5L6OA

Ephb3 kinase domain covalently bound to an irreversible inhibitor (compound 3)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
267
Chain Sequence
CVKIEEVIGAGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-B receptor 3
publication title Development of Specific, Irreversible Inhibitors for a Receptor Tyrosine Kinase EphB3.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 267
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6oA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6oA01
5JFSA 5BVKA 1K2PA 2C5NA 2E9UA 4TRLA 2JBOA 4DH3A 4BHNA 3I7CA 3E88A 4BCQA 2GFSA 3FQSA 4D0WA 4G5JA 3V5LA 4EH7A 3PE1A 4YZ9A 3WE4A 2J51A 1OKVA 2QOLA 2XK6A 3UIUA 4ANMA 3WF9A 5EFQA 4IFGA 1H1PA 1PXLA 4HYSA 5CI6A 4JAIA 2YLFA 3ELJA 4RA4A 3W2OA 4BDFA 1CTPE 4GYGA 3W2CA 5LMBA 3QCXA 5JZNA 4L9IA 2OGVA 3KRJA 3GXLA 2OK1A 4QQ5A 3VUDA 5HU9A 3R7YA 4TPTA 4NEUA 4QMQA 4KRDA 1K9AA 4YLLA 4D2VA 3A7JA 4XG2A 2OJJA 3NUNA 4D2SA 1OBDA 4XP0A 2QKRA 4EYMA 4JR7A 3R9NA 4TZRA 2BKZA 3F3ZA 3R1YA 4B0GA 2B52A 3MDYA 4D2TA 4HCTA 1T45A 1ZMWA 3Q4ZA 4LRJA 3R1QA 1PKDA 2BAJA 3C4CA 3O50A 2RG6A 4TNBA 4O1PA 2X81A 3MIYA 5KHXA 5LCKA 4QPAA 3I7BA 3VC4A 4BGQA 1PYEA 1OIYA 3CPCA 4IMYA 2F7ZE 5I9ZA 4N4SA 2J5FA 2J0KA 2XP2A 1DAWA 3TM0A 3II5A 3F3TA 4JBOA 4MKCA 4RC2A 3V01A 3DB6A 3UOLA 3EKNA 4Q9ZA 2C3KA 1ZYSA 2QLUA 2PK9A 4ORKA 3IKAA 3VUGA 2XYUA 3BQRA 3NW6A 3CJGA 5I9VA 4ZMFA 4IXPA 1E1VA 3UG2A 2G2FA 2WMSA 4V05A 3NNVA 4CLJA 2IJMA 1P4OA 3LM5A 4H39A 3PUPA 3BEAA 4XCUA 3QHWA 4YPDA 4F64A 3FSKA 5M07A 4PTEA 3EZRA 4MWHA 2EXCX 4WNKA 3ULIA 5CAPA 3GEQA 3RINA 3DGKA 3EN4A 3FL4A 4M69A 2WEVA 4HYIA 4HNFA 5GZAA 1F3MC 4TWCA 2HWPA 3EQCA 3U51A 2VWIA 3ZRKA 1OL5A 2NRYA 4YLKA 4DG3E 5ICPA 2XNMA 3Q32A 4MNEA 3QAME 3L8SA 1FMOE 3VIDA 3DV3A 4H1MA 4NL0A 4N70A 5IEVA 2X2MA 3FMNA 3QTRA 3FMEA 3RZBA 5CALA 2VX3A 4CFXA 5LMKC 2ITVA 4MYGA 2PE1A 4RZVA 4EQMA 4O7ZA 3F69A 2ITUA 4G16A 3BLRA 3ZFYA 2W4JA 1BYGA 3T3VA 4YJNA 4PV0A 3V8SA 3BPRA 3JYAA 4M12A 4XBRA 3MFRA 5H9BA 1OPJA 2OJFE 3I81A 4XHKB 5CF5A 4H58A 4JDIA 4LUEA 4BGHA 3IDCA 4CFUA 2JIVA 3NYNA 4QMTA 5HD7A 3FMMA 4BDBA 4MXXA 2CN5A 3QUEA 3MI9A 3LZBA 3PIYA 3PPKA 4YMJA 1GZ8A 4DF3A 4IX5A 2ETMA 3PWYA 5IH5A 4ZTNA 3R1SA 3K3JA 3E8DA 5IQDA 2H6DA 3MH2A 4KBKA 4CFMA 3FI3A 3C4ZA 1BKXA 3HV6A 5AV1A 