4JI9A

Jak2 kinase (jh1 domain) in complex with tg101209
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Amino-[1,2,4]triazolo[1,5-a]pyridines as JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ji9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ji9A01
4L53A 3ZM9A 2OGVA 4OR5A 4EQMA 4I6QA 4D0WA 2JKMA 3KXXA 3OVVA 4IZ7A 4IX3A 3QUPA 4NWMA 3KVWA 2BAJA 3QA0A 4Z16A 4O2PA 1ZZLA 2J7TA 4BWKA 3PYYA 4HPTE 3EN7A 1Z57A 4AACA 2F7ZE 3FPQA 2GQRA 4MNEA 2A4LA 4FG8A 3K54A 5HE3A 3MVLA 4DLIA 3C0HA 4TNDA 1WBWA 3I7CA 4M7IA 1Q3WA 1MQBA 3WE4A 4CLIA 1IRKA 5JGDA 4YC3A 4ITIA 2R3MA 2XZSA 2VV9A 5IQFA 4ALVA 4G3CA 3MDYA 4TWPA 3IW7A 2OLCA 4IZ5A 3I7BA 2J0LA 3R8LA 4G16A 2XKEA 3MB6A 4NIFB 3LW0A 3HDMA 4JX7A 3N4TA 2VWIA 3MESA 4R3PA 5AM6A 1OGUA 3RAHA 4QMWA 2J90A 3PJ8A 3CD3A 3FBVA 2Z8CA 5ETCA 4A9UA 3F9NA 4JG7A 3U6IA 4EZ3A 2WTKB 3LCTA 4M8TA 4S31A 4CMTA 5IQIA 3LFCA 1H1RA 1LEZA 3IW8A 1UU7A 2BTRA 1TQIA 1M2PA 3H9RA 5B2KA 3RGFA 2ZMCA 3R9DA 2XIYA 2CN8A 3DFCB 4MXAA 3BE2A 3GU5A 4RQKA 4TY1A 5IA0A 5IH4A 4O96A 4M3QA 3RPSA 3BU6A 2WOUA 5A4LA 4YP8A 2GU8A 4N70A 1FPUA 1YOMA 2QO9A 2WZJA 3EQIA 4C37A 2QOLA 4EYMA 3QQGA 4KB8A 1J7LA 5IU2A 3P23A 2F2CB 2YCFA 1OBGA 3AT2A 3GU7A 1Q99A 2B7AA 4DH7A 4F64A 2CGUA 3D94A 4AGCA 3C7QA 3IDBA 4ANSA 2R3JA 2RG5A 5B2LA 3CCNA 3BV2A 2YIQA 3P1AA 2X1NA 2VTOA 3GCQA 3UO6A 1L8TA 5AIKA 1GIIA 3PVBA 3W16A 3WF7A 2ZYBA 1H0VA 3VJNA 4USDA 2ITVA 3E3BX 5EOLA 4DH5A 2OICA 1P5EA 3A60A 4R5SA 4BDBA 3EYGA 5M57A 4FTUA 4G9CA 4EOSA 2P55A 3IGOA 2XJ1A 3OC1A 4KIKA 4N6YA 3SKCA 2VX0A 3QU0A 4OBPA 3KMUA 3QC9A 3ZDUA 1P4FA 1Q3DA 3CKXA 3BBWA 3ZEPA 2CNUA 2O64A 3BHUA 4L42A 3TCPA 5AR5A 4E6QA 4BY9E 4BCOA 2J0JA 1PMUA 2IJMA 2OK1A 5A46A 4HYSA 4E73A 1O6KA 2HXLA 4XOZA 4DGMA 3IKAA 3TKIA 4DA5A 2XCHA 3A4OX 3RK5A 3UO4A 2E9NA 1G5SA 2GHMA 2GHLA 2XKFA 4HGSA 2WPAA 3UZTA 5CT7A 3O23A 3VBYA 3HV6A 3R8VA 5J9ZA 5K9IA 5LXMA 2XM9A 3FQEA 2DUVA 3R7UA 3O8UA 3OTUA 3QRKA 3GFEA 5DT4A 3JS2A 5ICPA 3VNTA 2P2IA 1GY3A 3MH1A 4JQ8A 3VRZA 3R1NA 2PZ5A 3OCSA 4G2FA 2OJIA 2FSMX 2W5HA 4BHNA 3FL4A 3I79A 3KK9A 5IQGA 5I4NA 1QL6A 2Q0BA 4HZRA 1PKGA 5AP7A 1OBDA 3R8ZA 5KMMA 2VWZA 5I0BA 4F4PA 5DI1A 2YAAA 3RM6A 1JQHA 4EK4A 2UW6A 3EQHA 4O7TA 3AXWA 5KKRC 2PZYA 3V6RA 2YCSA 1KE6A 2BVAA 3ZUVA 4C36A 2OJFE 2JDTA 4CFFA 5C4KA 4FA2A 3DXQA 4X2KA 1P4OA 1Q8WA 2HY0A 5L2IA 2JIIA 4CG9A 3IK3A 4F9WA 4CMOA 4NH1A 2UZNA 5E8YA 5L2TA 3BKBA 3N51A 5EFQA 2ZB1A 4FTRA 2G1TA 4WUNA 2YJSA 2C3LA 4ZJIA 4Q5EA 3UTOA 3MSSA 3FV8A 3WARA 4NW5A 4G5PA 3FZPA 3QCQA 4FKUA 4WNPA 5M51A 4QQTA 4HVDA 4QMNA 5TE0A 2QKWB 2QR8A 3SOAA 1OMWA 4DG2E 4E1ZA 3FDNA 1PXPA 4G6NA 2H96A 2PVNA 4LL0A 5D9HA 5BVNA 4O7WA 3HUCA 3CQWA 4YR8A 2ERKA 2F2UA 4O0VA 5EW3A 1FQ1B 2UUEA 2XH5A 5JKGA 3LFFA 4XG2A 5DR6A 1PXIA 2AC5A 4YC6A 2WTKC 4BZOA 5J9YA 1EH4A 3H3CA 4O7YA 4NT4A 2BPMA 4LV5A 4O0XA 4E93A 1ZY4A 4ZAUA 5JZJA 4EYJA 3ZBFA 4EZ5A 3BWFA 4USFA 5EHYA 4EOOA 4Z55A 5AR7A 3UP7A 3F5PA 2YEXA 2R3IA 3QTIA 4EOKA 4UZHA 1H27A 4B99A 4GK4A 4WRSA 1M2QA 1STCE 3I4BA 1W83A 3TZMA 5AUWA 5FDXA 5L2WA 3KMMA 4Y95A 3CY2A 3VAPA 5TO8A 1ZOHA 4BKZA 2NO3A 4QYGA 4X7QA 3PWDA 5HE0A 4XG7A 5DRBA 3VUDA 4DHFA 2FB8A 5CVHA 3A8WA 4FIFA 1F5QA 3L9MA 4DGOA 3ENMA 5L8KA 4U0IA 3Q6UA 1JKSA 2BROA 2VX1A 2YDJA 1U5QA 4FSWA 4J52A 5GJDA 1V0PA 5CSHA 2A2AA 3OUNB 4I5MA 5AV4A 1H1WA 3DV3A 4EJNA 5J1VA 5M4FA 1JKLA 3EQCA 4Y72A 5H8EA 5HVKA 2SRCA 3DAEA 4YU2A 4YJRA 4C34A 3H4JA 4UWYA 2PU8A 1H08A 2OIQA 2PVKA 4IDVA 4X2GA 2WO6A 2HW6A 3HV5A 3NAYA 2VWVA 3DQXA 4MNFA 5LMAA 4EWQA 1HCKA 4ASEA 3SG8A 2I0EA 4YZCA 5IH5A 1OIRA 4XX9A 4QMXA 3HZTA 3ORZA 1Q62A 3P79A 2XNEA 4P90A 4IB0A 3OCTA 4U3YA 5CNNA 4E7WA 3CKWA 3RPYA 4B7TA 3AC2A 3PPJA 4G34A 3OXZA 5EH0A 1U54A 3G9LX 5HTBA 1REKA 1OM1A 3IOPA 3LCOA 3D7TA 1WBVA 2EUFB 4IVBA 4YNEA 4CFVA 5HD7A 4PMSA 3R7OA 2JITA 4U41A 3KU2A 2QOQA 3OXTA 4AT4A 2IVSA 4FIHA 4MQ1A 4KBCA 3VC4A 4XG8A 3SLSA 4BCKA 1R1WA 4NEUA 2AC3A 4XG6A 4QMSA 1H25A 2P2HA 1LEWA 4IAAA 4JG6A 5HNBA 5JT2A 2BKKA 1URWA 2X2MA 1PHKA 2VUWA 4I5HA 3RZBA 3T3VA 5IQAA 2QU5A 3DKGA 3VWAA 2J9MA 1OITA 4CYJA 4MK0A 5HU3A 5IH6A 2R5TA 4L3PA 3F88A 5AP3A 4I1ZA 4IANA 3EQDA 3PG1A 3T9TA 1WBOA 2X8IA 1FVRA 1XH8A 3ZLXA 3ROYA 4NM5A 3DNDA 4YHTA 4YBKA 4S34A 2OF2A 1GZOA 3ORPA 2R3KA 4U42A 5IMXA 4HNFA 5T68A 3C5IA 4J96A 2OKRA 2XRUA 3CR0A 5L3AA 1PF8A 4BDIA 2WMVA 4RZVA 5F94A 1ZOGA 2HWPA 3O50A 4GL9A 1A06A 3KXMA 2VWUA 1CSNA 1CM8A 3AGMA 3ZZEA 5AUZA 4BN1A 4IAKA 4TYHA 3W32A 5GJFA 3E87A 4IC7A 4DN5A 2B9JA 3EN5A 4WRGA 2YCRA 4X2JA 4D4RA 4UN0C 2HELA 4N4SA 3ZMMA 3LFQA 3LMHA 3A61A 1DM2A 3A62A 5F95A 1H1PA 3LLAA 1Y6BA 2G2HA 2RL5A 4FV8A 4O82A 5LWMA 1WBTA 3JY0A 3Q9YA 1UVRA 3LFDA 2CKPA 5KMLA 4H3PA 3VW6A 1OKVA 2QHNA 3QTWA 5DE2A 5KCVA 3FKNA 2VU3A 3ACJA 3V5WA 4NKAA 3AC4A 3R04A 3OWLA 5CVFA 5A9UA 2Q83A 5EDQA 3QQUA 4RJ8A 4UY9A 4D1XA 3POZA 5F20A 3MV5A 3TNWA 1KWPA 1UNLA 1OKWA 1IA9A 4UBAA 3WILA 2HZ4A 5IA3A 1PW2A 3RJCA 3SD0A 5IA4A 5EHOA 5DHJA 4H1JA 4I5CA 4FSTA 2YM3A 4IAFA 3ANQA 5LOHA 1OB3A 2XIRA 2C3IB 3L1SA 4AUAA 3FI8A 3VQHA 3NYVA 5FDPA 4YTHA 2WFYA 3FJQE 4IWQA 1VR2A 2C5NA 3NGAA 3LXLA 2XF0A 3MIYA 2CGVA 5ETIA 5C1QB 3SGCA 4L7FA 