIA 4BWXA 5AIRA 4EL9A 3UC3A 4IWQA 3EKKA 2C5VA 2VNWA 3D94A 1OBDA 1YOMA 4DFZE 5I3OA 2J2IB 2C6LA 1P5EA 3HP2A 1H08A 4FNZA 4NL0A 3NWWA 2EVAA 4X3FC 4OTDA 1YQJA 5EDRA 1MRUA 2IN6A 4BBMA 5CF8A 3DAJA 5A6OA 2VRXA 2CN5A 3DOGA 3BYSA 1Q62A 4ANBA 4USDA 4TYGA 5L2SA 3PSCA 4I6HA 4JIAA 4RWJA 5JEBA 2Y4IC 4TL0A 1OECA 4RVKA 1LEWA 1UU3A 4ZMFA 4D1SA 3O7LD 5E4HA 2UW4A 4L44A 3SW4A 3A2CA 4FTJA 2BKKA 3LCKA 4L6QA 5FTGA 2JKOA 4AOIA 4YC3A 3E88A 3SXSA 1PXOA 3ZMMA 3VJOA 2W5BA 2JKQA 2W4OA 4MAOA 4O1PA 3ZEPA 4FV9A 4UWCA 5KZ0A 2Y4IB 3OOGA 3QWJA 5F1ZA 3HNGA 3ULZA 2PE1A 3HUBA 4G5PA 4FKJA 4C36A 3GGFA 4MF0A 2BRNA 3EQPA 4EZ3A 3SG8A 3IGGA 2GS6A 4BBFA 4O0WA 2YM3A 5EHYA 2YM7A 3NAXA 3MPMA 2XIRA 4GFGA 4YC8A 3HV7A 1Q3DA 4I6FA 2C5NA 2VWYA 4JAIA 4QYYA 4FOBA 4CLIA 3C4XA 2CNUA 2PUPA 4JG6A 4IB5A 3Q53A 3L9MA 3R01A 2A4LA 4LRMA 1IAHA 1T45A 1YHVA 1FMKA 4L7SA 2XM9A 4ACCA 5EM6A 3PLSA 1MUOA 2CPKE 2LGCA 3ZRKA 3FSFA 3O17A 2JDSA 3Q4TA 2VV9A 4FSUA 3TWJA 5IISA 2OZOA 4ZMEA 2JDTA 3R21A 4EOQA 4J8NA 5J79A 3A60A 4OW8A 4C35A 1DM2A 1H0VA 1PMVA 3HP5A 4O82A 4KBKA 4V0GB 4FTTA 3SW7A 2W1IA 2GNGA 4U3YA 4EUTA 4FNXA 3N4TA 4FX3A 4CKJA 4W9WA 4O83A 2O63A 5HCXA 2EB3A 1QPEA 1UNGA 2QOIA 5FQDC 1KWPA 3FQSA 3IS5A 1OUYA 3G9LX 4BICA 1E9HA 3TNQB 3BEAA 1YDTE 3GQLA 4ZTRA 3SG9A 5DNRA 4HCVA 1H1SA 2IZTA 4Y73A 3M1SA 4GKIA 4RRVA 2HOGA 4LL5A 5JKGA 3PA4A 4YTIA 5EHOA 5L4QA 2JIUA 4E1ZA 1Q8ZA 3IDPA 3S1HA 1TQIA 3C50A 3QU0A 1L8TA 5B7VA 2R3FA 1JSTA 1IA8A 2GU8A 3IW5A 4U9AA 3FI2A 1SZMA 4N70A 3LJ2A 4E26A 3WZDA 2BUJA 5A3XA 4CKRA 2Y7JA 3E3PA 4YNEA 3LLAA 3DKFA 3REPA 3RTPA 3Q9YA 4RIOA 2BPMA 3KVXA 5CTPA 4RA5A 3LLTA 2QD9A 3F5XA 1YOLA 2ITUA 4G9RA 4X7QA 5D10A 2PVNA 4I0SA 5HIDA 3CP9A 3ZFYA 3QTRA 3I7CA 4IAYA 4L7FA 1PXMA 1YDSE 5CI7A 5EI8A 3FI4A 4GU9A 4YZ9A 4FSMA 2WTDA 2ITTA 5E91A 2WTCA 3QKLA 2Y9QA 4AACA 2CJMA 4AT4A 2XKCA 5L2IA 4ASEA 4O7WA 5E1EA 3FWQA 3DTWA 3OMVA 3MV5A 3EYGA 2HXQA 4D4RA 1PKDA 5FBNC 2W1ZA 2J7TA 4FSTA 2H96A 2R7BA 5CEOA 1JKSA 4RIXA 4FV8A 3O7LB 3SAYA 4OR5A 3ZLWA 2GPHA 4KIKA 4FICA 4NK9A 3KF4A 3RKBA 4P5ZA 2X0GA 4RJ5A 4IWPA 3LCSA 2YIYA 4AW0A 3W10A 5K5XA 3HEGA 3VIDA 4IXPA 5AWMA 4E20A 2WB8A 3MPTA 4EONA 3BI6A 2NP8A 5FRIA 3UZRA 4CV9A 2PZYA 5AP0A 5G1XA 4D4VA 4F9AA 4JRVA 1KOAA 4C4JA 4O0SA 1G5SA 5AFVA 2VO6A 4ACDA 3QKKA 2W1FA 5CY3A 4BIBA 1PXLA 4K9YA 3NRMA 3F88A 3OY1A 4G34A 4DFNA 2AYPA 5IEYA 2CNQA 3BV2A 4H1MA 5FG8A 1Q3WA 5CX9A 2O3PA 3TKUA 4BZOA 1LUFA 4MBJA 2WEVA 3C4FA 3P4KA 4I4FA 3D2KA 4FSWA 5CEIA 4O21A 4GYIA 4KINA 4GU6A 3UP7A 1Q8UA 2GFSA 3LMHA 3ITZA 4XG9A 3RK5A 3NVMB 1VEBA 2UW3A 4GJ3A 3ZSIA 2QKRA 3PG3A 3ZS5A 1HCLA 2R2PA 2R0IA 3H9RA 4K77A 4WUNA 5AP4A 2ITPA 4ACMA 4BCNA 1UNLA 4W9XA 3KULB 4G3GA 2XK8A 3AMAA 1A9UA 3R8PA 5AUYA 4X2GA 3RHXA 2RGPA 3EFJA 4C62A 3JXWA 4A06A 4YJQA 