2OZAB

Structure of p38alpha complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
348
structure length
340
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP kinase-activated protein kinase 2
publication title Molecular basis of MAPK-activated protein kinase 2:p38 assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 85
structure length 340
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ozaB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ozaB01
4GS6A 3Q9YA 4XLIA 2GMXA 3UC3A 4ERWA 4A4XA 2BRNA 5ANGA 2HXQA 4RWLA 4G6NA 5KBRA 3FY0A 5HVJA 3SXSA 4MD9E 5KBQA 5CU2A 3TJDA 5HO8A 1PXPA 1UU7A 2PE1A 4FKVA 2NO3A 3G9LX 2OZAA 4GJ2A 3VS4A 3AMAA 3P4KA 4U5JA 3UE4A 3ZDUA 5AWMA 2A4LA 3EQCA 4MVFA 3ZM9A 2XM8A 4IWDA 2O5KA 1OUKA 4E7WA 2W7XA 1LEZA 1ZYLA 2VD5A 4FSUA 4QNAA 4FKTA 2C3KA 4FTUA 2XA4A 4S34A 3RVGA 3BZ3A 4DH1A 2W1ZA 1GZ8A 3GCSA 3DBFA 3AC8A 3HGKA 5D12A 1Q24A 2G2FA 4TY1A 4ENXA 4CEGA 1DM2A 2X6EA 3Q3BA 4XOZA 2BHEA 2GNLA 3DQXA 4O7VA 4E5WA 4DFZE 2PVKA 4GK3A 4XP3A 1XBBA 4OTQA 3VS3A 3ZSGA 1STCE 4RQKA 5AUYA 1W83A 3PTGA 4ZS0A 1M17A 3D5XA 3D7TB 3DAEA 5L6OA 2RG6A 2GCDA 4A4LA 1T46A 4PPAA 4BY9E 2C68A 2UVZA 4I4FA 3N9XA 4IQ6A 4USDA 3RM6A 1SVGA 5HI2A 3BU6A 3QU0A 4P4CA 4Q2AA 3RZFA 3TKHA 3VS2A 4PMPA 3P23A 3MDYA 4K8AA 2ITYA 3K3IA 3ZC6A 2UZTA 3FLZA 1V0BA 3KRRA 1Z57A 3GB2A 5FXQA 2GNHA 5K0KA 4E73A 2W9ZB 4YHTA 4CVAA 2XMYA 3EJ1A 2P2HA 3V8SA 1L3RE 3A7JA 3E62A 4OTGA 1Y8YA 3PXZA 4QPAA 2J6MA 2Y0AA 2ZV2A 3Q5IA 4Q9SA 4XBRA 4K1BA 3WZKA 4BRXA 1P4OA 4GG5A 4QMLA 2X9EA 3JPVA 4FNZA 3BQRA 4IBMA 4D1ZA 1Q61A 5AX3A 4NTSA 4CFWA 5IISA 3QZIA 4OUCA 4GYIA 4RGJA 4TYHA 4QQ5A 5DEYA 4C35A 4FSZA 3COMA 4OBOA 3KA0A 4LUDA 4FNWA 3QTXA 4JIKA 4C3RA 5IU2A 3O51A 5IQDA 5FP5A 4GVAA 3PVUA 4JIAA 4B8LA 4CFVA 3ERKA 4ZSAA 5CAVA 3QQJA 4G2FA 3MGYA 5AV1A 4BDGA 3IOKA 4PV0A 3HUBA 4RC2A 4IVBA 3WYXA 4F9CA 4J8NA 5IA1A 4RPVA 3TTJA 3VNTA 5BUEA 3NWWA 2YAAA 3ZXZA 1KE6A 4FT9A 4AW5A 2VN9A 4IAYA 5FTOA 4QYEA 4E6AA 5I4NA 4G3DA 3AG9A 4C7TA 2WQBA 4D4YA 4FOBA 3RALA 4IB3A 4EH3A 2JIVA 1AD5A 5HD7A 4EHZA 1A48A 2PHKA 2UW0A 2JLDA 1UNGA 2R64A 5D41A 2W99B 4BL1A 4CV8A 5IH5A 5L2SA 5CSVA 4AS0A 4CG8A 3IOPA 1ND4A 5CEPA 4XRLA 4AZVA 4BI1A 4D2RA 5BX0A 5DGZA 4GU6A 4CT2A 3TDVA 4FT7A 3BU5A 4UMQA 4ACGA 3RHXA 5HU9A 3D94A 1RJBA 2G2HA 3Q6UA 5DT3A 3G90X 3NUSA 4ACMA 2J4ZA 4FIGA 3U54A 2PZRA 1WFCA 1ZYSA 4HYSA 1OECA 3NNUA 3D9VA 3R1QA 2W0JA 4UX9A 4MX9A 1XWSA 4P2KA 1OL6A 3HV7A 4X6QC 4D4SA 2VX0A 4QP4A 5FRIA 4IANA 4BDCA 3F5PA 4CYJA 3DLSA 2CHLA 2PMLX 4C4HA 4IM0A 3G9NA 4BZOA 5JFWA 2DYLA 2GFSA 4XV3A 2VWYA 4IZ5A 1FBNA 2PULA 2AUHA 3ZBXA 4ALVA 3VJOA 3M42A 3A4OX 4FK6A 5TE0A 5E90A 3WE8A 4JDHA 4ANSA 1YKRA 5KKRB 4FTJA 2PUUA 3VS1A 1DI8A 4FT5A 2B1PA 1WCCA 3EQGA 2WTJA 2ITOA 1H4LA 4CYIA 5ETAA 3LCOA 3OEZA 2WO6A 1P14A 3JXWA 4RT7A 4BHZA 3WE4A 5DG5A 5J5TA 4BTKA 4FR4A 2CLQA 2P3GX 4RWKA 1YHSA 4AACA 4MWHA 5GIPE 3UNKA 3QCYA 3BE9A 5AUVA 5J87A 4FEQA 5JRSA 2IG7A 4AZTA 3KRLA 3IW6A 4K9YA 2QURA 4QMNA 4RJ8A 3LQ3A 1FGKA 1YI6A 2JKKA 4BGGA 4QMOA 3QCQA 5CEOA 3PP1A 4FKSA 3IO7A 5FBNC 3U8WA 2CGXA 3QUDA 4X3JA 2C5XA 4O0VA 2IZRA 3KXMA 5AUZA 1URCA 3R8PA 2PYWA 4U9AA 3VVHA 1YHWA 3QXOA 5KKRC 1MP8A 2Z8CA 2DUVA 4NCTC 3P1AA 3LJ0A 3W2OA 3E87A 1OZ1A 4TTHB 4FKLA 1ZLTA 4D5HA 3C4ZA 3HZTA 2X2LA 4S30A 4YC6A 4O91A 1CKJA 2ONLA 3R28A 2YFXA 3NUPA 3PVGA 4GVJA 3OVVA 2BTRA 3ZSHA 4CMTA 4FUYA 4I41A 2YM6A 4M0YA 5LCKA 4PNIA 4EYMA 3ZU7A 2BUJA 2C3IB 4GYGA 3O23A 3QKMA 4L53A 3TM0A 2X7GA 5I0BA 4NT4A 5ETIA 3FQEA 2X2MA 5TT7A 3V8WA 4AFJA 2CMWA 5GZAA 3U9NA 3OS3A 4KS8A 4XLVA 3OW3A 4FZDB 3REPA 3WZUA 2OH4A 3QLGA 4YJNA 5ETCA 4TWPA 3TNIA 4RX5A 2J50A 2YITA 4YJOA 5HTCA 1Z9XA 4DTKA 4I5PA 4RIYA 3MFRA 2IVVA 3QL8A 3VBYA 4M67A 2W1DA 5JZNA 2R3IA 1KE7A 5TOZA 4BZNA 3W1FA 2OXXA 4M13A 5AA8A 1NT2A 5EOLA 4EH6A 1NVQA 1BMKA 3IK3A 3M11A 4BI2A 3ORKA 1SNUA 2QHMA 4WUNA 2IPXA 3EHAA 3P5KA 5HEZA 3SW7A 3I79A 3F3VA 3KXXA 3HKOA 4TYGA 3A99A 3R2YA 2WQNA 4MH7A 3UQCA 3VJNA 1H0WA 3Q5ZA 2ZV7A 3VIDA 2VGOA 3DKGA 4AT5A 2C0OA 5IQFA 4CLIA 5EW3A 2YIXA 4EYJA 2LGCA 2WTWA 3GC8A 4A4OA 4UWYA 2XBJA 3CTQA 3MFTA 3PZHA 4FKGA 2P55A 5EW9A 3QQGA 1YDTE 3OOMA 3PA5A 1KUTA 2JD5A 2ZJWA 4GU9A 4EONA 3EQIA 5K3YA 4OAUC 2J90A 2XK4A 2RF9A 5J5SA 3ELJA 4NZWB 4ZJJA 4I5MA 3G2FA 2IZTA 3FI4A 3OROA 3R02A 3HDMA 3LVPA 5T3QA 3BQCA 1GIIA 3DS6A 3ORLA 3GCQA 3FZSA 4DT8A 3M2WA 1SYKA 2VNYA 1R0PA 4FKRA 3ZO1A 4FK3A 4C0TA 1KE5A 4ASXA 2VX3A 3BLRA 2UW8A 3F7ZA 4GFOA 3BYSA 4FV2A 5C8MA 4EK3A 1VR2A 4FNYA 2VZ6A 3I6WA 4YUQA 4RIXB 4F64A 2I6LA 3KRJA 4F70A 3C7QA 3LFDA 4J96A 4IDTA 4FKOA 3ZTXA 3SOCA 1U5RA 2ZDTA 4WD5A 2R4BA 4JJRA 1G8SA 3C5IA 3MH1A 4F08A 4L00A 4ZP5A 2H8HA 4DLIA 3IW4A 4NWMA 1HCLA 2JDRA 1OL2A 3R71A 4XEYA 2GNFA 2RG5A 5DR9A 4AX8A 1M52A 3KXGA 4PNKA 2FO0A 2QR8A 2BKZA 3E5AA 2IVSA 5KMOA 3R9OA 4XG6A 5DEWA 3VUKA 4LGHA 4WT6A 4Y8DA 5F9EA 3SAYA 5CF6A 3E8NA 1PHKA 3FMLA 2VO0A 4JL9A 3BBWA 1OIQA 4RJ5A 3TZ9A 4B0GA 4PMMA 2XIKA 2IZUA 3DBEA 2ETMA 3VRZA 2QOHA 3OCGA 3QYZA 3OT8A 3VBQA 3GCUA 3DNEA 4QMZA 3PSDA 3CSVA 4BIEA 3UO5A 1OI9A 4O86A 3PXYA 4RJ6A 4DTBA 5EYDA 5ANEA 5DRBA 3BHTA 2CGVA 5LVPA 1UV5A 2PUPA 