3UVPA 4EKKA 4B8MA 3NNWA 5J95A 3HP5A 1BUHA 4IZAA 2O64A 4J71A 4GK4A 2PZ5A 4DBNA 5D41A 5CEQA 1ZZLA 4G2FA 3ZDIA 3B2WA 4JG7A 4F9AA 4RIOA 5FP6A 4I92A 3QZGA 3ZFMA 1RQQA 1YDSE 5DA3A 1Y8GA 5GJGA 4FK3A 2PVLA 1H1SA 1OI9A 3UQCA 4NW5A 5HIEA 2YIYA 2UVZA 2XKCA 2R0UA 1R39A 3VS1A 1YDTE 4XS2A 3W2SA 4BL1A 3QD2B 2J0JA 4ZSGA 4AUAA 4ENXA 3COMA 4FIEA 4GU9A 2FO0A 3R83A 3Q60A 4ERWA 5EW9A 3DBCA 2C6KA 3LFEA 4EH8A 5LOHA 3ZC5A 2OW3A 2YWVA 3L8PA 2UZOA 3O8UA 3C5UA 5C1QB 4ZAUA 4K77A 5DT3A 4MXCA 4NFNA 3ZUTA 3QRJA 4EL9A 5LARA 4C33A 3D2IA 1H27A 4PUZA 3HMMA 4IAFA 1V1KA 3QLFA 3UYTA 1H0VA 2UW9A 2XNEA 3QX4A 4IX4A 3KMMA 4A9UA 4ANLA 4E7WA 2VU3A 3B2TA 4ZS4A 4RX9A 1BL6A 1R1WA 3CQEA 4TWNA 4ACMA 3EKKA 3PLSA 3GC7A 3R22A 4NH1A 2C4GA 5GIPE 3AG9A 1XR1A 4F7LA 3R63A 4QP1A 1PXKA 3QF9A 4PY1A 4YUQA 4ANQA 1FVVA 4PDSA 5JSMA 3QTZA 5ETCA 4DCAA 5FWKK 1OL2A 3R9RA 1VJYA 2CGXA 3NAYA 4DEEA 4DEGA 2W1GA 4BCPA 1GZOA 4IQ6A 3ORLA 1AGWA 3KMUA 5CTPA 4FV3A 3ZSHA 4KWPA 2W96B 2WGJA 3TCPA 5EHLA 2HCKA 2BTRA 4FTAA 4GCJA 3MTLA 3SG9A 1FVRA 1PXIA 2BRMA 3BCEA 3F3WA 1UNGA 2BRBA 4ZSAA 4J1RA 3ZO2A 5KBRA 1IA8A 2IVVA 2Y9QA 3S00A 3IECA 2Z8CA 3UIBA 4IAZA 3UO6A 5EYCA 3OT8A 3IGGA 4RWJA 3R8VA 4QYYA 4RX7A 4NM3A 4NW6A 3QYZA 4I23A 2NPQA 4BC6A 4BB4A 4EC9A 5IQBA 3PY0A 2IVSA 3PVGA 3KEXA 4MF0A 5AUUA 3KXNA 2PVYA 4A07A 4I24A 4IVBA 4O7VA 1JOWB 3PVWA 2PE0A 4AZSA 1TQPA 2IVTA 5IUHA 3COIA 4Y8DA 4KINA 2G2HA 3CD3A 4EQUA 2H96A 5KUPA 4BDIA 3ULZA 3FQHA 4ZY6A 4GV1A 4W8EA 2PVFA 5JT2A 4G1WA 4QP7A 2EUFB 3TNPC 4FTLA 4C36A 5LJJA 2ZV9A 3UJGA 1G8AA 4P90A 2J90A 4ARKA 5BVNA 4XG6A 4AA0A 3PJ2A 5I9UA 3LCOA 5GZ8A 3U87A 3P5KA 4AZVA 4F4PA 4CZYB 4XG3A 1ATPE 3RALA 3QYWA 3OTUA 4FTUA 5C01A 4W9WA 4F7JA 3MB7A 3IOPA 1ZMVA 2C6DA 4AGUA 4FEVA 5EYDA 3BYUA 2FH9A 2VTTA 2WOUA 4FG9A 4PP9A 2YFXA 4A7CA 2WELA 4OAUC 3Q53A 3BGQA 4LRKA 3NVMB 4JI9A 1SNXA 3L9MA 3NUAA 2GDOA 4EH3A 3FEGA 4BCMA 3UBDA 5A4QA 2OXDA 1Q41A 4YTCA 5M51A 4IB5A 5K9IA 4H1JA 3V5QA 5IU2A 2G9XA 2W17A 4X3FA 3WZDA 2VO0A 4FV1A 4KIQA 1LR4A 1REKA 4MXYA 2IO6A 1ZOGA 4NYEA 4AQCA 4QMWA 4DE4A 3A61A 1OL1A 2R3NA 5BVEA 5EH0A 3CBLA 3NUSA 5J87A 3IK3A 3OWJA 3Q4TA 5KHWA 4IWOA 4D4VA 1SYKA 3C9WA 4FSWA 5I4NA 5IA4A 4R5SA 3EIDA 4AGWA 3NNXA 5AM6A 3R00A 5KZIA 5AAFA 3Q5ZA 5DG5A 4O2ZA 3FZPA 3BWFA 2PUIA 4O81A 3ZMMA 3T9IA 4IWDA 5B0XA 