5JGDA 4FKSA 2YM6A 3KA0A 3LMGA 2XKEA 3ZBXA 3F6XA 4FNYA 4C4FA 5ETIA 3AMBA 4QQCA 2R7IA 3ERKA 5D7AA 3OW3A 5IA2A 1JOWB 4NEUA 2HY81 3O8UA 1XR1A 1RW8A 1FMOE 3ZEWA 5EM5A 5J9YA 4LGHA 3GFWA 5LJJA 4AA0A 1WVWA 5JH6A 3TM0A 4UWBA 3SRVA 4JRNA 5M4IA 3C4ZA 3POZA 4ID7A 1LP4A 5H2UA 4NTTA 4QMQA 2F7XE 5KO1A 4AE9A 2Q0BA 4E5BA 3GC9A 5KZIA 2R4BA 1ZZLA 2R3JA 4E4NA 3OP5A 3DGKA 3Q52A 4GK4A 3QTQA 5CU4A 3KXGA 4AZFA 4HGTA 3GOKA 3MPAA 4IAKA 4ZOGA 2QU5A 5AR7A 4QTEA 4H3QA 4O22A 3AT3A 3O51A 4Z55A 4CG8A 3ORNA 1A48A 4TWOA 3UC4A 3MVMA 5J1WA 2YN8A 2CLQA 3FV8A 3BEGA 3FI8A 4B0GA 5EQYA 4I0TA 4IX3A 5HLWA 3FZPA 3AG9A 3OS3A 2B0QA 3Q9WA 4L8MA 4FV0A 2RF9A 3V8TA 4PMMA 4YO4A 5CEPA 4KSQA 4U44A 4EC9A 4QQJA 4EK4A 3C5UA 4J97A 2OBJA 4MD7E 2XA4A 3LFCA 4QQ5A 4Z7HA 4B7TA 4QMTA 4FE2A 3C4EA 2X9EA 3R8MA 4LFIA 3TG1A 5DRDA 3A4OX 4E5WA 2R3KA 4MF1A 3F2NA 4XOYA 2PVFA 3BPRA 5DN3A 3C13A 3ZCLA 3W33A 2A1AB 5A46A 2J50A 2ITZA 2OO8X 3KRLA 5FBOA 3QAME 3QCXA 3OCTA 4FV7A 3OW4A 5CU6A 4S34A 3LKMA 4MXAA 5TOZA 3SDJA 2B54A 3OC1A 4Y72A 4XJ0A 2F4JA 3FLSA 2CKEA 3M2WA 3ORTA 5CVGA 3W32A 4ZLZA 4C37A 3HVCA 2X8DA 4XYFA 3B2WA 1ZYCA 3ZC5A 3IGOA 5KMMA 4FTQA 3VHKA 4S2ZA 3U51A 1J1BA 3KQ7A 3R7UA 2QONA 3IOPA 4GK2A 4F1OA 2P33A 3QQUA 3MTFA 3QTIA 3L8SA 4FF8A 3U8WA 4LRJA 3OY3A 4FVPA 2J5EA 4PDOA 4R6VA 2OJIA 3LFAA 5M08A 4HGSA 2GDOA 4QMPA 1JKTA 3C5IA 1SMHA 4KIKB 4I1ZA 4AGWA 4O7RA 1PMNA 4A9YA 3MW1A 2XNPA 4HOKA 1S9IA 4W8EA 2C3LA 3UVQA 3UZPA 1M7QA 3P7AA 3EN6A 4AU8A 2XMYA 3MVJA 3RGFA 4PUZA 3FJQE 4FIFA 3W2OA 4A9SA 4EUUA 1OGUA 4IWOA 4BZDA 4R7HA 1W82A 2XYUA 4G1WA 4RLKA 3FHIA 4TPTA 4ZTQA 5K4IA 5ACKA 4AT5A 2AC5A 4CV8A 3R9HA 2KTYA 1FBNA 2JKMA 2XM8A 3DB8A 1J91A 4M67A 4BGQA 2J51A 3N51A 4XP2A 5E8TA 2PK9A 1YXTA 3C1XA 2J0LA 2E9OA 2GHMA 2YDJA 1DAYA 4HPTE 4IZAA 4LG4A 3ZDUA 4PMSA 3G51A 1UV5A 1Y6AA 1SNUA 4JR7A 2YCSA 5EHLA 3H9OA 5KMOA 1KV1A 3BYMA 5FTQA 3UOJA 4L42A 4YZDA 3GCUA 3EQCA 5HO7A 4S32A 4EORA 5IEVA 2OLCA 4ZJJA 5IUHA 4JR3A 4EOIA 3R2YA 2VTOA 3DLZA 5C1QB 2GQSA 1XH7A 5KKRC 2R3PA 5HLNA 2PY3A 2DUVA 4FYNA 2OI4X 4BI1A 4O7NA 4RIYB 1W7HA 4JT3A 4PRJA 5HTBA 3MY5A 5CF5A 3DB6A 3TZ9A 5FWKK 2ZMDA 3U54A 4WBOA 5IA4A 1OL6A 5AP1A 3S4QA 5E9EA 3VUKA 3ORPA 1XO2B 1O6YA 4WT6A 4AS0A 3F5GA 2WTVA 2VWIA 2OZAA 4R8QA 5KKRB 3EQRA 3HDNA 5DVRA 1B39A 3SVVA 5BMSA 2OH0E 3AMYA 3PJ1A 2QOFA 3ODYX 5CSVA 4BC6A 1H28A 4IAFA 4YTFA 3LJ0A 5B2KA 2XBJA 3SRVB 2OF2A 1XBBA 4BDFA 3AXWA 4IFGA 4EJNA 4TYJA 3BWFA 5IQHA 5EI6A 2P55A 4EKKA 4K18A 1B6CB 3G15A 4Q9ZA 2WQEA 4DTBA 3A7GA 5EW3A 4EBVA 2QQ7A 3OWKA 4RJ8A 2ZJWA 4I22A 5FLFA 3NUXA 2YEXA 3WF7A 1W8CA 2WZJA 4LRKA 2FH9A 3RPRA 5I9XA 3EYHA 4DLIA 4FEXA 4E8AA 1WAKA 2XK3A 3O0GA 3ZLSA 4DF3A 3D14A 2VWUA 3QRJA 3AC5A 5CF4A 4NJDA 4GJ2A 2JDOA 2XEYA 4FI1A 4BKYA 4DBXA 3DA6A 4ANNA 