4E5BA 4F7LA 2XNMA 4EQMA 2CPKE 4L68A 3UO4A 4RMZA 4MD8E 3HP2A 4IAZA 4C4IA 4EH8A 3R8LA 5FUTA 2OF2A 1JBPE 1XO2B 3ZRLA 2JAVA 4CTBA 2WD1A 5BVEA 2UZUE 3R04A 3ZLSA 3ACJA 2R2PA 2V7OA 2JAMA 4GSBA 5K4IA 4GMYA 4EQCA 4C61A 5M08A 2Q0BA 5CT7A 5A4QA 3EN9A 5JSMA 4KIPA 5KUPA 4IWPA 5JFSA 4UALA 3QBNA 2XEZA 2R9SA 1SMHA 5CEQA 3VF9A 2QKRA 4ZY4A 1IEPA 3F9NA 4X21A 1XKKA 2R3NA 4GV1A 5FGKA 2V5QA 3CJGA 3R7YA 4BCOA 3U6HA 2BZIB 2X81A 4YO6A 1G5SA 1CMKE 2UZEA 2OKRA 3NZ0A 4FZ6A 3UVPA 4O7ZA 4S31A 4FT0A 2YDIA 4RVLA 3O96A 5EHLA 4E5AX 3RAIA 4BCJA 2WOUA 1WBSA 3WOWA 3ZRMA 3PRFA 3AMBA 2C6DA 4AOIA 4P5ZA 3OY1A 3PLSA 4IM3A 5CSXA 4Y46A 3HV6A 5HD4A 1P5EA 1ZWSA 2GPHA 4YPDA 2BRHA 4IB1A 5IQAA 2OI4X 3W8QA 2GS7A 4AGDA 2BILB 4O7TA 3OUKA 3QF9A 4NIFB 5I9WA 4ACCA 4D2TA 3FXZA 4EOOA 2R3FA 1GY3A 3A7FA 1HCKA 5L8LA 2QOOA 4DYMA 5E1SA 3VF8A 4TWNA 4AT3A 3FUPA 2QOBA 4G1WA 5AV3A 2B9HA 2H96A 1ZARA 3DAKA 2ZM3A 3EMGA 5M56A 4G9RA 5GHVA 4OTWA 3TUCA 3VS6A 2YISA 4N4SA 3EQDA 4BF2A 4J98A 2XKDA 4E6QA 3O8TA 3ZO2A 4EOSA 4FV1A 2VWBA 1SZMA 4FT3A 5J1VA 4CTCA 3FV8A 4MQ2A 3RZBA 2WKMA 4O7WA 4GH2A 4XOYA 2ITXA 4BCKA 1MRUA 4YJPA 4AA5A 3FZTA 4E93A 1KE9A 3WZDA 1OPKA 4O0TA 5D1JA 1YW2A 3VQUA 4AGWA 4EHEA 3MY1A 3D2KA 4FSWA 2BMCA 3FYKX 3FBVA 3VW8A 5AFVA 1OIUA 1YXUA 3MYGA 5TR6A 4HZSA 5E8SA 4KKGA 3NMUF 3Q9ZA 3QQHA 5CY3A 3MI9A 3QGYA 2PVLA 5KCVA 3KFAA 4FL3A 4IAFA 3HYHA 4FL2A 4Z9LA 3R01A 5IA0A 3PE1A 1Q4LA 1M7NA 3I5ZA 2HXLA 2WMTA 3BRBA 2OF4A 4LL0A 5HNGA 4BTFA 4EH2A 2C1AA 5HTBA 3CGOA 3G6HA 5H2UA 3F2RA 1IA8A 5AX9A 2YCSA 3S2PA 3QRKA 3QX4A 4M12A 5HKMA 4FYOA 3LM0A 3HP5A 2ETKA 3PWDA 4GW8A 4R6VA 1PMNA 5GJFA 3TV7A 3V6RA 4G3FA 5EQPA 5HU3A 2HWOA 3POZA 3QA8A 3GU7A 4Y85A 3W2CA 2HZ4A 4X3FA 5HCZA 3VBWA 4U81A 4UWCA 2GHMA 2V22A 1XBCA 4FKWA 4E8AA 3FI8A 4ENYA 4FG9A 1YXXA 3EH9A 3GC0A 4QYGA 5C26A 3O7LB 4JQ7A 3AD6A 4XV1A 4DF3A 3RK9A 2WU7A 1BI8A 3MB7A 3QRTA 5C03A 5EM7A 3U55A 1LPUA 4ZLZA 4M3QA 5HTIA 4G3CA 2GFCA 4X2FA 3E92A 4C3FA 2WQEA 4L42A 4Q5EA 4ZY6A 5CAQA 5AUUA 4I3ZA 1LUFA 3U6IA 4LOQA 3D2IA 2VNWA 4ALWA 1WAKA 2B52A 4GT4A 4LQMA 3QZGA 5AV2A 3FL5A 4L7FA 4BB4A 1H0VA 4FSRA 3C4EA 1W7HA 4AP7A 2JDVA 4O7LA 2OZOA 2VO7A 5HLWA 5G6VA 3U6JA 4OGRA 3THBA 2QD9A 3MWUA 2XIYA 4U97A 3W10A 1W0XC 2SRCA 2F57A 3PG3A 5BPYA 3G5DA 2XNNA 3MJ2A 3R9HA 3Q4UA 2OG8A 5FP6A 4RG0A 4ANOA 3FKNA 2UZWE 4MXXA 3UMXA 4FNXA 3NYNA 3ZFMA 4EOIA 3B2TA 5AR4A 4JDKA 4V01A 3GBZA 1Q62A 4MBJA 4ID7A 3ZM4A 2ERKA 4RJ4A 4PDOA 2PMIA 1ZAOA 4XMOA 3QUEA 3R2BA 4FTOA 5LMAA 5DH3A 4U3YA 4G31A 4QYFA 3TJCA 4II5A 4XG9A 4AZFA 4Q9ZA 5BVFA 4NJ3A 3UZPA 4C8BA 3DFCB 4HYHA 5E1EA 5EOBA 3VULA 4NYEA 3K3JA 2VWUA 3W2QA 4EQUA 3FQSA 4HVIA 5CAUA 3QHRA 2ITQA 2BALA 1Y91A 2QG5A 4DGMA 4FKJA 2P4IA 3O0GA 3LLAA 2X8EA 3DDQA 4EOKA 2WHBA 4AGUA 3BU3A 3D4QA 3QUPA 4KAOA 5AEPA 5I9ZA 4NFMA 4R8QA 1OKWA 4X6RA 2IN6A 4C59A 4U7ZA 5AP0A 4FTAA 3W2SA 3NSZA 5IKWA 4IC8A 4DH5A 4EBVA 4N6ZA 1IR3A 4QMWA 5D9HA 4AUAA 1PY5A 3IDCA 4NEUA 3UDBA 5DI1A 2A19B 1YVJA 4I1ZA 5B2KA 5DOSA 3SA0A 5C9CA 3FKLA 3RK5A 4QP6A 2BPMA 4MQ1A 4NM0A 1ZYDA 2GNIA 2FYSA 4RA5A 1FQ1B 1M7QA 1PYEA 2VTHA 3PZEA 3QKLA 4L43A 4XH6A 4F0IA 4YURA 2PPQA 4WG3A 4DT9A 5B2MA 2WEVA 3HAMA 1NVRA 2BAQA 4EUUA 1J7IA 5IF1A 4K11A 3ZUVA 1V0PA 3GQIA 3MH0A 4JBQA 4HVGA 1OBGA 3V01A 3PLAE 5I9YA 1YI4A 4XX9A 2C5VA 3NAYA 5HOAA 2C0TA 2O2UA 2XNBA 5AV4A 3C5UA 4OT6A 4O38A 4U45A 4ZJIA 3BI6A 4GG7A 1GNGA 3LMGA 4ZSGA 4MXAA 2J0MB 4KIQA 5AP6A 3MIYA 3NRMA 4UEUA 4BWXA 3P7CA 4U41A 5M51A 3DT1A 2P2IA 2PZIA 3ZLXA 4O1OA 4KKHA 1CM8A 3UMWA 4APPA 4BR3A 2V7AA 3HMNA 3KVWA 3OBJA 2VTOA 5EG3A 3VUIA 4YP8A 2Z2WA 2NNWB 5DR2A 3V8TA 3PA4A 1PKDA 2J5FA 2FSMX 4LI5A 3CGFA 2QOCA 4TKSA 3KU2A 5CQUA 4EK4A 5ACBC 5C27A 5KMIA 5M53A 3UOKA 5HE2A 1V0OA 4AZWA 5A54A 3CQEA 2PU8A 3ZLWA 3PIXA 2B54A 3KN6A 2AYPA 4FTRA 3TWJA 3V51A 4BIBA 1Q41A 1XHAA 2F7EE 4TWCA 3NYXA 3MTLA 4E4NA 5BVNA 2W1CA 3CE3A 4NM3A 5T6KA 3EFKA 4R7IA 3P79A 4CKIA 4QO9A 1XJDA 4W8DA 5AP5A 4BVUA 3P0MA 1UKHA 3FY2A 3KCFA 3I7CA 3TT0A 4ANNA 3RWQA 3QXPA 4B9DA 3TNHA 1WBVA 3EIDA 3FQHA 3MPTA 4DG0E 5G1XA 4X2GA 4FEWA 4BDAA 4ZMEA 5CALA 5M07A 2IZSA 2O0UA 4H3BA 5CEKA 3HV5A 2YM8A 4O22A 2PVYA 4RVTA 3W8LA 4QTEA 2IWIA 3VUMA 1M14A 4J53A 3PE2A 3OOGA 2ZOQA 3AC4A 3BHYA 3P08A 4HVHA 2Y6OA 2YIRA 2FGIA 5DN3A 5CEIA 2QCSA 4FTTA 3DXQA 2R3QA 3LW0A 3MV5A 4FA2A 1XH7A 4FV0A 4XBUA 3RAWA 4ZY5A 5A9UA 3DAJA 4PX6A 4CCUA 1GZOA 1URWA 2X2KA 3UNZA 4U3ZA 1ZRZA 2HIWA 1YWVA 2A0CX 3AD4A 3EFLA 5K0XA 3KN5A 3LMHA 4X2KA 2BTSA 1U5QA 4OW8A 3R1NA 3UNJA 1SVEA 3DY7A 1H1SA 4I23A 5M4FA 1GAGA 4GEOA 2DWBA 3NW7A 5ANKA 2X8DA 5CQWA 3BYOA 2QQ7A 4TZRA 3RP9A 5L8KA 5HESA 5I9UA 5HORA 3LQ5A 2P0CA 4Q5HA 5BQ0A 4JDIA 3HMMA 2C1BA 5A6NA 3QD0A 3B2WA 2WZJA 4I4EA 3Q9WA 2FUMA 3ZUTA 3NVKI 2OJ9A 2CN5A 3ZDIA 1FMKA 4DEIA 3OC1A 4M15A 2J5EA 3P7BA 2YM3A 2CGUA 3A8WA 3H9FA 3HV4A 3TZMA 4ANLA 3EZVA 3R1YA 3F7WA 3HMPA 4MXYA 3VN9A 4FV8A 3ZZWA 1J3HA 2R3JA 3EQPA 5DMZA 2Y4IB 3GENA 3NCZA 3V5QA 4FZAB 4FODA 4LRMA 4FIIA 4YNEA 5HG8A 1PXNA 3H30A 3NNWA 4QP9A 3FXXA 2VTRA 3D83A 2PE2A 2Z7QA 4FVRA 5IA4A 3E8DA 4TW9A 3UZRA 2E9UA 4DEDA 5LMKA 4U40A 1VYZA 4FTQA 5EM8A 3SX9A 2WMBA 2WNTA 3LCSA 3UG1A 4C57A 