4D55A 4G3DA 3BLRA 5ANDA 3U51A 3R1YA 4WBBB 1WBSA 4GVJA 2YIYA 3QRIA 4QPSA 4I6HA 4EUUA 4DLJA 5LWNA 1Q61A 1OPLA 2YWPA 3VS1A 4BTKA 2PVFA 3RNIA 1ZAOA 1NVSA 4E6AA 4FOCA 4MH7A 2V7OA 1MP8A 4Y85A 4MD7E 1RW8A 2B1PA 2DS1A 3TT0A 3OROA 4XP0A 2ITOA 5AV1A 2XCKA 5F4NA 4DGGA 2BKZA 4R7IA 1UWJA 5DFPA 3VN9A 4BVUA 3GCSA 3L9NA 4YLKA 4FEXA 2EVAA 1XH7A 3II5A 4EOIA 5C4LA 1BKXA 2ZV2A 2X7GA 3LHJA 4UZDA 4KRDA 2C6LA 4L3LA 2JBOA 2V55A 3KRRA 2J4ZA 3DXNA 4YNOA 5M4UA 2QHMA 4KA3A 2X7OA 4AA0A 3K3IA 2ITTA 4Q9ZA 2JBPA 5BMSA 5IDPA 5J79A 3HA8A 2GNGA 2YFXA 4KKEA 4RJ6A 2RFSA 4HZSA 4EQCA 4QMMA 3JYAA 4AQCA 2C0IA 5E92A 2LGCA 4FMQA 3RK7A 4Y8DA 4A9TA 4DT9A 2GFCA 5CQUA 5IEVA 3JY9A 1DAYA 1T46A 3E63A 3HECA 4ZMFA 4NJDA 4B0GA 4WO5A 3QUDA 2XEZA 2XK6A 3PSCA 3OOGA 3P7CA 3T3UA 3V5JA 5I9YA 4BDDA 2VTSA 4RFZA 3MH3A 1K3AA 3SRVB 4LUDA 3UIBA 4FF8A 3L8PA 4JAJA 4DFNA 4FKSA 2QO2A 1OL2A 4BGGA 5EYCA 3W1FA 4BDHA 5DWRA 4RA5A 5KMIA 4GU9A 4RMZA 4A9SA 3ZXTA 3EN6A 3FI3A 4V05A 5EM6A 4KIKB 3R9NA 4EOMA 5C01A 4G3FA 2Z02A 4TWOA 2PVYA 5B0XA 4C62A 3SXRA 3TZ7A 5BVWA 2OW3A 4EHEA 4FYOA 4S30A 4FTLA 5JFVA 3JUHA 4RG0A 3VULA 5C8NA 1M2RA 2J5FA 5AV3A 5HNGA 5JQ8A 2OF4A 4EZ7A 2J50A 3PVUA 4K33A 4O7SA 3A7HA 4EH3A 3QGWA 5EI8A 3DJ7A 3R73A 3QUEA 3GP0A 4XLIA 5I5ZA 4O27B 4BKJA 2PPQA 4F9BA 4Q9SA 2OO8X 5A4TA 1PYXA 4L00A 3WF5A 4BTMA 1H26A 4YURA 3BQRA 4AXAA 3KN6A 4RZWA 2OJGA 2R4BA 2HENA 2C4GA 4WNKA 3G0EA 5AX9A 4BKYA 4DINA 2BHEA 1CMKE 2C6IA 3OWKA 2OU7A 3SC1A 4FKQA 3WZKA 4HVSA 2GNFA 4A4LA 3BHYA 4F9AA 4M68A 1W98A 4B6LA 4IHPA 1VEBA 3CJGA 2PVRA 3HMMA 4BWPA 4C2VA 4H3BA 5ANIA 4F6UA 3DCVA 3QLGA 4OT6A 3RAKA 2HZIA 4JBVA 5FUTA 2RSVA 4OUCA 5L8LA 4KD1A 4O0UA 1WBPA 4CFMA 5T3QA 1YXTA 3BLHA 4RWKA 5CU4A 2R3OA 1V0BA 4C57A 3Q4TA 1Y6AA 1YI6A 3LCDA 3PSBA 4RVLA 1HOWA 3EIDA 4I0RA 3HUBA 5HGIA 4BDFA 5M08A 2PMIA 4P5ZA 4XG4A 4GKHA 3MY1A 3R21A 5GZ9A 4J53A 4EI4A 3V5TA 4ENXA 2PY3A 3HA6A 4FKTA 2GS6A 3QZHA 2JD5A 3D5UA 4MAOA 4EBVA 4TYJA 3NZ0A 5EYKA 4E5BA 2IVVA 2ITYA 5JRSA 4EH6A 3TACA 4QMLA 3S95A 3UVQA 2FA2A 3SG9A 3HGKA 3I1AA 4N6ZA 2W1ZA 3JPVA 5H2UA 4ZZNA 3MTFA 3P7AA 5DGZA 3OD6X 5DEWA 2I40A 4XBUA 3R1QA 5HO6A 5IEYA 4RQVA 3RKBA 3AOXA 3QFVA 3L9PA 1XHAA 3OEZA 5C26A 5HBEA 2VNWA 1U46A 3IONA 4G6LA 4NTTA 3FEGA 2F7XE 4W9XA 2QD9A 3VW8A 3BLQA 2O63A 3P08A 3EFLA 3BPRA 1FBNA 3KQ7A 3VO3A 4DGNA 1XWSA 3Q52A 3GCPA 4ZLZA 4O22A 3HL7A 3HX4A 4WKQA 2PYWA 4LRJA 2Z7QA 5KHWA 3FLZA 4F7SA 3UQGA 3RVGA 5CXHA 4QQJA 4QTCA 4FKGA 2WKMA 4V0GA 2OJJA 3FMMA 1O9UA 3S4QA 3PA3A 5HIBA 4BBMA 4EH7A 5HU9A 1JWHA 5AR2A 2F57A 2PVHA 4O81A 4XG3A 2VTPA 4A9YA 4ZXTA 2WMTA 3PUPA 3SX9A 4IH8A 4PUZA 2V22A 4F7JA 2CN5A 4MF0A 1HCLA 4ZLOA 4MEDA 1YHSA 2BILB 3EL7A 3R00A 3KULB 4FGBA 4QMPA 3NNUA 4LYNA 1MRYA 3LXKA 1LPUA 4IZYA 5CSPA 1G8SA 5I9WA 2C3JA 1PRYA 2WHBA 4JNWA 4XMOA 4R3RA 4EONA 4AFJA 2UW3A 2X9EA 4NKSA 3KRJA 3DKOA 4NL0A 4IW0A 2YERA 4FKRA 5EM5A 5TOZA 3IO7A 3M2WA 4OW8A 4FSUA 4O7ZA 1Y91A 1Y57A 4CNHA 3CD8A 5IKWA 1BUHA 3QXPA 5F9EA 3Q9WA 3KCKA 3C0GA 4FV9A 3ULIA 4FT9A 4XOYA 1V1KA 5AADA 4E4NA 1OKYA 4EOJA 4KBAA 2RF9A 4AU8A 1CKIA 4UMTA 3ZH8A 4IFCA 5E8UA 3HDNA 3I5NA 3QGYA 2WEIA 4I3ZA 3ZM4A 3FUPA 5J95A 4MQ2A 5I9VA 3DJ6A 2JAMA 3M42A 5G1XA 1YDRE 3AT4A 3IDPA 5AX3A 3AD4A 3FMJA 4NCTA 2BIKB 3A8XA 3ZOSA 2C6KA 3D4QA 4LRKA 3KXHA 3MIAA 5J1WA 1FMOE 4IACA 1YWNA 2EXEA 2WAJA 3NS9A 3BWJA 4RIWB 3LXNA 4C33A 2QKRA 5CAOA 2B9HA 4GFMA 3CSVA 5AP5A 2GQGA 1PMEA 1U54B 5AA9A 4OTPA 3DXPA 2FO0A 3RALA 3TNIA 3ODYX 5L2SA 2FUMA 4IWOA 2WMRA 4N57A 4YGAA 3MVHA 3EHAA 4AT5A 3L8XA 3SOCA 4X3FB 4BCIA 4QNAA 4FTKA 4WNOA 2W7XA 5CAVA 3FXXA 3A7FA 5FEEA 4C58A 4F63A 4LQMA 1W8CA 4ACHA 3F3ZA 3PZHA 3FXWA 4F0GA 5HBJA 1FVTA 3G15A 3PY1A 2ZM3A 4FIGA 5A14A 4RJ3A 3FY0A 3UZPA 3W2SA 1Q41A 3UOHA 2BDJA 5C27A 2DYLA 3U9NA 4PTEA 2BRBA 5LVLA 5CEOA 5HNIX 4M67A 4U45A 4D4SA 1UWHA 4FK3A 4QQ5A 2JEDA 4RVTA 4HVIA 3RWQA 3NNWA 1DI9A 4FEVA 3TV6A 2DQ7X 2NRYA 5CEQA 3DAKA 2QOHA 4YPDA 4PMPA 4GG5A 3NWWA 4OT5A 4D2VA 3TZ8A 5BUJA 3O17A 4C0TA 1KE9A 2WMXA 1GNGA 4B9DA 3PDTA 4DT8A 4EH2A 3ROCA 1M17A 4MXYA 4MD9E 3OT8A 4OLIA 2W4JA 3MH0A 4C3FA 2FSTX 4D9UA 1OPKA 1U59A 3FSKA 1UKIA 4GJ3A 4I20A 2X0GA 5BUEA 3G33A 3V8WA 3OP5A 3HRFA 2CNVA 4BI2A 4CRSA 3LM0A 4O6LA 4RC4A 2PUIA 3W33A 1H28A 2V0DA 3BHHA 2VN9A 3Q32A 3S3IA 5IQDA 2IN6A 4MXZA 3DGKA 3ZC6A 1OZ1A 3NVMB 2QG7A 4RJ7A 2OG8A 2Y7JA 3TUCA 4FKOA 4FGRA 4DBXA 4CRLA 2E9VA 3LFEA 1AGWA 3OWPA 4YLJA 3A7GA 4YZMA 4M15A 1KV2A 4OGRA 2HOGA 4ZSGA 2ONLA 3MW1A 3C0IA 3F69A 3R7YA 3HMIA 3E7VA 3NUPA 2XMYA 2NPQA 1S9JA 2JIUA 3NLBA 4FZ7A 3WIKA 4FT5A 1W82A 2PUPA 5CZHA 5AP6A 4UMPA 4BF2A 3C4FA 4DEBA 2JLDA 4UMRA 4C4EA 3TL8A 4JBOA 3WZDA 2VTAA 3FYKX 2ITZA 3R9RA 1JLUE 2UW8A 3VIDA 3GVUA 4Z7HA 2F4JA 4CT1A 5AMNA 2R0IA 4JRNA 4ERWA 2P4IA 4MBJA 4RFYA 3Q5IA 4J8NA 3LVPA 3RBWA 4BCNA 4TW9A 3KN5A 5KMNA 3COKA 3B8QA 3FAAA 3IW6A 2JIVA 3R22A 4ZTRA 3VUGA 4B8MA 3NNVA 3JVSA 2XYNA 4V04A 1MRUA 2UZVA 4QP2A 5FXRA 4V01A 3FKOA 4J98A 4DTAA 3PJ1A 3ALNA 3C1XA 2PZRA 4FX3A 4IADA 4JAIA 4A7CA 2GDOA 1XJDA 2YACA 2FSLX 3E92A 3MI9A 5AUXA 2JKKA 2CDZA 3KL8A 3FI4A 4FV1A 1T45A 3UIUA 1YKRA 2UW0A 2WELA 5CEMA 1KOBA 3A99A 3HVCA 