4F7JA 5HE2A 4U97A 4AXAA 1I44A 4DFYA 3VF8A 4DLJA 2QR7A 4OTHA 1Z5MA 3VO3A 1ZMVA 3AQVA 2V5QA 4ZTMA 1Z57A 2PVLA 4IFCA 3EFKA 5ETFA 2E9VA 3FQEA 5LARA 2RSVA 4CCUA 4V04A 4AFJA 2XNGA 3FZ1A 4IX6A 5H3QA 3UO5A 4DH5A 4XRJA 5BX0A 4GFOA 2GHLA 3KRXA 4FKQA 3T8OA 3NUSA 2G15A 2W9FB 4HGLA 3ROCA 2PZPA 2Z7RA 4JDHA 2BAJA 2VUWA 3VS2A 3MA3A 3RK7A 5CASA 3R8VA 3ZSGA 4ZS4A 2UZVA 5M07A 2W1EA 2OIDA 4M68A 1OVEA 3DK3A 3VUDA 5LXMA 4FVRA 3WZKA 5FXQA 4BDCA 3SXFA 3SV0A 3GI3A 4ZTSA 1YRPA 1BLXA 4FKWA 2ZDUA 5M4CA 4JIKA 3S00A 4YJRA 4P2KA 4OAUC 2PZIA 5LMAA 3CTQA 4MD8E 5ETAA 4WBBB 4BCOA 3VBXA 1XKKA 4K6ZA 3QXPA 4HVDA 3FLYA 4BKZA 4E4LA 2QO7A 3FZRA 2Y8OA 1CKJA 1R0PA 3BHTA 3EQHA 4I92A 4PMPA 3CJFA 4QMNA 5BQ0A 4FT5A 4B9DA 5J5SA 3BE9A 4FV5A 5HLPA 3UNJA 2BILB 5A4LA 3QQGA 1R39A 2F49A 2QOKA 3EMGA 4RJ3A 4GVAA 2PVKA 4NUSA 4NZWB 2RFNA 2XRWA 4UY9A 3GCQA 3BHVA 4FKGA 5JRSA 5KE0A 4U42A 4Z16A 5IA3A 1M17A 5IQAA 4O91A 1OL1A 2O2UA 3VVHA 4BCFA 3PXKA 2FSTX 4K2RA 3OHTA 3RBWA 3P08A 2NNWB 2WELA 4CT1A 3NUAA 1WVXA 3FC1X 4FT9A 4RX9A 4XG3A 3S3IA 3VRZA 5CWZA 2PULA 5ANJA 3TZ7A 4XHKB 3FEGA 1QCFA 3KF7A 4U3ZA 1M7NA 4D2VA 3TKIA 1F5QA 3QZIA 5AX9A 3ZXTA 1XH9A 3DFCB 4CQEA 5FP6A 4XMOA 2UZEA 4U8ZA 1O6KA 4KIQA 4BDBA 3DQWA 3ALOA 4L3JA 3OUNB 2A19B 1WBWA 3MB6A 4GL9A 4NM0A 3GOPA 3ORKA 4QTAA 4FGRA 5KMKA 4C0TA 1H1QA 4HW7A 4R5SA 4Q5EA 5IU2A 3EZRA 3QQLA 2YM4A 2PZRA 1GZ8A 2QOOA 1UU7A 3P79A 3Q4ZA 5CU2A 1UWJA 5HBHA 1KE5A 4JDKA 4WUAA 2VO7A 1DI8A 3R9DA 3FAAA 2J4ZA 1UKIA 3FI3A 4LV5A 4HPUE 2VWVA 2UUEA 3QLFA 3SXRA 1STCE 1DI9A 2PE2A 2UZOA 5HNIX 4ZSGA 5JGBA 4KBCA 1PY5A 1WBTA 4JXFA 2OZAB 3A99A 2QG5A 3DNDA 3NSZA 3QRUA 4A9TA 5I9VA 2WMRA 5M44A 4FGBA 3MVHA 5CXHA 2RKUA 2REIA 2PHKA 4D2WA 4IMYA 1ZYDA 4DFXE 3MI9A 3TTIA 1OZ1A 3WBLA 4EOPA 3Q2JA 2QR8A 3C9WA 3MESA 2VTTA 2R3HA 2VTSA 3PIXA 5C9CA 2XK7A 3QTWA 4NTSA 2C6MA 2GS7A 2CN8A 4OBPA 5M56A 1UWHA 2HWPA 1TQMA 4QRCA 5CSWA 2R3GA 3F3WA 1BYGA 3KC3A 3ODZX 4JL9A 1E1VA 1CSNA 4NIFB 4QMWA 4K11A 2R64A 4XG2A 3KU2A 4RC3A 5ANIA 2VTLA 5JZJA 5LVPA 4IVCA 2Q0NA 3LZBA 3R9OA 4L46A 5EG3A 5IA5A 4KRCA 5H8GA 4BTKA 4EOSA 3R1QA 1JVPP 3MH0A 5FXRA 3BCEA 3U6IA 5IQIA 2HW6A 4D2RA 4YJNA 3TV7A 2Y0AA 3JY9A 4FV3A 4H1JA 5HG8A 3GNIB 4S30A 2WIHA 4XG4A 4RT7A 5A6NA 4WSQA 3TIZA 2B9IA 4DEAA 1YWVA 2G9XA 2ITXA 1Z9XA 3O2MA 2I6LA 2WMBA 4RPVA 2BZJA 2QCSA 4QP7A 2ZM4A 5HIBA 1PF8A 5I0BA 5AR3A 3ZDIA 5IZFA 1NW1A 3IW8A 3FMNA 4HYHA 4BF2A 5IMXA 2OIBA 4V0GA 3E8DA 4UXQA 4ZTNA 4YTCA 4LUEA 2QKWB 4OTWA 3UNZA 4QMYA 3HV3A 1K3AA 3PXFA 4RWKA 3ANQA 3RM6A 4X2FA 4CFUA 3NYXA 4F9YA 2WMUA 5IQGA 4C4IA 2BTSA 1J7IA 1MRYA 4JDIA 1OM1A 5ANKA 4UMRA 4WNKA 4O7YA 5D7VA 3NAYA 2RFSA 2PVRA
chains in the Genus database with same CATH superfamily
