2OZAB

Structure of p38alpha complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
348
structure length
340
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords MAP kinase-activated protein kinase 2
publication title Molecular basis of MAPK-activated protein kinase 2:p38 assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozaB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozaB01
4FZAB 2EXEA 2Y8OA 4M69B 4Q2AA 3FLNC 4EK5A 3I1AA 1WVXA 3CJGA 4FVRA 5IZFA 4BTKA 1MRYA 4MVFA 4K0YA 5E8XA 4R77A 3FMDA 4KA3A 2BFYA 3BBTB 4LRMA 4DFLA 4CMTA 2QHNA 2ITVA 5JFSA 3NIEA 2QO2A 4LGHA 5CVFA 3CPBA 3L8XA 2PZPA 4U3ZA 3ENMA 3EZRA 2CLXA 5FD2A 2Q0NA 1Y57A 1FQ1B 2R3NA 4O6LA 2BFXA 2FO0A 2REIA 3V6RA 5CASA 4G34A 4RLLA 3AMAA 3TZ8A 3ZO1A 5E4HA 1CKIA 2GDOA 4UALA 1XBCA 4D2SA 3V3VA 1YRPA 4R3RA 3LJ2A 3ZBXA 4E7WA 2OF2A 5HLPA 4CFVA 1YXTA 2C3IB 5CZHA 4GKHA 4NCTA 5TO8A 2XJ0A 5KE0A 3P7AA 5LVMA 2CN5A 3R71A 2CN8A 4BL1A 4ZLYA 4IDVA 3HRCA 3MH0A 4L3JA 5AEPA 3C9WA 1Q3DA 4FKVA 3ORPA 1YKRA 3OTUA 3AGMA 4IACA 5HLWA 3UQCA 2B9FA 5IPJA 4N0SA 3PZHA 5CF8A 4XV9A 3DT1A 3R7EA 2GQRA 4QP2A 5CENA 2ZV9A 3MA3A 4QP1A 3Q4TA 4PTGA 2W1IA 3JY0A 5HO6A 5ETAA 1OIRA 3HMIA 4YZNA 4AQCA 4C58A 4OT6A 4S33A 4D2RA 4H39A 5BYZA 2W1GA 3GC8A 1M2RA 1W84A 5JRQA 1YXSA 2A4LA 2A1AB 4A9RA 3BYMA 5C9CA 1Q8TA 5I4NA 3LMGA 5EW8A 3NNVA 4U5JA 1W98A 2F7XE 4KKGA 4HVGA 4YP8A 5H8GA 2EB2A 3LCSA 3T8OA 2JLDA 1YHSA 5EYKA 1G8SA 4AWIA 5LWMA 4Y46A 3BEAA 5TT7A 5JGBA 3GCPA 4BCFA 1OKWA 4TWCA 4ITIA 3UIMA 3WZJA 3G15A 1FGKA 4ACGA 3QTIA 1UKIA 3QALE 4KABA 4EOQA 4NWMA 4MD7E 2WNTA 4IAIA 4PWNA 4I6HA 4YO4A 1SVEA 3OFMA 4J8MA 4KSPA 4DEBA 4F9CA 3V8SA 3R00A 4FODA 3IOPA 2VTMA 4I3ZA 4MHAA 2X7GA 4KAOA 4PPCA 3P86A 3OCGA 4X7QA 4O0SA 2P4IA 4C3PA 2VTSA 5HHWA 3MW1A 4L52A 4BTMA 4EKLA 1ATPE 4D5KA 2FSOX 5EH0A 3ZO2A 2W9ZB 4QQJA 3IONA 2X2MA 1XH7A 2YDIA 3NYOA 5ETIA 5J5SA 3D5VA 3QZGA 1FBNA 3LVPA 4IAFA 3Q9YA 4ACCA 2J0IA 3BKBA 2KULA 2WMSA 4XEYA 3W2RA 4FGRA 3Q4UA 5A3XA 3UP2A 4PV0A 3MPMA 4GYIA 4JR7A 4YMJA 3LHJA 3WF5A 4U80A 2UZLA 5T68A 4R1YA 4F6WA 3ZC6A 3LM0A 3U8WA 3FL5A 1UNLA 3QZFA 4QMXA 4J7BA 1H8FA 2QOQA 2FB8A 3A7JA 3UE4A 2YITA 1QPEA 3G0EA 1E1XA 4G16A 4OAVB 3ALOA 1T45A 5KHXA 3HRFA 4AT4A 4EUUA 1H4LA 3UO6A 5AM6A 2PE2A 2ZVAA 1UU3A 3DJ5A 2CGWA 2OJ9A 5EKOA 4EZ5A 2X7OA 2F2UA 4ANQA 4C4GA 3MFTA 3QTQA 3ERKA 5CU6A 1HCKA 4ZIMA 3PPJA 5DN3A 3ZSGA 4E6QA 2QOLA 1GZ8A 2V7AA 4IANA 4Q5HA 2OH4A 4LGGA 3Q6UA 3LXNA 4W4WA 2NRYA 2R7IA 5DVRA 5BPYA 5AP4A 3TJDA 3ZOSA 3RHKA 1GZOA 5KZ0A 2ITOA 2GQSA 4QYGA 5H2UA 4U81A 2WMAA 4ERKA 3R6XA 1OBGA 3DBCA 3TNPC 3UIXA 3PVBA 2PVFA 2HXLA 5M53A 3F69A 4QMQA 3BWJA 4YLKA 2J5EA 4PMTA 4CSVA 2HZ0A 5K5NA 3NCZA 3O51A 3R28A 5GJDA 3U51A 3MJ2A 5HE1A 4EC8A 3NCGA 3AC5A 4EH4A 5JMSA 5KX8A 3DBFA 3R7GA 5HIDA 1H0VA 3ZBFA 4BN1A 4IBMA 4C34A 3OCTA 4F64A 2CKPA 3VHKA 4G3FA 3VRZA 5CAQA 2JDRA 2QO7A 3U87A 3E88A 3ORNA 5DR2A 4BDEA 5AIRA 5FM3A 5ANEA 3VIDA 1SNXA 4UY9A 5EW3A 4FNZA 1F3MC 3BGQA 3FKLA 4RQKA 3RGFA 3WE4A 1YWVA 4JQ7A 4DEAA 2UVZA 3OMVA 4NYEA 3GQIA 3QTXA 4XG6A 2BHEA 4FSQA 4KKHA 4O0RA 4RJ8A 5J1VA 2BKZA 1B6CB 4I5CA 3QU0A 2JBOA 1I44A 3UJGA 4FE2A 5EI8A 4F99A 5KBRA 4KKEA 3LXPA 2Y6OA 1KE7A 4BI1A 2QG7A 1G3NA 2ITPA 3DBEA 3KQ7A 2UZDA 3GENA 2PZYA 4IAZA 1R1WA 2WGJA 3QQKA 3PLAE 3ZZEA 1OKYA 4RIXA 2F7EE 3I7CA 2C6KA 1LR4A 1XR1A 3CXWA 4QP4A 4UX9A 4JXFA 2HCKA 1YHVA 4BKJA 2WB8A 3MA6A 3UODA 4CG9A 3MYGA 2QU5A 5JZNA 3BHVA 5HG9A 2UZNA 4AS0A 2CKQA 4I0RA 2FA2A 3GUBA 3W2CA 3ZXTA 1YVJA 2GS6A 2G9XA 3CEKA 4P5QA 2JKMA 2G2HA 4XV1A 3ZLWA 4YJTA 5KO1A 4I22A 3FXWA 4XH6A 1OL7A 4D4VA 4RVKA 2KTYA 3LFAA 3R2BA 4FSRA 3I7BA 4GT5A 4H1MA 5JRSA 4CFWA 5EQEA 5FXSA 4L46A 4OTIA 4FTAA 5FQDC 4AZFA 4NM3A 4D2TA 3LLAA 5HGIA 3V01A 1SVHA 4EJNA 5B2MA 3MESA 3RKBA 3U54A 3QCSA 2FSTX 5AR2A 3R8PA 1J3HA 1BI8A 4USFA 2W17A 3R22A 5J7BA 3BV3A 1W0XC 5BVDA 3TUBA 4GV1A 3F66A 5EOLA 2Z7RA 3FWQA 3R1NA 1XHAA 1MQBA 3E87A 1AQ1A 2RIOA 5J79A 2C5VA 3TJCA 5AX3A 5LVNA 5C26A 3O8TA 1OL2A 4RC4A 5DE2A 4E1ZA 3C0IA 4GU6A 4TTHB 3VS7A 3DLZA 4EI4A 1PXOA 2X8EA 1PW2A 4GVAA 3LCOA 4FT5A 2XIKA 2W1DA 4FF8A 3PXYA 3EQFA 4QT1A 4GJ3A 1JKKA 2GTMA 5GNKA 3DFAA 1F0QA 3EZVA 3O8UA 5EW9A 4AE6A 4QYEA 4EOIA 4EONA 2R3MA 1Z9XA 2BAJA 3RPSA 3A4PA 4DGMA 3ORLA 3FDNA 3MVHA 3OC1A 5EYDA 4RJ4A 3E7VA 4HYHA 3MFUA 3LQ8A 3VS1A 2VTHA 5IA4A 4M84A 4OLIA 3P79A 3ROYA 5DMZA 3WYXA 4FK6A 4FKJA 2GNHA 3BYVA 1Q3WA 1OL6A 3E7OA 1Q62A 5ANOA 2WQOA 4ITJA 4GMYA 4NTTA 4BDGA 2Z7SA 4IFGA 4IJ9A 4RWJA 5EFQA 2C3KA 2WZJA 4AN3A 2R3KA 5LMBA 4JQ8A 1H25A 1H08A 4L7SA 4TT7A 2UW4A 3FPQA 4PDSA 3TKHA 3DKGA 5C8NA 3PG1A 4P5ZA 1K3AA 2QCSA 2VWVA 4CLIA 2PUNA 2OO8X 5M07A 2GFSA 2W96B 3AC8A 4RX9A 3F6XA 5AM7A 3CLYA 2B9HA 2CGXA 1QPJA 3O0GA 4F1MA 2EU9A 3VBYA 3MDYA 3KXXA 3OWLA 2RKUA 3Q5IA 4HOKA 3FYKX 2HZNA 2XRWA 3QC9A 4XG7A 4Z9LA 3Q9ZA 4G6LA 4HCVA 4J99A 2VTNA 3MWUA 3QYZA 4K2RA 4UXQA 4WBOA 1GZKA 3WF8A 5DYJA 3CD8A 5BVOA 4I0TA 3UOJA 5J8IA 5EM8A 3ZUUA 4DLJA 4ALVA 4B9DA 5EHYA 4GFMA 2BDWA 2OU7A 4RJ3A 4ASZA 4J52A 4JL9A 1WBTA 3EOCA 2IO6A 4RJ5A 4EHZA 5M4IA 1UU8A 4ORKA 1JSVA 2PVLA 3E8EA 3QWKA 2Z7LA 1OL1A 4GVJA 4XNEA 3QD4A 