5H8GA 3C4EA 2QOIA 5D11A 1J91A 1QPDA 5FG8A 4PMTA 3OMVA 2VO7A 2YLFA 3NW7A 4RC3A 5JFXA 3D2IA 3W2PA 2C1AA 3BX5A 3UMWA 3NPCA 4BICA 3DTCA 4JQEA 5BVFA 2PWLA 3DLSA 4YJPA 3QXOA 5ANKA 3GB2A 5B7VA 3AC5A 3VUTA 4R77A 4ZS0A 3QYWA 3DDQA 2YIRA 3NUSA 5KBQA 3UPZA 2UZUE 3OEFX 5AV0A 1YRPA 2E9PA 1JSUA 2HY81 3KC3A 1JKTA 3CP9A 4FV5A 4OTFA 5AM7A 2C69A 3VUMA 2UW4A 2OJ9A 4ZK5A 4AWIA 3KMWA 4X3FC 5A4QA 1H1QA 5DMZA 5FWKK 2HK5A 2QOBA 3GQLA 4J8MA 4G1WA 1NVRA 2GS7A 3IPHA 3QWKA 4X6QC 4FSYA 3FL5A 3DU8A 4XCUA 3E8CA 5CU2A 5GNKA 3ZSHA 4IX6A 3UP2A 3L8SA 2VTMA 3LMIA 5EQPA 4FICA 4CQGA 2EXCX 3AC8A 2W17A 2IW8A 4C2WA 1UU3A 2G15A 2YIXA 3KRLA 5D7AA 4M12A 1F3MC 5E91A 4O7NA 2XK3A 3D83A 4FV4A 3OFMA 4CV9A 2PK9A 3OT3A 2YM6A 1O6YA 4LI5A 1Q4LA 5A3XA 2X4ZA 3TUDA 3V51A 2IWIA 3UODA 4DFXE 4QMYA 5CEPA 3QCXA 2OFUA 3ULZA 2WOTA 4FSZA 2EB3A 3QL8A 4TWCA 5JN2A 3VUHA 4IVAA 5J5TA 3D9VA 1REJA 4AW2A 2BTSA 5EW9A 4OAVB 3CEKA 5K0KA 1JKKA 1IR3A 2GPHA 2UV2A 3QZFA 2BRNA 3EWHA 5I3RA 2H8HA 4AW0A 3IW4A 3RWPA 3BGZA 3AMYA 5CVGA 1ZLTA 4HPUE 3GGFA 4YLLA 3RPVA 2J0IA 2YA9A 1SNUA 3ORXA 4E3CA 1SNXA 4AZTA 1QPEA 5FP5A 2C6MA 3CGFA 4ALWA 4BIBA 4EH8A 4DH8A 1FVVA 2OFVA 2GNIA 4BDKA 4WBOA 3I5ZA 3VUIA 4HYUA 5EG3A 4GEOA 2J0KA 5TKDA 4U97A 4QMTA 4AG8A 3R7IA 2ZAZA 2VTJA 4I0SA 4FSMA 4R1YA 4BC6A 4ZTSA 3F7ZA 3VBQA 4I41A 1I44A 4LGDA 4BCMA 5CSVA 2BRMA 2X39A 2GS2A 3U55A 4AN3A 3BI6A 4XHKB 4ZLYA 4CKRA 3HAMA 3E8EA 4R6VA 4M14A 4XV3A 4CGAA 4L67A 3I0OA 5AP0A 5BQ0A 4QP6A 3NR9A 1YOJA 4G3GA 4PMMA 3AMBA 4MCVA 5KBRA 5M06A 2R3HA 4O0SA 4MF1A 5E1EA 1Z5MA 4D9TA 5HESA 2C3KA 2IVUA 2YAKA 1TQPA 5M4CA 1OL6A 1FOTA 3BCEA 4GT5A 4HYHA 4RWIA 4BCJA 5EI2A 1ZYJA 5K4JA 2JDVA 2XIXA 2WEVA 3MFTA 4M0YA 3LQ5A 4UXQA 2HXQA 2B52A 4MYGA 2J0MB 3ZO4A 4Z7GA 3LKMA 4U8ZA 4M69A 4JIAA 4TXCA 2R3RA 5HO7A 3ATSA 4YJNA 4IJPA 1YWVA 4FKPA 2ITPA 4FTNA 3GC9A 5AR8A 5GZAA 3ZXZA 3MPMA 3DK3A 4J1RA 4KINA 4FV3A 5KKRB 3A4PA 3CQUA 2CCIA 3HMOA 5AV2A 5FTOA 5AFVA 3NUNA 3LXPA 1ZRZA 3GU6A 3BYUA 3D5XA 3TZ9A 4PY1A 2XKDA 4Q5HA 3E88A 4GS6A 2XJ0A 3UPXA 3QD3A 4CFNA 3NAXA 2V62A 3VJOA 3KKVA 3DT1A 5AR3A 2IZSA 3OZ6A 5BVKA 5DH3A 3DAJA 4D28A 5CI7A 3D0EA 3P4KA 4HVHA 3HNGA 5HTIA 3FMDA 4QMUA 4JBPA 4QP1A 4Y5HA 5M56A 2QVSE 2C6TA 3BU3A 1Q8YA 5HCZA 4JIKA 2RFNA 1SMHA 3OBJA 4LGHA 4KIOA 4E8AA 2HCKA 3GBZA 3AGLA 2REIA 3ZS5A 5DOSA 2R3PA 4NUSA 2KULA 5TR6A 5BYZA 2VTHA 5IZFA 3UVPA 2B9IA 4BGHA 3FZ1A 2OXXA 2BDWA 4FKIA 4M13A 4QYYA 4RX9A 3RCJA 4YMJA 5IA1A 1RE8A 2W9ZB 3CC6A 4FVPA 1MRVA 2VO6A 4PNIA 4W8DA 5F1ZA 4P7EA 5KE0A 2RKUA 2WIHA 4AX8A 5K5XA 3SW7A 4JLCA 5CZIA 4ZTNA 3E64A 3ZUTA 4AP7A 4FV0A 3IOKA 3EH9A 5KMJA 4PP9A 4YJQA 4ASXA 2ZDUA 3RMFA 3OF0A 3V04A 5CXZA 3ZFYA 4BB4A 1XBCA 1H1SA 4LV8A 3ZZWA 4WSQA 4O7RA 3LOKA 2HW7A 2OZOA 4YZNA 5GJGA 2C5YA 2WNTA 2WTDA 1GZKA 4LL5A 5HG8A 3SDJA 4DFLA 5AUUA 5CNOA 1SZMA 3R7EA 3E8NA 3A7IA 3EQGA 4CTCA 4QTDA 1B39A 3EYHA 3P9JA 3QZIA 2YM4A 4L8MA 5D10A 5E8SA 3VVHA 4TZRA 4IWDA 3NW5A 4S32A 4XV9A 1P14A 2ERZE 3EKKA 3F5GA 3QALE 4C59A 2Y8OA 5DLSA 5EQEA 2QLQA 4RC2A 4XP3A 4HOKA 4C35A 3TEIA 2OWBA 3DJ5A 4D2RA 4FUXA 2XK4A 4CT2A 2W5AA 4X0MA 5HIDA 3KXZA 2IVTA 3ZUUA 3CJFA 3S1HA 2XNMA 3F5XA 4RSSA 3ALOA 2Y4IB 4DG3E 2CKEA 5I9XA 1Y8GA 3AD5A 3ZLWA 2YM8A 3FC1X 5JFWA 3UE4A 1ZZ2A 5EHLA 1WMKA 2BDFA 4P4CA 5DR9A 5HKMA 5TF9A 2BHHA 5IEXA 3R02A 5KZIA 4GUEA 2YN8A 4CCBA 1Q5KA 4R3CA 5EKNA 2C6EA 4QP9A 5HZNA 3R7VA 1ERKA 3U54A 1JSTA 2ZJWA 4ZTMA 3MFUA 1BI7A 4QP3A 4XV1A 4DFBA 4KBKA 2ITQA 3IW5A 4AGDA 3BBTB 3QRUA 3QQKA 3TV7A 3QTUA 2XNNA 3QRTA 4KS7A 2ZDTA 3GQIA 2P33A 4M84A 3V5LA 2PHKA 2A27A 2VTTA 2W4KA 3FMHA 4AA5A 3NDMA 3PJCA 4G5JA 3LM5A 2GNHA 3C4ZA 4GMYA 4FNZA 4K0YA 5HCYA 1U4DA 3DB6A 2QONA 4JRVA 3MFSA 3GC8A 4AOTA 1JVPP 2NP8A 3O7LB 4ITHA 4RIXB 5T6KA 3RPRA 2O5KA 4AF3A 4GIIA 1E1VA 2VNYA 3P78A 5CY3A 1Q24A 4CTBA 2C47A 4EK8A 4NIFA 4F1MA 2PE1A 1PYEA 4FG7A 4PF4A 5JEBA 1W0XC 1M14A 3OTVA 3B2WA 4MD8E 4W8EA 4FTTA 4OBQA 3BYMA 2X6DA 4IB3A 4D1SA 2PE0A 3C51A 3C4XA 3FC2A 4Y46A 4P5QA 3UOKA 3QX4A 1YQJA 4BRXA 5E8WA 1XQZA 4EUTA 3NCZA 3FQSA 3M11A 1ZWSA 4QTEA 4RX8A 5M53A 3CTHA 2PUUA 3EN9A 1J3HA 2AYPA 2R7BA 3MN3A 3F3VA 3QLFA 3RHKA 2WQMA 3Q2JA 5E4HA 3R7GA 5FTQA 1H24A 4MNEB 4E4XA 1WVXA 5BVDA 2CMWA 1OECA 1NVQA 4FIIA 5LARA 4CLJA 5JK3A 4DEGA 4EHGA 5AUVA 2WMQA 4I4FA 1UKHA 5KO1A 4EKLA 3ODZX 1ZXEA 3ZLYA 3A2CA 2CSNA 2W99B 4IBMA 2XKCA 4YHFA 3JR1A 4DFUA 3BRBA 3HRCA 2RG6A 2HWOA 2QU6A 3BYSA 4CKJA 4H39A 2WIPA 3LFAA 5DG5A 3HP2A 2UZTA 4Y5QA 5M55A 4ANMA 5L6OA 3SW4A 2OZAA 3OCBA 3W18A 4K9YA 3DKFA 2Z60A 1KE7A 5CU3A 2FSOX 3LFNA 3PG3A 3U6JA 4U43A 2PVJA 4JXFA 4QMOA 2BZIB 4F7LA 2YABA 5H9BA 3K2LA 5AWMA 4C4FA 3RAWA 5DVRA 2X8EA 3PP1A 4IEBA 4RBLA 4X2NA 4EK3A 5CF8A 3LAUA 3FZSA 4JR3A 1DAWA 4I5PA 5HE1A 3COIA 4G6OA 4RGJA 1ND4A 2VWXA 3PIXA 5IQBA 2O3PA 5CU6A 2RGPA 2YISA 3CS9A 3KF7A 2QOOA 3ZU7A 5E9EA 3Q53A 5AJQA 4E5AX 5LMKC 1PY5A 2ZV7A 3VF8A 5CAUA 3BZ3A 3EFKA 2OBJA 3ZSGA 3UC4A 3OY3A 5CS6A 3W8QA 4RRVA 4BR3A 2YCQA 1Z9XA 4BCPA 3GC0A 4CSVA 3WF8A 1R3CA 3PSDA 4KABA 2C30A 1IA8A 5L6PA 3OBGA 3KRWA 4GFGA 2GMXA 3D14A 1A9UA 3P7BA 5DIAA 1BX6A 2WQOA 3D15A 3DB8A 5M07A 2YITA 2CKOA 4EJ7A 