4D55A 4Z55A 1S9IA 2WXVA 3P7AA 4W4YA 4OBPA 3GCVA 3HA8A 3KXNA 1WVWA 4RIYB 5ETFA 1PW2A 2QLQA 5I9XA 1KWPA 4ZS4A 3CBLA 3A60A 4ZTNA 2XBAA 3ITZA 4QMQA 3QTZA 2J0KA 1OKZA 2WMXA 2BROA 3BPRA 2ONLC 4ZSJA 3UZTA 5HG7A 1YXTA 4I92A 2Y4PA 4LRKA 2GU8A 2UW3A 4L3LA 4C02A 4MXCA 3ZXTA 2BAKA 3U51A 2RSVA 4AOJA 2PUIA 3UBDA 4W4XA 3ZO4A 2CKPA 4G9CA 2YJRA 3SGCA 1U59A 2GS2A 5DYJA 5DA3A 4QMMA 3W55A 1ZYJA 4YC3A 3CTHA 5J95A 3VUGA 4P7EA 1PYXA 2EUFB 4GIIA 2BFYA 4PWNA 3ZUUA 4UV0A 4CGAA 4C33A 1DS5A 2B0QA 3AXWA 3BIZA 2C6KA 2WU6A 1QPDA 2W1GA 3WZEA 1U54A 4MEDA 4QNYA 2C6LA 1R78A 4CT1A 4HNFA 4J99A 4QMVA 2YJSA 2XCKA 5GNKA 4HZRA 4JNWA 4J95A 4MWIA 4DHFA 4DG3E 1Q3WA 1UA2A 4UYAA 4XCUA 3RBWA 4AFEA 2CNUA 5I9VA 3LXLA 4DEHA 2IW9A 1DAWA 3UOHA 4H58A 2JDOA 3R8MA 3MN3A 4QYYA 3F2AA 4NW5A 4IAIA 3TEIA 2BVAA 2PZ5A 3JVRA 2GNGA 2CDZA 4WKQA 4YLLA 4QP8A 5DBXA 2PVJA 3I0OA 4EKKA 2CCHA 5C8NA 3RPVA 3D5WA 3PY1A 3RMFA 4WSQA 3ZO3A 3GOPA 3ANQA 4PDPA 3TZ7A 4DH8A 4PPCA 4JI9A 3R9RA 4HJOA 5E9EA 5AP2A 3S1HA 2REIA 4YGAA 2PVRA 4YHJA 3DBQA 2NRYA 4D2WA 3FMMA 2UZOA 2E9PA 4E20A 3QTWA 2QOFA 1MQBA 5JEBA 4J97A 4ALUA 2VUWA 3MSSA 4OTHA 4UZDA 4ASDA 5FLFA 4GJ3A 3GC7A 2A1AB 3HL7A 1UWHA 1UNLA 3Q53A 3KVXA 4BDBA 3OZ6A 3P9JA 5CX9A 4O7RA 4IB5A 3OUNB 3L9PA 4V05A 4NSTA 3H0YA 1ZOEA 4QTCA 1AQ1A 4ZTRA 5J7HA 5BYLA 4R3RA 5CANA 1Q8UA 3NEWA 2VTIA 5IZFA 3MVMA 4KSQA 4DGLC 1H24A 3POOA 4BC6A 4YSJA 1IAHA 4CFNA 2C5OA 3KMUA 3QC9A 4JX7A 4O2ZA 4ZLOA 5LOHA 4KIKA 4F0GA 4TNDA 2XIZA 2W4JA 2WOTA 3ACKA 3EYGA 4H1JA 5FEDA 3QTUA 5DRDA 4ACHA 3DXNA 4GFMA 3R21A 1ZMUA 4A9RA 5IUGA 4PY1A 4NW6A 4KWPA 4EH9A 3DDPA 3GOKA 3PJ3A 5L2TA 4TPTA 4BI0A 2ZYBA 3K54A 5CT0A 4E26A 2BFXA 1PXMA 2OLCA 4IH8A 5CU3A 3SW4A 4DA5A 2R0IA 5HE0A 3GC9A 2XF0A 3BV2A 4J71A 4X7QA 1K9AA 1V1KA 3SC1A 2WTVA 4RX8A 4XRJA 2VWIA 4MAOA 4C4EA 4NTTA 1QPJA 3NYOA 1XH4A 3NDMA 1JLUE 4ASZA 3N4UA 4CRLA 4LGGA 4XP0A 5DWRA 1REKA 2WFYA 3I6UA 2IJMA 2C30A 2HZIA 2UV2A 2W1IA 4ZEGA 4MNFA 3G51A 3LHJA 2H34A 3HMIA 4KKEA 4F1MA 3FSFA 5JN2A 4PMSA 3NUUA 4WRSA 2Z7RA 4U8ZA 4C37A 1H00A 1OPJA 3PFQA 4ZXTA 2GHGA 4N0SA 4BZDA 4F0FA 5D7VA 1XH6A 3FWQA 3QLFA 3ZH8A 2E2BA 4TYEA 2BZHB 4U44A 3RI1A 3BHUA 3H9OA 4CZUA 2WTKB 1BL7A 4BBEA 4BBMA 4BFMA 3CC6A 4GIHA 2B9IA 1SVHA 2WPAA 3ENHA 4D0XA 3F82A 3F2NA 4DH7A 3GP0A 5DT4A 4MK0A 5JGDA 4KUJA 3VBTA 5C4KA 1NXKA 3WF8A 4D4VA 4IEBA 2RFNA 4JS8A 3C9WA 1H1PA 4OTFA 3DFAA 5EM6A 2WTDA 4K2RA 4EH7A 1XR1A 5A4TA 3NIEA 1RW8A 1VJYA 4AG8A 1K3AA 4DCEA 2XM9A 3F5GA 4ZK5A 1TQPA 4BDKA 4O84A 4FMQA 3PXRA 4EL9A 3QTQA 2VTSA 2W1HA 3C4WA 2YLEA 3QD4A 3UOLA 4DG2E 4ERKA 1WVYA 2PMNX 1GJOA 4W9XA 3T8OA 3RPRA 4Y5HA 3RWPA 4YZCA 4WG4A 1OL5A 2XYUA 5D11A 4FSMA 3AQVA 4LOOA 5FEEA 4KRCA 2XNPA 3ZYAA 4P90A 3SVVA 3SDJA 3RK7A 4BDIA 4TT7A 3EL8A 4D9UA 1BX6A 3UPZA 2WTKC 4I93A 3LXPA 3D15A 2XJ2A 4F99A 3TZ8A 4I24A 2OJIA 4U43A 5EW8A 4FTLA 1MQ4A 3NW5A 2E9VA 2OFUA 5BVOA 4WUAA 3N4TA 2VU3A 3CD8A 2YACA 1H1RA 2Q0NA 3FZ1A 4LUEA 4QP3A 4FIJA 5KMLA 5CU4A 3ZFYA 3ORZA 2B53A 4N70A 4ZZOA 1YI3A 2Q83A 1OGUA 2WMRA 2JC6A 1JSVA 3FLSA 5LQFA 3LFCA 1KE8A 3OHTA 3BYVA 3GQLA 4NKAA 4XV9A 3RGFA 1XH8A 4KRDA 5FXRA 2YM4A 4Y73A 3KY2A 3MS9A 3DKFA 2VWVA 4HGTA 3AD5A 1UKIA 4FIHA 4WA9A 4DINA 4YPSA 4Y95A 2XNGA 1O6LA 2CGWA 4L6QA 3BE2A 4J8MA 3OW4A 2YM5A 3AC2A 3CQWA 4NM5A 3I81A 5DVRA 4DGOA 3ZFXA 2ESMA 4X3FB 2EB2A 5AAEA 3RKBA 1M2QA 1UU8A 4MBIA 2R3RA 2KTYA 4Y72A 1FINA 3OG7A 1B39A 4I0RA 4JQ8A 1ZMWA 2WIHA 2OIDA 3QD2B 4YU2A 3DKCA 3Q2JA 5DIAA 3R1SA 5H8GA 3KREA 5H8BA 3I60A 3E7VA 5EH0A 4UN0C 4YLJA 3R7UA 3LCKA 3PY0A 5CLPA 3V6SA 3LCTA 3SHEA 3D5UA 2Y6MA 2J7TA 1I09A 3TIYA 5L3AA 4BTJA 4BWKA 4F1OA 3AT4A 5EYKA 3UJGA 3JVSA 3QQFA 4F9YA 4K6ZA 5C01A 4AA0A 1RDQE 3F3UA 4HW7A 2HYYA 3QRUA 5IQGA 4HVSA 5CNNA 2VWXA 4GK2A 3K2LA 4G3GA 3C0IA 2B9JA 4RX9A 5ANOA 1HOWA 3BEGA 5E8ZA 4USFA 2QHNA 4WSYA 4RBLA 3KK8A 5KE0A 5KMNA 3DXPA 1PXJA 4JAJA 4QQTA 3QX2A 2HAKA 4X3FC 4PTEA 1F5QA 5FM2A 2WIPA 3GXLA 2XK7A 3L9NA 5HGIA 1G3NA 4C36A 3OF0A 3A8XA 5EI2A 4KS7A 3PWYA 4BDHA 3CJFA 2J51A 4NUSA 3ZS5A 4O2PA 4DAWA 3SLSA 4GL9A 1QMZA 1H27A 4AOTA 4ZTHA 3D7ZA 2VAGA 2RIOA 2PK9A 4ANBA 2JDTA 1FGIA 5J9YA 3ODYX 2ZM1A 3MA6A 2VO3A 4KA3A 4V0GB 5L4QA 5CF4A 2EXMA 2UZBA 4U42A 3OCTA 4G3EA 2Y9QA 2XKCA 3HV3A 4ZSEA 3RINA 4BIDA 4CQEA 4QTAA 2BZKB 5ANJA 3DK7A 4B6LA 2E9NA 4CFMA 3TNWA 5CF8A 1B38A 4LV5A 3EB0A 1X8BA 4D1XA 4EOPA 4A7CA 3CD3A 4O7SA 5E4HA 5IDPA 4QP1A 4CRSA 4YTIA 4TL0A 2G1TA 5KO1A 2VTLA 3JY0A 2OXYA 1PXOA 4RA4A 2XK6A 3OWLA 3FC1X 5EHYA 1H25A 3RM7A 4M7IA 3PVBA 3IECA 5I5ZA 2HZ0A 5AR5A 1PF8A 4FBXA 3GU8A 1GOLA 3VRYA 1IG1A 2RFDA 4AN2A 5A46A 3AOXA 3GCPA 3IGGA 3C50A 4OTPA 3RHKA 2W96B 5IA3A 5K9IA 5L2IA 4KB8A 1Q3DA 4CKJA 2GSFA 1JKSA 4EHGA 4HCUA 4RSSA 3DK6A 4EEVA 4JG8A 2BDFA 1IA9A 2W5BA 2ITWA 1PXIA 5F1ZA 3PA3A 4M0ZA 2PVMA 3JS2A 4UXQA 2R3LA 4HNIA 2ITZA 4L01A 2FSLX 4HCVA 4ANQA 4DEGA 3MH2A 4RFMA 4YTCA 3ODZX 3CR0A 4J52A 1U4DA 1WBOA 4PDSA 2R7IA 3QALE 5E8VA 3IW7A 5AV0A 5HG9A 5HICA 4DGNA 4YTHA 2FSOX 4LM5A 1FVVA 3HLLA 4RWIA 2YCFA 3S95A 5EYCA 4MD7E 3EN7A 2C4GA 2XZSA 5DHJA 5LWNA 1KSWA 5GZ9A 5JRQA 2BDJA 5BUIA 4BCGA 3HNGA 1PMUA 3JY9A 3BX5A 5CVFA 3T3VA 2UVYA 3F61A 4X0MA 