3DV3A 3ZZWA 4YZCA 3GP0A 2UW0A 2QG7A 4KS7A 4QYEA 2YJSA 4MYGA 3I81A 3WI6A 3UNKA 4L00A 1GNGA 3QFVA 3R73A 4U45A 3QCSA 5LVLA 5L8LA 3E62A 3PUFC 4BDDA 3ATSA 4QNAA 4BDKA 4AWIA 1GZOA 1T46A 3LM5A 1GIJA 2XNMA 2ZM3A 4WKQA 5AUVA 5HI2A 3II5A 2WTKB 4QMMA 3ZSHA 4ZSAA 5DLSA 3UIMA 3UG1A 5BVEA 2XCKA 2FYSA 3GU6A 1KE8A 4FK6A 5E8WA 4EOMA 3DTCA 3QC9A 2PSQA 1XH4A 3B2TA 4ZSEA 3FY0A 3HGKA 3IOKA 1TQPA 3LQ5A 4KKEA 3RPYA 3BV3A 3L9NA 2WQMA 1CKPA 3T3UA 1TFFA 4L9IA 2X9FA 4K0YA 3BYUA 5TKDA 4PL5A 4FTUA 2F7EE 3FE3A 1JQHA 3MIAA 2C6KA 2OU7A 1CM8A 3OTUA 3CD8A 4MNEA 3UIUA 1Q8WA 4ANLA 4O84A 2C69A 2JBPA 4G31A 5CI6A 1WMKA 2E9PA 4ARKA 3Q3BA 4ASDA 2XKDA 3F3VA 2OGVA 2Y6OA 3PY3A 4FT3A 4WIHA 4TN6A 1OGYA 1OKVA 4FTCA 4D2TA 4Q9SA 5EM8A 2R3LA 5JGAA 1YHSA 4FTAA 4B8LA 4U0IA 4EH8A 1O6LA 2O0UA 4GFMA 5AV1A 5AUUA 5GZ9A 4TYEA 5JSMA 3MS9A 4E6QA 4BHZA 4MQ1A 4XNEA 4KIOA 2AUHA 2FVDA 3FMMA 3GCPA 3RCJA 2FO0A 2OKRA 2UW9A 4BIEA 2CMWA 2CGVA 4NWMA 1XBAA 4KBAA 4FSQA 4N4SA 4M84A 4FVQA 3MFRA 5FP5A 2X0OA 2XCHA 5HEZA 4D5HA 3FSKA 2R5TA 2YACA 4FUXA 4EOJA 4XH6A 4YBJA 4AXCA 3UQFA 5M53A 1VYWA 3DNEA 5BPYA 2JEDA 2YIWA 4JNWA 3AGMA 3F82A 4XG6A 5CANA 4I20A 3EJ1A 3F61A 2XAOA 5HE3A 3FMLA 3VS4A 4O7VA 2NO3A 4LV7A 2ZVAA 1VLRA 5JT2A 5HIEA 1BMKA 1W2FA 4RWLA 1AD5A 5EM7A 2ITWA 3EL7A 4HNFA 3W2PA 5TF9A 5TT7A 4FIJA 4E5AX 3BGZA 4W4XA 3HX4A 3TNWA 2O65A 4FG9A 3QTZA 3Q32A 4AN2A 2YA9A 2B55A 3OCSA 4BKJA 5IH6A 4FEUA 3KULA 3C0GA 4YZNA 5HCYA 3W1FA 5IEXA 4PPBA 4M8TA 4BCMA 1GIIA 4QYFA 2OICA 2PVJA 2F2UA 3PFQA 3UYTA 4DAWA 4JLCA 2VTRA 1W2CA 2HZ0A 2XJ1A 4OUCA 4C59A 3F3UA 4DITA 5DI1A 2BALA 3KXMA 4OGRA 4C3FA 5F94A 2GNIA 5LOHA 2JAMA 4BDHA 5ANOA 3BBTB 3ELJA 5DR6A 2WEIA 4RX8A 4V01A 4F6WA 3UZTA 2C6OA 3VUMA 3NFGB 5BVNA 2HWOA 4EWQA 2XK4A 5DHJA 1KUTA 4DHZA 2JLDA 4MXXA 4R5YA 1ZARA 4H36A 2P3GX 5K9IA 1ZXEA 4BDGA 4KKGA 4YO6A 4DEIA 3KGAA 3R00A 5IG1A 4AW1A 3JVSA 5CT0A 4U81A 4GYGA 4LUDA 5CENA 2SRCA 4C4EA 4I23A 2OXXA 4BCGA 2ERKA 3QRTA 2ZAZA 1YXVA 4UALA 5HNBA 3LXLA 2J0JA 4IVDA 2C0TA 4F09A 5CAPA 3PYYA 4NW6A 4FZDB 4WNPA 1HOWA 4DG0E 4W8DA 2UZTA 4KKHA 2PPQA 1KOBA 3GVUA 4IBMA 2Z60A 3ZLXA 1JKLA 3R7VA 4P90A 2XNBA 5F20A 3BKBA 4KIPA 5EDQA 1H27A 5ITAA 1FPUA 4ITHA 4YMJA 3W16A 1QL6A 4RVTA 2G1TA 3BRBA 3BWJA 5L2TA 2W06A 4IZ7A 1Q8YA 3BQRA 4B4LA 4E6CA 4M97A 1A06A 2C6TA 4MK0A 2QO9A 4FG7A 1PXJA 2QVSE 4BVUA 1AGWA 1I09A 4QPSA 3K5VA 3R1NA 5D1JA 3A7JA 3LJ1A 5TR6A 3TDWA 1TVOA 2E9NA 2X8EA 4YPSA 2YLEA 1M52A 3P5JC 5EOBA 1OIUA 3GFEA 4LMNA 4MHAA 4I4EA 5BYLA 3COMA 2FGIA 5E8VA 3VRYA 2V55A 2W5AA 4G6LA 2IVUA 3ZO1A 4D2PA 4ZEGA 3GEQA 4IIRA 4MEDA 4C61A 3KXNA 3RP9A 4XRLA 2UW5A 3U9NA 4DEDA 2QHNA 4FIIA 4EH2A 3O50A 3O8TA 3AKLA 3A62A 1GAGA 4UMUA 2KULA 3KCFA 2YZLA 1R3CA 3QGYA 4MNEB 2WTWA 3SOCA 2PTKA 1W84A 5LWNA 1B38A 4CFXA 1G3NA 3FUPA 2VTHA 4MWHA 2VGOA 4QP6A 