4AWIA 2E9NA 2J2IB 1H4LA 1YXVA 2VTJA 3L9NA 5EI2A 4OTIA 1NVQA 3HL7A 1LEWA 3HMPA 2ZDTA 5CU3A 4FKPA 4O83A 1MUOA 2JITA 3DT1A 4USDA 4I0TA 5J9LA 4LMUA 3NIEA 4CGAA 1FINA 3BHVA 5FXQA 3QCYA 4YO4A 1JAMA 1XBCA 4ANOA 1YXUA 1FOTA 3H4JA 5CAQA 3MVLA 4BYIA 2WMXA 2VTAA 2O63A 3HMIA 4GIIA 4XLVA 3QCQA 3TZ8A 3HA6A 5B2KA 3HMOA 4RIXB 3TXOA 3TZ9A 3KF7A 2CNVA 2GNIA 4CG9A 1LEZA 4QP9A 4EH9A 4MF1A 3QTIA 2J0MB 5H8EA 3PJ8A 3R8ZA 5CAVA 2P0CA 3U4WA 5AA9A 4AZWA 3DDQA 1NVRA 3ZRMA 1FPUA 1UV5A 4DLJA 1M2PA 3R28A 4IDTA 4UZHA 3AGLA 1U46A 4P4CA 4RFYA 5LVMA 2DUVA 2QI8A 5DR9A 3MFSA 4PDPA 2ACXA 5JQ8A 2WIHA 1ZRZA 5TOZA 5HBHA 2X6DA 5L2WA 2HY81 4DTBA 2QU5A 1UNHA 5LVPA 1PJKA 4F7NA 3FL5A 4YHFA 4ALWA 3EN6A 3A2CA 3PVBA 5HHWA 3BV3A 3DKGA 2VN9A 4ZZOA 4U6RA 3B8QA 4FZFB 4AZTA 4XH6A 3MJ2A 1WBWA 3OUKA 3TNHA 4WNOA 1MRVA 4H3PA 4LV5A 1XH8A 4R3PA 3RK7A 5CEOA 1R0EA 4JG6A 3GFWA 3ROCA 4BCNA 3DS6A 2VTQA 2BCJA 4Q9SA 4QNAA 4R3RA 3OBJA 3RI1A 1M17A 3TNWA 1G5SA 3ACJA 4CMTA 5EM6A 3F6XA 3KU2A 4L46A 3O7LD 3EYHA 4BIBA 4QT1A 1RDQE 2OSCA 3GQLA 4WBBB 4G34A 4E6DA 2GNLA 1YI4A 1WAKA 3KL8A 1K3AA 3L1SA 5ANEA 2JKOA 3QUDA 4GT5A 5CENA 3Q52A 5IQIA 5HCYA 3LW0A 1KWPA 4L52A 1Q5KA 4L45A 5DBXA 4O7LA 4EORA 2Z02A 3AMAA 5CLPA 1KV2A 4RLLA 4G3EA 4IX3A 5E1EA 2IZRA 5AP5A 4YTHA 2A2AA 2ZV8A 3NSZA 3FMLA 1Q97A 4NSTA 5TT7A 4ASEA 1IASA 4GEOA 3E7OA 4JQEA 2CN8A 2VTHA 1JPAA 3FDNA 4II5A 4YJVA 2V62A 4C4FA 4I5MA 3OC1A 5CEKA 3MVHA 3TL8A 1M7NA 2C6LA 4YPSA 5D9HA 2WMTA 2BVAA 3P0MA 4EOMA 3ZSIA 2YM5A 2CKOA 3GOKA 4Z7HA 4YJQA 2VX1A 3EQHA 3BGPA 2XNNA 3K3IA 3VQHA 4FSTA 5LVOA 3Q4UA 3AC1A 4IM0A 4J97A 4XYFA 1Q61A 4IH8A 3OXZA 5DN3A 3VUHA 2FSOX 4DITA 4Y85A 2BZHB 2UZUE 4FTKA 3V8WA 4V04A 3AMBA 5DT0A 4QMXA 3EJ1A 3TUCA 3ZO3A 1PXNA 3A99A 3ALNA 2YA9A 4QMZA 4FF8A 3DJ6A 3VO3A 3G2FA 3DQWA 4AGDA 5KMMA 2R5TA 4XOZA 4U97A 2CKPA 1L8TA 1F0QA 4I21A 4EOPA 5KKRB 3LXNA 3CPBA 5K4JA 3NMUF 5HU3A 2GTMA 4BDDA 3E64A 4NCTC 5CEPA 5BUIA 2LGCA 4V0GA 5M4UA 3FBVA 3GCSA 3MA6A 2B9IA 3Q6WA 3PRIA 3DK6A 4UV0A 4NTSA 3SRVB 5I9XA 3F5PA 4DT8A 2JFLA 1OB3A 2VNYA 4C0TA 3LAUA 2XS0A 2XBAA 3EHAA 4U44A 3SW4A 1BX6A 3OG7A 1W83A 1XH4A 2WTDA 3PSBA 3F61A 4FSMA 3BE9A 4KA3A 1OECA 4MVFA 3UMXA 3ORMA 1VEBA 2O2UA 2QOKA 3LQ5A 5AFVA 4D28A 3NUYA 4RX8A 2BZJA 4AOTA 4PP7A 4PPBA 2UZLA 4O7SA 3DFAA 4FKIA 4NJ3A 