1REJA 3H9RA 4RRVA 4PP9A 3NUAA 1YOMA 5KMJA 2QVSE 3FPMA 2QONA 5C4LA 1FVRA 5HIEA 2ZV8A 4ITIA 4L3JA 5FXSA 4F7SA 4FKUA 1QPCA 1Q97A 3CQUA 4IACA 4TN6A 4DFLA 4A9UA 1JKLA 5HO6A 1H07A 4F63A 4ZOGA 5CTPA 3GUBA 1NY3A 3LXKA 2OIQA 3C4CA 3IQ7A 1RE8A 5CVHA 4A9YA 4O7YA 3A2CA 3UODA 4IWOA 4FTCA 3H0ZA 2QODA 5FWKK 3RPYA 4XG2A 4JDJA 1QL6A 4NL0A 3SRVA 3QC4A 3FKOA 3OXIA 4AE6A 1W82A 4AW1A 4BKZA 2ITTA 2O3PA 4FTIA 4ONAA 4ZZMA 3F6XA 3FMHA 2XS0A 4F65A 3H10A 3SOAA 4JG7A 5CXZA 2H9VA 5IMXA 3NYVA 1Q5KA 4M69A 5CXHA 5JH6A 4IB0A 2CKOA 4U6RA 2I1MA 4ARKA 4D2SA 1PXLA 4JR7A 3WF7A 5A6OA 3SQQA 4C34A 2O65A 4BGHA 2W5HA 3PSBA 4JRNA 2X8IA 3LKMA 2WGJA 4IX5A 4LV8A 2OSCA 4OTIA 3R83A 5AR7A 4R78A 3D5VA 3P78A 4YC8A 3UYTA 4FZ7A 2I40A 2QO9A 4QMYA 3IGOA 3CP9A 3HRCA 3F3ZA 3QKKA 5JGAA 4PL4A 3NIZA 1UWJA 2C3JA 2V55A 3C13A 4ZMFA 4LMUA 4D0WA 3NUXA 3ID6C 2Z7SA 3NAXA 3ZBFA 5EQYA 3VBXA 2Z02A 4MF1A 5KHXA 4QT1A 3TNPC 1PRYA 3KRXA 3R0TA 3C51A 3QZFA 4OT5A 4MF0A 2G2IA 4FTMA 3KKVA 4I94A 4DFNA 3HA6A 4IIRA 2A27A 4FUXA 4BCNA 1F3MC 1OVEA 2YIWA 3H3CA 3OEFX 5CAPA 3ORIA 4V0GA 4X2NA 4Z7HA 4DTAA 2ITNA 3OFMA 3ULIA 4D9TA 3NLBA 4CV9A 5AAFA 2JIIA 2YM7A 2FH9A 2OH0E 3OXTA 3W18A 4ZTMA 2R5TA 4FG7A 3WILA 5CSPA 4ORKA 4QTDA 4Y83A 3UYSA 2LAVA 3PPJA 2JFMA 4S32A 1PKGA 4RVKA 3BGQA 1LEWA 4OLIA 5AMNA 3OD6X 2RKUA 4CMOA 4EZ7A 5E91A 5EDQA 5H3QA 1UU3A 4OBQA 4YZDA 4C3PA 4IDVA 4U80A 1WBWA 2H6DA 4EWHA 3W16A 4OR5A 1J7UA 3BYMA 3U4WA 2EWAA 2ZDUA 2VTAA 2R3KA 3CKXA 4IVAA 4O1PA 4BDEA 2YLFA 3R8UA 4E6CA 4EORA 3V5PA 3FMDA 5HX8A 3V3VA 5A14A 1J91A 3PJCA 1R3CA 4QMTA 5IQIA 4WNPA 3UPXA 5D7AA 3TACA 2F2UA 4MYGA 1SM2A 1XBAA 2PTKA 4C4FA 4IZ7A 4D5KA 1OITA 3ENMA 5IEXA 2VRXA 2X0GA 4HGSA 4ZLYA 4O96A 1W84A 2CKEA 3TNQB 1JAMA 2W4KA 2P33A 3CLYA 4YMJA 3LAUA 5IG1A 4PDYA 4YJVA 3PYYA 3COHA 3FDNA 3MFSA 3NCGA 4GK4A 4I6BA 4TYJA 4ZTQA 2XYNA 5ICPA 1CKIA 2QOKA 2VO6A 3MB6A 5FQDC 1H01A 4C38A 2HENA 4UMPA 5C8KA 3I7BA 1PXKA 2I0YA 1YQJA 5DR6A 3UC4A 5LMKC 3MVHA 3U9CA 1Q8WA 2WTCA 5FM3A 1U54B 3B8RA 3TCPA 2PSQA 4OTRA 1Q99A 4AQCA 2BHHA 1ZXEA 5CASA 3EWHA 5L2QA 2ACXA 4DBXA 3FI2A 4O27B 3QCSA 5CNOA 4EJNA 5HX6A 5CSWA 3BWJA 3E63A 4PTGA 3BGPA 4YNOA 3KK9A 2JITA 3DTCA 3EFJA 2W1FA 4EK6A 3DZQA 2X4FA 2XK3A 4G34A 5CU6A 5AUWA 1YDRE 1JNKA 5TKDA 1Q8YA 4YJTA 1ATPE 2QR7A 2WELA 3LPBA 3QRJA 4HPUE 4H05A 4PQNA 2ETRA 3L1SA 5DNRA 4BDDA 5DPVA 2XNOA 3L8XA 3GU6A 4AZEA 1GZNA 5BVKA 4JRVA 3SXRA 3KC3A 3C0GA 4L9IA 2WQMA 3AC1A 4H3PA 3KF7A 1TVOA 4D2PA 1OKVA 3HDNA 3LFSA 1H08A 4G16A 5GZ8A 2J0JA 3FHRA 2WMWA 2OW3A 3FZPA 3R9NA 2QOLA 4EZ5A 4AW2A 4QP7A 3KQ7A 3NR9A 3OCBA 4UMRA 3GU4A 3FL4A 1OKYA 4YJQA 3C4XA 4PF4A 3O50A 1QCFA 4KSPA 3WF5A 3BLHA 5ANIA 4BICA 4DN5A 4CKRA 4EK8A 4AN9A 4JLCA 2VV9A 1E1XA 2DQ7X 3KULA 3WF6A 4R5YA 3V5JA 1VEBA 4XYFA 3RNIA 3QWKA 2V0DA 1H1WA 4FV3A 4DGGA 3EQRA 4LOPA 4DH3A 3HRFA 4EOLA 3EKKA 2OIBA 3ROYA 4WNKA 3MH3A 3GI3A 2PZPA 4XNEA 2YCRA 3OWKA 2X6DA 3MBLA 3VUHA 1UU9A 3LFFA 4AZSA 4KIKB 4F6UA 2VWWA 1JVPP 4IHPA 4G17A 4FV9A 5GINE 2YIQA 3F3WA 3LQ8A 1YDSE 4YLKA 2I0EA 5JZJA 4FTNA 4GT5A 3TV4A 4GCJA 4M84A 4F9WA 3CCNA 4JBVA 3QTSA 3ZMMA 4JG6A 5D10A 4AF3A 1YHVA 3NPCA 2YCQA 3CY3A 1XH9A 1R1WA 5JQ8A 3GVUA 2C5NA 4FICA 4O0YA 4S2ZA 2XIRA 5J7BA 1VYWA 3PJ8A 1MRYA 5EI6A 1H8FA 1OPLA 2XRUA 2ZMCA 4FGBA 4FSNA 5E7RA 3Q9XA 4S33A 3FAAA 5M4UA 2UZDA 5AUXA 4EUTA 2ERZE 3DNDA 2G15A 3FEGA 3RNYA 3QTIA 1GZKA 3N4VA 3DB8A 5AJQA 3HEGA 4U0IA 3VUDA 3DQWA 4L46A 4IX3A 4CXAA 1CSNA 3DBCA 4DLJA 3UIXA 4AE9A 4FKPA 4CZYB 5HVYA 2EVAA 3FMEA 4PRJA 4ZJVA 2CCIA 3BLQA 1FVTA 2J0IA 2RFEA 2OGVA 4XV2A 5E8TA 5AIRA 4L45A 3BKBA 3GFWA 3MY0A 5E8XA 3TXOA 2OJJA 5BYZA 1NA7A 2BZJA 2JKMA 4M68A 4QMUA 2J0LA 4JVGA 2KULA 3NVMB 3MY5A 1S9JA 4RC4A 3FHIA 3D0EA 3ETAA 1JKKA 5DT0A 4CNHA 3NGAA 4OAVB 2YWPA 4I0TA 3COKA 3DKOA 4C2VA 5B2LA 5FTGA 3E8CA 4JXFA 4EBWA 3FMJA 4M97A 2F7XE 5BMSA 2Y4IC 3B8QA 3FLYA 3WI6A 4EH5A 4YZBA 1MUOA 3GT8A 2XRWA 4CFUA 5EM5A 2HW6A 3TV6A 2FB8A 4FV5A 4IJ9A 4WNOA 1Y57A 4YJRA 2C47A 4MNEA 4WRGA 4JBPA 5KZ0A 2CNQA 4O0WA 4I5HA 5EHOA 5CWZA 4BKJA 1L8TA 4E3CA 4IX6A 4RJ7A 5HHWA 4R3CA 2HWPA 4HVDA 5EKNA 3KXZA 2UW6A 4MXOA 4PMTA 2BRMA 3MPAA 4J7BA 5AP7A 5A4LA 1ZOGA 3PY3A 3Q4TA 5CAOA 3R7EA 2W06A 5FDXA 2E9OA 1NVSA 2Z7LA 4ZIMA 2Y8OA 4RZVA 3W32A 3PDTA 3BCEA 5IA2A 1BLXA 2F9GA 2O63A 2W5AA 4BTMA 4IVDA 5BNJA 2C5YA 2JKOA 4N57A 1YWNA 3H4JA 4W8EA 3Q2MA 5DFPA 3TN8A 4A9SA 4LGDA 5J9ZA 4PTCA 5HNBA 1P2AA 3SD0A 2NP8A 4RWJA 4EZ3A 4FV4A 2IO6A 1ZZ2A 2F2CB 2W17A 3RAKA 3UIBA 5HNIX 4YTFA 4FYNA 2XJ0A 3G6GA 3PJ1A 3SV0A 5IEVA 4RZWA 3BHHA 3S4QA 2QC6A 5HBEA 3SKCA 4RLKA 2XK8A 3UVRA 5J1WA 2Z60A 4K0YA 5AA9A 2GQGA 3FPQA 4BYIA 4C4GA 1KOBA 3U4UA 4MCVA 1XQZA 4I22A 3RJCA 5LMBA 1BKXA 5HLPA 3GEQA 4BKYA 3HX4A 4KINA 5TF9A 2C3LA 4NJDA 3TG1A 4JBOA 3WARA 5FDPA 4H1MA 3R63A 1M2PA 2OFVA 2QG7A 4W4WA 2HY81 5GJDA 2JDSA 4JAIA 5CVGA 3LFAA 3PSCA 4EI4A 4B8MA 3S0OA 2PVFA 4QMSA 2OWBA 2HK5A 4TXCA 5E8UA 3PRIA 5EKOA 3MPMA 2YZAA 4UZHA 1B6CB 3QA0A 4RQVA 4YJUA 1H26A 3GNIB 4I6HA 5JFVA 3IKAA 3TI1A 2PMOX 3R7VA 1EH4A 1H1QA 3R00A 4O6LA 3E88A 2AC5A 2BIKB 3ZZEA 4CD0A 4K77A 2QU5A 5J79A 3UQGA 4FSTA 2AC3A 2VWZA 4IX4A 5E8YA 3DTWA 3K5VA 