4XX9A 3OD6X 5IQEA 4RX7A 3V6RA 2GNLA 2A0CX 1E1XA 2WKMA 5BNJA 4BGHA 4G3EA 2X2KA 4QP9A 2WQBA 4G9CA 5LVNA 1W83A 3PP0A 3VS6A 2PVHA 5LCJA 1HCKA 4U40A 4I6QA 3PZEA 4D9TA 2GNHA 3JYAA 4F6UA 3LPBA 4FKTA 4HZRA 4JVGA 1U4DA 4TNDA 5FDPA 3QX4A 4TRLA 3R9NA 3T3VA 3I5ZA 4FSNA 4U41A 2XIYA 3PJ2A 4A4XA 3BU6A 3DZOA 2BAQA 2QODA 2Y6MA 4AZTA 1WVYA 2C30A 4ZJVA 2XAMA 4BI2A 2EB2A 1ZLTA 3H3CA 3G33A 4JX3A 5FXSA 3KL8A 2J0MB 4I41A 3WF9A 3ZRLA 4ZAUA 5CXZA 2W0JA 3NW6A 4NM5A 5M4FA 3CGFA 1KV2A 2R3RA 1U46A 4P5QA 3BX5A 3VUHA 3QD0A 3NMUF 5A4TA 4GSBA 1OUKA 5A4CA 4JQ8A 4IM2A 3OG7A 3OEZA 1RE8A 2H34A 4CFFA 4DYMA 2ZM1A 2YHVA 4IC7A 5DG5A 3U6HA 2BCJA 1WFCA 3BU5A 2X7OA 3WOWA 4OTRA 2BIYA 4U80A 4YZMA 3U55A 4RIYA 2PZ5A 1GOLA 2VN9A 4KAOA 5K0KA 3FMHA 3CR0A 3E3BX 1UU8A 3IK3A 3CQUA 4UXLA 5BVWA 1UNHA 3V01A 3LQ3A 3O23A 5L3AA 2R0UA 5E92A 5FEDA 1YHWA 3OWPA 5ANEA 5HO8A 2C4GA 1H01A 2ESMA 3GC0A 4G3FA 4X6QC 1ZRZA 4CEGA 4NT4A 4EHVA 4TXCA 4IX5A 5BUJA 5FGKA 3C4CA 2ITYA 3VBQA 4O86A 4I93A 4CXAA 5T3QA 1XWSA 4TWPA 4DGGA 3K2LA 4WO5A 3PVUA 4AZEA 3UO6A 3FPQA 3TKHA 5IF1A 4O7SA 2WU6A 3KXXA 2I40A 3NYVA 3G9NA 3V5PA 5A4EA 3F2AA 4LGDA 3KIOC 4M3QA 5CSXA 4BY9E 5A4QA 4O7LA 4Y5QA 4LI5A 4DEBA 1OL5A 4HJOA 2J5FA 2UV2A 5HOAA 2P2HA 3P86A 4DDIA 1OIRA 3ZO3A 1R1WA 2YZAA 4AOTA 5FEEA 4GT5A 3HYHA 5DFPA 1P4FA 5C8MA 3UE4A 4QMZA 2BTRA 4Y83A 1WBVA 3QQKA 2CDZA 5F4NA 3VUGA 3RAWA 3FMJA 3QL8A 4KD1A 4M13A 4BCHA 3DDQA 3BU3A 3WIGA 5K0XA 3VQUA 3OBGA 3FXZA 4F9BA 3BBWA 3MTLA 4PP7A 1XH5A 3A7IA 4E73A 4NJ3A 2XP2A 2ZMCA 4YPDA 4CLJA 1XJDA 4W4VA 2PUUA 4PWNA 3ZXZA 4YJOA 2ITOA 4WNOA 1CDKA 3OT8A 4IE9A 3UODA 4MD9E 4E93A 1Y8YA 4KS8A 4A9RA 2C47A 3P23A 1NA7A 2ITQA 5HE1A 2VWZA 3EQIA 2X8IA 3CKWA 4A9UA 3VW6A 5GNKA 4GV1A 4G5JA 3HA8A 3LCDA 4C2WA 4O0RA 3HECA 5C01A 4CRSA 5GJDA 4BDAA 3O71A 2C68A 3DCVA 2GQRA 2VX3A 3PRIA 3ENMA 3NNWA 5AV0A 2ETKA 4RFYA 4ZIMA 1Y57A 4UN0C 3OWLA 5LWMA 3QQHA 4YSMA 4FZ7A 4F64A 5LVMA 4F78A 3UTOA 4MCVA 5DGZA 2JIVA 3R0TA 1H24A 4PY1A 2BMCA 2JFLA 4LV8A 3UOLA 3ANRA 4FIHA 3ZFXA 2YLFA 5D11A 4EK6A 5L8KA 2WMVA 4BHNA 4DEEA 5J8IA 1M2PA 3I1AA 2G2HA 5JFXA 4FL1A 4K1BA 4NM7A 4FL3A 4O0TA 3TNIA 3MJ1A 4IAIA 5AV4A 4XG8A 5B0XA 3IPHA 2JDVA 3G6HA 4QMUA 4RVMA 4PF4A 5CT7A 4EHGA 4F1TA 4U6RA 2VTJA 4C3RA 4FMQA 4ZY6A 4RLLA 4CVAA 3COKA 3IECA 2YCRA 4LOQA 4F7SA 3TI1A 2OJ9A 4RJ7A 4QTCA 5DR9A 3W2CA 3DAKA 3BGQA 2HENA 3POOA 1LPUA 2QOQA 4F0GA 2QLUA 3NW7A 1YW2A 5K5NA 2PUIA 4MWIA 3UIBA 4HCUA 4O1OA 1F0QA 3PJ3A 3A8WA 5T6KA 3KFAA 1G8AA 2WOTA 2YIRA 4UEUA 4YJSA 4GUEA 5DE2A 2QOBA 5EYCA 4AX8A 5DRBA 3ZONA 4ZY4A 3PXYA 2G2FA 3DBDA 5L8JA 4IM0A 4D4YA 2XB7A 4FBXA 4Y5HA 3OOMA 5JFSA 3W2RA 2JITA 3LFFA 4XLVA 5AEPA 4J71A 2I0HA 5I9ZA 3CPBA 3E8CA 2X81A 3EQGA 4P7EA 3V8SA 3AD4A 3IDCA 2FB8A 3QZGA 4TT7A 4OTQA 5EYDA 