4MD9E 2AUHA 4RRVA 5FDXA 5IMEA 2YHVA 3D94A 4AACA 4QQJA 3U4UA 4CTCA 4PDOA 3LHJA 2YAAA 5E8XA 2W1EA 4ANSA 5CZIA 5EW3A 1APME 4BGGA 4EKLA 2PMOX 3CQUA 3DZOA 5LCJA 2HK5A 4GVJA 4PTCA 4BYJA 3RK5A 5CF6A 3AC2A 5HG9A 4WG4A 2BFXA 1W8CA 4I22A 1G3NA 1WFCA 4C4GA 3PE2A 4TW9A 4BVUA 2RFEA 4RJ7A 4UMRA 5EKOA 3P78A 4L44A 1SZMA 5JRQA 4IADA 4PL3A 3ZLWA 2PZYA 2F57A 4OBPA 2BFYA 4RJ4A 3WF5A 3KULA 2YCQA 4BDGA 4OUCA 4EZ7A 3JUHA 4JBQA 3HAMA 3R6XA 2VTSA 3QHRA 3DTWA 3OBGA 3V5WA 4PL5A 1BI8A 4M66A 4PNIA 4ASDA 1OL6A 4NT4A 3DY7A 4EK3A 2V5QA 2HY0A 3ORZA 4HVIA 4IC7A 1OITA 1W98A 2VV9A 2X7OA 2OIQA 2VTNA 5FP5A 5EK7A 3CSVA 1WVXA 3PY1A 2QONA 4Y73A 2VGPA 3UOJA 3PJCA 4JX7A 3C0IA 2XRWA 2WTKC 4HGLA 3T9TA 4C3FA 5L6OA 2IW8A 4E93A 2OZAB 3O0GA 5IA5A 3W10A 2G01A 4AN2A 3QFVA 4QMNA 4BTJA 5L2TA 1GY3A 3OW4A 4XJ0A 2BTSA 2QOOA 3F2NA 3VWAA 2ZJWA 4OBQA 4C4EA 4GUEA 2RFSA 4ZY4A 4W9XA 4BFMA 5HTIA 3A8WA 3BI6A 3MFUA 5L8KA 4RT7A 2CGWA 1DS5A 1VZOA 2R3JA 2VD5A 4Y5QA 1U54B 3ZO4A 5CYIA 1GJOA 3FLWA 4O84A 3O8TA 3OWLA 4TTHB 1CM8A 3DKCA 4L68A 4QRCA 3ZLXA 1X8BA 2BROA 4IB0A 5DFPA 3SXFA 3OY3A 2J6MA 2YZLA 4LOPA 4CT2A 2BUJA 2XIYA 4AW1A 4RMZA 2HZ4A 4NIFA 2OF4A 4OR5A 5D7VA 2R0IA 3PIXA 3N9XA 3TEIA 4DFBA 4ACCA 2E2BA 1UU7A 2WEIA 2XUUA 3DK3A 4L3JA 4LM5A 2E9OA 2W5BA 4WUAA 3I5ZA 3FUPA 1LP4A 3LFDA 3GCUA 3WF7A 3ORTA 1M7QA 1Q3WA 3ODZX 2H8HA 3QXPA 1UVRA 2XIKA 4MXAA 3H0YA 3FMDA 2WB8A 3RM7A 1KOAA 4A9TA 3MSSA 3WILA 4KBAA 3WYYA 3SAYA 1WVYA 3FE3A 4OTRA 4D2RA 4KKHA 1IEPA 4FA2A 5AUWA 2WMWA 5AM7A 2GFCA 3P9JA 4DINA 4LL0A 2XCKA 4R1VA 3RTPA 5L2IA 2W1DA 4RVTA 4GT4A 3NAXA 1WBPA 5HI2A 4PPCA 4DEIA 3HUBA 5CU4A 4GKIA 3R04A 5E7RA 5AP6A 3LQ3A 2XCHA 3ZCLA 5AP2A 4AU8A 1B39A 4XG7A 1Q99A 1HCKA 2IW6A 3GOPA 4TN6A 4YHTA 5A54A 1UU8A 2CGVA 2QO9A 3HA8A 5IDNA 4R78A 3BBWA 2CCHA 2YM6A 3OHTA 3D5WA 4JIKA 2P3GX 4IM2A 2B4SB 4CV9A 5CS6A 4FZ6A 4L43A 5FLFA 4ZY5A 4JDHA 4L7SA 3QQFA 4OW8A 3LFNA 2HOGA 2X8EA 1XJDA 3QWJA 5HX8A 4FOBA 4UN0C 2YZAA 1NXKA 2R3GA 4JS8A 4QMSA 4EK8A 5KMIA 4FKTA 4D1ZA 1ND4A 3F5UA 4RC4A 5J8IA 5HQ0A 3QA8A 4FODA 2WOTA 5DLSA 5FEDA 1U5QA 2V7OA 3GI3A 4NFMA 1IRKA 3AT4A 3CP9A 4RSSA 3KK9A 4RIYB 5F4NA 4ZTMA 2G2IA 4FIJA 3BLQA 2I6LA 1XH7A 2B9FA 3EQDA 5JK3A 4PPAA 4OT5A 1KE9A 2XNBA 4BCJA 5LMKA 2P4IA 4QYFA 2WMAA 2ITOA 5F95A 5EOBA 5DGZA 3AGMA 4FL2A 2WTJA 