4XHKB 2YFXA 1ZMVA 4EL9A 1LP4A 1R78A 2CDZA 3SKCA 1HCLA 2IZRA 4APCA 4BDCA 2W4JA 2PL0A 5E8TA 4U9AA 3MB6A 3QLGA 2JDTA 3VRYA 3IW6A 4D2VA 2X1NA 4MQ2A 5DA3A 5AAEA 2WIPA 4QTEA 1JVPP 4IAYA 4AXAA 2OWBA 2G2FA 4TWOA 2OBJA 1H28A 4WA9A 2W1EA 2XRUA 1OPKA 2WD1A 3FMLA 3PWDA 4UBAA 5C4LA 2GS7A 4TPTA 1A06A 4BGHA 3H10A 2PMOX 1V0OA 3Q9XA 3LIJA 4HJOA 4O0WA 3F2AA 4WUAA 4I93A 2QOIA 5EDPA 4UMUA 3UOHA 4IM2A 2QLUA 4CYJA 3PLSA 2W5HA 3G51A 4L44A 2P0CA 3EYHA 5CU4A 2CCIA 3HA6A 4O82A 4X3JA 5AFVA 4Y72A 1BX6A 4ACDA 3KXHA 4QMTA 3B8QA 3HECA 5FXQA 4K9YA 3KMUA 4BCNA 2VV9A 1S9JA 2I0HA 4FV5A 3QD2B 2VWUA 3SDJA 4F7NA 2GHMA 3RMFA 2VWWA 3OW4A 1FGIA 3AT2A 1O9UA 4I24A 4KS8A 3CTHA 4ZSGA 4AG8A 3F5PA 4BY9E 4EQMA 3F5GA 3C5UA 1GNGA 3L9NA 1FOTA 4I41A 4QMSA 5HG5A 3RZFA 4PL3A 1TQPA 4AOIA 4L6QA 4NIFB 4V0GA 5DT4A 4UMQA 1Q8WA 4YBJA 4EZ3A 5EQPA 4AGCA 2R3RA 3RWQA 4YLLA 3C4WA 2CNUA 5HTIA 2CSNA 2WPAA 3W33A 4K11A 3DKFA 3D7TA 4F9YA 5I3RA 4AGWA 2FSLX 3E63A 3KK9A 5AUTA 5I9XA 4A06A 3HV7A 3W8QA 5GZAA 2O2UA 4G9CA 3VS3A 5A46A 2O0UA 4GU9A 2HY0A 3OY1A 4IM0A 5CSVA 4O21A 3ZONA 4XLVA 3ORMA 3GFEA 2UVYA 3FHIA 4DGNA 5KNJA 1DM2A 3FC1X 3FMEA 4QP7A 4BFMA 4FZ6A 1MP8A 3F3TA 1NY3A 2PMNX 3DCVA 2YEXA 5CF6A 3BQCA 5AP3A 4LYNA 2RFNA 4IB3A 1ZYJA 2VO3A 3VUKA 2ZYBA 4KIKB 4BDKA 2XF0A 2IVSA 2PULA 4ZJJA 4B8LA 2BPMA 4G31A 4QTBA 1UWHA 3EN4A 3ZDIA 3HZTA 4GIIA 4XP0A 5J7HA 5J9LA 4DG0E 5LOHA 3T3VA 3II5A 3OCBA 3EYGA 3ZLSA 3NZ0A 4IZ7A 3FMNA 4I6BA 2PK9A 4GK4A 4HGEA 4GT4A 4N6ZA 4APPA 3QGYA 4L7FA 3OXTA 3PSCA 2XKFA 1FVTA 3PP0A 4FA2A 4RQVA 4PTEA 4XLIA 3EQGA 3M1SA 4KIPA 1WBWA 3UC3A 4C3FA 4W9XA 5M44A 4O7LA 5C27A 4FOBA 2B55A 3VQHA 5CY3A 2ITTA 3C0GA 3D4QA 4FI1A 3FZTA 4CGAA 2XM9A 4MNFA 2G2IA 5C1QB 2V5QA 3HL7A 4CNHA 5DR6A 4JBOA 3AD4A 3KXNA 4RWLA 4IVBA 4U40A 4NFMA 4QQCA 1RQQA 1YI4A 5CXHA 4Z7GA 4RIYA 3CTJA 3ODYX 3ZM9A 2I0VA 3SW4A 4YUQA 3HNGA 2E9OA 3ENHA 4KBAA 3UQFA 3QRJA 4AAAA 5FTGA 4CT2A 3AQVA 4QNYA 5IMXA 1OPLA 3UMXA 3DJ7A 5M57A 2BTRA 3PWYA 1URCA 4NFNA 3MTFA 3U55A 4M13A 4EYJA 4J95A 3NSZA 2R0IA 2XIZA 3VWAA 3ITZA 3FV8A 2WQEA 4PP9A 5HBEA 3SAYA 5FP6A 3W8LA 2C47A 4JT3A 4O0UA 4EH5A 1CM8A 2ONLA 3GP0A 2RL5A 2FUMA 4A9UA 3G2FA 3R9RA 3I6WA 4N4SA 2B0QA 3QX2A 3VAPA 3R1QA 4NEUA 2W99B 4ZLOA 2BDJA 2VTAA 5IQHA 5ANKA 1PF8A 4UWYA 3OG7A 5CEPA 4PPAA 3PPKA 5IQEA 1OIUA 3Q5ZA 1AGWA 4P2KA 4GIHA 3SQQA 1ZMWA 2FYSA 3IQ7A 4ASXA 4CZUA 1WFCA 2OK1A 1YWNA 1AD5A 2GS2A 5C8MA 1JKLA 1XJDA 2OZOA 3POZA 4X6RA 2HELA 3UVQA 5LCJA 4UWBA 3Q9WA 1JQHA 2ZM1A 4R5YA 5AP7A 2CKEA 4L3LA 3GC9A 3TL8A 4ANNA 5AAFA 4BKZA 3DKCA 3A7IA 3BBWA 3H9OA 4FEWA 5J95A 4DCAA 1P14A 2ZM4A 2A19B 3LCDA 3ORTA 4M8TA 4U6RA 5BX0A 5EG3A 3HMMA 4F09A 4PMSA 4IAKA 1OBDA 3R30A 5IH4A 2LAVA 2UW6A 4Y5QA 3F5XA 2XKDA 1VYZA 4TRLA 3ZLXA 3A99A 3EWHA 4DFBA 2W06A 3GU6A 2BCJA 4ZSLA 5HNGA 2UZBA 4NW6A 4QTDA 4AA5A 4BRXA 3PTGA 2A0CX 4OTFA 5AR4A 3T3UA 4YURA 4MCVA 1W82A 5DH3A 2ZV7A 5FP5A 4LGDA 3NVKI 3DBQA 4DGOA 2ITXA 4JVGA 3KCKA 2X9EA 3MIAA 3D2IA 3FMJA 4BCQA 3JPVA 2PPQA 4GKIA 3ATSA 4FTRA 5HNIX 2YM5A 3PVWA 5DBXA 4PMPA 2OKRA 3ZH8A 5TE0A 2VO7A 3HV3A 4FTMA 4QYHA 5AUVA 3RM7A 2XNNA 3UP7A 3TZMA 4A9SA 4E5BA 5HI2A 4Z3VA 2WEVA 3LE6A 4C62A 4AZTA 3FZPA 4KNBA 2YCRA 4TYHA 4DYMA 4C3RA 5HX6A 1JPAA 2FGIA 4CMUA 2QNJA 2QONA 4O7SA 4F70A 1W83A 3RP9A 4NW5A 4ASDA 4R3CA 2XK6A 4MBLA 4U79A 2IG7A 3H0YA 3I0OA 3I5ZA 4GCJA 5CT7A 1NT2A 4WBBB 4FG9A 4GFGA 4ANOA 5I9ZA 1PXNA 1B39A 3QTUA 2YAKA 4FOCA 5AR8A 3V8TA 3F82A 3C7QA 2Q83A 3FY0A 5L2SA 2H34A 2WXVA 5CTPA 4X2KA 3CTQA 3OHTA 1Q24A 2ZM3A 2GFCA 3FSKA 5H9BA 5L3AA 2BIYA 3IECA 2ETRA 1CKPA 2F49A 1YI6A 3QRTA 4R6VA 4H36A 4XX9A 1GJOA 2B1PA 4D28A 3R0TA 3R9OA 4Q9ZA 1WVYA 4XCUA 2OFUA 2ZJWA 4B4LA 5K4JA 3NRMA 3R73A 4RIOA 4FV2A 2VX0A 4GYGA 4ANLA 5T6KA 3PSDA 2UZOA 3I4BA 4YJNA 1OMWA 1BLXA 3FYJX 5M4CA 1P4FA 4RA4A 2YIXA 3V5TA 3ZS5A 4QYYA 2CMWA 2WMRA 1XBAA 3GB2A 4R78A 4EOJA 3ZO3A 4EQUA 2PUIA 1Z57A 2F4JA 3EFKA 5HE3A 4JBQA 1SZMA 4GFOA 5IA3A 4PDYA 3H3CA 1TQMA 4JDJA 4LI5A 3ZMMA 4L00A 2HIWA 4MNEA 1G8AA 2B52A 2RFEA 4FUYA 3TIZA 3UYTA 2W4OA 4YPDA 3IDCA 2OXXA 1MRVA 4FT7A 2XJ1A 4CQEA 3OUKA 4RA5A 4RVLA 4UMPA 1DI9A 3P7BA 3UNJA 3Q53A 3PA3A 3UVPA 2PZIA 4R1VA 4CKIA 3QTZA 5HTBA 3SG9A 4KIQA 2UW8A 3GOKA 5E8WA 3VC4A 3ZTXA 4BC6A 2YM4A 2OFVA 2QG5A 4EH7A 3R7IA 4AGUA 3AD6A 4ZP5A 4LUEA 3F5UA 2PZRA 4M0ZA 4C4FA 4KBCA 2JEDA 4AF3A 5IDNA 4RSSA 1HOWA 2BZHB 5DHJA 5DOSA 5M55A 4NM7A 3C0HA 4AT5A 2UW0A 4FSWA 4GS6A 1J7LA 4LL0A 5E8SA 4Z16A 3SVVA 3LOKA 2HXQA 4D58A 4XRJA 4EKKA 4EOOA 4QMZA 3KN5A 3RHXA 4L45A 2OZAB 4EOLA 4I4EA 1IA9A 2PUUA 4JX7A 1BUHA 2C6MA 3AGLA 2WHBA 3QCYA 4FSNA 4AFEA 4V0GB 4ZK5A 4Y85A 5DRBA 3NDMA 4A9YA 4UWCA 4IWDA 2GCDA 4G9RA 3VJNA 4BIDA 3QTWA 4MD8E 4QP9A 4EH3A 4W4XA 3EQHA 3F88A 5JN2A 3DBDA 1J1BA 1LUFA 3I81A 3IS5A 4LM5A 3L9MA 4RMZA 3QHRA 3BGZA 5HZNA 5H8EA 3KULB 2C6LA 3NYXA 5CEOA 2E9VA 4DFYA 5IQDA 2ITZA 2WELA 4MF1A 2PWLA 1W8CA 2IJMA 4MBIA 4NM5A 4RWIA 1PXMA 3SXSA 5L8KA 5L8LA 5FG8A 1YQJA 2OIBA 4QTCA 2CJMA 2Y0AA 3DXQA 4O7ZA 5AUXA 1IAJA 3BYOA 3VUHA 4EHEA 4YLJA 2HZ4A 3QA8A 4TWNA 4MWHA 5L2IA 4MX9A 4IZ5A 5CAUA 4C57A 3MFSA 3N9XA 5A9UA 3P23A 3NLBA 4CTCA 