4KABA 3DZOA 1A9UA 5CSHA 4USEA 5LVNA 5AP4A 4APCA 3VS5A 2CKQA 3O7LD 4L67A 3Q04A 4AA4A 4QMXA 4EHVA 4F9AA 3LFQA 2XCHA 5ACKA 3II5A 5AIKA 3FMKA 2CSNA 3FLNC 2ITVA 4BGQA 3DBDA 4YBJA 2XIXA 4JT3A 2RL5A 4PL3A 4EOQA 4Z16A 4IFCA 3HUCA 3LFEA 4NH1A 2O64A 3E3PA 3IDBA 3IS5A 1YWRA 4CFXA 1TQIA 3LZBA 3OT3A 4WBBB 1O6KA 4FEUA 3FMNA 3PVWA 2JIUA 2YA9A 3OY3A 1WMKA 3AT2A 3KMWA 3EQFA 4F7NA 2BR1A 4DEEA 3DB6A 2ZMDA 1E9HA 2F49A 3RTPA 2B7AA 3R22A 3PXFA 4IFGA 3DJ7A 4L52A 3LM5A 4IE9A 3QQLA 4EWQA 1OUYA 3LIJA 1Q8TA 3BYUA 4YSMA 4EH4A 4F6SA 2C69A 2FA2A 5CENA 3VO3A 3BEAA 3E93A 3OBGA 2GHLA 5M57A 2VGPA 3LCDA 4MHAA 4M8TA 2XNEA 3MFUA 3O8PA 3R30A 2ZVAA 4ANMA 3UTOA 4HYIA 2ZV9A 3D7TA 4O21A 1R0EA 4UBAA 3KEXA 4XS2A 3SG8A 2YDKA 3BELA 3P86A 1DAYA 4ACDA 1BI7A 5JKGA 4TNBA 4BCPA 5CF5A 4IC7A 3TUBA 2WB8A 1P4FA 5EDRA 4CMUA 3GGFA 3OTUA 3G0FA 4KIOA 4QTBA 4BDJA 1VZOA 4FZFB 3E64A 4BCHA 3R7OA 2R3GA 3OTVA 5LVMA 4FGRA 3CY2A 4JX3A 2QOQA 3EN6A 1JOWB 2UW9A 3SXFA 4QRCA 3V04A 1Z5MA 2I0VA 5AR8A 3EFWA 3PG1A 1OIRA 4L7SA 5JQ5A 5EI8A 4LRJA 3A7IA 4O0UA 1J1CA 2X1NA 2VTMA 1I44A 3DJ5A 3Q52A 5HBHA 5M55A 3EKNA 4GFGA 4A07A 2GTNA 3EN5A 3JYAA 5AP3A 3NUYA 3ZLYA 3VWAA 2UW4A 5CU0A 3C1XA 4KD1A 5EFQA 5H8EA 4F9BA 5CEMA 2VTPA 4ZTSA 3W2RA 3UIMA 2O8YA 4DITA 4L3PA 4Z3VA 3Q6WA 4CQGA 4WOVA 5JGBA 2R3OA 5HLNA 5KNJA 4IAKA 3UVQA 2GNJA 3TIZA 4YHFA 2XKFA 3DK3A 3IONA 2QOIA 3KRWA 3QQKA 5AM7A 1KV2A 4LMNA 5A4EA 5K5XA 3NNVA 4WHZA 3CTJA 5BMMA 5IQEA 1UVRA 4ZTLA 3UG2A 4DFXE 2C6MA 3UGCA 3L8PA 3VBVA 5M09A 2Y7JA 3ET7A 3MVLA 5M4IA 3NNXA 3A7HA 3QTRA 2OJGA 3AT3A 4W9WA 2CN8A 2DS1A 2OBJA 2R3HA 2W4OA 3AC5A 3DLZA 2IVUA 1ZMVA 2QO7A 3L8VA 3W2PA 3ANRA 3HMOA 3FJQE 4IXPA 2YABA 4J1RA 5KX8A 2YDJA 3V5TA 3O17A 3NW6A 4F7JA 3OWPA 4RC3A 2WMUA 2IW6A 2R3MA 3SRVB 4FOCA 4XG3A 3F88A 1KV1A 5IA5A 2PZYA 3LOKA 3WBLA 4IM2A 3TUDA 4XG8A 5I3OA 2RGPA 2JKQA 4DEAA 4G6LA 4M69B 4W4VA 1Y6BA 4FV7A 3BWFA 4DFUA 4KBKA 4N6YA 1OMWA 4KNBA 5T68A 3ZOSA 2JBOA 4AT4A 4DE4A 4AXAA 2JEDA 5AAGA 3UQFA 3Q4ZA 3FLWA 2NRUA 4H39A 2C0IA 1R39A 1YXVA 3MA3A 4ASEA 4DFYA 4ZAUA 5M4CA 1G8AA 3ORTA 4NCTA 3UP2A 4R5SA 5CZIA 5TO8A 2WQOA 5JMSA 4I5CA 4O82A 3WIGA 1JKTA 4EC8A 2F4JA 2QNJA 1MRVA 4AGCA 4CFFA 5H9BA 1OIYA 2BCJA 3K5UA 3PPZA 4MBLA 5FEQA 3R8ZA 1PMEA 4YO4A 4QMPA 5IMEA 2VTQA 3QYWA 3W33A 2UW7A 2OXDA 4FF8A 5LJJA 2VTNA 2JBPA 3MJ1A 2EXEA 3EL7A 3Q32A 2PWLA 5LXMA 3VHKA 3I4BA 3A7GA 4WIHA 4CSVA 4XP2A 1OBDA 1BL6A 4YZNA 4RIOA 3ZRKA 1JWHA 4RX7A 5C1QB 5JK3A 2G9XA 4MTAA 3TDWA 5M06A 3ZONA 3VAPA 2YHVA 1GIJA 3RPSA 5AR3A 3VHEA 4BCQA 4BN1A 4ZSLA 3WZJA 4O81A 1ZYCA 4HYUA 5HBJA 5HG5A 3FZRA 5EDPA 3IPHA 4FC0A 3CPCA 2FSTX 3ALOA 4YZMA 2YZLA 3PIYA 3R6XA 4TRLA 4E1ZA 1GIHA 2OU7A 3F3TA 2C6EA 4P5QA 2V62A 3C0HA 3EQBA 3PP0A 4FKQA 4EK5A 3WIKA 5GIOE 3L9LA 3RPOA 3NS9A 3TL8A 3V5WA 3QRIA 2PY3A 5LARA 4BWPA 4E4XA 2R7BA 2W9FB 2HOGA 4MXZA 4XJ0A 3OCSA 3RCJA 4F09A 4K33A 2XUUA 3F66A 4YZ9A 3TTIA 4BCMA 2PVHA 3ZSIA 3Q96A 4UXLA 4CCBA 5K4JA 3KF4A 2CNVA 5E92A 3E3BX 1WZYA 3TKIA 5JFXA 4EJ7A 2GDOA 3ORXA 4F4PA 3NUNA 5M44A 4QPMA 2UZVA 3I0QA 3NX8A 3QAME 2WAJA 4FEVA 5CS6A 2QLUA 2CJMA 5EYMA 3DCVA 4R77A 1OL7A 4EKLA 2ZB0A 4LFIA 4U79A 2ZM4A 5K5NA 3I1AA 4DC2A 1IAJA 2UUEA 2WEIA 3PJ2A 3AGMA 4HGEA 4HCTA 3CXWA 3QD3A 3OWJA 2RFSA 4LG4A 1TKIA 5IEYA 2BKKA 2WTIA 2ZAZA 3F5UA 3MESA 3UO6A 5EK7A 3ZC5A 2B9FA 1ERKA 2UZNA 4EOMA 1K2PA 1OL1A 1ZY4A 2OK1A 2VX1A 4R1VA 3EZRA 5AM6A 4CLJA 1KOAA 5HZNA 5F95A 1JPAA 4FI1A 2I7QA 2YIYA 4QPSA 4AW0A 5A4CA 3DOGA 4H36A 3Q4CA 4I21A 2A2AA 4UYNA 3LFBA 2ZB1A 1T45A 5IQCA 3OP5A 4IJPA 4KBAA 4O0SA 4RIWB 4DFBA 1NW1A 3BBTB 4O0RA 4FE2A 2W05A 1QPEA 1IASA 4IMYA 4RFZA 4E4LA 5KHWA 3CIKA 4NU1A 4QP2A 4BDFA 3LXNA 4R1YA 5KZIA 3VC4A 3CEKA 3JR1A 2PE0A 1YOJA 4B99A 2PVNA 2YN8A 4OTDA 2PL0A 2PUNA 3FC2A 4FVQA 4FSYA 4UY9A 2YEXA 5CI6A 4ITHA 5FD2A 3UOJA 5HCXA 3A62A 1OM1A 1Y6AA 2ITUA 3KCKA 3M1SA 3EYHA 1WBTA 3FLQA 2WMQA 3LJ2A 3RCDA 3EN4A 4GUBA 3AC3A 4FEXA 4FTKA 4YBKA 1H28A 3DJ6A 2UW5A 4JQEA 4RIXA 1J1BA 3LLTA 4BHNA 3GFEA 5BVDA 2X9FA 4FVPA 3KULB 4IZAA 5J8IA 4D1SA 3F69A 3CPBA 1W98A 2QI8A 3N51A 4IAAA 5HIDA 4NKSA 5E8WA 1WVXA 2X7FA 3IG7A 2XH5A 4LYNA 5GJGA 5DLSA 3VS7A 4G5PA 5IQHA 4RFYA 4UMUA 2BRGA 3ZEPA 3ATSA 3QQUA 2XP2A 3L9MA 2GS6A 3IW5A 3LJ1A 3COIA 4WG5A 5L2WA 2UVXA 2VTJA 4UMTA 5AADA 2B4SB 4G6OA 3PXKA 3AGLA 3KGAA 3DGKA 3FI3A 4F6WA 3ATTA 1ZY5A 2X39A 3ZCLA 4BBFA 5IH4A 5FTQA 2C6TA 4NM7A 5LVLA 2C6IA 1FMOE 4TYIA 3EOCA 3FE3A 1RQQA 4G5JA 3O71A 3O8UA 3PIZA 4PPBA 4XHKB 3T9TA 2WMSA 2QU6A 4FIEA 4R7HA 4UB7A 3KXHA 3S3IA 4C62A 2OZAB 4BYJA 4CG9A 4XG7A 1LP4A 3FSKA 3R8VA 5AP1A 5HE3A 3CS9A 4AWIA 1YOLA 1DI9A 1UNHA 5LVOA 3G0EA 3MTFA 2IVTA 4A9TA 4I0SA 2C6OA 3HRBA 1Y8GA 4L8MA 2JGZA 4Z7GA 4FIFA 3QFVA 4M66A 5IUHA 4BCFA 2WMAA 4B4LA 1YRPA 5JT2A 3EQHA 1APME 1ZOHA 3G15A 4TWOA 2XB7A 3QHWA 2R0UA 3DA6A 4PUZA 2GQSA 2UZLA 1AGWA 4CZTA 4K18A 4V04A 4XUFA 4IVCA 3MIAA 2BDWA 3ZHPC 3WYYA 1W8CA 4R3PA 5FBOA 4YR8A 3ORPA 5DE2A 5IPJA 3ORNA 3S00A 1JSUA 2IW8A 3BGZA 3A4PA 2WMVA 4AAAA 3PPKA 5HVKA 4O6EA 3QGWA 2YWVA 1BUHA 2J2IB 4H3QA 5B0XA 4Y5QA 3DPKA 5KMMA 4QQCA 2XVDA 2EU9A 2W1EA 4D4RA 5IH6A 4D28A 4EOJA 3D14A 4HOKA 3F5XA 