3C1XA 3R7OA 3WYXA 1Z9XA 4GRBA 3KY2A 4IACA 2WQNA 3WIGA 4F63A 3MBLA 4LOOA 1Q8ZA 3F9NA 5HIBA 4D9TA 2XJ2A 4YJOA 4DGLC 5CEMA 2Q0NA 5KMNA 1SMHA 5E92A 4DG0E 4ZLZA 3Q5IA 4GS6A 1UU3A 3FLYA 5JGAA 2B9JA 3NW5A 3O23A 5HBJA 4S34A 2JGZA 5AADA 1OKYA 5DHJA 4F9CA 5F94A 3AOXA 4NJDA 3PZEA 2CKQA 2GMXA 3EQPA 4G6OA 5CSWA 3DAJA 4X2FA 2ERKA 4CFVA 4FTRA 4M7IA 4JDKA 3QXOA 4C02A 1KOBA 1UA2A 3BGZA 1YXTA 4N57A 4IVDA 3NWWA 4EOOA 5EYKA 3SA0A 1PXJA 1XKKA 2LAVA 2X6EA 4JAJA 4YR8A 5FDPA 1WBNA 2XIZA 3LCSA 4KNBA 4XOYA 5CSHA 4EK5A 3HMNA 4HVGA 5KMOA 4ZS0A 1O9UA 3CTHA 2CJMA 2FSMX 4JRVA 4ACGA 4EZ3A 1JSTA 5CVHA 5CAOA 4ZSEA 3R2BA 4GSBA 3R7EA 3HV3A 3ZO1A 1ZLTA 4DFNA 4PTGA 2PVKA 4S30A 4UMPA 3S2PA 4XV2A 2VWVA 4EOLA 3F88A 1OIQA 4HOKA 4BI2A 1SNUA 2QU6A 3CTJA 5JFVA 2FYSA 2PPQA 5AUTA 3WZEA 3NNUA 4CEGA 2ETKA 4WNMA 5AP1A 4RWKA 5CWZA 5IQGA 5C27A 4FSRA 4C61A 2Z7SA 3DBEA 1ZAOA 1XHAA 3DFCB 3ORXA 4FL1A 2WTCA 4LYNA 1YWNA 4FV7A 4ZOGA 3SQQA 4FV8A 4BBFA 4U42A 3JR1A 2RIOA 3F3UA 3QA0A 4U5JA 3PYYA 4YTFA 2YN8A 3IW7A 2XK9A 4I5CA 2BZIB 5CSPA 5BVDA 3W32A 4NM0A 3NR9A 3KVWA 4IVCA 4B9DA 1B38A 4ZTLA 4AT4A 4EEVA 5HLNA 4KUJA 3I4BA 5HX6A 4OTDA 2XM8A 3UOKA 3SHEA 5LQFA 3LFFA 3MPMA 4XEYA 4TYHB 5HOAA 2WMQA 2GTNA 3Q9WA 2C3IB 1YWVA 2PU8A 1UWHA 5A4LA 3E8EA 3Q9ZA 4QMMA 4FT9A 4AP7A 2HXLA 4GYIA 2X4ZA 5HLPA 4FSYA 4R3CA 5IG1A 3VVHA 4HZRA 4I5HA 5CX9A 2O0UA 3JXWA 4CYJA 3E5AA 3PPJA 2RF9A 2BIKB 2R3MA 4DGNA 2X2KA 3NUUA 4UXLA 3HDMA 5EM8A 1OMWA 4BI1A 4BZDA 4TL0A 2XKDA 2XEYA 3TNQB 4CCBA 4FKSA 3I79A 4MBLA 4WIHA 3VUMA 4IVAA 2YIWA 4GU6A 2UW3A 5JMSA 5AR5A 2XH5A 1PKGA 4ZJJA 2IVUA 3Q04A 4X3JA 5A4TA 4O7RA 3UG1A 3LVPA 2JEDA 4FKWA 4JDJA 3MGYA 2OBJA 3ZC6A 4KKEA 2C69A 5EI8A 4KSQA 5C03A 5EHYA 4USFA 4ITHA 4PX6A 1AD5A 3VRZA 4TXCA 2GHMA 3A62A 4OTPA 2UW8A 3TKHA 3VJNA 3RK9A 3CGOA 2ZVAA 3AC4A 3IDBA 4BZNA 3DAKA 1A06A 4H36A 1BLXA 4XV9A 4FKUA 2VWBA 4XP3A 5CF8A 4HCUA 5A6NA 4Y46A 5AR2A 2JLDA 4XNEA 3BYSA 4DFZE 2NRUA 2EXMA 1ZOEA 3ORPA 3AXWA 3OXIA 5EDQA 4G3DA 3SOAA 3VULA 3KMWA 2HW6A 4C4HA 3SC1A 3ACKA 4IZ7A 3VS0A 2VO7A 4AS0A 1JSUA 4R6VA 4FV0A 2HAKA 3PSCA 3KXZA 3BU5A 3N4VA 3OZ6A 4O7WA 3MVJA 4YBKA 3S1HA 3UQFA 4CSVA 2YM4A 1UKIA 2EU9A 3LCKA 3SLSA 4KAOA 2GS7A 2J0IA 5M09A 2J9MA 2JKKA 3B8RA 2R3LA 4J52A 4I94A 4YBJA 3BIZA 2XB7A 3U8WA 3ZDUA 3GP0A 4O1OA 3QRKA 