3F5UA 2ITVA 2XF0A 1JLUE 5KMIA 2EXMA 2XBAA 2JAVA 4QP1A 1URCA 2C3IB 1ZOGA 5EKOA 1VZOA 3QHRA 3FLNC 2IW8A 3RNYA 4F08A 5C26A 4FZAB 3DXQA 4RSSA 3LCOA 3LFEA 1MP8A 4A4OA 4BTJA 1YXXA 3DKCA 3HV4A 4L68A 4HVGA 2XK9A 1VJYA 1LR4A 4E7WA 2QNJA 5I9YA 3KXHA 3COIA 2HXLA 3UIXA 2VTQA 2YIXA 3LXPA 5J95A 2C6EA 4WHZA 4ZLYA 2OH4A 1H1PA 2C1AA 3NR9A 3K54A 3PIZA 4EH6A 3I6WA 4RA4A 1Q99A 3VQHA 4IX4A 5BVDA 2C1BA 2YM5A 5L6OA 1IA9A 1MQ4A 4FG8A 4EHZA 5BUEA 2C3JA 3TUBA 4ZJIA 2YJRA 1U5QA 1Y6BA 2WMWA 3GCSA 3QWKA 3BHUA 4HYUA 4RJ6A 4DEHA 4YURA 5C8NA 4B8MA 3VHEA 4PPAA 5J9LA 4AZSA 2EXEA 4NIFA 3PP1A 4TKSA 5C8KA 4FIEA 2UZWE 2CKQA 3A61A 2C5OA 4DC2A 4IANA 3D0EA 3PIYA 4L43A 3DU8A 3F7ZA 3L1SA 4WRGA 3WIKA 4CTBA 5EKNA 1GZNA 4G6OA 4BBEA 3PY1A 1XHAA 3EN7A 4O38A 3NVKI 3WZEA 2I0EA 3BLRA 3KMMA 5GZ8A 2WMXA 2O5KA 5LMBA 4GKHA 2B7AA 3R8LA 1PXIA 4O2ZA 4A4LA 2QU6A 4PQNA 1WBPA 4BTMA 3SGCA 5ETCA 4BDJA 4FTRA 1XH8A 1W2DA 2BZKB 2WU7A 3ZO2A 5IPJA 3CTHA 5HQ0A 3LFSA 2V7AA 3JVRA 4OBQA 3HMNA 1P2AA 3ID6C 4YP8A 1FVRA 2W4JA 2X2LA 3ZO4A 4A7CA 5KMNA 2R9SA 3EQBA 2PL0A 4RQKA 3LAUA 3G5DA 2BHHA 3MY1A 3OROA 3NUPA 4FEVA 4RC2A 4KABA 3NZ0A 3WF5A 2B4SB 4TTHB 4WG5A 5HTCA 4IB3A 2ONLA 4GS6A 1XQZA 3S95A 4YHFA 4R7IA 4EH7A 3GC8A 1F3MC 4E4XA 4ERWA 1WZYA 4IEBA 3CCNA 3Q96A 2Z8CA 4G2FA 4QOXA 4FTMA 3QKMA 1NT2A 4DH3A 3LCTA 3K3IA 1CMKE 2XEZA 4FTKA 3ZOSA 4CQGA 5AM6A 4JAJA 3ACKA 3NX8A 4WD5A 2UW8A 4RFMA 3QC4A 4EBWA 2R3MA 2B9FA 3I0QA 3TTJA 1PRYA 5AUXA 4CFMA 2IG7A 2OWBA 4HYIA 1MQBA 3W8LA 2W96B 3QD3A 5T68A 4LOPA 4FTOA 4ASXA 2I1MA 2W1DA 1VYZA 1NVSA 1ZMUA 4QP3A 4M7IA 1SVHA 4WG3A 4O0YA 1QPDA 3ETAA 3QCQA 4UMQA 3V5WA 5BYYA 4AOJA 3OEFX 3QBNA 4YHTA 3ZU7A 2BVAA 2Z7QA 4UYNA 4X2JA 3H0YA 5AR2A 1ZOHA 3BYVA 4FT0A 4O0XA 4BZNA 5M06A 5H8BA 1DAWA 4PP9A 5EW9A 1H00A 3BHHA 3I4BA 3P0MA 3PSBA 4MXZA 3BLQA 3OVVA 4UBAA 3TZMA 3H4JA 1PJKA 3E7VA 4CZTA 5DR2A 1IR3A 4QQTA 3DK6A 2PMNX 4C33A 3DBQA 4F9CA 1PXKA 5AP2A 4TYHB 3U4UA 3O5AA 1R78A 3O8PA 2PE0A 3ZLYA 4QPAA 1J7LA 3QZHA 2VTMA 1YI4A 2UZNA 4YJTA 4XV1A 2QOHA 5LQFA 4MVFA 3WYYA 2G2IA 1BKXA 4X6RA 3QXOA 2BZHB 1ZYSA 3AT4A 5AP5A 1M2QA 4R1VA 3PG1A 2WMQA 3EZVA 4FSZA 2J90A 1G8KA 5FUTA 3R1SA 3LVPA 1H8FA 4BN1A 5BUIA 3CEKA 3RNIA 2ZV8A 3DBFA 4DHFA 4G17A 4C34A 1J1CA 2BRMA 2C5XA 3RPSA 3SD0A 3FHRA 3VBWA 5IA0A 1UKHA 1K9AA 2EU9A 2X6EA 5AV2A 4JBPA 3NPCA 5EI2A 4M12A 2UVXA 4FEWA 3I60A 4DGMA 5CYIA 5B2MA 4GIHA 3U6JA 4F0FA 4WRSA 3NGAA 2O8YA 2YAKA 4FZ6A 4TWNA 4DGNA 3TMOA 2PVYA 3F7WA 2LAVA 4N6YA 3RAIA 3EN9A 3MDYA 2H8HA 3UDBA 3V8WA 4ALVA 3W0MA 3AT2A 4ZY5A 3L8PA 5DYJA 4EJ7A 4MXOA 3RHKA 2OIQA 4QTBA 4IACA 4D58A 2NPQA 4APPA 4P4CA 2JKKA 5CVHA 3AD6A 5KHWA 2GSFA 2VGPA 2C6IA 2DS1A 2XJ2A 4YJVA 3KEXA 3V6SA 4LDTA 5AR4A 1IAJA 4C02A 3WILA 4ZZNA 4BJJB 5DWRA 4DE4A 5BVOA 