3COHA 4ID7A 2WMUA 3PXFA 2WD1A 4BZDA 5D1JA 1B38A 4FNXA 5I9UA 2RFDA 3RAIA 3G9NA 4A9RA 5CF4A 5EK7A 2X9FA 4A07A 2UZDA 3T9IA 4GRBA 3HKOA 3QQFA 1Q8ZA 3F3UA 3VS5A 5FRIA 5E1SA 1FINA 1BMKA 4DBNA 2XIKA 4L68A 5AAGA 2Y4IC 5CU0A 3KXNA 3KY2A 2ZOQA 2Y6OA 2YIWA 4FBXA 4JG8A 3QZGA 3DS6A 5DPVA 4AE6A 3R30A 4IB1A 4CKIA 5HOAA 4ONAA 4DEAA 5KMOA 2LAVA 5J9LA 5DBXA 3PE1A 3DNEA 3IS5A 1UU9A 2HIWA 1CKJA 2R0UA 4PWNA 1XKKA 3CXWA 4RX5A 2UZEA 4NM0A 4BCFA 5AR4A 2W1FA 3OW4A 1Q8UA 3OG7A 4KSPA 3DBCA 2WTVA 4BHZA 4JOAA 3V01A 4FEUA 4XH6A 3NVKI 4F6WA 4K2RA 5BYLA 4ITJA 4D4VA 3WYXA 4L6QA 2Z2WA 5J8IA 2X6EA 4ANNA 3D5VA 2JFMA 3SHEA 4WNMA 5E8ZA 3MB7A 4APCA 5DNRA 4F6SA 2IW6A 4YTCA 4CQEA 4IB5A 3FLSA 4W4YA 2VWWA 5HG7A 3BGPA 5M4IA 3G0FA 2BALA 1VYWA 1WVWA 2VD5A 4D5HA 1S9IA 2VO0A 5HLPA 1JBPE 4R1VA 2EB2A 4TRLA 3ZRKA 4BTJA 3IECA 3JVRA 3R2YA 4FSRA 4YTFA 3EQPA 4O2ZA 2IZRA 5L2QA 1WBNA 5JGAA 2XYUA 1LUFA 4JX3A 3W10A 5LVMA 3GCVA 5C8MA 4ANLA 1YWRA 3KF4A 5L6WL 4BDAA 1XH5A 1UV5A 1ZMUA 1XBBA 3CPBA 3ZDIA 2EXMA 3DTWA 1X8BA 4XEYA 5ETFA 3NEWA 1BI8A 5JFSA 4CG8A 4AN2A 3UZRA 1OIQA 2UW7A 3WF6A 4FSQA 2WMSA 3UGCA 4WG4A 3F82A 3GXLA 5K4IA 3LJ2A 4KWPA 3E7OA 5AP4A 3FZOA 3E62A 1XH6A 3R2BA 2Y9QA 4ZY6A 3PA5A 3ORMA 3NUUA 3QCYA 4D2PA 4O91A 3I0QA 4YJTA 4XLVA 3NX8A 4M97A 4ZJJA 2OXDA 1SVHA 3RM7A 4IVDA 4AAAA 4P2KA 2PMNX 3POOA 5EYDA 2PVLA 4PPBA 3PLAE 1XH9A 3CBLA 4IVCA 4UXLA 5FLFA 4ZSLA 3WF9A 3QQHA 1R0PA 1WZYA 4M0ZA 4FSNA 4U5JA 3R8MA 4U80A 2XNGA 5CSXA 4W9WA 3CPCA 1RQQA 2PMLX 3K3JA 2CLXA 4DE4A 2YDKA 2DWBA 3SXSA 2IO6A 3GNIB 4HCUA 4WD5A 2UZOA 3QKKA 2J6MA 3PRIA 1NY3A 3R83A 3Q3BA 5EDRA 4HW7A 1GIHA 2PVMA 3KFAA 4FT3A 1SYKA 1TVOA 2VTLA 4TNBA 3ACKA 3I6UA 4CFWA 4L45A 4PTCA 5AIRA 4ERKA 4AZWA 2J51A 4EH4A 3O7LD 3MFRA 4YSJA 4J99A 4UALA 1YDSE 4D4YA 5BVOA 2ITNA 1YXUA 3DY7A 4BYIA 4QYHA 4C7TA 5K3YA 3PPKA 5IPJA 2CJMA 2XBAA 4JJRA 2BRGA 2CCHA 3JXWA 4ZSAA 4RPVA 3TTIA 5JQ5A 4U6RA 3OCGA 3UNKA 3NUAA 2XB7A 4ZIMA 3FY2A 4CFXA 1BL7A 4PL4A 4C38A 1IAJA 1Q8TA 2GNJA 3LQ8A 3O51A 1OKZA 4IM2A 3ZTXA 4FC0A 1KSWA 3ZC5A 3B8RA 3WZEA 4AZFA 4YO4A 5ANGA 3ZONA 1TKIA 3C4WA 5FEDA 2B0QA 1H4LA 4MX9A 4O0TA 3EQRA 2W1GA 4X3JA 4M66A 2QLUA 4FNWA 5CALA 4BBEA 5FXSA 3PE2A 4KNBA 4R8QA 3PRFA 4OBOA 2GFSA 2WU7A 3FLQA 1BLXA 2WXVA 3BEGA 3KVXA 2HZNA 3BYVA 2ZV8A 1G3NA 4FIJA 5FTGA 4GT4A 3MH2A 4AFEA 2G01A 3MTLA 2CNQA 1KE8A 2XK9A 4FG9A 2YWVA 4JBQA 5D7VA 2ACXA 4O84A 3ERKA 4BCHA 3NYNA 3PY3A 3PXZA 3VHKA 3GOPA 5FGKA 2VX3A 4RX7A 3D7TB 3VS6A 4FL1A 4IDTA 3HAVA 1H8FA 4LGGA 2HZ0A 5EW8A 3UC3A 3QYZA 4KRCA 3KA0A 3UMXA 4DG0E 2XIZA 5ITAA 3G51A 3LJ0A 3QA8A 5HD4A 4FEWA 5FM3A 1WAKA 3LCKA 2BZJA 3HP5A 3W2RA 1OIYA 2UVYA 1YI4A 5HG5A 2ZMDA 3NSZA 4FR4A 3ENHA 2E9OA 1R39A 3PVGA 3QX2A 2A1AB 2WGJA 4G9RA 4JR7A 4D1ZA 4FZDB 3W55A 3PLSA 3UNJA 1WFCA 3AC3A 2ETMA 4FKWA 1B6CB 4W4WA 4B4LA 1J1CA 1KV1A 2H9VA 3R9HA 3PIYA 3VS7A 3PIZA 2R2PA 2R3QA 2VAGA 4K8AA 2XNOA 2B4SB 4FKLA 4EK6A 3WZUA 3UJGA 3NYXA 3EZRA 4MHAA 2C0OA 2IZTA 3QBNA 4YZ9A 4EC9A 5HVYA 4TYIA 4F08A 2A19B 5AAFA 1PXOA 3K5UA 5L4QA 4UMQA 4FTMA 3WYYA 3UNZA 4TTHB 3GC7A 4QTBA 2W1IA 4UWCA 2KTYA 3AD6A 3QD0A 4EQUA 4QT1A 4CYIA 5CSWA 3S00A 4IM3A 5JH6A 3TNPC 3Q9XA 5CEKA 2WB8A 4ZZOA 2W1DA 4C3RA 4TYHB 2W96B 2XM8A 4FV6A 1UA2A 3BE9A 2B54A 1RDQE 3FKLA 3KGAA 2VTQA 4QRCA 1WVYA 3PPZA 4U3ZA 1YDTE 1ZYCA 1I09A 4TYEA 4UWBA 3Q9ZA 4FT0A 4OTHA 5CI6A 3RTPA 1YHWA 3V5QA 4C3PA 5IISA 4JQ7A 3GU4A 5DYJA 4IFGA 4L44A 3FE3A 5E8TA 3CTQA 4I94A 4FTCA 3ID6C 4IWPA 4FOBA 3REPA 1OUKA 1QMZA 1ZMWA 4RT7A 4L01A 4QD6A 1PXKA 2ESMA 4HGEA 5CX9A 3R28A 3R9OA 1OL5A 4AZSA 4UYAA 4PNKA 2ZVAA 3CIKA 3DPKA 3QTQA 1KUTA 4YZDA 3ZO1A 2P0CA 1U5RA 5D12A 4I6FA 2FH9A 3QAME 2XUUA 4I23A 3TNQB 1BL6A 3BU5A 2WQNA 3BHTA 4K18A 4F1TA 5DEYA 5C9CA 1URCA 1QPJA 2EWAA 2FGIA 2WTWA 3CGOA 3EZVA 4KS8A 3VRYA 5AEPA 3VS2A 4NFNA 3MYGA 3E8DA 3S2PA 5CAPA 4OTDA 4FUYA 3CQEA 2B53A 5FBNC 3UG2A 4LOPA 3UG1A 1L3RE 2Q0NA 4GH2A 3ORLA 4GU6A 3LZBA 4F7NA 5JRQA 2QQ7A 4ASDA 4ZS4A 4CVAA 4LM5A 3G90X 3TIZA 2WMAA 4B8LA 3P86A 5FBOA 4CEGA 2JFLA 4WOVA 2BAQA 3KEXA 3GCUA 3VS4A 2QNJA 4ZP5A 1PMVA 4WG3A 4JDJA 4CZTA 3AQVA 2PULA 5BMMA 1Y8YA 3DK7A 3DOGA 3HV4A 2G2IA 4FKJA 4XBRA 3KCFA 4H3QA 1JSVA 5LCJA 5KZ0A 3UIXA 3MPTA 1YVJA 4FE2A 3PXYA 2W4OA 3O2MA 3MS9A 3FZTA 3IG7A 2XP2A 4D58A 5LVNA 5EYMA 2V5QA 2BCJA 3TTJA 4XRLA 2OZAB 3FPMA 2GNLA 2H6DA 3EJ1A 4QP7A 3TV4A 2X2LA 1FGIA 2BZKB 3ORTA 2OSCA 3QWJA 3UOLA 1A48A 3RHXA 2OIBA 3LPBA 2QOCA 3SRVA 3R63A 1M7NA 4KKGA 5CWZA 2PSQA 4AOJA 2VTIA 1PXNA 4TT7A 4GG7A 5CASA 2P3GX 3SXFA 4EHZA 4F09A 5KMKA 4OTQA 3TKHA 3DFAA 2Z7SA 4X6RA 3KXGA 4D2SA 4W4XA 4C4HA 4O1OA 4DFYA 4BCQA 1AD5A 2BRHA 2Y6MA 3FHIA 5GIPE 1AQ1A 3QHRA 4DEDA 4O7LA 2YDIA 2W5BA 2W1CA 4OTIA 4WHZA 2PUNA 5EKOA 3ZBXA 4ACMA 4AGWA 5JMSA 4XRJA 4L7SA 2X7FA 3NYOA 4RFMA 4LMNA 3RPOA 2OI4X 3E3PA 4BWXA 4ACDA 4FT7A 2WTIA 2YLEA 3EOCA 4RJ5A 3NW6A 3H0YA 3DK6A 3QTXA 4BDGA 4LRMA 3QQLA 4WIHA 4NM7A 3BQCA 4AGUA 4ARKA 4X21A 2R64A 1NXKA 4FZAB 5HORA 3HV3A 5HO8A 4FTAA 5AP1A 5IA5A 2QOFA 1XBAA 3DZQA 3R6XA 4EOLA 5M09A 4MWIA 3V8TA 4J97A 4JT3A 4MTAA 1H07A 3NCGA 4I4EA 4IAYA 3OY1A 4MXCA 4PQNA 1IASA 5CEIA 