2GTMA 1FPUA 5IUIA 4O0XA 4FX3A 5BVWA 3QZHA 2J9MA 2OICA 2XEYA 3DU8A 5L6WL 3LFNA 3TKUA 3JUHA 4NIFA 1SNXA 3KB7A 3G33A 5BYYA 3WF9A 4RJ3A 4MNEB 3ROCA 1JSTA 3T3UA 4PL5A 4PP7A 3KL8A 5ANDA 4BCIA 3VS0A 3PUPA 3MW1A 4I6QA 4JR3A 3OMVA 4WO5A 2R3PA 4DEBA 5EQEA 5IQBA 4GT3A 4TYHB 2QO2A 3ULZA 1YXSA 5FG8A 1XH5A 4I6FA 3UP7A 5J9LA 3SG9A 5BUJA 1PMVA 3BV3A 3QCXA 4FSQA 4YJSA 2B55A 3T9IA 2GQRA 1CDKA 3LE6A 3HVCA 2BRBA 3RAHA 3HECA 3QWJA 2YAKA 4QYHA 5AUTA 3PXQA 2HZNA 1JQHA 4I20A 4X2JA 5HIBA 3C4FA 3DV3A 4RIWA 3CKWA 1U46A 3R9DA 4D58A 4KBCA 5CZHA 3U87A 5I3RA 2YERA 2EB3A 2OJFE 4O83A 4GUEA 1PJKA 3Q60A 4M14A 1F0QA 1E1VA 2VTTA 4C58A 3ALNA 5LWMA 1CKPA 4FV6A 4GKHA 4E4MA 3ORMA 3ZEWA 4ZZNA 4JOAA 5HQ0A 5F20A 5IDNA 2BAJA 4A06A 4IWQA 1M2RA 4ITJA 5HE1A 4C4JA 2EXCX 5F4NA 4DCAA 3GU5A 5L8JA 3FXWA 5B7VA 4EC9A 5ITAA 2HCKA 3BHVA 3E8EA 2XK9A 4LL5A 2BIYA 2X4ZA 3E7OA 3OXZA 2QKWB 4IW0A 5AR2A 4R7BA 3KMMA 4RLLA 3FYJX 4IZYA 3IW8A 3VQHA 4GKIA 2I0HA 2NPQA 4XG4A 3A61A 5LCJA 3I5NA 2HELA 1LR4A 1IRKA 2X7OA 4F1TA 4C2WA 4E6DA 2HW7A 5KMKA 4DBNA 4FG8A 1J7LA 4NK9A 3L8SA 2XKEA 3O2MA 4HPTE 4WNMA 1CTPE 5CYIA 4O7NA 3IDPA 2G01A 5CI7A 4QD6A 1O6YA 4MKCA 3VUTA 4NFNA 5HO7A 5F94A 3R7IA 3AMYA 2F7ZE 1O9UA 2CLXA 4D2VA 2HY0A 2ITPA 5A3XA 3R7GA 2OO8X 4FL1A 5HCYA 1BYGA 5L6PA 1TQMA 2JFLA 4IADA 4WBOA 1OB3A 4AU8A 4GRBA 4L44A 3V5LA 3VW6A 1WBNA 1ZZLA 4HGLA 2XJ1A 4UWBA 2FVDA 3UIUA 1FOTA 1A06A 4QQJA 4FKIA 3LMIA 4RVMA 1Q8ZA 3HAVA 3FZOA 1WBPA 4QOXA 3R73A 4B7TA 4AN3A 3MVJA
chains in the Genus database with same CATH superfamily
4GS6A 3Q9YA 4XLIA 3VONA 2GMXA 3UC3A 4ERWA 4A4XA 2BRNA 5ANGA 2HXQA 4RWLA 4G6NA 5KBRA 3FY0A 5HVJA 3SXSA 4MD9E 5KBQA 5CU2A 3TJDA 5HO8A 1PXPA 1UU7A 2PE1A 4FKVA 2NO3A 3G9LX 2OZAA 4GJ2A 3VS4A 3AMAA 3P4KA 4F78A 4U5JA 3UE4A 3ZDUA 5AWMA 2A4LA 3EQCA 4MVFA 3ZM9A 2XM8A 4IWDA 2O5KA 1OUKA 4E7WA 2W7XA 1LEZA 1ZYLA 2VD5A 4FSUA 4QNAA 4FKTA 2C3KA 4FTUA 2XA4A 4S34A 3RVGA 3BZ3A 4DH1A 2W1ZA 1GZ8A 3GCSA 3DBFA 3AC8A 3HGKA 5D12A 1Q24A 2G2FA 4TY1A 4ENXA 4CEGA 1DM2A 2X6EA 3Q3BA 4XOZA 2BHEA 3PFYA 2GNLA 3DQXA 4O7VA 1TZDA 4E5WA 4DFZE 2PVKA 4GK3A 4XP3A 1XBBA 4OTQA 3W0QA 3VS3A 3ZSGA 1STCE 2AQXA 4RQKA 5AUYA 1W83A 3PTGA 4ZS0A 1M17A 3D5XA 3D7TB 3DAEA 5L6OA 4AXCA 2RG6A 2GCDA 4A4LA 1T46A 4PPAA 4BY9E 2C68A 2UVZA 4I4FA 3N9XA 4IQ6A 4USDA 3RM6A 1SVGA 5HI2A 3BU6A 3QU0A 4P4CA 4Q2AA 3RZFA 3TKHA 3VS2A 4PMPA 4I6LA 3P23A 3MDYA 4K8AA 3UDTA 2ITYA 3K3IA 3ZC6A 2UZTA 3FLZA 1V0BA 3KRRA 1Z57A 3GB2A 5FXQA 2GNHA 5K0KA 4E73A 2W9ZB 4YHTA 4CVAA 2XMYA 3EJ1A 2P2HA 3V8SA 1L3RE 3A7JA 3E62A 4OTGA 1Y8YA 3PXZA 4QPAA 2J6MA 2Y0AA 2ZV2A 3Q5IA 4Q9SA 4XBRA 4K1BA 3WZKA 4BRXA 1P4OA 4GG5A 4QMLA 2X9EA 3JPVA 4FNZA 3BQRA 4IBMA 4D1ZA 1Q61A 5AX3A 4NTSA 4CFWA 5IISA 3QZIA 4OUCA 4GYIA 4RGJA 4TYHA 4QQ5A 5DEYA 4C35A 4FSZA 3COMA 4OBOA 3KA0A 4LUDA 4FNWA 3QTXA 4JIKA 4C3RA 5IU2A 3O51A 5IQDA 5FP5A 4GVAA 3PVUA 4JIAA 2XARA 4B8LA 4CFVA 3ERKA 4ZSAA 5CAVA 3QQJA 4G2FA 3MGYA 5AV1A 4BDGA 3IOKA 4PV0A 3HUBA 4RC2A 4IVBA 3WYXA 4F9CA 4J8NA 5IA1A 4RPVA 3TTJA 3VNTA 5BUEA 3NWWA 2YAAA 3ZXZA 1KE6A 4FT9A 4AW5A 2VN9A 4IAYA 5FTOA 4QYEA 4E6AA 5I4NA 4G3DA 3AG9A 4C7TA 2WQBA 4D4YA 4FOBA 3RALA 4IB3A 4EH3A 2JIVA 1AD5A 5HD7A 4EHZA 1A48A 2PHKA 2UW0A 2JLDA 1UNGA 4DDGA 2R64A 5D41A 2W99B 4BL1A 4CV8A 5IH5A 5L2SA 5CSVA 4AS0A 4CG8A 3IOPA 1ND4A 5CEPA 4XRLA 4AZVA 4BI1A 4D2RA 5BX0A 5DGZA 4GU6A 4CT2A 3TDVA 4FT7A 3BU5A 4UMQA 4ACGA 3RHXA 5HU9A 3D94A 1RJBA 2G2HA 3Q6UA 5DT3A 3G90X 3NUSA 4ACMA 2J4ZA 4FIGA 3U54A 2PZRA 1WFCA 1ZYSA 4HYSA 1OECA 3NNUA 3D9VA 3R1QA 2W0JA 4UX9A 4MX9A 1XWSA 4P2KA 1OL6A 3HV7A 4X6QC 4D4SA 2VX0A 4QP4A 5FRIA 4IANA 4BDCA 3F5PA 4CYJA 3DLSA 2CHLA 2PMLX 4C4HA 4IM0A 3G9NA 4BZOA 5JFWA 2DYLA 2GFSA 4XV3A 2VWYA 4IZ5A 1FBNA 2PULA 2AUHA 3ZBXA 5FEDA 4ALVA 3VJOA 3M42A 3A4OX 4FK6A 5TE0A 5E90A 3WE8A 4JDHA 4ANSA 1YKRA 5KKRB 4FTJA 2PUUA 3VS1A 1DI8A 4FT5A 2B1PA 1WCCA 3EQGA 2WTJA 2ITOA 1H4LA 4CYIA 5ETAA 3LCOA 3OEZA 2WO6A 1P14A 3JXWA 4RT7A 4BHZA 3WE4A 5DG5A 5J5TA 4BTKA 4FR4A 2CLQA 2P3GX 4RWKA 1YHSA 4AACA 4MWHA 5GIPE 3UNKA 3QCYA 3BE9A 5AUVA 5J87A 4FEQA 5JRSA 2IG7A 4AZTA 3KRLA 3IW6A 4K9YA 2QURA 4QMNA 4RJ8A 3LQ3A 1FGKA 1YI6A 2JKKA 4BGGA 4QMOA 3QCQA 5CEOA 3PP1A 4FKSA 3IO7A 5FBNC 3U8WA 2CGXA 3QUDA 4X3JA 2C5XA 4O0VA 2IZRA 3KXMA 5AUZA 1URCA 3R8PA 2PYWA 4U9AA 3VVHA 1YHWA 3QXOA 5KKRC 1MP8A 2Z8CA 2DUVA 4NCTC 3P1AA 3LJ0A 3W2OA 3E87A 1OZ1A 4TTHB 4FKLA 1ZLTA 4D5HA 3C4ZA 3HZTA 2X2LA 4S30A 4YC6A 4O91A 1CKJA 2ONLA 3R28A 2YFXA 3NUPA 3PVGA 4GVJA 3OVVA 2BTRA 3ZSHA 4CMTA 4FUYA 4I41A 2YM6A 4M0YA 5LCKA 4PNIA 4EYMA 3ZU7A 2BUJA 2C3IB 4GYGA 3O23A 3QKMA 4L53A 3TM0A 2X7GA 5I0BA 4NT4A 5ETIA 3FQEA 2X2MA 5TT7A 3V8WA 4AFJA 2CMWA 5GZAA 3U9NA 3OS3A 4KS8A 4XLVA 3OW3A 4FZDB 3REPA 3WZUA 2OH4A 3QLGA 4YJNA 5ETCA 4TWPA 3TNIA 4RX5A 2J50A 2YITA 4YJOA 5HTCA 1Z9XA 4DTKA 4I5PA 4RIYA 3MFRA 2IVVA 3QL8A 3VBYA 4M67A 2W1DA 5JZNA 2R3IA 1KE7A 5TOZA 4BZNA 3W1FA 2OXXA 4M13A 5AA8A 1NT2A 5EOLA 4EH6A 1NVQA 1BMKA 3IK3A 3M11A 4BI2A 3ORKA 1SNUA 2QHMA 4WUNA 2IPXA 3EHAA 3P5KA 5HEZA 3SW7A 3I79A 3F3VA 3KXXA 3HKOA 4TYGA 3A99A 3R2YA 2WQNA 4MH7A 3UQCA 3VJNA 1H0WA 1OGYA 3Q5ZA 2ZV7A 