2WOUA 3DJ5A 3R8ZA 3DXPA 3LMIA 4II5A 3HAMA 4BDIA 3PVGA 4FTNA 3M11A 4O4BB 3CE3A 3KREA 1SVGA 2R3IA 5CAVA 3HKOA 4C58A 3R2BA 5AUZA 5JFWA 4DCAA 4EZ7A 4DH7A 3FXXA 2WMSA 2X39A 5H9BA 4MX9A 2ONLC 4WA9A 5JZNA 3HV6A 5CEQA 3SLSA 2UZDA 5F9EA 1XMLA 2PMOX 3FYJX 5EH0A 4GT3A 4ANOA 4KSPA 3E63A 3L8VA 4KRDA 3FMDA 3U87A 5I9UA 4G3DA 3QUEA 2XJ0A 4ERKA 4PPCA 3HRBA 2V62A 3JPVA 5HG5A 3MN3A 4LYNA 3TL8A 4UYAA 2I7QA 5CSPA 3FDNA 3PPZA 4YBKA 5CAOA 5KX8A 4RBLA 2WGJA 3B8RA 3IW6A 2WTKC 3VS0A 3PLAE 3EB0A 4G16A 3NCGA 5BYZA 2GTMA 2Z2WA 1BL7A 3NIZA 3K3JA 4IWDA 4YJPA 2EUFB 3PJ8A 4I24A 5I3RA 4I21A 2GHGA 1U54B 3KB7A 4YTHA 4EOKA 1JWHA 4H05A 2ETMA 3KY2A 4GH2A 1ZAOA 2HK5A 2OG8A 2CCHA 3AC3A 3LXNA 5CNOA 4R77A 4DTKA 5HX8A 2P2IA 2VD5A 3IONA 4K33A 2XNOA 4EH3A 5DT4A 3LFBA 5HCZA 4IADA 4BWPA 1OPJA 1H1RA 5DIAA 5AP7A 3RAKA 4CFVA 2XIKA 3GT8A 5GIPE 5E8YA 3MFTA 5CAQA 3A8XA 3PRFA 3MWUA 3DFAA 4ZS0A 4C2VA 3EFLA 3I6UA 2ZV9A 4AXDA 3TDVA 3TJDA 4IH8A 3VS3A 4I0RA 3ZTXA 4B6LA 1OBGA 2VWXA 3DK7A 5DEYA 3G90X 5FM2A 2HIWA 2C6DA 4OTFA 3MH3A 4U43A 3GBZA 4OTGA 2RIOA 1OB3A 2YITA 3BE2A 4X3JA 1K2PA 1ZMWA 2B1PA 1OITA 4NW5A 1FQ1B 3D5UA 2GFCA 3ZUUA 4KA3A 3G0EA 4C3PA 5IUGA 1AQ1A 4AGUA 3TCPA 4CYIA 4F65A 4EZ5A 4RFZA 3GU8A 3KMWA 4FZFB 3NUYA 4L53A 4AFEA 2R3OA 4MNFA 4U7ZA 4AZVA 2DYLA 2WMTA 4AT3A 2X6DA 4FOCA 4EQMA 4OLIA 1PW2A 3JS2A 3PXRA 3QCYA 4DBNA 4YU2A 4AQKA 2BDJA 1KE9A 3A7HA 4KWPA 2ZV7A 4IVAA 3TV6A 4HNIA 5IH5A 3GUBA 4H3PA 5BMMA 3AD5A 3V5LA 3Q6UA 3FXWA 4M0ZA 3ZYAA 4C7TA 4C57A 3NDMA 3P7CA 1CTPE 2YWVA 4FKIA 1OKYA 4F6SA 4HGEA 3I79A 1URWA 1M2RA 1ZYLA 4AF3A 4J96A 3DPKA 5JQ8A 4F70A 4CCBA 4PTGA 2J0KA 2J9MA 2QOLA 2XUUA 4MBLA 4NFNA 4E4MA 2CKOA 3W2QA 3W18A 2OFVA 4Q2AA 4X21A 4ZTHA 5E90A 3FL4A 3OFMA 3EH9A 4CMTA 1PXPA 5IKWA 4IW0A 3MY0A 3D7ZA 4CKIA 1BX6A 3F9NA 3WF6A 3W2SA 3R7GA 1U5RA 3THBA 1IRKA 3UDZA 4FV4A 5LMKA 5M4UA 2PMLX 2IJMA 2GTNA 3IKAA 4GG5A 4NFMA 5AAGA 3GB2A 4X3FB 1IASA 2VO3A 2HAKA 1KSWA 1R0EA 3HRFA 5EW8A 5HORA 2ZFYA 3EIDA 3MFSA 1JKKA 2CGXA 5M55A 1P4OA 2IEWA 2X1NA 5LCKA 3VNTA 1SYKA 3UVRA 2CLXA 5A14A 2QO2A 5CAUA 4BYJA 4BGGA 4M66A 4GMYA 5KBRA 4DTAA 5AR8A 1UU9A 3PJCA 4N0SA 1YDRE 4MXCA 1XH6A 3HL7A 5AX3A 3C51A 4JS8A 2W5HA 4RWIA 4DINA 5HBJA 2AC3A 1WBNA 2XIZA 4Y85A 4IZYA 2OJFE 5GJFA 3R9RA 3DLSA 5IQCA 5HD4A 2R3QA 3CSVA 3DXNA 2WNTA 4H39A 2ETRA 2WIPA 3SKCA 3A4PA 3Q2MA 2J0IA 4BB4A 4R3PA 3CJGA 5HICA 2C0OA 5KMLA 1S9JA 2VX0A 3P7BA 4YZBA 3TXOA 3UO4A 4F9WA 1GJOA 1ZY5A 3FYKX 3R02A 5HD7A 3A7FA 3ROYA 4U79A 1BUHA 3VS1A 2B52A 1Q61A 1RJBA 2YWPA 4BCQA 4F7LA 4OAVB 1ZYJA 4BR3A 3G6GA 3ZUVA 4UMPA 3ZRMA 2HELA 2JGZA 3ACJA 3HMMA 4IC8A 4ZSJA 3ZM9A 3UMWA 4ANQA 4HZSA 2VAGA 3UOHA 3VUIA 2WQOA 4D28A 4R78A 3HDMA 4JG7A 4O81A 3COHA 2FUMA 2WFYA 4K8AA 4PV0A 3UYSA 4DEGA 1WCCA 