3WI6A 4U7ZA 4H05A 3FWQA 3KK8A 3RNYA 3Q96A 4IM0A 1YW2A 4L52A 3HRBA 4FL3A 2R9SA 3BV3A 3TJCA 3VUKA 4FIEA 4CD0A 3AT3A 1JPAA 5KNJA 4FV7A 3TDVA 4O7VA 3VF9A 2PZPA 3CE3A 3GFWA 4AZEA 4TL0A 4RIYA 4GK3A 3EL8A 5DA3A 3DBDA 3TXOA 2C1BA 4O6EA 2F7EE 2Y0AA 3PXKA 1SM2A 4TPTA 4RWJA 3F5UA 4IX4A 3VS3A 4EBWA 4ACCA 3U4WA 5HE2A 4F65A 1NT2A 3MJ2A 3WZJA 3TN8A 3VS0A 4BCGA 3LMGA 3DBQA 4QYEA 4UB7A 3W8LA 1XH4A 4HCTA 4MWHA 3UVRA 3OW3A 3QD2B 4AW1A 4QP4A 2IW9A 2CGXA 5FQDC 3OS3A 4R78A 4F9CA 4I93A 1GOLA 1UU8A 4X2FA 3C50A 5EI6A 2QCSA 3WIGA 4DFZE 4EHVA 4EL9A 4F99A 2OIDA 3ET7A 2OH0E 3EQBA 4O1PA 4CCUA 5KX8A 4WSYA 3FMNA 4GSBA 2QR7A 4BIDA 4BI0A 4FZ6A 2X2KA 3TM0A 3FHRA 2YHVA 3F61A 4XG9A 2VGPA 2ITUA 4FODA 2VTRA 4O0RA 4Y73A 4N0SA 3LFSA 4OTWA 2BMCA 4JS8A 1ZMVA 2G9XA 5HVJA 2BZHB 3FLYA 4YJVA 4FTOA 4GKIA 2XRWA 2WQEA 3S0OA 1O6LA 3ORIA 4EK5A 3EB0A 4ZJVA 1OPJA 2O8YA 3KRXA 4U79A 4GK2A 3Q4ZA 5IA2A 3MA6A 1NW1A 1ZOEA 4G31A 4ZMEA 4QPAA 5CAQA 2UVZA 2VO3A 4GT3A 2C6DA 3L8VA 4QOXA 3KULA 2F9GA 1R0EA 4FVQA 2EU9A 3DA6A 4W4VA 5GHVA 2HYYA 4WUAA 5H8BA 3ZEWA 1ZARA 4DYMA 3UYSA 4YTIA 3EFWA 1RJBA 3HMPA 5ACKA 3ELJA 3RZFA 4E4LA 4ZY5A 4YPSA 2QI8A 4NW6A 5JZNA 3V6SA 5HBHA 2W06A 4PPAA 5CF6A 3TDWA 5CYIA 3R8UA 4YJUA 4NTSA 5IUIA 4E20A 5CTPA 4BDEA 4D2TA 4HNIA 4JDHA 4O21A 2JDRA 4ZZMA 5CT0A 4ASZA 3QKLA 3DKCA 1Q97A 4DEHA 3H0ZA 2GQSA 1KOAA 4AS0A 1QCFA 2ETRA 4JDKA 2JDSA 4PL3A 5HCXA 1J7IA 3SA0A 5ETAA 4USEA 3NUYA 3UIMA 4RLLA 4V0GB 5IUHA 4PL5A 5HQ0A 1VZOA 4RWLA 1PXLA 5CF5A 1ATPE 3MPAA 5I9ZA 3F3WA 3OUKA 3G5DA 4NFMA 2V7AA 4IXPA 4RIWA 5ANEA 2Y4PA 4RLKA 2XNPA 3FLNC 4YJOA 2UZBA 4A4OA 5EOBA 4E26A 4DC2A 4FNYA 4I0TA 4KSQA 5D41A 4FL2A 3G6HA 4E4MA 5AP2A 1K9AA 5HX6A 3PXQA 1W7HA 4CZUA 3LQ3A 2JGZA 4KAOA 3IGGA 1P2AA 4QMQA 4CMUA 3ZLSA 1NA7A 3GU8A 4X3FA 1PKDA 4QQCA 4ANBA 2WTJA 4ORKA 4MXXA 3THBA 2R3LA 2C68A 4BI1A 4I21A 5CLPA 4E5WA 3FMEA 5HTCA 4C8BA 4OTGA 4C4JA 3TJDA 2VTNA 2WMWA 3MGYA 4EORA 4Y83A 1XR1A 4K6ZA 1MUOA 3MWUA 4DH3A 3HV7A 5A4CA 3OXIA 2J5EA 4MXOA 4ZTQA 5A6OA 3TKUA 4IAZA 5C8KA 2X4FA 2W9FB 4CV8A 4GYGA 1APME 4LG4A 3PY0A 3ZCLA 4BDJA 2XK8A 4QMZA 5FEQA 2YJRA 4G3EA 3C4CA 4C61A 4DGLC 1SVEA 4RVMA 4PX6A 3U8WA 3GT8A 5IMEA 3UOJA 4DTBA 2BFYA 3R0TA 4UEUA 2VZ6A 5BUIA 3SV0A 4E6CA 2IZUA 3PA4A 1BYGA 4J95A 4BTFA 3G6GA 5BPYA 3CTJA 1OL7A 3BHVA 2I0HA 2R7IA 3HYHA 3ZRLA 3UQFA 5DT0A 4PDYA 2C6OA 4AZVA 5IDNA 4TYGA 3H10A 4J7BA 4ANOA 4PV0A 4DH1A 4QNYA 4RIOA 5EM8A 3ZO3A 3IQ7A 4I24A 1PXJA 5J7HA 3PJ3A 5G6VA 4NK9A 3ZHPC 4XP2A 4YHJA 3MY5A 4MKCA 5FM2A 3MJ1A 4PTGA 3NMUF 1TQMA 2QOKA 4RJ4A 4BL1A 2PL0A 2C5XA 1CKPA 3QC4A 4FK6A 1GZ8A 3UDBA 3DLZA 3RINA 4H1MA 3EFJA 4QTAA 3PXRA 4YJSA 4HCVA 1JOWB 3O71A 1GZNA 3O8PA 3TG1A 4PRJA 3OOMA 5BNJA 4ZEGA 3RCDA 3F6XA 4O0YA 4DCEA 3FQHA 3VHEA 3C13A 2CGWA 3FYJX 3I81A 4Q2AA 3NUXA 3A7JA 1W84A 3DQWA 3LFBA 1KE5A 1PJKA 4IX5A 2C5VA 4DEIA 4UV0A 4YC8A 4XS2A 5IG1A 4AE9A 2GHGA 3QF9A 3R1SA 4EOPA 3QTZA 4BFMA 4XUFA 3V5PA 3ITZA 4IQ6A 3N4UA 4FZFB 3GUBA 3KB7A 1J1BA 4PPCA 4BDCA 3CLYA 3Q6WA 3ZYAA 5DRDA 2PE2A 1V0OA 3QTSA 2VRXA 3DBFA 4PDSA 3T8OA 2O65A 3V8SA 4APPA 4AW5A 2QODA 4EOQA 2WQBA 4GW8A 2XBJA 3LCSA 3Q4UA 1K2PA 4LFIA 2ZM4A 4D0XA 4R5YA 2FVDA 2X81A 4JL9A 4PDOA 4RA4A 4ZSEA 1ZYLA 3E93A 2XNBA 2B55A 2W1EA 3F2RA 1PXMA 2VWYA 4DF3A 4QO9A 1OVEA 2OH4A 3F2AA 1CDKA 3VBTA 3PP0A 3VBXA 3O96A 5LJJA 4L3JA 4MBLA 4HGLA 4QPMA 4S2ZA 4HVGA 5LQFA 4FV2A 2O0UA 5FP6A 5H3QA 1YXVA 1ZY5A 5IQEA 5ANJA 2BUJA 1IEPA 5E8VA 3TUBA 2BIYA 5GZ8A 2GCDA 4YSMA 5AA8A 3VBWA 3AC1A 2CKQA 4DCAA 1E1XA 3BGQA 5TT7A 2AUHA 1GAGA 3EQFA 4O86A 4ENYA 5LMBA 4H36A 2QG5A 4F1OA 4U44A 4XV2A 4BZNA 4GJ2A 1QPCA 3ZRMA 3ZFXA 4F0FA 3CY3A 3LLTA 1M52A 4IJ9A 4R7BA 2C5OA 3UQCA 4AA4A 3I60A 4AT3A 4IE9A 5DN3A 4FYNA 4UX9A 2F49A 4O0WA 4IAIA 3SQQA 2E2BA 4KIPA 2GTMA 3MVMA 4CXAA 1JNKA 3U6HA 3COMA 2WMBA 2H34A 3P0MA 5KHXA 2I6LA 4JVGA 4YBJA 2YZLA 5IQCA 3EKNA 2E9UA 4BIEA 3F2NA 3FZRA 4NCTC 5CQWA 5HEZA 5L8JA 4ACGA 4EC8A 4J71A 4Z9LA 2GSFA 3WE8A 4EWHA 2IG7A 5A6NA 2YM5A 5K5NA 5FXQA 3Q04A 3RI1A 1H01A 3HLLA 3F7WA 1F0QA 4F9YA 4H58A 5AAEA 3ATTA 3HEGA 3TIYA 1OL1A 2NNWB 1XO2B 2X8DA 1SVGA 1OI9A 5HG9A 5CENA 1GIJA 4RVKA 4NJ3A 3W2OA 4ALUA 4XNEA 4QP8A 4MVFA 4NYEA 2IPXA 2R3GA 2W1HA 3F66A 3ZO2A 4DAWA 2BFXA 5DR2A 4S33A 5HLWA 1LR4A 4CZYB 3W2QA 5JGBA 4TN6A 4U40A 2JKOA 5BYYA 3C5UA 4XYFA 4F70A 2XK7A 2GTNA 3FXZA 3PTGA 4II5A 3EMGA 4O38A 4YZBA 2QO7A 3UYTA 1DI8A 3QRJA 3Q4CA 4K11A 4EEVA 3P5KA 2W0JA 3MBLA 2QC6A 2CLQA 3BELA 4C4GA 2A0CX 4FTQA 1LP4A 2XVDA 4ZTHA 5HHWA 2FYSA 3WOWA 3EN4A 4DTKA 3Q60A 2ETKA 1DS5A 2JC6A 4GCJA 2C0TA 3NIZA 2VGOA 4ZTLA 5EQYA 2ZM1A 3ANRA 4HJOA 4ANQA 5ANOA 3HMNA 2UZWE 3ORNA 4DEEA 4K1BA 5M44A 3TWJA 4BYJA 3SVVA 4RIYB 3AG9A 4FTJA 5EM7A 5IQHA 3FSFA 2JDOA 5IUGA 3N4VA 4YO6A 1IAHA 3B2TA 4DITA 2J2IB 5B2MA 2I7QA 4FKVA 3BIZA 5E8XA 3IDCA 4I6BA 4AN9A 3PWYA 2JAVA 5LVPA 4C02A 4IIRA 4G17A 2R3NA 4HGTA 4NSTA 4BBFA 4Z3VA 5K0XA 1CTPE 1YXSA 4PDPA 5I3OA 3D2KA 2XS0A 3QTRA 4LUEA 4AOIA 4YUQA 3MY0A 5J7BA 2ONLC 2W05A 3VQUA 3UBDA 3E5AA 4UMUA 3DDPA 3U87A 2ITXA 4ZOGA 4KKHA 3W2CA 3TNHA 2BR1A 3ETAA 2NRUA 3MA3A 2PMOX 4U9AA 3RP9A 4NZWB 4U81A 