3C1XA 4FSTA 4BDJA 4RBLA 2BILB 2OI4X 2OGVA 5AJQA 2XYUA 3TKUA 3JR1A 2RF9A 2DS1A 3S0OA 3ANRA 3U6IA 2H8HA 5CT0A 1Q97A 3U4UA 1PRYA 3RM6A 2XEYA 5CQUA 3BHYA 3MPTA 2XBAA 3RNIA 3UZPA 4YTCA 1U5QA 1LPUA 1H01A 4ACHA 4NT4A 3WARA 4C4EA 3DLSA 3L1SA 3KF7A 4IE9A 5EM5A 4E6AA 3HRBA 2XIRA 4BZNA 1O6KA 3BQRA 3HA8A 2X8DA 4MQ1A 2VWYA 3PXZA 3DY7A 4YJPA 3BI6A 3WOWA 4D5HA 5J1WA 1UNHA 2QI8A 5CF4A 4A7CA 3PRFA 3HUCA 4ID7A 4L67A 5LMKC 1YOLA 2C1AA 5EDQA 4KINA 5M51A 4F7LA 3DTCA 4XBUA 2OW3A 3SHEA 4FTLA 3UNZA 1UKHA 2IVVA 3U6HA 4BHZA 2O3PA 3KC3A 1V0PA 2VTRA 3EFLA 1OB3A 1H24A 3SLSA 4HGTA 4IEBA 3D7ZA 4ALUA 2SRCA 3PVUA 2QR8A 2J4ZA 3VS6A 5J87A 1YDRE 2BRMA 3IG7A 2VWZA 2HW7A 1PXPA 1TKIA 4UYNA 4UB7A 5BVFA 5FDPA 4DINA 1I09A 1H1RA 3FXZA 3OOGA 3VBQA 5CANA 3PYYA 3P0MA 3KF4A 1U54A 3PUPA 3EQCA 4RRVA 3F3ZA 3V8WA 4JDIA 3TNWA 4FNXA 4FSUA 5F4NA 4ZTLA 5AV3A 3LPBA 3V6SA 2PE0A 3ZFXA 2HENA 5HG7A 4DH3A 5IH5A 2YM6A 2P2IA 4GG7A 1ND4A 2FSMX 3LXLA 3TT0A 4QRCA 4FIJA 4J97A 4UZDA 3NUYA 3FMHA 5E90A 1BMKA 4TY1A 5HBJA 4TYIA 2YJRA 3SRVB 2BDFA 4WKQA 4UMRA 4S30A 3DK7A 1QL6A 1YOJA 2W05A 2EB3A 4YZCA 4FV3A 5D1JA 3DQWA 2X2KA 4FYNA 3TZ7A 4DFNA 4ZJIA 2YDJA 4P4CA 4XG4A 4BTFA 3VF8A 3FKNA 1S9IA 2GTNA 3MY5A 2Z8CA 3NYNA 4DA5A 3OP5A 1H0WA 3D9VA 3QZIA 4WD5A 5IEVA 4FC0A 3PY3A 5BMMA 4G6OA 4AOTA 2CGUA 4FT9A 4FZFB 3W18A 5FDXA 3PA4A 4WNKA 2I1MA 1IAHA 1UU7A 3R04A 3FY2A 1NVRA 4FV0A 4O7RA 2O65A 3M2WA 5L6WL 2VNWA 3V04A 4XP2A 3FLQA 5ANIA 4AW1A 3HP2A 4JLCA 5CAOA 2NP8A 5KMJA 4YSJA 1V1KA 4ZS4A 3ZSIA 4G3EA 2BKKA 4O38A 4OTQA 4TL0A 3P4KA 3TTJA 4CVAA 4ZS0A 2R3FA 3OUNB 1ZAOA 4WIHA 4JNWA 3TDWA 4B8MA 5CNNA 3HV5A 3TTIA 1OUKA 3WBLA 1UNGA 3LFSA 3LFFA 1NA7A 4IWOA 4IM3A 2W5BA 1VYWA 4B99A 4FV7A 3F3WA 4D2PA 5CEMA 1BYGA 3ROCA 3CJFA 3ZFMA 5BNJA 4NZWB 4FKSA 3TZ9A 5E9EA 1H26A 4RX5A 4AW0A 5CF5A 2YLEA 4KS7A 3CE3A 4H3BA 4FX3A 4W9WA 4OBOA 3NNWA 2P2HA 4S31A 4F0GA 4MBJA 3RTPA 2XP2A 3FSFA 2WMBA 3CIKA 1ZYDA 2ACXA 2YWPA 2V55A 4M3QA 2Y7JA 3R21A 4YZ9A 3PDTA 3DS6A 3TI1A 3GCVA 3BLHA 3HEGA 4HVHA 2Q0BA 3KL8A 2YM8A 2BRGA 4FSMA 4KWPA 1OUYA 4RJ6A 4JAJA 5HIEA 3LJ0A 4TWPA 3KRRA 4X3FA 5GJFA 2ERKA 2HW6A 2YISA 4QTAA 4RFYA 4RVMA 3W2PA 3ZUVA 3MBLA 3O71A 3OEFX 4RIWA 3VS2A 4ZTMA 3KRWA 4WUNA 4IB0A 4M97A 4IIRA 4DBNA 2C3LA 1E1VA 3LJ1A 4QP3A 4FL3A 1WBSA 2VNYA 2XKCA 4O86A 4AZEA 4IMYA 4QP8A 5AA9A 4USEA 4M67A 2CKOA 3I79A 1PXIA 2IW9A 4QMNA 2JFLA 3R8UA 1XH6A 4FSZA 3A62A 4L53A 3UVRA 4BR3A 3DXNA 3ZU7A 1XWSA 2JIVA 3AC3A 2OF4A 3VS4A 2C68A 5T3QA 4YHJA 4NJ3A 5K0KA 4F0IA 4NU1A 1XKKA 5DEWA 2W1FA 4F7SA 5M09A 3D5XA 4X6QC 2XNGA 1SNUA 1M52A 3PZEA 2RFDA 4O7VA 2J5FA 3G9LX 1JKTA 2YM3A 4YO6A 1SMHA 2OXDA 4UZHA 4CQGA 4I0SA 5B0XA 3G9NA 1T46A 3R01A 3FKOA 2WQMA 3QAME 4GH2A 2ETKA 3O23A 3NEWA 2I0YA 4UXLA 3UOLA 4O0VA 4O81A 3SG8A 3NS9A 4WNMA 3EQBA 2BRNA 1Y8YA 5ANDA 4FKUA 3RAKA 2PU8A 4JR3A 3C4XA 4J98A 5FTOA 4U7ZA 3U4WA 5FGKA 2JDSA 3N4VA 4IX4A 4OGRA 3QL8A 3TCPA 4CKJA 5IQBA 2WMVA 2R0UA 3GT8A 3GCSA 4F63A 4RWKA 1H00A 4S32A 4EORA 5KHWA 5AV0A 4DT8A 3ZM4A 4E4NA 3LLTA 4FIEA 4M14A 4E4XA 3GOPA 3F3VA 4DEDA 3UO5A 4U0IA 3NUXA 4A9TA 2HWPA 5EYMA 4PPBA 4U97A 3QQLA 3ZO4A 1VR2A 2R3IA 3CQUA 4N6YA 1CKJA 3H30A 3CQWA 2NO3A 2A27A 2WOTA 3LCKA 2VX3A 4NK9A 3QYWA 5CI7A 3LFBA 3DNEA 3RPVA 1Q8YA 3VN9A 1OIYA 3R1YA 5LMAA 3OEZA 4CV8A 2GSFA 2NRUA 4RZVA 3ODZX 4M12A 5IEXA 2J7TA 3TEIA 3TNQB 3P78A 2W9FB 3LFNA 3KFAA 2BZKB 2XNMA 4PDOA 3WZKA 4PQNA 3C13A 2QKWB 1ZY5A 4EBVA 3QX4A 4HGSA 5E8VA 5IQAA 4IB1A 4D1XA 3DTWA 1FINA 3IW8A 1URWA 3EN6A 3QD0A 3TV4A 4N57A 2PVNA 3VHEA 4ZEGA 5HESA 3SX9A 3LFEA 3LXKA 3MH1A 2ZMDA 2IZTA 3PXRA 1PYEA 2H6DA 3G6GA 4C4JA 4XG8A 2X6DA 4WNPA 4DH1A 4BYJA 5AV1A 2BTSA 5FM2A 2VN9A 2YIYA 3TKIA 3N4UA 3HGKA 5AMNA 3UYSA 2X4FA 4XOZA 3W2OA 3ZEWA 2XIYA 3OY3A 4ZMFA 3M42A 3QXOA 4I94A 3RPRA 4DFZE 4L43A 4HPTE 2IWIA 5FEEA 4NCTC 4HYIA 2JC6A 4DAWA 5IUHA 4YNEA 3COIA 5E7RA 4PDPA 3O50A 1ZOGA 5IA0A 4GL9A 2C0IA 2YCSA 4NTSA 2PVHA 3PY0A 1REKA 2W0JA 2F2CB 1WBPA 2BUJA 2GNGA 4WNOA 4BBMA 5HIBA 4I6QA 3E62A 4MXAA 3U6JA 2G1TA 2IW6A 3QXPA 4FKOA 4QP6A 4ZMEA 4HNFA 4O6EA 3FMMA 5HE2A 1VEBA 4CEGA 3BE2A 1JOWB 3KRJA 4EK4A 1A9UA 3OXIA 4IVAA 3WIKA 3JUHA 2R3PA 3H0ZA 5FLFA 2CHLA 5AA8A 3GQLA 1XH4A 4ZXTA 2WTWA 4Y83A 5BVNA 5IF1A 2XUUA 3VUDA 2CLQA 1IRKA 4JBPA 4BGGA 1CSNA 3OZ6A 4RVTA 3NMUF 2WMUA 1BKXA 4D9UA 5CYIA 3ZRLA 5LVPA 3NNUA 3ZYAA 2C6OA 3GI3A 3DV3A 3LZBA 3BHTA 4CYIA 3WE8A 1M2QA 2JKKA 3A2CA 3AOXA 2JKQA 4FEQA 4FKIA 4RJ7A 4WG4A 2WKMA 4QD6A 3UG2A 3UMWA 4LOPA 3S1HA 5AR5A 4NJDA 3VVHA 1M7QA 1PMUA 3MSSA 3DK6A 3WYYA 4BCIA 5CXZA 4E93A 5D7VA 3DDPA 3BPRA 4HNIA 4XG2A 4IDTA 2R4BA 4O1PA 5AADA 5ANJA 4BDFA 3L8SA 4CTBA 5JQ5A 1M14A 1KE5A 2C30A 2QOBA 1EH4A 4FNWA 2WMTA 3S3IA 1ZYLA 4D4YA 4F9AA 4DBXA 3KREA 4MTAA 4JI9A 1Q61A 5GJGA 4YTHA 3AD5A 2YWVA 3D15A 3A8XA 4NKAA 2QLQA 4H58A 4F0FA 1OGUA 4EYMA 2VGOA 3GCUA 5D9HA 3VNTA 2IVUA 4TNBA 4U42A 4TKSA 3EFJA 5I9UA 1GOLA 2BVAA 4ZAUA 3FI8A 4YTFA 3SV0A 3E8CA 3FZ1A 3IW5A 3R83A 4O0YA 5JT2A 1SYKA 5L2TA 3QQHA 3TN8A 4F6SA 4PNIA 3TM0A 1J7IA 2IVTA 5KCVA 1OM1A 4K33A 1IG1A 5HE0A 2GNIA 3F7ZA 3DB8A 3D2KA 5M56A 3LMHA 4PL4A 3IO7A 2C5YA 3EFWA 4O2ZA 