4BDKA 2Y4IB 3BX5A 4F1MA 4M0YA 2WMUA 2Z7RA 1YRPA 4FICA 3RJCA 5M44A 2WIPA 2R3KA 4D4SA 1JNKA 1KE8A 2PMLX 4IBMA 4YC6A 4BF2A 3FMHA 4FVRA 3OWPA 4LOQA 4QYHA 3FMKA 4RFMA 1U5RA 4RVMA 4C4JA 2X7FA 1KV1A 4FIHA 2C6OA 4QTDA 4ZTQA 2OJ9A 3PSDA 4AN3A 3C13A 1QL6A 5EG3A 4FKLA 3KN6A 3R7IA 3FZTA 2P2HA 4LMNA 2X9EA 2XKFA 5IKWA 5EQEA 3QRUA 3TJCA 3BE2A 3QTXA 4ALVA 5DE2A 5EQYA 2PL0A 4O6LA 4NZWB 4HCVA 5IA1A 5AUXA 5CT7A 2BRHA 3NVKI 3MVMA 2OI4X 3MPAA 5HVJA 3UZTA 1O6LA 4YGAA 3EB0A 4CT1A 5IA0A 4E1ZA 3LXPA 4DGMA 5HNBA 4WBOA 4YURA 3K2LA 5C4LA 1VR2A 3FPQA 2ZB1A 1QMZA 1JVPP 4DA5A 1TKIA 4FT3A 4FEXA 1EH4A 3JY0A 3OY1A 3KRXA 4D4YA 3BKBA 4MX9A 4WG3A 1WBSA 2BZKB 1MRUA 2OIDA 1SVEA 1J7LA 2Y4PA 1MRYA 1B6CB 4YJTA 1V0PA 4Z7GA 4PRJA 3ZHPC 4GL9A 3SW7A 4CNHA 4OLIA 5HVYA 3MTFA 4JNWA 1Q24A 2F9GA 2VTMA 3HDNA 3QTSA 3VS5A 4PMPA 4HGEA 5KX8A 4I6FA 2QOBA 2GQGA 3I5NA 3QKLA 4DCEA 1H08A 2UZEA 1Q4LA 5IISA 3IW8A 4P5QA 3OD6X 4J53A 3R0TA 4J98A 3LFAA 4U80A 4KIPA 4L00A 4RJ6A 4UWCA 5ACKA 1CSNA 4V01A 2GQSA 4YLJA 3TN8A 2XEZA 3I0OA 3FZRA 5KMKA 4IX6A 5HLWA 4WA9A 5A46A 4E5AX 3LMIA 4JL9A 4UMUA 3EQBA 3I6WA 3G5DA 3QU0A 1QPJA 3EOCA 2XMYA 4M69B 5L2SA 4APCA 1YWRA 3CY3A 3IW4A 1DI9A 5FXRA 4TWOA 2NO3A 2QOFA 3M1SA 4N6YA 1W82A 5H3QA 5M4CA 3FC1X 5JQ5A 1J7UA 3ID6C 4MNEB 5BPYA 5A4CA 2PZPA 3F5XA 4IM3A 5B7VA 5CSVA 5ACBC 4EOJA 4BIEA 5DRDA 4O6EA 3PXRA 4M67A 2VO6A 1XO2B 1YI3A 4HVSA 5IEXA 1J7IA 3CJFA 3ZLSA 3FLQA 3R8UA 4U40A 3NS9A 3TI1A 3IW6A 2JDTA 3HYHA 4FEWA 2YABA 4O7TA 4CRSA 3DPKA 3F7ZA 1ZYCA 5CU0A 3PA5A 2XK8A 5K0KA 3BHHA 4P2KA 4U79A 3PXZA 5CSXA 3VHKA 4JJRA 4WRSA 3UVQA 3C4EA 4I93A 3IG7A 3QZIA 3MV5A 5BMMA 5K5XA 4E6CA 4QP6A 1PMVA 2C5YA 3PA3A 3QTWA 4O91A 1XWSA 3D0EA 3ZUUA 2R3QA 3NUXA 3LE6A 2SRCA 2Z7LA 4KIOA 3O51A 2C0IA 3GQIA 4M14A 4R7IA 5F1ZA 2OFVA 3UYSA 4DEBA 4GH2A 5JN2A 3HVCA 3FXWA 2R3HA 3VS7A 1IR3A 1Q8UA 4ZTRA 4EOSA 4Q5EA 2ITYA 2P55A 4F0FA 4MH7A 4EH6A 2PMIA 4JQ8A 2A19B 4YU2A 5AAGA 4X6QC 4L01A 4GG5A 4MXZA 4AGCA 3OOGA 3F82A 1BI7A 3P1AA 4XG4A 4FZDB 3OS3A 4OTWA 3DJ5A 5TO8A 3NW7A 3FHRA 4Y95A 2Z2WA 2W7XA 2PE2A 2VAGA 3ZYAA 4XMOA 3VRYA 4EWQA 5A14A 4AF3A 3JVRA 4GMYA 4AE9A 1SM2A 2Q83A 1PXPA 2O8YA 5E8VA 2G15A 2VUWA 4RIWA 4XUFA 3UP7A 5GZ9A 5CASA 1YHVA 2OXXA 3D7TA 3NYOA 3HRCA 3MH3A 3BV2A 4X2GA 2OO8X 2YDKA 4DH7A 4WD5A 4Y72A 