3O8TA 4OTRA 3R01A 3FMKA 1PMNA 2CHLA 3R71A 4E6DA 4NU1A 1VJYA 5AUTA 5CANA 2ZV9A 3ZFMA 5C03A 1M7QA 2I1MA 1ZYDA 3R8PA 1MQ4A 3BYOA 5FD2A 3N9XA 1OIUA 2O2UA 2BAKA 3LE6A 4IZAA 4QYFA 5ACBC 5JSMA 2G2FA 5HI2A 4M69B 4TWNA 2HAKA 2OXYA 3RK9A 3U4UA 2XJ2A 3O0GA 2WU6A 1H0WA 1YXXA 3LJ1A 4GUBA 3SAYA 4EH5A 2I0YA 2YM7A 5GIOE 5LMKA 3OHTA 1J7UA 4TKSA 4LOQA 3H9FA 5EDPA 4CFUA 4O83A 2Z7RA 3F3TA 4IMYA 2JKQA 1YI3A 4ZSJA 2Z7LA 3LIJA 3GOKA 3FMLA 3OWJA 4HYIA 3TI1A 3WBLA 4WG5A 1R78A 4FI1A 5BX0A 5HIEA 1IG1A 2VWBA 3FLWA 5E7RA 4GFOA 3FI2A 3K5VA 4F0IA 1G8AA 4WT6A 4JDIA 4MBIA 2ITWA 3NNXA 4EKKA 3ORKA 5A4EA 5HLNA 1H00A 2PZIA 3GENA 4A06A 3QKMA 3G2FA 4PP7A 4BGQA 2RFEA 5LVOA 4I92A 1E9HA 3KREA 3ZSIA 1FGKA 4KIQA 5A54A 5DT3A 4JI9A 1UNHA 5BVEA 4D5KA 3U9CA 3PFQA 3PVWA 5KUPA 4GVAA 2ZB0A 4GIHA 3UO5A 2I0VA 4ZY4A 4K77A 3AMAA 2UVXA 5J87A 1UNGA 3D5WA 4FTIA 4IC8A 1YOLA 3QHWA 1YHVA 4XJ0A 5IF1A 1ZYSA 2R3FA 2XA4A 4LOOA 4NM3A 4C4IA 3BEAA 3PZEA 3Q2MA 4FVRA 3H9OA 3M1SA 4L9IA 4UYNA 3DZOA 3D7ZA 2WTCA 3QQJA 4R7HA 4EH9A 2CPKE 3VBVA 3C9WA 3QCSA 2XEYA 5AUYA 1GJOA 2YZAA 3V3VA 4GYIA 5HX8A 1FMKA 1JAMA 2B9FA 5HICA 4QMVA 2UZLA 3DBEA 1VYZA 1OUYA 4WA9A 3MVJA 3NIEA 2UW5A 4L43A 4D2WA 3I6WA 4FEQA 4RIXA 5GINE 4LMUA 3H30A 3L9LA 4L46A 5E90A 3Q5ZA 3PJ2A 3NRMA 4OAUC 1WCCA 5J5SA 4KUJA 2RIOA 4I22A 3GEQA 3QD4A 2UW9A 3GI3A 4GV1A 5LCKA 4A4XA 2PTKA 2QURA
chains in the Genus database with same CATH superfamily
4L53A 3ZM9A 2OGVA 4OR5A 4EQMA 4I6QA 4D0WA 2JKMA 3KXXA 3OVVA 4IZ7A 4IX3A 3QUPA 4NWMA 3KVWA 2BAJA 3QA0A 4Z16A 4O2PA 1ZZLA 2J7TA 4BWKA 3PYYA 4HPTE 3EN7A 1W2FA 1Z57A 4AACA 2F7ZE 3FPQA 2GQRA 4MNEA 2A4LA 4FG8A 3K54A 5HE3A 3MVLA 4DLIA 3C0HA 4TNDA 1WBWA 3I7CA 4M7IA 1Q3WA 1MQBA 3WE4A 4CLIA 1IRKA 5JGDA 4YC3A 4ITIA 2R3MA 2XZSA 2VV9A 5IQFA 4ALVA 4G3CA 3MDYA 4TWPA 3IW7A 2OLCA 4IZ5A 3I7BA 2J0LA 3R8LA 4G16A 2XKEA 3MB6A 4NIFB 3LW0A 3HDMA 4JX7A 3N4TA 2VWIA 3MESA 4R3PA 5AM6A 1OGUA 3RAHA 4QMWA 2J90A 3PJ8A 3CD3A 3FBVA 2Z8CA 5ETCA 4A9UA 3F9NA 4JG7A 3U6IA 4EZ3A 1VLRA 2WTKB 3LCTA 4M8TA 4S31A 4CMTA 5IQIA 3LFCA 1H1RA 1LEZA 3IW8A 1UU7A 2BTRA 1TQIA 1M2PA 3H9RA 5B2KA 4O4FA 3RGFA 2ZMCA 3R9DA 2XIYA 2CN8A 3DFCB 4MXAA 3BE2A 3GU5A 4RQKA 4TY1A 5IA0A 5IH4A 4O96A 4M3QA 3RPSA 3BU6A 2WOUA 5A4LA 4YP8A 2GU8A 4N70A 1FPUA 1YOMA 2QO9A 2WZJA 3EQIA 4C37A 2QOLA 4EYMA 3QQGA 4KB8A 1J7LA 5IU2A 3P23A 2F2CB 2YCFA 1OBGA 3AT2A 3GU7A 1Q99A 2B7AA 4DH7A 1XMMA 4F64A 2CGUA 3D94A 4AGCA 3C7QA 3IDBA 4ANSA 2R3JA 2RG5A 5B2LA 3CCNA 3BV2A 2YIQA 3P1AA 2X1NA 2VTOA 3GCQA 3UO6A 1L8TA 5AIKA 1GIIA 3PVBA 3W16A 3WF7A 2ZYBA 1H0VA 3VJNA 4USDA 2ITVA 3E3BX 5EOLA 4DH5A 2OICA 1P5EA 3A60A 4R5SA 4BDBA 1XMLA 3EYGA 5M57A 4FTUA 4G9CA 4EOSA 2P55A 3IGOA 2XJ1A 3OC1A 4KIKA 4N6YA 3SKCA 2VX0A 3QU0A 4OBPA 3KMUA 3QC9A 3ZDUA 1P4FA 1Q3DA 3CKXA 3BBWA 3ZEPA 2CNUA 2O64A 3BHUA 4L42A 3TCPA 5AR5A 4E6QA 4BY9E 4BCOA 2J0JA 1PMUA 2IJMA 2OK1A 5A46A 4HYSA 4E73A 1O6KA 2HXLA 4XOZA 4DGMA 3IKAA 3TKIA 4DA5A 2XCHA 3A4OX 3RK5A 3UO4A 2E9NA 1G5SA 2GHMA 2GHLA 2XKFA 4HGSA 2WPAA 3UZTA 5CT7A 3O23A 3VBYA 3HV6A 3R8VA 5J9ZA 5K9IA 5LXMA 2XM9A 3FQEA 2DUVA 3R7UA 3O8UA 3OTUA 3QRKA 3GFEA 5DT4A 3JS2A 5ICPA 3VNTA 2P2IA 1GY3A 3MH1A 4JQ8A 3VRZA 3R1NA 2PZ5A 3OCSA 4G2FA 2OJIA 2FSMX 2W5HA 4BHNA 3FL4A 3I79A 3KK9A 5IQGA 5I4NA 1QL6A 2Q0BA 4HZRA 1PKGA 5AP7A 1OBDA 3R8ZA 5KMMA 2VWZA 5I0BA 4F4PA 5DI1A 2YAAA 3RM6A 1JQHA 4EK4A 2UW6A 3EQHA 4O7TA 3AXWA 5KKRC 2PZYA 3V6RA 2YCSA 1KE6A 2BVAA 3ZUVA 4C36A 2OJFE 2JDTA 3KIOC 4CFFA 5C4KA 4FA2A 3DXQA 4X2KA 1P4OA 1Q8WA 2HY0A 5L2IA 2JIIA 4CG9A 3BL9A 3IK3A 4F9WA 4CMOA 4NH1A 2UZNA 5E8YA 5L2TA 3BKBA 3N51A 5EFQA 2ZB1A 4FTRA 2G1TA 4WUNA 2YJSA 2C3LA 4ZJIA 4Q5EA 3UTOA 3MSSA 3FV8A 3WARA 4NW5A 4G5PA 3FZPA 3QCQA 4FKUA 4WNPA 5M51A 4QQTA 4HVDA 4QMNA 5TE0A 2QKWB 2QR8A 3SOAA 1OMWA 4DG2E 4E1ZA 3FDNA 1PXPA 4G6NA 2H96A 2PVNA 4LL0A 5D9HA 5BVNA 4O7WA 3HUCA 3CQWA 4YR8A 2ERKA 2F2UA 4O0VA 5EW3A 1FQ1B 2UUEA 2XH5A 5JKGA 3LFFA 4XG2A 5DR6A 1PXIA 2AC5A 4YC6A 2WTKC 4BZOA 5J9YA 1EH4A 3H3CA 4O7YA 4NT4A 2BPMA 4LV5A 4O0XA 4E93A 1ZY4A 4ZAUA 5JZJA 4EYJA 3ZBFA 4EZ5A 3BWFA 4USFA 5EHYA 4EOOA 4Z55A 5AR7A 3UP7A 3F5PA 2YEXA 2R3IA 3QTIA 4EOKA 4UZHA 2XAMA 1H27A 4B99A 4BJJB 4GK4A 4WRSA 1M2QA 1STCE 3I4BA 1W83A 3TZMA 5AUWA 5FDXA 5L2WA 3KMMA 4Y95A 3CY2A 3VAPA 5TO8A 2XALA 1ZOHA 4BKZA 2NO3A 4QYGA 4X7QA 3PWDA 5HE0A 4XG7A 5DRBA 3VUDA 4DHFA 2FB8A 5CVHA 3A8WA 4FIFA 1F5QA 3L9MA 4DGOA 3ENMA 5L8KA 4U0IA 3Q6UA 1JKSA 2BROA 2VX1A 2YDJA 1U5QA 4FSWA 4J52A 5GJDA 1V0PA 5CSHA 2A2AA 3OUNB 4I5MA 5AV4A 1H1WA 3DV3A 4EJNA 5J1VA 5M4FA 1JKLA 3EQCA 4Y72A 5H8EA 5HVKA 2SRCA 3DAEA 4YU2A 4YJRA 4C34A 3H4JA 4UWYA 2PU8A 1H08A 2OIQA 2PVKA 4IDVA 4X2GA 2WO6A 2HW6A 3HV5A 3NAYA 2VWVA 3DQXA 4MNFA 5LMAA 4EWQA 1HCKA 4ASEA 3SG8A 2I0EA 4YZCA 5IH5A 1OIRA 4XX9A 4QMXA 3HZTA 3ORZA 1Q62A 3P79A 2XNEA 4P90A 4IB0A 3OCTA 4U3YA 5CNNA 4E7WA 3CKWA 3RPYA 4B7TA 3AC2A 3PPJA 4G34A 3OXZA 5EH0A 1U54A 3G9LX 5HTBA 1REKA 1OM1A 3IOPA 3LCOA 3D7TA 1WBVA 2EUFB 4IVBA 4YNEA 4CFVA 5HD7A 4PMSA 3R7OA 2JITA 4U41A 3KU2A 2QOQA 3OXTA 4AT4A 2IVSA 4FIHA 4MQ1A 4KBCA 3VC4A 4XG8A 3SLSA 4BCKA 1R1WA 4NEUA 2AC3A 