3VBVA 4DTKA 2DYLA 4I4FA 2ZV8A 4JQEA 1XBBA 3NWWA 3OBGA 3PJ3A 2OJJA 3MFRA 3RINA 3QZHA 3TNHA 3P9JA 2YACA 2OG8A 3K2LA 4W8EA 5CQWA 5BVKA 3E93A 3R8VA 3ZCLA 4PUZA 2C3JA 2PVMA 1WBNA 3MY0A 4J1RA 2WTIA 4IXPA 3GBZA 5DG5A 2XB7A 3GGFA 5EYCA 3VS5A 1Y6BA 3SGCA 1PMNA 2VAGA 2X81A 5DPVA 3KMMA 3VBTA 4AGDA 2F7ZE 2YABA 4QMOA 2WTVA 4EEVA 4BDDA 4OW8A 4CFXA 4QPSA 5FRIA 4FIGA 3N51A 3RAIA 2C69A 3HP5A 2XBJA 5M4FA 5FWKK 4YC6A 4IX5A 3DNDA 5BUEA 1JSUA 4GRBA 1O6LA 4BZDA 3PJ8A 4OTRA 5HU3A 2EUFB 3DDQA 4BWPA 5AUWA 4JDHA 4G5PA 3FI4A 2Y4IB 3R8LA 5DRDA 4MXZA 2XA4A 3DAKA 5D11A 4DH7A 1ZXEA 1L3RE 3EMGA 3HMPA 2B9JA 3F2NA 5EK7A 1XO2B 3D83A 5AX9A 4C33A 4E20A 3CGOA 2YJSA 1PYXA 2EXMA 2JITA 1PY5A 2XCHA 3PJCA 3S4QA 4EOMA 4RIXB 4AZWA 3W2QA 1O6YA 3UPZA 3MPAA 3Q2JA 2QURA 4MXXA 4C37A 3TNIA 5HOAA 4FTCA 2OJIA 4U3YA 4BDBA 3UZRA 4IJPA 5HX8A 3DK3A 1OPJA 3A7FA 4U44A 5E92A 4Z55A 2J2IB 2RFSA 2ITUA 3GC0A 4C59A 3ALNA 3GVUA 3JS2A 4X3FB 5CU0A 1Y6AA 4S34A 2XM8A 4ZTSA 5KMNA 3O7LB 4FL1A 2XJ2A 1GZNA 4JG7A 4I5HA 4RIWB 5DWRA 3VUTA 2YN8A 3MVMA 3HUBA 3FC2A 4LOOA 4LV5A 2E9UA 5HD7A 3L8PA 4FTKA 3QCXA 5AP5A 4FZDB 4YJRA 3WF6A 3WILA 3FEGA 4IW0A 2R2PA 3G5DA 2V7OA 4E5AX 2WU6A 4HYUA 4ZZMA 3FAAA 5ACBC 1U5RA 3M11A 2VO6A 5AP0A 3E5AA 4E6DA 1ZOEA 5GZ9A 2XZSA 3K5VA 4QNAA 4M0YA 5FTQA 1ZARA 2YCQA 2I6LA 5AP6A 1P2AA 1YXUA 3ETAA 2W1CA 2VWBA 1CDKA 1YXVA 3F9NA 3OW3A 2ITNA 4GK2A 4IQ6A 3RZBA 4C7TA 1JAMA 4W4VA 5EI6A 3MB7A 5L2WA 3NVMB 4V05A 1P5EA 5L6OA 3QQFA 3CBLA 3G33A 3HVCA 4FTNA 1KOBA 3B8RA 5ITAA 5FUTA 5D7AA 4B0GA 4TN6A 4IX3A 5A54A 1R0PA 3E3BX 3W1FA 4FGBA 3SW7A 2JIUA 3V5QA 2WFYA 4YZBA 2IN6A 3HYHA 4II5A 1RE8A 3W2SA 4CRSA 4R7BA 5H8BA 4DT9A 3U9CA 2HK5A 3KY2A 5JEBA 2XMYA 4D1ZA 5CAPA 1YOMA 3AT4A 5ETFA 1J7UA 4YR8A 1XH5A 4JX3A 4EH9A 5A4QA 5BQ0A 1H1PA 3C5IA 1H27A 1WVWA 4YHTA 3QKLA 4JRVA 4RGJA 4E5WA 2XNEA 3BHUA 5ANGA 4WSQA 4ZY6A 3OROA 5JH6A 5DT3A 1UU9A 4BHNA 5L2QA 5JFWA 1ZRZA 3A60A 2C1BA 3QTSA 4FIHA 3AMYA 4CCBA 2R3QA 3Q96A 3D14A 3ZSHA 3V5WA 4XMOA 2OH0E 1J1CA 1MUOA 3TV7A 1APME 3C4ZA 3LAUA 4FTIA 4H1JA 4BZOA 4ZTRA 1A48A 1JLUE 3AMBA 1VJYA 3DA6A 4Q5EA 1ZOHA 4EWHA 5IA1A 5JQ8A 5KKRB 2WMXA 3VO3A 3P08A 1UV5A 5F20A 5AWMA 5CEIA 4IADA 2PMLX 3JVSA 3BCEA 4F6UA 2AYPA 5GIPE 3VULA 5KMIA 5E91A 4ALWA 1JNKA 4IFCA 4YGAA 3SOCA 4IVCA 4EK3A 4YNOA 3OBJA 2XH5A 2GHLA 4FL2A 3SD0A 3L9PA 4OTPA 4RZWA 4YZDA 3MH3A 5HEZA 1PMEA 1YXXA 3V51A 4A4LA 3EKNA 4CFMA 3RK7A 4LUDA 3H9RA 1OZ1A 5A4TA 3P5KA 4G3CA 2F57A 1RW8A 2R3LA 3NR9A 2BALA 3OWKA 4CV9A 3FQEA 4LG4A 1PXLA 1UVRA 4HCUA 4BF2A 1UWJA 4ZTHA 1NXKA 3CP9A 3PA5A 3RJCA 3ACJA 4IZAA 2A2AA 2BRBA 5JFVA 4RG0A 2PVRA 3BIZA 4FTOA 4WOVA 5FBNC 4CMOA 4DEHA 3DQXA 2XNPA 3GFWA 2BROA 3UTOA 4BCPA 4BI2A 3MIYA 3RPYA 2J50A 3EHAA 1CTPE 3BZ3A 2OIDA 4RC3A 3C4EA 1GIJA 4GW8A 3EN7A 3ATTA 4AW5A 4BCKA 4AN9A 4G2FA 1XH8A 5JGDA 4N70A 1PJKA 4RFMA 5ACKA 1YW2A 2QKRA 5AR7A 4OBQA 2PVJA 5F95A 3R9NA 4R3PA 5JGAA 2VX1A 3B2WA 3K5UA 4J8NA 3PP1A 2YERA 3R8ZA 4IZYA 2OIQA 2RG5A 2BZJA 3G6HA 4IX6A 3NAXA 1H1QA 4I5PA 4LFIA 4DEIA 4OTWA 2BAKA 2VUWA 5H3QA 2VWIA 2J0KA 5TKDA 5IEYA 2J9MA 3ET7A 4JIKA 3UPXA 2ZDUA 4XBRA 4CFFA 4TYEA 4EHVA 5CX9A 3C51A 1PXJA 3G90X 4BWXA 2X6EA 4OBPA 2QD9A 4QMUA 5EM6A 1U46A 3NUUA 4IC7A 3FZOA 4D9TA 2OLCA 4G1WA 4U43A 2JFMA 2PVKA 2C0TA 3EL8A 2ERZE 5HVYA 3Q6WA 3CQEA 3QWJA 3D7TB 3COHA 5D10A 4AUAA 2X2LA 4K1BA 2EWAA 3VBWA 2VZ6A 4C4IA 3NUPA 5DGZA 1V0BA 3FLZA 2XK9A 1DI8A 4GUBA 1TQIA 2PZ5A 4ZTQA 4FYOA 4DITA 3MVJA 3ZFYA 2IPXA 4FG8A 4EJ7A 1KE9A 2PVYA 4G3DA 4K6ZA 2HOGA 3DU8A 4FKTA 5IQIA 1REJA 1ZYSA 3NUAA 3CKWA 4BCMA 2XIXA 3D0EA 3O2MA 2P55A 1XQZA 5CU3A 4MXOA 3OS3A 3GCQA 5M4UA 1OECA 3KCFA 4DGLC 2WQNA 5A6OA 5E8UA 3ULIA 2VD5A 3OWJA 5BVWA 1WBOA 2C4GA 3KEXA 4NKSA 3TWJA 2RGPA 4XG9A 5CS6A 2VTLA 5HG8A 3UDBA 2YZLA 5FEQA 5DLSA 1KV2A 5KBQA 4BI0A 4HZSA 3H4JA 3FPMA 3RPOA 4FSYA 3MGYA 2J0LA 1Q41A 3FBVA 3NPCA 3AT3A 5KUPA 3FQSA 1WMKA 3KXGA 1Q5KA 4ERWA 3FXXA 5GINE 3GU4A 2XNBA 4IWQA 1PMVA 3GU8A 2UZTA 2YLFA 3FLSA 5IQGA 4XJ0A 2G15A 4RX8A 2XKEA 4BDIA 1UA2A 2B54A 3NGAA 2Y4PA 4EK6A 4L8MA 3UGCA 3VUMA 5IISA 4C35A 4FEXA 3WZEA 2R3GA 3IW4A 3PSBA 4ZTNA 3R7VA 2UW9A 5K4IA 3ORIA 4FKQA 4L9IA 4EHGA 3BLRA 3CPCA 1WZYA 5AIKA 4OTGA 3TXOA 5CALA 2VTOA 1QMZA 2ESMA 3EB0A 3IDBA 4O22A 2ZDTA 4ACMA 5M08A 2PHKA 5CSWA 4CD0A 3JY9A 4KRDA 3HDMA 4IC8A 4I20A 4OAUC 3F2RA 4DGGA 5B2KA 3IPHA 4BBFA 4XP3A 4FV9A 4NIFA 5I9VA 1OIQA 4RIYB 1H07A 3RK5A 3QQJA 3A7GA 4OT5A 4E73A 3FI3A 3GXLA 4W8DA 1KE8A 3IK3A 4L68A 5BMSA 1H1SA 3LQ5A 5K9IA 3DB6A 4BYIA 3WZUA 4L42A 1WCCA 2ZOQA 4QMYA 4DEGA 2CNQA 4I92A 5GIOE 4YBKA 3MI9A 5KMLA 3BELA 4ZSJA 3MH2A 4RPVA 3UG1A 4FEUA 3KRLA 1NVSA 5DNRA 3W16A 4MF0A 4O83A 2F9GA 3DGKA 3AXWA 3R7YA 3RBWA 4EZ7A 3PIXA 3W32A 2JAMA 1GIIA 4QMMA 4Z7HA 4NM0A 2BAQA 4E4LA 5I9YA 4U8ZA 4UN0C 2XK3A 4V04A 5JFXA 4AP7A 3QHWA 4JIAA 3Q60A 3VUGA 5GZ8A 1OKVA 5IDPA 4KIOA 3VUIA 2R3JA 1FVRA 2WTKB 5CAVA 3CR0A 3HMNA 5IU2A 4K18A 4KIKA 2Z60A 4MXCA 5HCZA 5LARA 2ITYA 5TOZA 2GU8A 3S95A 4EC9A 5JKGA 4ZY5A 3MJ1A 4MH7A 2CNVA 3RK9A 3PY1A 4AN2A 4BGQA 3OVVA 2BIKB 1H1WA 1X8BA 4Y5HA 4FKRA 3SXFA 3TG1A 4ZJVA 4MKCA 5C4KA 3BLQA 1M7NA 4CLJA 