3VIDA 2VGOA 3DKGA 4AT5A 2C0OA 5IQFA 4CLIA 5EW3A 2YIXA 4EYJA 2LGCA 2WTWA 3GC8A 4A4OA 4UWYA 2XBJA 3CTQA 3MFTA 3PZHA 4FKGA 2P55A 5EW9A 3QQGA 1YDTE 3OOMA 3PA5A 1KUTA 2JD5A 2ZJWA 4GU9A 4EONA 3EQIA 5K3YA 4OAUC 2J90A 2XK4A 2RF9A 5J5SA 3ELJA 4NZWB 4ZJJA 4I5MA 3G2FA 2IZTA 3FI4A 3OROA 3R02A 3HDMA 3LVPA 5T3QA 3BQCA 1GIIA 3DS6A 3ORLA 3GCQA 3FZSA 4DT8A 3M2WA 1SYKA 2VNYA 1R0PA 4FKRA 3ZO1A 4FK3A 4C0TA 1KE5A 4ASXA 2VX3A 3BLRA 2UW8A 3F7ZA 4GFOA 3BYSA 4FV2A 5C8MA 4EK3A 1VR2A 4FNYA 2VZ6A 3I6WA 4YUQA 4RIXB 4F64A 2I6LA 3KRJA 4F70A 3C7QA 3LFDA 4J96A 4IDTA 4FKOA 3ZTXA 3SOCA 1U5RA 2ZDTA 4WD5A 2R4BA 4JJRA 1G8SA 3C5IA 3MH1A 4F08A 4L00A 4ZP5A 2H8HA 4DLIA 3IW4A 4NWMA 1HCLA 2JDRA 1OL2A 3R71A 4XEYA 2GNFA 2RG5A 5DR9A 4AX8A 1M52A 3KXGA 4PNKA 2FO0A 3PUFC 2QR8A 2BKZA 3E5AA 2IVSA 5KMOA 3R9OA 4XG6A 5DEWA 3VUKA 4LGHA 4FRFA 4WT6A 4Y8DA 5F9EA 3SAYA 5CF6A 3E8NA 1PHKA 3FMLA 2VO0A 4JL9A 2IEWA 1OIQA 3BBWA 4RJ5A 3TZ9A 4B0GA 4PMMA 2XIKA 2IZUA 3DBEA 2ETMA 3VRZA 2QOHA 3OCGA 3QYZA 3OT8A 3VBQA 3GCUA 3DNEA 4QMZA 2A98A 3PSDA 3CSVA 4BIEA 3UO5A 1OI9A 4O86A 3PXYA 4RJ6A 4DTBA 5EYDA 5ANEA 5DRBA 3BHTA 2CGVA 5LVPA 1UV5A 2PUPA 4E5BA 4F7LA 2XNMA 4EQMA 2CPKE 4L68A 3UO4A 4RMZA 4MD8E 3HP2A 4IAZA 4C4IA 4EH8A 3R8LA 5FUTA 2OF2A 1JBPE 1XO2B 3ZRLA 2JAVA 4CTBA 2WD1A 5BVEA 2UZUE 3R04A 3ZLSA 3ACJA 2R2PA 2V7OA 2JAMA 4GSBA 4BJJB 5K4IA 4GMYA 4EQCA 4C61A 5M08A 2Q0BA 5CT7A 5A4QA 3EN9A 5JSMA 4KIPA 5KUPA 4IWPA 5JFSA 4UALA 3QBNA 2XEZA 2R9SA 1SMHA 5CEQA 3VF9A 2QKRA 4ZY4A 1IEPA 3F9NA 4X21A 1XKKA 2R3NA 4GV1A 5FGKA 2V5QA 3CJGA 3R7YA 4BCOA 3U6HA 2BZIB 2X81A 4YO6A 1G5SA 1CMKE 2UZEA 2OKRA 3NZ0A 4FZ6A 3UVPA 4O7ZA 4S31A 4FT0A 2YDIA 4RVLA 3O96A 5EHLA 4E5AX 3RAIA 4BCJA 2WOUA 1WBSA 3WOWA 3ZRMA 3PRFA 3AMBA 2C6DA 4AOIA 4P5ZA 3OY1A 3PLSA 4IM3A 5CSXA 4Y46A 3HV6A 5HD4A 1P5EA 1ZWSA 2GPHA 4YPDA 2BRHA 4IB1A 5IQAA 2OI4X 3W8QA 2GS7A 4AGDA 2BILB 4O7TA 3OUKA 3QF9A 4NIFB 5I9WA 4ACCA 4D2TA 4DDIA 3FXZA 4EOOA 2R3FA 1GY3A 3A7FA 1HCKA 5L8LA 2QOOA 4DYMA 5E1SA 3VF8A 4TWNA 4AT3A 3FUPA 2QOBA 4G1WA 5AV3A 2B9HA 2H96A 1ZARA 3DAKA 2ZM3A 3EMGA 5M56A 3W0NA 4G9RA 5GHVA 4OTWA 3TUCA 3VS6A 2YISA 4N4SA 3EQDA 4BF2A 4J98A 2XKDA 4E6QA 3O8TA 1G8JA 3ZO2A 4EOSA 4FV1A 2VWBA 1SZMA 4FT3A 5J1VA 4CTCA 3FV8A 4MQ2A 3RZBA 2WKMA 4O7WA 4GH2A 4XOYA 2ITXA 4BCKA 1MRUA 4YJPA 4AA5A 3FZTA 4E93A 1KE9A 3WZDA 1OPKA 4O0TA 5D1JA 1YW2A 3VQUA 4AGWA 4EHEA 3MY1A 3D2KA 4FSWA 2BMCA 3FYKX 3FBVA 3VW8A 5AFVA 1OIUA 1YXUA 3MYGA 5TR6A 4HZSA 5E8SA 4KKGA 3NMUF 3Q9ZA 3QQHA 5CY3A 3MI9A 3QGYA 2PVLA 5KCVA 3KFAA 4FL3A 4IAFA 3HYHA 4FL2A 4Z9LA 3R01A 5IA0A 3PE1A 1Q4LA 1M7NA 3I5ZA 2HXLA 2WMTA 3BRBA 2OF4A 4LL0A 5HNGA 4BTFA 4EH2A 2C1AA 5HTBA 3CGOA 3G6HA 5H2UA 3F2RA 1IA8A 5AX9A 2YCSA 3S2PA 3QRKA 3QX4A 4M12A 5HKMA 4FYOA 3LM0A 3HP5A 2ETKA 3PWDA 4GW8A 4R6VA 1PMNA 5GJFA 3TV7A 3V6RA 4G3FA 5EQPA 5HU3A 2HWOA 3POZA 3QA8A 3GU7A 4Y85A 3W2CA 2HZ4A 4X3FA 5HCZA 3VBWA 4U81A 4UWCA 2GHMA 2V22A 1XBCA 4FKWA 4E8AA 3FI8A 4ENYA 4FG9A 1YXXA 3EH9A 3GC0A 4QYGA 5C26A 3O7LB 4JQ7A 3AD6A 4XV1A 4DF3A 3RK9A 2WU7A 1BI8A 3MB7A 3QRTA 5C03A 5EM7A 3U55A 1LPUA 4ZLZA 4M3QA 5HTIA 4G3CA 2GFCA 4X2FA 3E92A 4C3FA 2WQEA 4L42A 4Q5EA 4ZY6A 5CAQA 5AUUA 4I3ZA 1LUFA 3U6IA 4LOQA 3D2IA 2VNWA 4ALWA 1WAKA 2B52A 4GT4A 4LQMA 3QZGA 5AV2A 3FL5A 4L7FA 4BB4A 1H0VA 4FSRA 3C4EA 1W7HA 4AP7A 2JDVA 4O7LA 2OZOA 2VO7A 5HLWA 5G6VA 3U6JA 4OGRA 3THBA 2QD9A 3MWUA 2XIYA 4U97A 3W10A 1W0XC 2SRCA 2F57A 3PG3A 5BPYA 3G5DA 2XNNA 3MJ2A 3R9HA 3Q4UA 2OG8A 5FP6A 4RG0A 4ANOA 3FKNA 2UZWE 4MXXA 3UMXA 4FNXA 3NYNA 3ZFMA 4EOIA 3B2TA 5AR4A 4JDKA 4V01A 3GBZA 1Q62A 4MBJA 4ID7A 3ZM4A 4BJJA 2ERKA 4RJ4A 4PDOA 2PMIA 1ZAOA 4XMOA 3QUEA 3R2BA 4FTOA 5LMAA 5DH3A 4U3YA 4G31A 4QYFA 3TJCA 4II5A 4XG9A 4AZFA 4Q9ZA 5BVFA 4NJ3A 3UZPA 4C8BA 3DFCB 4HYHA 5E1EA 5EOBA 3VULA 4NYEA 3NFFB 3K3JA 2VWUA 3W2QA 4EQUA 3FQSA 4HVIA 5CAUA 3QHRA 2ITQA 2BALA 1Y91A 2QG5A 4DGMA 3KIOC 4FKJA 2P4IA 4MUQA 3O0GA 3LLAA 2X8EA 3DDQA 4EOKA 2WHBA 4AGUA 3BU3A 3D4QA 3QUPA 4KAOA 5AEPA 5I9ZA 4NFMA 4R8QA 1OKWA 4X6RA 2IN6A 4C59A 3BLAA 4U7ZA 5AP0A 4FTAA 3W2SA 3NSZA 5IKWA 4IC8A 4DH5A 4EBVA 4N6ZA 1IR3A 4QMWA 5D9HA 4AUAA 1PY5A 3IDCA 4NEUA 3UDBA 5DI1A 4LDTA 2A19B 1YVJA 4I1ZA 5B2KA 5DOSA 3SA0A 5C9CA 3FKLA 3RK5A 4QP6A 2BPMA 4MQ1A 4NM0A 1ZYDA 2GNIA 2FYSA 4RA5A 1FQ1B 1M7QA 1PYEA 2VTHA 3PZEA 3QKLA 4L43A 4XH6A 4F0IA 4YURA 2PPQA 4WG3A 4DT9A 5B2MA 2WEVA 3HAMA 1NVRA 2BAQA 4EUUA 1J7IA 5IF1A 4K11A 3ZUVA 1V0PA 3GQIA 3MH0A 4JBQA 4HVGA 1OBGA 3V01A 3PLAE 5I9YA 1YI4A 4XX9A 2C5VA 3NAYA 5HOAA 2C0TA 2O2UA 2XNBA 5AV4A 3C5UA 4OT6A 4O38A 4U45A 4ZJIA 3BI6A 4GG7A 1GNGA 3LMGA 4ZSGA 4MXAA 2J0MB 4KIQA 5AP6A 3MIYA 3NRMA 4UEUA 4BWXA 3P7CA 4U41A 5M51A 3DT1A 2P2IA 2PZIA 3ZLXA 4O1OA 4KKHA 1CM8A 3UMWA 4APPA 4BR3A 2V7AA 2X0PA 3HMNA 3KVWA 3OBJA 2VTOA 5EG3A 3VUIA 4YP8A 2Z2WA 2NNWB 5DR2A 3V8TA 3PA4A 1PKDA 2J5FA 2FSMX 4LI5A 3CGFA 2QOCA 4TKSA 3KU2A 5CQUA 4EK4A 5ACBC 5C27A 5KMIA 5M53A 3UOKA 5HE2A 1V0OA 4AZWA 5A54A 3CQEA 2PU8A 3ZLWA 3PIXA 2B54A 3KN6A 2AYPA 4FTRA 3TWJA 3V51A 4BIBA 1Q41A 1XHAA 2F7EE 4TWCA 3NYXA 1TFFA 3MTLA 4E4NA 5BVNA 2W1CA 3CE3A 4NM3A 5T6KA 3EFKA 4R7IA 3P79A 