4XG6A 4QMSA 1H25A 2P2HA 1LEWA 4IAAA 4JG6A 5HNBA 5JT2A 2BKKA 1URWA 2X2MA 1PHKA 2VUWA 4I5HA 3W0MA 3RZBA 3T3VA 5IQAA 2QU5A 3DKGA 3VWAA 2J9MA 1OITA 4CYJA 4MK0A 5HU3A 5IH6A 2R5TA 4L3PA 3F88A 5AP3A 4I1ZA 4IANA 3EQDA 3PG1A 3T9TA 1WBOA 2X8IA 1FVRA 1XH8A 3ZLXA 3ROYA 4NM5A 3DNDA 4YHTA 4YBKA 4S34A 2OF2A 1GZOA 3ORPA 2R3KA 4U42A 5IMXA 4HNFA 5T68A 3C5IA 4J96A 2OKRA 2XRUA 3CR0A 5L3AA 1PF8A 4BDIA 2WMVA 4RZVA 5F94A 1ZOGA 2HWPA 3O50A 4GL9A 1A06A 3KXMA 2VWUA 1CSNA 1CM8A 3AGMA 3ZZEA 5AUZA 4BN1A 4IAKA 4TYHA 3W32A 5GJFA 3E87A 4IC7A 4DN5A 2B9JA 3EN5A 4WRGA 2YCRA 4X2JA 4D4RA 4UN0C 2HELA 4N4SA 3ZMMA 3LFQA 3LMHA 3A61A 1DM2A 3A62A 5F95A 1H1PA 3LLAA 1Y6BA 2G2HA 2RL5A 4FV8A 4O82A 5LWMA 1WBTA 3JY0A 3Q9YA 1UVRA 3LFDA 2CKPA 5KMLA 4H3PA 3VW6A 1OKVA 2QHNA 3QTWA 5DE2A 5KCVA 3FKNA 2VU3A 3ACJA 3V5WA 4NKAA 3AC4A 3R04A 3OWLA 5CVFA 5A9UA 2Q83A 5EDQA 3QQUA 4RJ8A 4UY9A 4D1XA 3POZA 5F20A 3MV5A 3TNWA 1KWPA 1UNLA 1OKWA 1IA9A 4UBAA 3WILA 2HZ4A 5IA3A 1PW2A 3RJCA 3SD0A 5IA4A 5EHOA 5DHJA 4H1JA 4I5CA 4FSTA 2YM3A 4IAFA 3ANQA 5LOHA 1OB3A 2XIRA 2C3IB 3L1SA 4AUAA 3FI8A 3VQHA 3BLAA 3NYVA 5FDPA 4YTHA 2WFYA 3FJQE 4IWQA 1VR2A 2C5NA 3NGAA 3LXLA 2XF0A 3MIYA 2CGVA 5ETIA 5C1QB 3SGCA 4L7FA 4D55A 4G3DA 3BLRA 5ANDA 3U51A 3R1YA 4WBBB 1WBSA 4GVJA 2YIYA 3QRIA 4QPSA 4I6HA 4EUUA 4DLJA 5LWNA 1Q61A 1OPLA 2YWPA 3VS1A 4BTKA 2PVFA 3RNIA 1ZAOA 1NVSA 4E6AA 4FOCA 4MH7A 2V7OA 1MP8A 4Y85A 4MD7E 1RW8A 2B1PA 2DS1A 3TT0A 3OROA 4XP0A 2ITOA 5AV1A 2XCKA 5F4NA 4DGGA 2BKZA 4R7IA 1UWJA 1ST0A 5DFPA 3VN9A 4BVUA 3GCSA 3L9NA 4YLKA 4FEXA 2EVAA 1XH7A 3II5A 4EOIA 5C4LA 1BKXA 2ZV2A 2X7GA 3LHJA 4UZDA 4KRDA 2C6LA 4L3LA 2JBOA 2V55A 3KRRA 2J4ZA 3DXNA 4YNOA 5M4UA 2QHMA 4KA3A 2X7OA 4AA0A 3K3IA 2ITTA 4Q9ZA 2JBPA 5BMSA 5IDPA 5J79A 3HA8A 2GNGA 2YFXA 4KKEA 4RJ6A 2RFSA 4HZSA 4EQCA 4QMMA 3JYAA 4AQCA 2C0IA 5E92A 2LGCA 4FMQA 3RK7A 4Y8DA 4A9TA 4DT9A 2GFCA 5CQUA 5IEVA 3JY9A 1DAYA 1T46A 3E63A 3HECA 4LDTA 4ZMFA 4NJDA 4B0GA 4WO5A 3QUDA 2XEZA 2XK6A 3PSCA 3OOGA 3P7CA 3T3UA 3V5JA 5I9YA 4BDDA 2VTSA 4RFZA 3MH3A 1K3AA 3SRVB 4LUDA 3UIBA 4FF8A 3L8PA 4JAJA 4DFNA 4FKSA 2QO2A 1OL2A 4BGGA 5EYCA 3W1FA 4BDHA 5DWRA 4RA5A 5KMIA 4GU9A 4RMZA 4A9SA 3ZXTA 3EN6A 3FI3A 4V05A 5EM6A 4KIKB 3R9NA 4EOMA 5C01A 4G3FA 2Z02A 4TWOA 2PVYA 5B0XA 4C62A 3SXRA 3TZ7A 5BVWA 2OW3A 4EHEA 4FYOA 4S30A 4FTLA 5JFVA 3JUHA 4RG0A 3VULA 5C8NA 1M2RA 2J5FA 5AV3A 5HNGA 5JQ8A 2OF4A 4EZ7A 2J50A 2A98A 3PVUA 4K33A 4O7SA 3A7HA 4EH3A 3QGWA 5EI8A 3DJ7A 3R73A 3QUEA 3GP0A 4XLIA 5I5ZA 4O27B 4BKJA 2PPQA 4F9BA 4Q9SA 2OO8X 5A4TA 1PYXA 4L00A 3WF5A 4BTMA 1H26A 4YURA 3BQRA 4AXAA 3KN6A 4RZWA 2OJGA 2R4BA 2HENA 2C4GA 4WNKA 3G0EA 5AX9A 4BKYA 4DINA 2BHEA 1CMKE 2C6IA 3OWKA 2OU7A 3SC1A 4FKQA 3WZKA 4HVSA 2GNFA 4A4LA 3BHYA 4F9AA 4M68A 1W98A 4B6LA 4IHPA 1VEBA 3CJGA 2PVRA 3HMMA 4BWPA 4C2VA 4H3BA 5ANIA 4F6UA 3DCVA 3QLGA 4OT6A 3RAKA 2HZIA 4JBVA 4O4CA 5FUTA 3ML1A 2RSVA 4OUCA 5L8LA 4KD1A 4O0UA 1WBPA 4CFMA 5T3QA 1YXTA 3BLHA 4RWKA 5CU4A 2R3OA 1V0BA 4C57A 3Q4TA 1Y6AA 1YI6A 3LCDA 3PSBA 4RVLA 1HOWA 3EIDA 4I0RA 3HUBA 5HGIA 4BDFA 5M08A 2PMIA 4P5ZA 4XG4A 4GKHA 3MY1A 3R21A 5GZ9A 4J53A 4EI4A 3V5TA 4ENXA 2PY3A 3HA6A 4FKTA 2GS6A 3QZHA 2JD5A 3D5UA 4MAOA 4EBVA 4TYJA 3NZ0A 5EYKA 4E5BA 2IVVA 2ITYA 5JRSA 4EH6A 3TACA 4QMLA 3S95A 3UVQA 3VONA 2FA2A 3SG9A 3HGKA 3I1AA 4N6ZA 2W1ZA 3JPVA 5H2UA 4ZZNA 3MTFA 3P7AA 5DGZA 3OD6X 5DEWA 2I40A 4XBUA 3R1QA 5HO6A 5IEYA 4RQVA 3RKBA 3AOXA 3QFVA 3L9PA 1XHAA 3OEZA 5C26A 5HBEA 2VNWA 1U46A 3IONA 4G6LA 4NTTA 3FEGA 2F7XE 4W9XA 2QD9A 3VW8A 3BLQA 2O63A 3P08A 3EFLA 3BPRA 1FBNA 3KQ7A 3VO3A 4DGNA 1XWSA 3Q52A 3GCPA 4ZLZA 4O22A 3HL7A 3HX4A 4WKQA 2PYWA 4LRJA 2Z7QA 5KHWA 3FLZA 4F7SA 3UQGA 3RVGA 5CXHA 4QQJA 4QTCA 4FKGA 2WKMA 1G8KA 4V0GA 3PUFC 2OJJA 3FMMA 1O9UA 3S4QA 3PA3A 5HIBA 4BBMA 4EH7A 5HU9A 1JWHA 5AR2A 2F57A 2PVHA 4O81A 4XG3A 2VTPA 4A9YA 4ZXTA 2WMTA 3PUPA 3SX9A 4IH8A 4PUZA 2V22A 4F7JA 2CN5A 4MF0A 1HCLA 4ZLOA 4MEDA 1YHSA 2BILB 3EL7A 3R00A 3KULB 4FGBA 4QMPA 3NNUA 4LYNA 1MRYA 3LXKA 1LPUA 4IZYA 5CSPA 1G8SA 5I9WA 2C3JA 1PRYA 2WHBA 4JNWA 4XMOA 4R3RA 4EONA 4AFJA 2UW3A 2X9EA 4NKSA 3KRJA 3DKOA 4NL0A 4IW0A 2YERA 4FKRA 5EM5A 5TOZA 3IO7A 3M2WA 4OW8A 4FSUA 4O7ZA 1Y91A 1Y57A 4CNHA 3CD8A 5IKWA 1BUHA 3QXPA 5F9EA 3Q9WA 3KCKA 3C0GA 4FV9A 3ULIA 1ST4A 4FT9A 4XOYA 1V1KA 5AADA 4E4NA 1OKYA 4EOJA 4KBAA 2RF9A 4AU8A 1CKIA 4UMTA 3ZH8A 4IFCA 5E8UA 3HDNA 3I5NA 3QGYA 2WEIA 4I3ZA 3ZM4A 3FUPA 5J95A 4AXDA 4MQ2A 5I9VA 3DJ6A 2JAMA 3M42A 5G1XA 1YDRE 3AT4A 3IDPA 5AX3A 3AD4A 3FMJA 4NCTA 2BIKB 3A8XA 3ZOSA 2C6KA 3D4QA 4LRKA 3KXHA 3MIAA 5J1WA 1FMOE 4IACA 1YWNA 2EXEA 2WAJA 3NS9A 3BWJA 4RIWB 3LXNA 4C33A 2QKRA 5CAOA 2B9HA 4GFMA 3CSVA 5AP5A 2GQGA 1PMEA 1U54B 5AA9A 4OTPA 3DXPA 2FO0A 3RALA 3TNIA 3ODYX 5L2SA 2FUMA 4IWOA 2WMRA 4N57A 4YGAA 3MVHA 3EHAA 4AT5A 3L8XA 3SOCA 4X3FB 4BCIA 4QNAA 4FTKA 4WNOA 2W7XA 5CAVA 3FXXA 3A7FA 5FEEA 4C58A 4F63A 4LQMA 1W8CA 4ACHA 3F3ZA 3PZHA 3FXWA 4F0GA 5HBJA 1FVTA 3G15A 3PY1A 2ZM3A 4FIGA 5A14A 4RJ3A 3FY0A 3UZPA 3W2SA 1Q41A 3UOHA 2BDJA 5C27A 4DDIA 2DYLA 3U9NA 4PTEA 2BRBA 5LVLA 5CEOA 5HNIX 4M67A 4U45A 4D4SA 1UWHA 