3ZRMA 4CKRA 4YC8A 4BBEA 5JK3A 4C2VA 2R5TA 1U4DA 3MVLA 4YJVA 2ONLC 3R7OA 4BB4A 5LVLA 4MEDA 5CSXA 3IGOA 3LFDA 5CVHA 3PVGA 4P7EA 3ORZA 1QPCA 3RCJA 2E9PA 2JGZA 4MAOA 3QCQA 2VTJA 2W4KA 2WEIA 3D5UA 3FI2A 5EHOA 4CFUA 5HO7A 1OITA 3QUEA 1W7HA 4FUXA 3VQUA 5AUUA 4G3GA 4BKYA 2WTKC 4YZMA 1MRUA 4ZSEA 4C8BA 1GAGA 2Y6MA 3BRBA 4I6FA 4DFUA 5IQFA 2WOUA 4OTDA 5AUZA 1WAKA 4H3PA 4PNKA 4ANSA 1GY3A 4O27B 4J96A 3KRXA 4TW9A 2YIQA 3BU3A 4PF4A 3BHHA 1M17A 3L9LA 4MD9E 5BVEA 4KUJA 3E8DA 3UIUA 3KMWA 1K2PA 4AACA 5A14A 4MWIA 3AG9A 2C5NA 4G5JA 4CRLA 2JIIA 2WIHA 4TYGA 4AX8A 3HMOA 2AC5A 1G5SA 4XS2A 3EQPA 2WO6A 4R8QA 5JZJA 5HNBA 2UW5A 2B53A 3Q4ZA 2V22A 2CCHA 3GNIB 3Q3BA 3OTVA 4I23A 3OCSA 2PYWA 2W1ZA 2ZAZA 4NH1A 3VS0A 3QC4A 3DJ6A 4HCTA 2XCKA 1DAYA 4BIEA 3U9NA 4CG8A 3NYVA 4TYHB 1QPDA 4G6NA 4TXCA 5IUIA 4HGLA 4X2NA 3VBXA 2UZVA 4EWQA 3SA0A 5IH6A 4RFZA 1K9AA 3LCTA 2WTJA 3QRUA 5EQYA 2W1HA 2UW3A 4JOAA 4P90A 3PIYA 5CNOA 4C0TA 2YDKA 4FR4A 4XG3A 3RAWA 2R64A 3DZQA 3HAMA 4B7TA 2RG6A 4HVDA 4HVIA 2P3GX 2I40A 2J51A 2IZSA 4JS8A 4Y95A 2LGCA 3OT8A 5EM7A 3HAVA 2QOKA 1JSTA 4LOQA 3DPKA 4GSBA 2QOCA 3CC6A 1NW1A 2ITWA 4J71A 3WF9A 3NNXA 5AV2A 3VW6A 3ZDUA 4FTUA 1LEZA 4D1SA 3Q32A 3DZOA 4CXAA 5AUYA 2G01A 3NIZA 1BL7A 4YTIA 4UMTA 4DLIA 4AA4A 4V01A 3R9HA 2VTIA 3KGAA 4MXYA 2W7XA 1Q99A 3PXQA 3ORKA 5AR3A 3QQGA 3RAHA 2BZIB 1P4OA 3I6UA 1J91A 4PL5A 2Z02A 4D4SA 2JD5A 2QQ7A 3ACKA 5ICPA 4TNDA 2QOHA 4YSMA 4AE9A 4MNEB 1Q4LA 3MV5A 2B9IA 4BDHA 3PFQA 1DAWA 4XRLA 4RX7A 5HO8A 3NW5A 1ZYCA 4QPMA 3QRIA 1STCE 1KV1A 2YHVA 3O17A 3QBNA 1IR3A 4LL5A 4MK0A 3O8PA 3QKKA 4RC2A 4WG5A 3UBDA 5LXMA 2FH9A 5E8YA 4C2WA 3E3PA 5HLNA 5HD4A 2E2BA 2GNFA 4IB5A 4KD1A 3VJOA 5DT0A 2Z2WA 3EQIA 4HZRA 1YHWA 4QMWA 4FICA 4CT1A 1MQ4A 3OT3A 4FKGA 3CCNA 2YCFA 4O7NA 2BRHA 3RCDA 4BCHA 3IW7A 4ANMA 3KU2A 2B4SB 1RJBA 4UYAA 3Q52A 5J9ZA 2UUEA 4QMLA 2HYYA 2QOOA 3KKVA 4L01A 5GHVA 5HICA 1OI9A 3DAEA 4QQ5A 3K3IA 4K77A 5AP2A 3P7CA 1FMKA 3ZEPA 4FTQA 2YA9A 4F1TA 3K3JA 3HV4A 4C61A 4FIFA 3RNYA 3DKOA 5LCKA 3UOKA 4EQCA 5LVOA 2GMXA 3K54A 4AZVA 4C02A 4YC3A 4EH6A 3PE2A 4TZRA 1Q8UA 3LFQA 2C6TA 2W5AA 2OXYA 4HPUE 2C6DA 4XUFA 5E1SA 4O7YA 3LKMA 5B2LA 3WF7A 3LMIA 5EI2A 2E9NA 4FG7A 2I7QA 3QGWA 3QUDA 3ULZA 2DWBA 3TUDA 5L6PA 4BCGA 5HORA 2QOFA 2Y9QA 4BVUA 3Q04A 4FBXA 5K0XA 4JG8A 5DI1A 4LQMA 2H9VA 3DAJA 3OF0A 5IQCA 5EKNA 4FEVA 3GU5A 5J5TA 3EN5A 3AC2A 3LQ3A 3REPA 4Y8DA 3ZZWA 3EKKA 5EHLA 5FEDA 4QMVA 4DH5A 5CZIA 3KXZA 4NSTA 4JAIA 2GHGA 4PRJA 4I5MA 4Y73A 2PSQA 2YAAA 3TDVA 5DR9A 1CMKE 5HTCA 3W55A 3BGPA 3LM5A 2UV2A 3GEQA 1YDTE 2I0EA 2WU7A 4JG6A 4WHZA 4YJOA 4IHPA 5I3OA 2UZEA 2C5XA 5IUGA 3OOMA 1Z5MA 2B7AA 2RSVA 4W4YA 5BUJA 4D55A 4O84A 3TUCA 3MY1A 1Y8GA 4YJSA 3LW0A 3AC1A 2YIRA 3NW7A 4I1ZA 5DFPA 5F94A 4EUTA 5AAGA 3A7HA 4GUEA 3OWPA 4X2GA 3CGFA 3UNKA 1Y91A 3GU7A 4M69A 1U59A 4FT3A 4M15A 4WT6A 3NUNA 4DEEA 2VWXA 3Q2MA 4NL0A 4DF3A 3TIYA 3LFCA 4ZY4A 4FIIA 4FKWA 3E92A 4FKPA 5D12A 5HBHA 3ZLYA 4DH8A 4LRJA 4C38A 4YHFA 2NPQA 3UIBA 3KVWA 4ARKA 3PXKA 3ANQA 2PE1A 2QVSE 3E64A 3OXZA 4O7TA 3H9FA 5IMEA 1F5QA 3SXRA 3PE1A 2J6MA 3Q4CA 4AZSA 4HW7A 1KOAA 2J0MB 3EQRA 3D5WA 3ORXA 2X4ZA 4BCOA 4DCEA 5JSMA 1BI7A 2V62A 4FTJA 4IVDA 5IKWA 1ZWSA 2R3OA 4O0TA 2UVXA 4OUCA 4WG3A 2EVAA 2C0OA 4FV6A 1PKDA 3IKAA 2OJGA 4F4PA 2XS0A 3QLFA 4BICA 4X2FA 4LMNA 2JDOA 3IOKA 3FZSA 2OZAA 4M68A 2CPKE 5L4QA 3A8WA 3R2YA 3I5NA 4WSYA 4IWPA 3HLLA 3WIGA 1KWPA 5HKMA 2QC6A 3QD3A 3F61A 2PY3A 1R3CA 4O2PA 4G17A 5FBOA 4QMPA 2ITQA 4FZ7A 5C01A 2YM7A 5TR6A 3FJQE 3I60A 5BUIA 2R9SA 3QTRA 4RLKA 4A07A 3I0QA 4FVQA 1FMOE 1XH9A 3KULA 4PP7A 4CCUA 3R8MA 2HWOA 3KA0A 3C50A 2C5OA 1U54B 2QHMA 4WO5A 3V5JA 3A61A 2PMIA 2PTKA 3ELJA 4C36A 4L3PA 4GJ2A 5ETCA 4ZLZA 3PRIA 4U45A 2R3HA 2HAKA 2VO0A 3RI1A 3FQHA 4YU2A 3BWFA 3NAYA 3EN9A 3QQUA 3KXMA 3TACA 5CEKA 3S2PA 3VF9A 5IA5A 4F9WA 2HZIA 2P33A 2ZB0A 3V5PA 3SOAA 4DG2E 3FE3A 5LMKA 2OJFE 3DXPA 1NVQA 3EIDA 4O0XA 4UEUA 5CI6A 2NNWB 3JXWA 2X39A 1M2PA 4DTAA 4D0XA 3R7UA 2BMCA 3CY2A 3COKA 3G0FA 4J53A 2ETMA 4H3QA 2O63A 2OSCA 4JDKA 2XK4A 5CEQA 5A6NA 2X7FA 5LJJA 3BYSA 5C03A 1R0EA 2XEZA 4FNYA 2X9FA 2CGVA 5A4LA 4E3CA 4EK8A 4WRSA 3BX5A 2WMWA 4B6LA 4BDAA 1Q8ZA 5BYYA 4I21A 3P1AA 3OD6X 1YDSE 3VW8A 3KVXA 2O8YA 2O64A 3QF9A 4WRGA 2DUVA 5HCXA 1OVEA 4M7IA 5KMMA 3O96A 4DTBA 5CU2A 1GIHA 4F9BA 3BV2A 4RT7A 4D4RA 4DE4A 4FTTA 4FVPA 1YI3A 2ZMCA 5IA2A 4A4OA 4O91A 5F1ZA 2UW7A 1PKGA 4Q9SA 5I5ZA 3IGGA 5DEYA 3PPZA 2JDVA 3A4OX 3ZUTA 3QKMA 2OICA 4MYGA 1OKZA 3F3UA 4USDA 4X21A 4BCJA 2VTQA 2C6EA 4OTHA 4U41A 3QA0A 4E6CA 2DQ7X 4JJRA 4DC2A 3B2TA 4QPAA 3UQGA 4PY1A 3C4CA 2O5KA 4LRKA 3WI6A 3BU5A 5IG1A 4LV8A 2ZV2A 4HVSA 4ZZNA 5TF9A 5M06A 5KMKA 4FT0A 5KZIA 4O1OA 3ZRKA 1IEPA 3L8VA 2WTDA 3CKXA 4D0WA 3PJ2A 2JBPA 3O7LD 3R1SA 4JRNA 4S2ZA 4AA0A 4CZTA 5A4CA 2GQGA 4FV8A 4AU8A 4BTJA 4XOYA 2X0GA 4D2WA 3EH9A 4KRCA 3QUPA 3RWPA 3UC4A 4ZZOA 3FLWA 3CS9A 2Y4IC 2IZUA 3V5LA 5CWZA 3ID6C 1SM2A 1LEWA 4YPSA 4EOSA 4A4XA 5HVKA 2VTPA 3THBA 4FV4A 3SRVA 5C8KA 4BWKA 3QFVA 4YJUA 4NUSA 5J9YA 5B7VA 4FKLA 3PXFA 3MTLA 2VGPA 4ZSAA 2GNJA 3COMA 2UZWE 4PMMA 5CSPA 4LMUA 3W10A 1JWHA 4FMQA 4EOKA 