2VWXA 5BQ0A 5IPJA 2AC3A 2PSQA 3GU4A 4AW5A 3PJ3A 4C38A 3U6HA 3ORKA 3ZSGA 4W4WA 5HNGA 4I4FA 3QCSA 2Q0BA 4TYIA 2F7XE 2UW7A 3TDVA 3MYGA 5D12A 5DMZA 2CNQA 5CU2A 2PVMA 5AP4A 5HE0A 4CCUA 3WBLA 1WBTA 4BDHA 3OROA 4M68A 4X6RA 3RAIA 4EHEA 2YIQA 4R77A 1HOWA 3H10A 3KRLA 3R71A 4QMUA 2VTOA 4NCTA 1XBAA 2WFYA 1Q8WA 3HUCA 2JAVA 2C5OA 5CNOA 4DT9A 1OVEA 4C35A 3TV6A 1OUYA 3PY3A 2WNTA 3GBZA 4KBCA 4F9BA 1WBOA 4KIKA 3DNDA 4LG4A 4O2PA 1PRYA 3FMJA 5FUTA 4YNEA 1U4DA 5IA3A 3DK7A 2BAKA 4GJ2A 2VX0A 5EI6A 4K6ZA 1P14A 3ZTXA 4WSQA 4AE6A 3IDPA 2ZMDA 3PRFA 2HYYA 1WCCA 5CNNA 1YHWA 4JBPA 4Z16A 3K5UA 4O27B 3NUPA 4U9AA 2JIUA 3GC9A 4F0GA 5AX9A 3QKMA 1H01A 4PMMA 4ASXA 4IDVA 3ZLYA 3SOCA 2RFDA 3VN9A 2WZJA 5L8JA 3FKOA 5EYMA 3KXGA 3OXTA 5IF1A 1GZKA 1ZARA 4WKQA 4M3QA 4RQVA 4BCKA 3G9LX 3F5GA 3KXMA 5KZ0A 2ZM4A 4A9RA 4F9YA 3FKLA 5TF9A 1UKHA 3IONA 4HVHA 1W0XC 4EHZA 5BYYA 2FA2A 3TKIA 3C0GA 2YEXA 5AUVA 2QOCA 4TYEA 4DHFA 4LL5A 4RZWA 3CR0A 4F1OA 3C0HA 4UMQA 4MQ2A 4GK3A 3VBYA 4BR3A 3JS2A 4Y83A 3QKKA 4G6NA 5EOLA 2UW4A 5AAEA 3EN7A 4WO5A 2Y7JA 5L6WL 4E6AA 2E9PA 4G31A 3RAHA 3D83A 4ERKA 4HGTA 3RZFA 5JFWA 3NEWA 2FUMA 3TG1A 4FI1A 4A4XA 5M57A 5IQHA 3EFJA 4R7HA 4NTTA 3LM0A 3VJOA 2PUPA 4FNZA 1O6YA 2JDRA 4C8BA 2X39A 4Q5HA 5KKRC 3LLTA 4L6QA 2CGUA 4FL3A 4G9CA 2ZDUA 3AD5A 5C8MA 2CCIA 3QBNA 3CE3A 1L3RE 1ZOHA 2CNUA 3HKOA 1ZWSA 3L9LA 3NGAA 4RA5A 3DDPA 4FTNA 5AJQA 2RFNA 4PMTA 3M11A 2V22A 2HZNA 5H8BA 2C5XA 2ONLC 4BCHA 1BL7A 2C47A 3BELA 3OEFX 3POZA 5IMXA 4FE2A 3MY5A 4QP3A 3R1NA 4FT7A 5HE1A 3TUBA 3KXHA 5G6VA 1ZXEA 3R8MA 4I6HA 5E8TA 4O0SA 5AX3A 3NCGA 4X3FB 4EI4A 2R3IA 3FXZA 4DFLA 2XJ0A 4CQGA 3GCVA 3R21A 5HO8A 4NM5A 3GCQA 4L7FA 2ZAZA 3NCZA 2J0LA 1YHSA 4DN5A 3UNKA 2KTYA 1GAGA 4FNWA 2PULA 4QD6A 3P08A 3Q2MA 1WZYA 3G6HA 4N6ZA 2C6MA 4FTCA 2BDFA 2NP8A 2QQ7A 1J1CA 4RVLA 5GHVA 3TZMA 4HW7A 2ZMCA 4X0MA 4YSJA 3U9NA 2GHGA 3KXXA 5AV4A 4MD8E 3V5TA 4FUYA 1JKSA 3EMGA 4LV8A 4BDAA 2WTIA 4O7NA 2RKUA 5DEWA 2GS2A 4I0RA 3EFWA 5AR3A 1NVSA 5IQCA 2YIRA 4PWNA 1PXMA 3QWKA 1H1RA 4HGSA 4OTFA 4GKHA 4A9YA 2QNJA 3POOA 4DC2A 4FV9A 4EJ7A 3ERKA 2YDIA 5TKDA 4EWHA 3WOWA 1CMKE 3A4PA 4C2WA 5M4FA 3DCVA 3E87A 4PMSA 2OKRA 2B1PA 1H25A 3OP5A 1QPEA 3LIJA 1V0BA 2C5VA 4R5YA 4BBEA 4S31A 5AMNA 5KBQA 4QMPA 5AWMA 2PYWA 3O96A 2V7AA 4PDYA 5C26A 3ZEPA 4C2VA 