4FK3A 4QQ5A 2JEDA 4RVTA 4HVIA 3RWQA 3NNWA 1DI9A 4FEVA 3TV6A 2DQ7X 2NRYA 5CEQA 3DAKA 2QOHA 4YPDA 4PMPA 4GG5A 3NWWA 4OT5A 4D2VA 3TZ8A 5BUJA 3O17A 4C0TA 1KE9A 2WMXA 1GNGA 4B9DA 3PDTA 4DT8A 4EH2A 4O4BB 3ROCA 1M17A 4MXYA 4MD9E 3OT8A 4OLIA 2W4JA 3MH0A 4C3FA 2FSTX 4D9UA 1OPKA 1U59A 3FSKA 1UKIA 4GJ3A 4I20A 2X0GA 5BUEA 3G33A 5JK3A 3V8WA 3OP5A 3HRFA 2CNVA 4BI2A 4CRSA 3LM0A 4O6LA 4RC4A 2PUIA 3W33A 1H28A 2V0DA 3BHHA 2VN9A 3Q32A 3S3IA 5IQDA 2IN6A 4MXZA 3DGKA 3ZC6A 1OZ1A 3NVMB 2QG7A 4RJ7A 2OG8A 2Y7JA 3TUCA 4FKOA 4FGRA 4DBXA 4CRLA 2E9VA 3LFEA 1AGWA 3OWPA 4YLJA 3A7GA 4YZMA 4M15A 1KV2A 4OGRA 2HOGA 4ZSGA 2ONLA 3MW1A 3C0IA 3F69A 3R7YA 3HMIA 3E7VA 3NUPA 2XMYA 2NPQA 1S9JA 2JIUA 3NLBA 4FZ7A 3WIKA 4FT5A 1W82A 2PUPA 5CZHA 5AP6A 4UMPA 4BF2A 3C4FA 4DEBA 2JLDA 4UMRA 4C4EA 3TL8A 4JBOA 3WZDA 2VTAA 3FYKX 2ITZA 3R9RA 1JLUE 2UW8A 3VIDA 3GVUA 4Z7HA 2F4JA 4CT1A 5AMNA 2R0IA 4JRNA 4ERWA 2P4IA 4MBJA 4RFYA 3Q5IA 4J8NA 3W0PA 3LVPA 3RBWA 4BCNA 4TW9A 3KN5A 5KMNA 3COKA 3B8QA 3FAAA 3IW6A 2JIVA 3R22A 4ZTRA 3VUGA 4B8MA 3NNVA 4DHIB 3JVSA 2XYNA 4V04A 1MRUA 2UZVA 4QP2A 5FXRA 4V01A 3FKOA 4J98A 4DTAA 3PJ1A 3ALNA 3C1XA 2PZRA 4FX3A 4IADA 4JAIA 4A7CA 2GDOA 1XJDA 2YACA 2FSLX 3E92A 3MI9A 5AUXA 2JKKA 2CDZA 3KL8A 3FI4A 4FV1A 1T45A 3UIUA 1YKRA 2UW0A 2WELA 5CEMA 4AAYA 1KOBA 3A99A 3HVCA 5H8GA 3C4EA 2QOIA 5D11A 1J91A 1QPDA 5FG8A 4PMTA 3OMVA 2VO7A 2YLFA 3NW7A 4RC3A 5JFXA 3D2IA 3W2PA 2C1AA 3BX5A 3UMWA 3NPCA 4BICA 3DTCA 4JQEA 5BVFA 2PWLA 3DLSA 4YJPA 3QXOA 5ANKA 3GB2A 5B7VA 3AC5A 3VUTA 4R77A 4ZS0A 3QYWA 3DDQA 2YIRA 3NUSA 5KBQA 3UPZA 2UZUE 3OEFX 5AV0A 1YRPA 2E9PA 1JSUA 2HY81 3KC3A 1JKTA 3CP9A 4FV5A 4OTFA 5AM7A 2C69A 3VUMA 2UW4A 2OJ9A 4ZK5A 4AWIA 3KMWA 4X3FC 5A4QA 1H1QA 5DMZA 5FWKK 2HK5A 2QOBA 3GQLA 2X0QA 4G1WA 1NVRA 2GS7A 3IPHA 3QWKA 4J8MA 4X6QC 4FSYA 3FL5A 3DU8A 4XCUA 3E8CA 5CU2A 5GNKA 3ZSHA 4IX6A 3UP2A 3L8SA 2VTMA 3LMIA 5EQPA 4FICA 4CQGA 2EXCX 3AC8A 2W17A 2IW8A 4C2WA 1UU3A 2G15A 2YIXA 3KRLA 5D7AA 4M12A 1F3MC 5E91A 4O7NA 2XK3A 3D83A 4FV4A 3OFMA 4CV9A 2PK9A 3OT3A 2YM6A 1O6YA 4LI5A 1Q4LA 5A3XA 2X4ZA 3TUDA 3V51A 2IWIA 3UODA 4DFXE 4QMYA 5CEPA 3QCXA 2OFUA 3ULZA 2WOTA 4FSZA 2EB3A 3QL8A 4TWCA 5JN2A 3VUHA 4IVAA 5J5TA 3D9VA 1REJA 4AW2A 2BTSA 5EW9A 4OAVB 3CEKA 5K0KA 1JKKA 1IR3A 2GPHA 2UV2A 3QZFA 2BRNA 3EWHA 4O4DA 5I3RA 2H8HA 4AW0A 3IW4A 3RWPA 3BGZA 3AMYA 5CVGA 1ZLTA 4HPUE 3GGFA 4YLLA 3RPVA 2J0IA 2YA9A 1SNUA 3ORXA 4E3CA 1SNXA 4AZTA 1QPEA 5FP5A 2C6MA 3CGFA 4ALWA 4BIBA 4EH8A 4DH8A 1FVVA 2OFVA 2GNIA 4BDKA 4WBOA 3I5ZA 3VUIA 4HYUA 5EG3A 4GEOA 2J0KA 5TKDA 4U97A 4QMTA 4AG8A 3R7IA 2ZAZA 2VTJA 4I0SA 4FSMA 4R1YA 4BC6A 4ZTSA 3F7ZA 3VBQA 4I41A 1I44A 4LGDA 4BCMA 5CSVA 2BRMA 2X39A 2GS2A 3U55A 4AN3A 3BI6A 4XHKB 4ZLYA 4CKRA 3HAMA 3E8EA 4R6VA 4M14A 4XV3A 4CGAA 4L67A 3I0OA 5AP0A 5BQ0A 4QP6A 3NR9A 1YOJA 4G3GA 4PMMA 3AMBA 4MCVA 5KBRA 5M06A 2R3HA 4O0SA 4MF1A 5E1EA 1Z5MA 4D9TA 5HESA 2C3KA 2IVUA 2YAKA 1TQPA 5M4CA 1OL6A 1FOTA 3BCEA 4GT5A 4HYHA 4RWIA 4BCJA 5EI2A 1ZYJA 5K4JA 2JDVA 2XIXA 2WEVA 3MFTA 4M0YA 3LQ5A 4UXQA 2HXQA 2B52A 4MYGA 2J0MB 3ZO4A 4Z7GA 3LKMA 4U8ZA 4M69A 4JIAA 4TXCA 2R3RA 5HO7A 3ATSA 4YJNA 4IJPA 1YWVA 4FKPA 2ITPA 4FTNA 3GC9A 5AR8A 5GZAA 3ZXZA 3MPMA 3DK3A 4J1RA 4KINA 4FV3A 5KKRB 3A4PA 3CQUA 2CCIA 3HMOA 5AV2A 5FTOA 5AFVA 3NUNA 3LXPA 1ZRZA 3GU6A 3BYUA 3D5XA 3TZ9A 4PY1A 2XKDA 4Q5HA 3E88A 4GS6A 2XJ0A 3UPXA 3QD3A 4CFNA 3NAXA 2V62A 3VJOA 3KKVA 3DT1A 3W0OA 5AR3A 2IZSA 3OZ6A 5BVKA 4I6LA 5DH3A 3DAJA 4D28A 5CI7A 3D0EA 3P4KA 4HVHA 3HNGA 5HTIA 3FMDA 4QMUA 4JBPA 4QP1A 4Y5HA 5M56A 2QVSE 2C6TA 3BU3A 1Q8YA 5HCZA 4JIKA 2RFNA 1SMHA 3OBJA 4LGHA 4KIOA 4E8AA 2HCKA 3GBZA 3AGLA 3PFYA 2REIA 3ZS5A 3UDZA 5DOSA 2R3PA 4NUSA 2KULA 5TR6A 5BYZA 2VTHA 5IZFA 3UDSA 3UVPA 2B9IA 4BGHA 3FZ1A 2OXXA 2BDWA 4FKIA 4M13A 4QYYA 4RX9A 3RCJA 4YMJA 5IA1A 1RE8A 2W9ZB 3CC6A 4FVPA 1MRVA 2VO6A 4PNIA 4W8DA 5F1ZA 4P7EA 5KE0A 2RKUA 2WIHA 4AX8A 5K5XA 3SW7A 4JLCA 5CZIA 4ZTNA 3E64A 3ZUTA 4AP7A 4FV0A 3IOKA 3EH9A 5KMJA 4PP9A 4YJQA 4ASXA 2ZDUA 3RMFA 3OF0A 3V04A 5CXZA 3ZFYA 4BB4A 1XBCA 1H1SA 4LV8A 3ZZWA 4WSQA 4O7RA 3LOKA 2HW7A 2OZOA 4YZNA 5GJGA 2C5YA 2WNTA 2WTDA 1GZKA 4LL5A 5HG8A 3SDJA 4DFLA 2IF8A 5CNOA 5AUUA 1SZMA 3R7EA 3E8NA 3A7IA 3EQGA 4CTCA 4QTDA 1B39A 3EYHA 3P9JA 3QZIA 2YM4A 4L8MA 5D10A 5E8SA 3VVHA 4TZRA 4IWDA 3NW5A 4S32A 4XV9A 1P14A 2ERZE 3EKKA 3F5GA 3QALE 4C59A 2Y8OA 5DLSA 5EQEA 2QLQA 4RC2A 4XP3A 4HOKA 4C35A 3TEIA 2OWBA 3DJ5A 4D2RA 4FUXA 2XK4A 4CT2A 2W5AA 4X0MA 5HIDA 3KXZA 2IVTA 3ZUUA 3CJFA 3S1HA 2XNMA 3F5XA 4RSSA 3ALOA 2Y4IB 4DG3E 2CKEA 5I9XA 1Y8GA 3AD5A 3ZLWA 2YM8A 3FC1X 5JFWA 3UE4A 1ZZ2A 5EHLA 1WMKA 2BDFA 4P4CA 5DR9A 5HKMA 5TF9A 2BHHA 5IEXA 3R02A 5KZIA 4GUEA 2YN8A 4CCBA 1Q5KA 4R3CA 5EKNA 2C6EA 4QP9A 5HZNA 3R7VA 1ERKA 3U54A 1JSTA 2ZJWA 4ZTMA 3MFUA 1BI7A 4QP3A 4XV1A 4DFBA 4KBKA 2ITQA 3IW5A 4AGDA 3BBTB 3QRUA 3QQKA 3TV7A 3QTUA 2XNNA 3QRTA 4KS7A 2ZDTA 3GQIA 2P33A 4M84A 3V5LA 2PHKA 2A27A 2VTTA 2W4KA 3FMHA 4QDEA 4AA5A 3NDMA 3PJCA 4G5JA 3LM5A 2GNHA 3C4ZA 4GMYA 4FNZA 4K0YA 5HCYA 1U4DA 3DB6A 2QONA 4JRVA 3O5AA 4F78A 3MFSA 3GC8A 4AOTA 1JVPP 2NP8A