4R7IA 4H05A 4DFXE 4QO9A 2QO9A 3KK8A 2AC3A 3FHRA 3FZRA 4ZOGA 4BIBA 4GT3A 3SC1A 2QR7A 1IASA 2FVDA 4F65A 2VU3A 3FLYA 4X2JA 2XVDA 3JYAA 4X3FC 5HVJA 4AFJA 2QU6A 1B38A 3ZXZA 3WZDA 2X8IA 3UZTA 1ZY4A 5K3YA 4M66A 4F1OA 2YIWA 1IA8A 3MN3A 4PTCA 2BR1A 4FV1A 3D94A 3EJ1A 2VTTA 1FVVA 1QCFA 3MS9A 1JBPE 5I9WA 4GG5A 5EDRA 4R5SA 4IAAA 5FXRA 4GK3A 1ZLTA 3CY3A 3NW6A 4IH8A 3POOA 5AP1A 3C4FA 1TVOA 2HY81 3R9DA 4X0MA 2WAJA 3RALA 3CD3A 3UO4A 3ZHPC 2JAVA 1JKSA 1RDQE 2XK8A 5CVGA 3PJ1A 1KSWA 5DIAA 3NX8A 2GPHA 2XNOA 2ZB1A 2IW8A 3RVGA 4C4HA 4UV0A 3BU6A 4F08A 1DS5A 1SVGA 3N4TA 5D41A 2WTCA 3JVRA 1ZZLA 4KBKA 5BYLA 2Z7QA 3BEGA 1E9HA 5LWNA 4E26A 2YZAA 1ERKA 1BL6A 3HDNA 3PIZA 3BE9A 5A4EA 1ZZ2A 3E8NA 3R02A 4AW2A 5I0BA 3HV6A 2VRXA 4XYFA 3QRKA 1R39A 2R7BA 5G1XA 4EOPA 1PXKA 3IDPA 1FPUA 2GNLA 5F9EA 4QQTA 3S00A 2BHHA 3FL4A 4ENYA 2H96A 4XV3A 2JKOA 1KE6A 3F7WA 4ENXA 3R63A 3PG3A 2AUHA 4QOXA 4ASEA 2J90A 3GC7A 4CFNA 4EBWA 1KUTA 3ZC5A 4GEOA 5HCYA 5KMOA 3DOGA 5CLPA 4AOJA 1YWRA 2V0DA 3AC4A 4OR5A 5EOBA 4O7WA 3CSVA 5CSHA 2UZUE 1L8TA 3FUPA 2XK7A 4HYSA 4CZYB 4ANBA 4EH2A 4ONAA 5LQFA 4ITHA 4K8AA 2J0JA 3HKOA 2QODA 4TYJA 4FK3A 5E1EA 5G6VA 5K5XA 5KKRC 3DFCB 4KSQA 3EQDA 4DN5A 1OL5A 2XYNA 3T9IA 1WBVA 5HU9A 3HX4A 3FMKA 4DHFA 4F7JA 4PX6A 1ZMUA 4YJQA 4E4MA 5E8ZA 3T9TA 3TV6A 2C6IA 3KB7A 4XV2A 4KB8A 2EXCX 3EL7A 5HQ0A 5AV4A 4R7HA 4QYFA 3NUSA 4O96A 4DG3E 2WMQA 2WQBA 3BYUA 4JBVA 5L8JA 4EH8A 1VZOA 4AT3A 4E8AA 2PUPA 3KN6A 1PHKA
chains in the Genus database with same CATH superfamily
4FZAB 2EXEA 2Y8OA 4M69B 4Q2AA 3FLNC 4EK5A 3I1AA 1WVXA 3CJGA 4FVRA 5IZFA 4BTKA 1MRYA 4MVFA 4K0YA 5E8XA 4DDIA 4R77A 3FMDA 4KA3A 2BFYA 3VONA 3BBTB 4LRMA 4DFLA 4CMTA 2QHNA 2ITVA 5JFSA 3NIEA 2QO2A 4LGHA 5CVFA 3CPBA 3L8XA 2PZPA 4U3ZA 3ENMA 3EZRA 2CLXA 5FD2A 2Q0NA 1Y57A 1FQ1B 2R3NA 4O6LA 2BFXA 2FO0A 2REIA 3V6RA 5CASA 4G34A 4RLLA 3AMAA 3TZ8A 3ZO1A 5E4HA 1CKIA 2GDOA 4UALA 1XBCA 4D2SA 3V3VA 1YRPA 4R3RA 3LJ2A 3ZBXA 4E7WA 2OF2A 5HLPA 4CFVA 1YXTA 2C3IB 5CZHA 4GKHA 4NCTA 5TO8A 2XJ0A 5KE0A 3P7AA 5LVMA 2CN5A 3R71A 2CN8A 4BL1A 4ZLYA 4IDVA 3HRCA 3MH0A 4L3JA 5AEPA 3C9WA 1Q3DA 4FKVA 3ORPA 1YKRA 3OTUA 3AGMA 4IACA 5HLWA 3UQCA 2B9FA 5IPJA 4N0SA 3PZHA 5CF8A 4XV9A 3DT1A 3R7EA 2GQRA 4QP2A 5CENA 2ZV9A 3MA3A 4QP1A 3Q4TA 4PTGA 2W1IA 3JY0A 5HO6A 5ETAA 1OIRA 3HMIA 4YZNA 4AQCA 4C58A 4OT6A 4S33A 4D2RA 4H39A 5BYZA 2W1GA 3GC8A 1M2RA 1W84A 5JRQA 1YXSA 2A4LA 2A1AB 4A9RA 3BYMA 5C9CA 1Q8TA 5I4NA 3LMGA 5EW8A 3NNVA 4U5JA 1W98A 2F7XE 4KKGA 4HVGA 3W0QA 4YP8A 5H8GA 2EB2A 3LCSA 3T8OA 2JLDA 1YHSA 5EYKA 1G8SA 4AWIA 5LWMA 4Y46A 3BEAA 5TT7A 5JGBA 3GCPA 4BCFA 1OKWA 4TWCA 4ITIA 3UIMA 3WZJA 3G15A 1FGKA 4ACGA 3QTIA 1UKIA 3QALE 4KABA 4EOQA 4NWMA 4MD7E 2WNTA 4IAIA 4PWNA 4I6HA 4YO4A 1SVEA 3OFMA 4J8MA 4KSPA 4DEBA 4F9CA 3V8SA 3R00A 4FODA 3IOPA 2VTMA 4I3ZA 4MHAA 2X7GA 4KAOA 4PPCA 3P86A 3OCGA 4X7QA 4O0SA 2P4IA 4C3PA 2VTSA 5HHWA 3MW1A 4L52A 4BTMA 4EKLA 1ATPE 4D5KA 4AXDA 2FSOX 5EH0A 3ZO2A 2W9ZB 4QDEA 4QQJA 4DHZA 3IONA 2X2MA 1XH7A 2YDIA 3NYOA 5ETIA 5J5SA 2X0OA 3D5VA 3QZGA 1FBNA 3LVPA 4IAFA 3Q9YA 4ACCA 2J0IA 3BKBA 2KULA 2WMSA 4XEYA 3W2RA 4FGRA 3Q4UA 5A3XA 3UP2A 4PV0A 3MPMA 4GYIA 4JR7A 4YMJA 3LHJA 3WF5A 4U80A 2UZLA 3AKLA 5T68A 4R1YA 4F6WA 3ZC6A 3LM0A 3U8WA 3FL5A 1UNLA 3QZFA 4QMXA 4J7BA 1H8FA 2QOQA 2FB8A 3A7JA 3UE4A 2YITA 1QPEA 3G0EA 1E1XA 4G16A 4OAVB 3ALOA 1T45A 5KHXA 3HRFA 4AT4A 4EUUA 1H4LA 3UO6A 5AM6A 2PE2A 2ZVAA 1UU3A 3DJ5A 2CGWA 2OJ9A 5EKOA 4EZ5A 2X7OA 2F2UA 4ANQA 4C4GA 3MFTA 3QTQA 3ERKA 5CU6A 1HCKA 4ZIMA 3PPJA 5DN3A 3ZSGA 4E6QA 2QOLA 1GZ8A 2V7AA 4IANA 4Q5HA 2OH4A 4LGGA 3Q6UA 3LXNA 4W4WA 2NRYA 2R7IA 5DVRA 5BPYA 5AP4A 3TJDA 3ZOSA 3RHKA 1GZOA 5KZ0A 2ITOA 2GQSA 4QYGA 5H2UA 4U81A 2WMAA 4ERKA 3R6XA 1OBGA 3DBCA 3TNPC 3UIXA 3PVBA 2PVFA 2HXLA 5M53A 3F69A 4QMQA 3BWJA 4YLKA 2J5EA 4PMTA 4CSVA 2HZ0A 5K5NA 3NCZA 3O51A 3R28A 5GJDA 3U51A 3MJ2A 5HE1A 4EC8A 3NCGA 3AC5A 4EH4A 5JMSA 5KX8A 3DBFA 3R7GA 5HIDA 1H0VA 3ZBFA 4BN1A 4IBMA 4C34A 3OCTA 4F64A 2CKPA 3VHKA 4G3FA 3VRZA 5CAQA 2JDRA 2QO7A 3U87A 3E88A 3ORNA 5DR2A 4BDEA 5AIRA 5FM3A 5ANEA 3VIDA 1SNXA 4UY9A 5EW3A 4FNZA 1F3MC 3BGQA 3FKLA 4RQKA 3RGFA 3WE4A 1YWVA 4JQ7A 4DEAA 2UVZA 3OMVA 4NYEA 3GQIA 3QTXA 4XG6A 2BHEA 4FSQA 4KKHA 4O0RA 4RJ8A 5J1VA 2BKZA 1B6CB 4I5CA 3QU0A 2JBOA 1I44A 3UJGA 4FE2A 5EI8A 4F99A 4LDTA 5KBRA 4KKEA 3LXPA 2Y6OA 1KE7A 4BI1A 2QG7A 1G3NA 2ITPA 3DBEA 3KQ7A 2UZDA 3GENA 2PZYA 4IAZA 1R1WA 2WGJA 3QQKA 3PLAE 3BL7A 3ZZEA 1OKYA 4RIXA 2F7EE 3I7CA 2C6KA 1LR4A 1XR1A 3CXWA 4QP4A 4UX9A 4JXFA 2HCKA 1YHVA 4BKJA 2WB8A 3MA6A 3UODA 4CG9A 3MYGA 2QU5A 5JZNA 3BHVA 5HG9A 2UZNA 4AS0A 2CKQA 4I0RA 2FA2A 3GUBA 3W2CA 3ZXTA 1YVJA 2GS6A 2G9XA 3CEKA 4P5QA 2JKMA 2G2HA 4XV1A 3ZLWA 4YJTA 5KO1A 4I22A 3FXWA 4XH6A 1OL7A 4D4VA 4RVKA 2KTYA 3LFAA 3R2BA 4FSRA 3I7BA 4GT5A 4H1MA 5JRSA 4CFWA 5EQEA 5FXSA 4L46A 4OTIA 4FTAA 5FQDC 4AZFA 4NM3A 4D2TA 3LLAA 5HGIA 3V01A 1SVHA 4EJNA 5B2MA 3MESA 3RKBA 3U54A 3QCSA 2FSTX 5AR2A 3R8PA 1J3HA 1BI8A 4USFA 2W17A 3R22A 5J7BA 3BV3A 1W0XC 5BVDA 3TUBA 4GV1A 3F66A 5EOLA 2Z7RA 3FWQA 3R1NA 1XHAA 1MQBA 3E87A 1AQ1A 2RIOA 5J79A 2C5VA 3TJCA 