4CKIA 4QO9A 1XJDA 4W8DA 5AP5A 4BVUA 3P0MA 1UKHA 3FY2A 3KCFA 3I7CA 3TT0A 4ANNA 3RWQA 3QXPA 4B9DA 3UDSA 3TNHA 1WBVA 3EIDA 3FQHA 3MPTA 4DG0E 5G1XA 4X2GA 4FEWA 4BDAA 4ZMEA 5CALA 5M07A 2IZSA 2O0UA 4H3BA 5CEKA 3HV5A 2YM8A 4O22A 2PVYA 4RVTA 3W8LA 4QTEA 2IWIA 3VUMA 1M14A 4J53A 3PE2A 3OOGA 2ZOQA 3AC4A 3BHYA 3P08A 4HVHA 2Y6OA 2YIRA 2FGIA 5DN3A 5CEIA 2QCSA 4FTTA 3DXQA 2R3QA 3LW0A 3MV5A 4FA2A 1XH7A 4FV0A 4XBUA 3RAWA 4ZY5A 5A9UA 3DAJA 4PX6A 4CCUA 1GZOA 1URWA 2X2KA 3UNZA 4U3ZA 1ZRZA 2HIWA 1YWVA 2A0CX 3AD4A 3EFLA 5K0XA 3KN5A 3LMHA 4X2KA 2BTSA 1U5QA 4OW8A 3R1NA 3UNJA 1SVEA 3DY7A 1H1SA 4I23A 5M4FA 1GAGA 4GEOA 2DWBA 3NW7A 5ANKA 2X8DA 5CQWA 3BYOA 2QQ7A 4TZRA 3RP9A 5L8KA 5HESA 5I9UA 5HORA 3LQ5A 2P0CA 4Q5HA 5BQ0A 4JDIA 3HMMA 2C1BA 5A6NA 3QD0A 3B2WA 2WZJA 4I4EA 3Q9WA 2FUMA 3ZUTA 3NVKI 2OJ9A 2CN5A 3ZDIA 1FMKA 1W2CA 4DEIA 3OC1A 4M15A 2J5EA 3P7BA 2YM3A 2CGUA 3A8WA 3H9FA 3HV4A 3TZMA 4ANLA 3EZVA 3R1YA 3F7WA 3HMPA 4MXYA 3VN9A 4FV8A 3ZZWA 1J3HA 2R3JA 3EQPA 5DMZA 2Y4IB 3GENA 3NCZA 3V5QA 4FZAB 3W0SA 4FODA 4LRMA 4FIIA 4YNEA 5HG8A 1PXNA 3H30A 3NNWA 4QP9A 3FXXA 2VTRA 3D83A 2PE2A 2Z7QA 4FVRA 5IA4A 3E8DA 4TW9A 3UZRA 2E9UA 4DEDA 5LMKA 4U40A 1ST4A 1VYZA 4FTQA 5EM8A 3SX9A 2WMBA 2WNTA 3LCSA 3UG1A 4C57A 4D55A 4Z55A 1S9IA 2WXVA 3P7AA 4W4YA 4OBPA 3GCVA 3HA8A 3KXNA 1WVWA 4RIYB 5ETFA 1PW2A 2QLQA 5I9XA 1KWPA 4ZS4A 3CBLA 3A60A 4ZTNA 2XBAA 3ITZA 4QMQA 3QTZA 2J0KA 1OKZA 2WMXA 2BROA 3BPRA 2ONLC 4ZSJA 3UZTA 5HG7A 1YXTA 4I92A 2Y4PA 4LRKA 2GU8A 2UW3A 4L3LA 4C02A 4MXCA 3ZXTA 2BAKA 3U51A 2RSVA 4AOJA 2PUIA 3UBDA 4W4XA 3ZO4A 2CKPA 4G9CA 2YJRA 3SGCA 1U59A 2GS2A 5DYJA 5DA3A 4QMMA 3W55A 1ZYJA 3W0OA 4YC3A 3CTHA 5J95A 3VUGA 4P7EA 1PYXA 2EUFB 4GIIA 2BFYA 4PWNA 3ZUUA 4UV0A 4CGAA 4C33A 1DS5A 2B0QA 3AXWA 3BIZA 2C6KA 2WU6A 1QPDA 2W1GA 3WZEA 1U54A 4MEDA 4QNYA 2C6LA 1R78A 4CT1A 4HNFA 4J99A 4QMVA 2YJSA 2XCKA 5GNKA 4HZRA 4JNWA 3TMOA 4J95A 4MWIA 4DHFA 4DG3E 1Q3WA 1UA2A 4UYAA 4XCUA 3RBWA 4AFEA 2CNUA 5I9VA 3LXLA 4DEHA 2IW9A 1DAWA 3UOHA 4H58A 2JDOA 3R8MA 3MN3A 4QYYA 3F2AA 4NW5A 4IAIA 3TEIA 2BVAA 2PZ5A 3JVRA 2GNGA 2CDZA 4WKQA 4YLLA 4QP8A 5DBXA 2PVJA 3I0OA 4EKKA 2CCHA 5C8NA 3RPVA 3D5WA 3PY1A 3RMFA 4WSQA 3ZO3A 3GOPA 3ANQA 4PDPA 3TZ7A 4DH8A 4PPCA 4JI9A 3R9RA 4HJOA 5E9EA 5AP2A 3S1HA 2REIA 4YGAA 2PVRA 4YHJA 3DBQA 2NRYA 4D2WA 3FMMA 2UZOA 2E9PA 4E20A 3QTWA 2QOFA 1MQBA 5JEBA 4J97A 4ALUA 2VUWA 3MSSA 4OTHA 4UZDA 4ASDA 5FLFA 4GJ3A 3GC7A 2A1AB 3HL7A 1UWHA 1UNLA 3Q53A 3KVXA 4BDBA 3OZ6A 3P9JA 5CX9A 4O7RA 4IB5A 3OUNB 3L9PA 4V05A 4NSTA 3H0YA 1ZOEA 4QTCA 1AQ1A 4ZTRA 5J7HA 5BYLA 4R3RA 5CANA 1Q8UA 3NEWA 2VTIA 5IZFA 3MVMA 4KSQA 4DGLC 1H24A 3POOA 4BC6A 4YSJA 1IAHA 4CFNA 2C5OA 3KMUA 3QC9A 4JX7A 4O2ZA 4ZLOA 5LOHA 4KIKA 4F0GA 4TNDA 2XIZA 2W4JA 2WOTA 3ACKA 3EYGA 4H1JA 4O4FA 3QTUA 5DRDA 4ACHA 3DXNA 4GFMA 3R21A 1ZMUA 4A9RA 5IUGA 4PY1A 4NW6A 4KWPA 4EH9A 3DDPA 3GOKA 3PJ3A 5L2TA 4TPTA 4BI0A 2ZYBA 3K54A 5CT0A 4E26A 2BFXA 1PXMA 2OLCA 4IH8A 5CU3A 3SW4A 4DA5A 2R0IA 5HE0A 3GC9A 2XF0A 3BV2A 4J71A 4X7QA 1K9AA 1V1KA 3SC1A 2WTVA 4RX8A 4XRJA 2VWIA 4MAOA 4C4EA 4NTTA 1QPJA 3NYOA 1XH4A 3NDMA 1JLUE 4ASZA 3N4UA 4CRLA 4LGGA 4XP0A 5DWRA 1REKA 2WFYA 3I6UA 2IJMA 2C30A 2HZIA 2UV2A 2W1IA 4ZEGA 4MNFA 3G51A 3LHJA 2H34A 3HMIA 4KKEA 4F1MA 3FSFA 5JN2A 4PMSA 3NUUA 4WRSA 2Z7RA 4U8ZA 4C37A 1H00A 1OPJA 3PFQA 4ZXTA 2GHGA 4N0SA 4BZDA 4F0FA 5D7VA 1XH6A 3FWQA 3QLFA 3ZH8A 2E2BA 4TYEA 2BZHB 4U44A 3RI1A 3BHUA 3H9OA 4CZUA 2WTKB 1BL7A 4BBEA 4BBMA 4BFMA 3CC6A 4GIHA 2B9IA 1SVHA 2WPAA 3ENHA 4D0XA 3F82A 3F2NA 4DH7A 3GP0A 5DT4A 4MK0A 5JGDA 4KUJA 3VBTA 5C4KA 1NXKA 3WF8A 4D4VA 4IEBA 2IF8A 2RFNA 4JS8A 3C9WA 1H1PA 4OTFA 3DFAA 5EM6A 2WTDA 4K2RA 4EH7A 1XR1A 5A4TA 3NIEA 1RW8A 1VJYA 4AG8A 1K3AA 4DCEA 2XM9A 3F5GA 4ZK5A 1TQPA 4BDKA 4O84A 4FMQA 3PXRA 4EL9A 3QTQA 2VTSA 2W1HA 3C4WA 2YLEA 3QD4A 3UOLA 4DG2E 4ERKA 1WVYA 2PMNX 1GJOA 4W9XA 3T8OA 3RPRA 4Y5HA 3RWPA 4YZCA 4WG4A 1OL5A 2XYUA 5D11A 4FSMA 3AQVA 4LOOA 5FEEA 4KRCA 2XNPA 3ZYAA 4P90A 3SVVA 3SDJA 3RK7A 4BDIA 4TT7A 3EL8A 4D9UA 1BX6A 3UPZA 2WTKC 4I93A 3LXPA 3D15A 2XJ2A 4F99A 3TZ8A 4I24A 2OJIA 4U43A 5EW8A 4FTLA 1MQ4A 3NW5A 2E9VA 2OFUA 5BVOA 3W0PA 4WUAA 3N4TA 2VU3A 3CD8A 2YACA 1H1RA 2Q0NA 3FZ1A 4LUEA 4QP3A 5IPJA 4FIJA 5KMLA 5CU4A 3ZFYA 3ORZA 2B53A 4N70A 4ZZOA 1YI3A 2Q83A 1OGUA 2WMRA 2JC6A 1JSVA 3FLSA 5LQFA 3LFCA 1KE8A 3OHTA 3BYVA 3GQLA 4NKAA 4XV9A 3RGFA 1XH8A 4KRDA 5FXRA 2YM4A 4Y73A 3KY2A 3MS9A 3DKFA 2VWVA 4HGTA 3AD5A 1UKIA 4FIHA 4WA9A 4DINA 4YPSA 4Y95A 2XNGA 1O6LA 2CGWA 4L6QA 3BE2A 4J8MA 3OW4A 2YM5A 3AC2A 3CQWA 4NM5A 3I81A 5DVRA 4DGOA 3ZFXA 2ESMA 4X3FB 2EB2A 5AAEA 4AXEA 3RKBA 1M2QA 1UU8A 4MBIA 2R3RA 2KTYA 4Y72A 1FINA 3OG7A 1B39A 4I0RA 4JQ8A 1ZMWA 2WIHA 2OIDA 3QD2B 4YU2A 3DKCA 3Q2JA 5DIAA 3R1SA 5H8GA 3KREA 5H8BA 3I60A 3E7VA 5EH0A 4UN0C 4YLJA 3R7UA 3LCKA 3PY0A 5CLPA 3V6SA 3LCTA 3SHEA 3D5UA 2Y6MA 2J7TA 4QDVA 1I09A 3TIYA 5L3AA 4BTJA 4BWKA 4F1OA 3AT4A 5EYKA 4O4CA 3UJGA 3JVSA 3QQFA 4F9YA 4K6ZA 5C01A 4AA0A 1RDQE 3F3UA 4HW7A 2HYYA 1XMMA 3QRUA 5IQGA 4HVSA 5CNNA 2VWXA 4GK2A 3K2LA 4G3GA 3C0IA 2B9JA 4RX9A 5ANOA 1HOWA 3BEGA 5E8ZA 4USFA 2QHNA