5JQ5A 4CNHA 2XK6A 3UPZA 3K5UA 5IH4A 3PE1A 4PMTA 1YXUA 3DS6A 4FODA 4O96A 5DT3A 4Z7GA 5L2QA 3PUPA 4ONAA 4RIWA 4FNWA 4O2PA 4FT7A 3UG2A 4TWCA 2DWBA 3BHYA 3D4QA 3FZSA 4BL1A 4DT9A 4CTCA 4ALWA 3BLHA 3FL5A 3UJGA 2C3KA 1OL7A 5HBEA 3PXQA 3OXIA 4XG7A 4AQCA 4DA5A 3NUUA 2XS0A 3OCBA 1ZOEA 2ZOQA 5EOLA 2CHLA 5A54A 4XBRA 4DFLA 4M69B 3ZC6A 3U4WA 2VNYA 1SVEA 3ULIA 2XZSA 2F7ZE 4QTDA 4C4HA 1YI6A 4A07A 3MGYA 2VX1A 4IDTA 2VTIA 3FMKA 4J99A 3DT1A 3OCGA 4XS2A 4QP4A 3OTVA 5K4JA 3QQFA 1MRVA 2HYYA 4QD6A 4AN3A 2BROA 5GINE 2CGUA 3Q9XA 2GCDA 3E5AA 4JBOA 1W0XC 1KE7A 1JPAA 3BQCA 3LFNA 5KCVA 4PX6A 2I0VA 3Q04A 2UZUE 3G0FA 4GIIA 4HCTA 5CNNA 3QA8A 3HRCA 3LXKA 3HAVA 3DBEA 3ML1A 3T9IA 3MBLA 3CTJA 3E64A 4IZ5A 3WE8A 3SA0A 2QLQA 4F1MA 4AUAA 4E6AA 4FKOA 2W99B 3FC2A 4DH8A 1OKZA 5M57A 3R04A 4D1ZA 5CU3A 3QHWA 5GIOE 4I6BA 2A27A 3AOXA 4XP0A 2C0IA 4EYJA 3D5XA 2GNFA 3DZQA 3RPVA 1V0OA 1Q4LA 4CFNA 4N57A 3W0NA 3RPOA 3E8EA 4D9UA 5CSHA 2B9HA 3BYOA 5LMKC 2BRGA 3D5WA 4D0WA 3MIYA 1YXSA 4EH5A 3JR1A 3DKGA 3Q5ZA 4AG8A 4YR8A 5AAEA 4FTLA 5A9UA 1FGIA 1GY3A 5KHXA 3RWQA 3W8QA 1NVRA 2X7GA 2XNNA 3CBLA 4NKSA 4XEYA 5DOSA 4ZZOA 1BI8A 3E93A 4C8BA 4ZZMA 2XKFA 1EH4A 5CF6A 3P5KA 3R7OA 2OK1A 3BZ3A 3CC6A 1Y91A 3WE4A 3R8UA 5C4KA 3IW7A 1YWNA 4FR4A 3F66A 3FKNA 4FKLA 1X8BA 4I5MA 3CS9A 5AP6A 1M14A 4CSVA 4FKVA 3CQWA 4JJRA 5IQFA 4LM5A 2DQ7X 4CZYB 2GMXA 2IZSA 2XRUA 2Z7SA 1YVJA 4NKAA 4W4YA 5CU0A 4DHJA 3CXWA 4L67A 4FSRA 3E92A 2H6DA 3PTGA 4QPMA 4YGAA 1RDQE 3KCKA 3VS5A 3HZTA 4DH1A 2O64A 4RQVA 2IW6A 3EKNA 4Z3VA 5AA9A 4EH4A 5FDXA 1IEPA 2WTJA 3RWPA 2W4KA 3S2PA 2CKPA 1OMWA 5E1SA 5F95A 5KNJA 1NVQA 2YM8A 3NFFB 1ND4A 3VBTA 4BYIA 4QEBA 3QA0A 1J3HA 4DT8A 3PZHA 1GZKA 4PTCA 3SOAA 4C4GA 4Z9LA 3BL9A 2YABA 4R7BA 3L8XA 3H0ZA 3NYOA 4EC8A 2PU8A 3DY7A 3QTXA 3R6XA 5DA3A 3WF8A 4DGLC 2QOCA 2VTAA 3KK8A 3P1AA 3UPXA 4JBVA 2V0DA 3DKOA 4OTIA 4JQ7A 1H1WA 4V05A 5HVJA 2FSMX 5AUTA 2Z7LA 5E8SA 2IWIA 1PYEA 4J53A 2VWBA 4F0IA 4EI4A 2XANA 4JX7A 2G01A 2F9GA 2OJJA 5IA1A 3FLQA 2YIQA 4XV9A 3KRWA 3QUDA 4UWYA 1OPLA 3OUKA 3Q60A 4ACGA 4FK3A 4WSYA 3R7IA 3RAHA 4IAZA 2YDKA 1P14A 4EH9A 4CRLA 2FA2A 3Q4CA 4DG2E 3B8QA 4RIWB 2BKZA 3TV4A 5AA8A 4O7TA 5E8UA 3RINA 3PPKA 2PUNA 4DFBA 2BR1A 5C27A 5JMSA 3ORLA 3V5JA 3OWJA 2OFUA 3ET7A 4XLIA 4C38A 3VJNA 5FEQA 5IDPA 4GK3A 4FUYA 4QMOA 1J7UA 4RZVA 3HV5A 4BCJA 4LOOA 5HU9A 4U5JA 5EYKA 1RQQA 4B99A 3VW8A 4JI9A 5HE0A 4J98A 4RC4A 5EYMA 4LMUA 3KKVA 4CG9A 2WD1A 2JDRA 3I0OA 5D12A 2UW7A 5EDPA 4M0YA 1H26A 1TZDA 1BI7A 5KBQA 2IZUA 4I3ZA 4AA5A 3UVPA 5L2WA 1PMEA 4DG3E 4EEVA 3G2FA 4WOVA 5C03A 4FC0A 1PMUA 3OXZA 3VUTA 5BVFA 3AC4A 2VU3A 3DJ6A 4TYIA 2PYWA 3VBVA 4Y95A 4X2KA 3QALE 3NW5A 3UBDA 4UV0A 4AP7A 4RIXB 5I9WA 4O4EA 4ACHA 3VONA 2ZYBA 2GNJA 4PNIA 3MB7A 4M15A 4ENXA 4L3LA