5AX3A 5LVNA 5C26A 3O8TA 1OL2A 4RC4A 5DE2A 4E1ZA 4FJVA 3C0IA 4GU6A 4TTHB 3VS7A 3DLZA 4EI4A 1PXOA 2X8EA 1PW2A 4GVAA 3LCOA 4FT5A 2XIKA 2W1DA 4FF8A 3PXYA 3EQFA 4QT1A 4GJ3A 1JKKA 2GTMA 5GNKA 3DFAA 1F0QA 3EZVA 3O8UA 5EW9A 4AE6A 4QYEA 4EOIA 4EONA 2R3MA 1Z9XA 2BAJA 2XAOA 3RPSA 3A4PA 4DGMA 3ORLA 3FDNA 3MVHA 3OC1A 5EYDA 4RJ4A 3E7VA 4HYHA 3MFUA 3LQ8A 3VS1A 2VTHA 5IA4A 4M84A 4OLIA 3P79A 3ROYA 5DMZA 3WYXA 4FK6A 4FKJA 2GNHA 3BYVA 1Q3WA 1OL6A 3E7OA 1Q62A 5ANOA 2WQOA 4ITJA 4GMYA 4NTTA 4BDGA 2Z7SA 4IFGA 4IJ9A 4RWJA 5EFQA 2C3KA 2WZJA 4AN3A 2R3KA 5LMBA 4JQ8A 1H25A 1H08A 4L7SA 4TT7A 2UW4A 3FPQA 4PDSA 3TKHA 4O4BB 3DKGA 5C8NA 3PG1A 4DHJA 4P5ZA 1K3AA 2QCSA 2VWVA 4CLIA 2PUNA 2OO8X 5M07A 2GFSA 2W96B 3AC8A 4RX9A 3F6XA 5AM7A 3CLYA 2B9HA 2CGXA 1QPJA 3O0GA 4F1MA 2EU9A 3VBYA 3MDYA 3KXXA 3OWLA 2RKUA 3Q5IA 4HOKA 3FYKX 2HZNA 2XRWA 3QC9A 4XG7A 4Z9LA 3Q9ZA 4G6LA 4HCVA 4J99A 2VTNA 3MWUA 3QYZA 4K2RA 4UXQA 4WBOA 1GZKA 3WF8A 5DYJA 3CD8A 5BVOA 4I0TA 3UOJA 5J8IA 5EM8A 3ZUUA 4DLJA 4ALVA 4B9DA 5EHYA 4GFMA 2BDWA 2OU7A 4RJ3A 4ASZA 4J52A 4JL9A 1WBTA 3EOCA 2IO6A 4RJ5A 4EHZA 5M4IA 1UU8A 4ORKA 1JSVA 2PVLA 3E8EA 3QWKA 2Z7LA 1OL1A 4GVJA 4XNEA 3QD4A 4XHKB 2YFXA 1ZMVA 4EL9A 1LP4A 1R78A 2CDZA 3SKCA 1HCLA 2IZRA 4APCA 4BDCA 2W4JA 2PL0A 5E8TA 4U9AA 3MB6A 3QLGA 2JDTA 3VRYA 3IW6A 4D2VA 2X1NA 4MQ2A 5DA3A 5AAEA 2WIPA 4QTEA 1JVPP 4IAYA 4AXAA 2OWBA 2G2FA 4TWOA 2OBJA 1H28A 4WA9A 2W1EA 2XRUA 1OPKA 2WD1A 3FMLA 3PWDA 4UBAA 5C4LA 2GS7A 4TPTA 1A06A 4BGHA 3H10A 2PMOX 1V0OA 3Q9XA 3LIJA 4HJOA 4O0WA 3F2AA 4WUAA 4I93A 2QOIA 5EDPA 4UMUA 3UOHA 4IM2A 2QLUA 4CYJA 3PLSA 2W5HA 3G51A 4L44A 2P0CA 3EYHA 5CU4A 2CCIA 3HA6A 4O82A 4X3JA 5AFVA 4Y72A 1BX6A 4ACDA 3KXHA 4QMTA 3B8QA 3HECA 3TYKA 5FXQA 4K9YA 3KMUA 4BCNA 2VV9A 1S9JA 2I0HA 4FV5A 3QD2B 2VWUA 3SDJA 4F7NA 2GHMA 3RMFA 2VWWA 3OW4A 1FGIA 3AT2A 1O9UA 4I24A 4KS8A 3CTHA 4ZSGA 4AG8A 3F5PA 4BY9E 4EQMA 3F5GA 3C5UA 1GNGA 3L9NA 1FOTA 4I41A 4QMSA 5HG5A 3RZFA 4PL3A 1TQPA 4AOIA 4L6QA 4NIFB 4V0GA 5DT4A 4UMQA 1Q8WA 4YBJA 4EZ3A 5EQPA 4AGCA 2R3RA 3RWQA 4YLLA 3C4WA 2CNUA 4QDVA 5HTIA 2CSNA 2WPAA 3W33A 4K11A 3DKFA 3D7TA 4F9YA 5I3RA 4AGWA 2FSLX 3E63A 3KK9A 5AUTA 5I9XA 3PFYA 4A06A 3HV7A 3W8QA 5GZAA 2O2UA 4G9CA 3VS3A 5A46A 2O0UA 4GU9A 2HY0A 3OY1A 4IM0A 5CSVA 4O21A 3ZONA 4XLVA 3ORMA 3GFEA 2UVYA 3FHIA 4DGNA 5KNJA 1DM2A 3FC1X 3FMEA 4QP7A 4BFMA 4FZ6A 1MP8A 3F3TA 2IEWA 1NY3A 2PMNX 3DCVA 4JMQA 2YEXA 5CF6A 3BQCA 5AP3A 4LYNA 2RFNA 4IB3A 1ZYJA 2VO3A 3VUKA 2ZYBA 4KIKB 4BDKA 2XF0A 2IVSA 2PULA 4ZJJA 4B8LA 2BPMA 4G31A 4QTBA 1UWHA 3EN4A 3ZDIA 3HZTA 4GIIA 4XP0A 5J7HA 5J9LA 4DG0E 5LOHA 3T3VA 3II5A 3OCBA 3EYGA 3ZLSA 3NZ0A 4IZ7A 3FMNA 4I6BA 2PK9A 4GK4A 4HGEA 4GT4A 4N6ZA 4APPA 3QGYA 4L7FA 3OXTA 3PSCA 2XKFA 1FVTA 3PP0A 4FA2A 4RQVA 1W2CA 4PTEA 4XLIA 3EQGA 3M1SA 4KIPA 1WBWA 3UC3A 4C3FA 4W9XA 5M44A 4O7LA 4AXFA 5C27A 4FOBA 2B55A 3VQHA 5CY3A 2ITTA 3C0GA 3D4QA 4FI1A 3FZTA 4CGAA 2XM9A 4MNFA 2G2IA 5C1QB 2V5QA 3HL7A 4CNHA 5DR6A 4JBOA 3AD4A 3KXNA 4RWLA 4IVBA 4U40A 4NFMA 4QQCA 1RQQA 1YI4A 5CXHA 4Z7GA 4RIYA 3CTJA 3ODYX 3ZM9A 2I0VA 3SW4A 4YUQA 3HNGA 2E9OA 3ENHA 4KBAA 3UQFA 3QRJA 4AAAA 5FTGA 4CT2A 3AQVA 4QNYA 5IMXA 1OPLA 3UMXA 3DJ7A 5M57A 2BTRA 3PWYA 1URCA 4NFNA 3MTFA 3U55A 4M13A 4EYJA 4J95A 3NSZA 2R0IA 2XIZA 3VWAA 3ITZA 3FV8A 2WQEA 4PP9A 5HBEA 3SAYA 5FP6A 3W8LA 2C47A 4JT3A 4O0UA 4EH5A 1CM8A 2ONLA 3GP0A 2RL5A 2FUMA 4A9UA 3G2FA 3R9RA 3I6WA 4N4SA 2B0QA 2XARA 3QX2A 3VAPA 3R1QA 4NEUA 2W99B 4ZLOA 2BDJA 2VTAA 5IQHA 5ANKA 1PF8A 4UWYA 3OG7A 5CEPA 4PPAA 3PPKA 5IQEA 1OIUA 3Q5ZA 1AGWA 4P2KA 4GIHA 3SQQA 1ZMWA 2FYSA 3IQ7A 4ASXA 3KIOC 4CZUA 1WFCA 2OK1A 1YWNA 1AD5A 2GS2A 5C8MA 1JKLA 1XJDA 2OZOA 3POZA 4X6RA 2HELA 3UVQA 5LCJA 4UWBA 3Q9WA 1TFFA 1JQHA 2ZM1A 4R5YA 5AP7A 2CKEA 4L3LA 3GC9A 4FRFA 3TL8A 4ANNA 5AAFA 4BKZA 3DKCA 3A7IA 3BBWA 3H9OA 4FEWA 5J95A 4DCAA 1P14A 2ZM4A 2A19B 3LCDA 3ORTA 4M8TA 4U6RA 5BX0A 5EG3A 3HMMA 4F09A 4PMSA 4O4CA 4IAKA 1OBDA 3R30A 5IH4A 2LAVA 2UW6A 4Y5QA 3F5XA 2XKDA 1VYZA 4TRLA 3ZLXA 3A99A 3EWHA 4DFBA 2W06A 3GU6A 2BCJA 4ZSLA 5HNGA 2UZBA 4NW6A 4QTDA 4AA5A 4BRXA 3PTGA 2A0CX 2A98A 4OTFA 5AR4A 3T3UA 4YURA 4MCVA 1W82A 5DH3A 2ZV7A 5FP5A 4LGDA 3NVKI 3DBQA 4DGOA 2ITXA 4JVGA 3KCKA 2X9EA 3MIAA 3D2IA 3FMJA 4BCQA 3JPVA 2PPQA 4GKIA 3ATSA 4FTRA 5HNIX 2YM5A 3PVWA 5DBXA 4PMPA 2OKRA 3ZH8A 5TE0A 2VO7A 3HV3A 4FTMA 4QYHA 5AUVA 3RM7A 2XNNA 3UP7A 3TZMA 4A9SA 4E5BA 5HI2A 4Z3VA 2WEVA 3LE6A 4C62A 4AZTA 3FZPA 4KNBA 2YCRA 4TYHA 4DYMA 4C3RA 5HX6A 1JPAA 2FGIA 4CMUA 2NYAA 2QNJA 2QONA 4O7SA 4F70A 1W83A 3RP9A 4NW5A 4ASDA 4R3CA 2XK6A 4MBLA 4U79A 2IG7A 3H0YA 3I0OA 3I5ZA 4GCJA 5CT7A 1NT2A 4WBBB 4FG9A 4GFGA 4ANOA 5I9ZA 1PXNA 1B39A 3QTUA 2YAKA 4FOCA 5AR8A 3V8TA 3F82A 3C7QA 2Q83A 3FY0A 5L2SA 2H34A 2WXVA 5CTPA 4X2KA 3CTQA 3OHTA 1Q24A 2ZM3A 2GFCA 3FSKA 5H9BA 5L3AA 2BIYA 3IECA 2ETRA 1CKPA 2F49A 1YI6A 3QRTA 4R6VA 4H36A 4XX9A 1GJOA 2B1PA 4D28A 3R0TA 3R9OA 4Q9ZA 1WVYA 4XCUA 2OFUA 2ZJWA 4B4LA 5K4JA 3NRMA 3R73A 4RIOA 4FV2A 2VX0A 4GYGA 4O4FA 4ANLA 5T6KA 2AQXA 3PSDA 2UZOA 3I4BA 4YJNA 1OMWA 1BLXA 3FYJX 5M4CA 1P4FA 4RA4A 2YIXA 3V5TA 3ZS5A 4QYYA 2CMWA 2WMRA 1XBAA 3GB2A 4R78A 4EOJA 3ZO3A 4EQUA 2PUIA 1Z57A 2F4JA 3EFKA 5HE3A 4JBQA 1SZMA 4GFOA 5IA3A 4PDYA 3H3CA 1TQMA 4JDJA 4LI5A 3ZMMA 4L00A 2HIWA 4MNEA 1G8AA 2B52A 2RFEA 4FUYA 3TIZA 3UYTA 2W4OA 4YPDA 3IDCA 2OXXA 1MRVA 4FT7A 2XJ1A 4CQEA 3OUKA 4RA5A 4RVLA 4UMPA 1DI9A 3P7BA 3UNJA 3Q53A 3PA3A 3UVPA 2PZIA 4R1VA 4CKIA 3QTZA 5HTBA 3SG9A 4KIQA 2UW8A 3GOKA 5E8WA 3VC4A 3ZTXA 4BC6A 2YM4A 2OFVA 2QG5A 4EH7A 3R7IA 4AGUA 3AD6A 4ZP5A 4LUEA 3F5UA 2PZRA 3W0MA 4M0ZA 4C4FA 4KBCA 2JEDA 4AF3A 5IDNA 4RSSA 1HOWA 2BZHB 5DHJA 5DOSA 5M55A 4NM7A 3C0HA 4AT5A 2UW0A 4FSWA 4GS6A 1J7LA 4LL0A 5E8SA 4Z16A 3SVVA 3LOKA 2HXQA 4D58A 4XRJA 4EKKA 4EOOA 4QMZA 3KN5A 3RHXA 4L45A 2OZAB 4EOLA 4I4EA 1IA9A 2PUUA 4JX7A 1BUHA 2C6MA 3AGLA 2WHBA 3QCYA 4AAYA 4FSNA 4AFEA 4V0GB 4ZK5A 4Y85A 5DRBA 3NDMA 4A9YA 4UWCA 4IWDA 2GCDA 4G9RA 3VJNA 4BIDA 3QTWA 4MD8E 4QP9A 4EH3A 4W4XA 3EQHA 3F88A 5JN2A 3DBDA 1J1BA 1LUFA 3I81A 3IS5A 4LM5A 3L9MA 4RMZA 3QHRA 3BGZA 5HZNA 5H8EA 3KULB 2C6LA 3NYXA 5CEOA 2E9VA 4DFYA 5IQDA 2ITZA 2WELA 4MF1A 2PWLA 1W8CA 2IJMA 4MBIA 4NM5A 4RWIA 1PXMA 3SXSA 5L8KA 5L8LA 5FG8A 1YQJA 2OIBA 4QTCA 2CJMA 2Y0AA 3DXQA 4O7ZA 5AUXA 1IAJA 3BYOA 3VUHA 4EHEA 4YLJA 2HZ4A 3QA8A 4TWNA 4MWHA 5L2IA 4MX9A 4IZ5A 5CAUA 4C57A 3MFSA 3N9XA 5A9UA 3P23A 3NLBA 4CTCA 3C1XA 4FSTA 4BDJA 4RBLA 2BILB 2OI4X 2OGVA 5AJQA 2XYUA 3TKUA 3JR1A 2RF9A 2DS1A 3S0OA 3ANRA 3U6IA 2H8HA 5CT0A 1Q97A 3U4UA 1PRYA 3RM6A 2XEYA 5CQUA 3BHYA 3MPTA 2XBAA 3RNIA 4O4DA 3UZPA 4YTCA 1U5QA 1LPUA 1H01A 4ACHA 4NT4A 3WARA 4C4EA 3DLSA 3L1SA 3KF7A 4IE9A 5EM5A 4E6AA 3HRBA 2XIRA 4BZNA 1O6KA 3BQRA 3HA8A 2X8DA 4MQ1A 2VWYA 3PXZA 3DY7A 4YJPA 3BI6A 3WOWA 4D5HA 5J1WA 1UNHA 2QI8A 5CF4A 4A7CA 3PRFA 3HUCA 4ID7A 4L67A 5LMKC 1YOLA 2C1AA 5EDQA 4KINA 5M51A 4F7LA 3DTCA 4XBUA 2OW3A 1ST4A 3SHEA 4FTLA 3UNZA 1UKHA 2IVVA 3U6HA 4BHZA 2O3PA 3KC3A 1V0PA 2VTRA 3EFLA 1OB3A 1H24A 3SLSA 4HGTA 4IEBA 3D7ZA 4ALUA 2SRCA 3PVUA 2QR8A 2J4ZA 3VS6A 5J87A 1YDRE 2BRMA 3IG7A 2VWZA 2HW7A 1PXPA 1TKIA 4UYNA 4UB7A 5BVFA 5FDPA 4DINA 1I09A 1H1RA 3FXZA 3OOGA 3VBQA 5CANA 3PYYA 3P0MA 3KF4A 1U54A 3PUPA 3EQCA 4RRVA 3F3ZA 3V8WA 4JDIA 3TNWA 4FNXA 4FSUA 4O4EA 5F4NA 4ZTLA 2X0PA 3LPBA 5AV3A 3V6SA 2PE0A 3ZFXA 2HENA 5HG7A 4DH3A 5IH5A 2YM6A 2P2IA 4GG7A 1ND4A 2FSMX 3LXLA 3TT0A 4QRCA 4FIJA 4J97A 4UZDA 3NUYA 3FMHA 5E90A 1BMKA 4TY1A 5HBJA 4TYIA 2YJRA 3SRVB 2BDFA 4WKQA 4UMRA 4S30A 3DK7A 1QL6A 1YOJA 2W05A 2EB3A 4YZCA 4FV3A 5D1JA 3DQWA 2X2KA 4FYNA 3TZ7A 4DFNA 4ZJIA 2YDJA 4P4CA 4XG4A 4BTFA 3VF8A 3FKNA 1S9IA 2GTNA 3MY5A 2Z8CA 3NYNA 4DA5A 3OP5A 1H0WA 3D9VA 3QZIA 4WD5A 5IEVA 4FC0A 3PY3A 5BMMA 4G6OA 4AOTA 2CGUA 4FT9A 4FZFB 3W18A 5FDXA 3PA4A 4WNKA 2I1MA 1IAHA 1UU7A 3R04A 3FY2A 1NVRA 4FV0A 4O7RA 2O65A 3M2WA 5L6WL 2VNWA 3V04A 4XP2A 3FLQA 5ANIA 4AW1A 3HP2A 4JLCA 5CAOA 2NP8A 5KMJA 4YSJA 1V1KA 4ZS4A 3ZSIA 4G3EA 2BKKA 4O38A 4OTQA 4TL0A 3P4KA 3TTJA 4CVAA 4ZS0A 2R3FA 3OUNB 1ZAOA 4WIHA 1XMLA 4JNWA 3TDWA 4B8MA 5CNNA 3HV5A 3TTIA 1OUKA 3WBLA 1UNGA 3LFSA 3LFFA 1NA7A 4IWOA 4IM3A 2W5BA 3PUFC 1VYWA 4B99A 4FV7A 3F3WA 4D2PA 5CEMA 1BYGA 3ROCA 3CJFA 3ZFMA 5BNJA 4NZWB 4FKSA 3TZ9A 3AKKA 5E9EA 1H26A 4RX5A 4AW0A 5CF5A 2YLEA 4KS7A 3CE3A 4H3BA 4FX3A 4W9WA 4OBOA 3NNWA 2P2HA 4S31A 4F0GA 4MBJA 3RTPA 2XP2A 3FSFA 2WMBA 3CIKA 1ZYDA 2ACXA 2YWPA 2V55A 4M3QA 2Y7JA 3R21A 4YZ9A 3PDTA 3DS6A 3TI1A 3GCVA 3BLHA 3HEGA 4HVHA 2Q0BA 3KL8A 2YM8A 2BRGA 4FSMA 4KWPA 1OUYA 4RJ6A 4JAJA 5HIEA 3LJ0A 4TWPA 3KRRA 4X3FA 5GJFA 2ERKA 2HW6A 2YISA 4QTAA 4RFYA 4RVMA 3W2PA 3ZUVA 3MBLA 3O71A 3OEFX 4RIWA 3VS2A 4ZTMA 3KRWA 4WUNA 4IB0A 4M97A 4IIRA 4DBNA 2C3LA 1E1VA 3LJ1A 4QP3A 4FL3A 1WBSA 2VNYA 2XKCA 4DDGA 4O86A 4AZEA 4IMYA 4QP8A 5AA9A 4USEA 4M67A 2CKOA 3I79A 1PXIA 2IW9A 4QMNA 2JFLA 3R8UA 1XH6A 4FSZA 3A62A 4L53A 3UVRA 4BR3A 3DXNA 3ZU7A 1XWSA 2JIVA 3AC3A 2OF4A 3VS4A 2C68A 5T3QA 4YHJA 4NJ3A 5K0KA 4F0IA 4NU1A 1XKKA 5DEWA 2W1FA 4F7SA 5M09A 3D5XA 4X6QC 2XNGA 1SNUA 1M52A 3PZEA 2RFDA 4O7VA 2J5FA 3G9LX 1JKTA 2YM3A 4YO6A 1SMHA 2OXDA 4UZHA 4CQGA 4I0SA 5B0XA 3G9NA 1T46A 3R01A 3FKOA 2WQMA 3QAME 4GH2A 2ETKA 3O23A 3NEWA 2I0YA 4UXLA 3UOLA 4O0VA 4O81A 3SG8A 3NS9A 4WNMA 3EQBA 2BRNA 1Y8YA 5ANDA 4FKUA 2IF8A 3RAKA 3UDTA 2PU8A 4JR3A 3C4XA 4J98A 5FTOA 4U7ZA 3U4WA 5FGKA 2JDSA 3N4VA 4IX4A 4OGRA 3QL8A 3TCPA 4CKJA 5IQBA 2WMVA 2R0UA 4BJJA 3GT8A 3GCSA 4F63A 4RWKA 1H00A 4S32A 4EORA 5KHWA 5AV0A 4DT8A 3ZM4A 4E4NA 3LLTA 4FIEA 4M14A 4E4XA 3GOPA 3F3VA 4DEDA 3UO5A 4U0IA 3NUXA 4A9TA 2HWPA 5EYMA 2AEGA 4PPBA 4U97A 3QQLA 3ZO4A 1VR2A 2R3IA 3CQUA 4N6YA 1CKJA 3H30A 3CQWA 2NO3A 2A27A 2WOTA 3LCKA 2VX3A 4NK9A 3QYWA 5CI7A 3LFBA 3DNEA 3RPVA 1Q8YA 3VN9A 1OIYA 3R1YA 5LMAA 3OEZA 4CV8A 2GSFA 2NRUA 4RZVA 3W0NA 3ODZX 4M12A 5IEXA 2J7TA 3TEIA 3TNQB 3P78A 2W9FB 3LFNA 3KFAA 2BZKB 2XNMA 4PDOA 3WZKA 4PQNA 3C13A 2QKWB 1ZY5A 4EBVA 3QX4A 4HGSA 5E8VA 5IQAA 4IB1A 4D1XA 3DTWA 1FINA 3IW8A 1URWA 3EN6A 3QD0A 3TV4A 4N57A 2PVNA 3VHEA 4ZEGA 5HESA 3SX9A 3LFEA 3LXKA 3MH1A 2ZMDA 2IZTA 3PXRA 1PYEA 2H6DA 3G6GA 4DHIB 4C4JA 4XG8A 2X6DA 4WNPA 4DH1A 4BYJA 5AV1A 2BTSA 5FM2A 2VN9A 2YIYA 3TKIA 3N4UA 3HGKA 5AMNA 3UYSA 2X4FA 4XOZA