3FKNA 5J5TA 2H9VA 3F66A 1O6KA 4C59A 5HICA 4F0IA 5HZNA 5AR8A 1LPUA 3H30A 4E6QA 4FV6A 5DEYA 3R7UA 3TTIA 2F2UA 5BVOA 4M97A 5LWMA 2ETRA 1S9JA 2J4ZA 4YP8A 2CPKE 1MQ4A 3AT2A 3HLLA 4JT3A 4M13A 2VNWA 3ALOA 3FJQE 4DFUA 3O8PA 4S32A 4ZP5A 4AW2A 3CIKA 3O2MA 4TYGA 5L3AA 1JQHA 4FEQA 5BYZA 1I44A 4ZLYA 2F4JA 2HIWA 3TTJA 5GJFA 5K0XA 2O5KA 2YCSA 1V0OA 4AA5A 2BIYA 3GT8A 3MA3A 4QQTA 5JH6A 3DBQA 1OKWA 3DB8A 5HGIA 4FVQA 3RBWA 3C4XA 2BAQA 4J99A 3LXLA 5H8GA 3GU7A 4FIGA 1XH6A 3P7BA 3KVXA 2F7EE 1H00A 5ETFA 3TV4A 2R4BA 1MP8A 4G3GA 4K2RA 5EM7A 3VS3A 3BHUA 5CEIA 1P2AA 3R01A 5GIOE 3VUIA 4R8QA 5DOSA 4D58A 1SVGA 3OCGA 5EDRA 2W1CA 4IFCA 2WAJA 1DI8A 3THBA 2PZIA 1PY5A 4WT6A 5CT0A 2R3PA 4YZCA 4FKRA 4YZDA 1FQ1B 5HCZA 4FTOA 1ZYLA 2QOQA 3FZOA 3RHXA 1JLUE 3FPMA 4WNPA 4IC8A 2X2LA 2XZSA 3VBVA 1WMKA 3ODYX 4A4LA 5AV3A 5ANKA 3G0EA 4N0SA 4AOIA 3RPOA 4JG8A 4AFJA 2C6IA 2QLQA 1NY3A 3RPVA 1DAYA 3KREA 2BMCA 3P4KA 1M2QA 4JVGA 5FM2A 3KCFA 5AV2A 3EQFA 4BZOA 3C5IA 4EQCA 4R7BA 4AN9A 4OTQA 3SVVA 2GSFA 2C68A 5HO7A 2HWOA 3GU5A 2GPHA 3HEGA 2P33A 3W2PA 2VTRA 4D4RA 4HYHA 2JC6A 1NT2A 2R3RA 3E62A 2WTKB 3ROYA 3QQGA 3UVRA 3M2WA 3UNJA 2YIXA 4USEA 4J8MA 3RGFA 3OCSA 3BYMA 3QUPA 3GCPA 4FIFA 4NU1A 4XV3A 1RW8A 3MJ1A 3W55A 3KRWA 1BMKA 4YJPA 3VF8A 4NUSA 3KGAA 3KQ7A 3A7HA 3TZ7A 3ZOSA 3MY0A 2UW0A 4IB1A 5DVRA 1GZNA 1R0PA 4S2ZA 4ENYA 4DEDA 2RG5A 3FYKX 3ZH8A 4BWKA 5IEYA 4GW8A 5JFXA 3GB2A 3LLAA 2XNPA 3KCKA 3OVVA 3PP1A 4V0GB 3CY2A 5AP3A 5EHOA 3CKXA 2ZM3A 3HP2A 4DBXA 3OEZA 3PP0A 4QMVA 4X7QA 4IIRA 2EVAA 3VAPA 4UMTA 1CKPA 2UZBA 3E7VA 4BCGA 4FKQA 3OFMA 5IQFA 4F6WA 4RJ5A 4LUDA 3R9DA 4ZZMA 3E92A 2GS6A 5JGBA 3ZBXA 3LCDA 1YQJA 5EDPA 3PFQA 4ANNA 2QVSE 3OF0A 3W8LA 4DAWA 2WQOA 4DEAA 2BRGA 1CDKA 1GIIA 3TV7A 4F7SA 3D14A 3UMWA 4D5HA 3SX9A 5HVKA 3NPCA 3IW5A 4D0XA 5IZFA 4ANBA 3RVGA 4E20A 2QC6A 3NYXA 2UVYA 4UYAA 3W8QA 4BTKA 4EONA 3F3VA 4F70A 2OZOA 3BRBA 5L2QA 5C8NA 4FKVA 3UO4A 4AW0A 3U6IA 4NKSA 2GU8A 5E8YA 1IAHA 5E8UA 3CQWA 4HNIA 3DLSA 1OKZA 3QZHA 2YLEA 3EYGA 4R1YA 5CI7A 4CKJA 3A7IA 4FTMA 4D2PA 2BALA 4RFZA 2DWBA 4CD0A 1URWA 4CQEA 2F2CB 4FKGA 1H1QA 3QALE 2C0OA 2JD5A 2AYPA 3ZEWA 4AA4A 3R7VA 4QTEA 3KULB 3NZ0A 1E1XA 2P2IA 4FSQA 3VS2A 3AD6A 2UZNA 3R9HA 4LGDA 4HPUE 3QGWA 4B8LA 2RSVA 3TNIA 2I7QA 2R2PA 3EH9A 3PWDA 1YOLA 4F65A 3R02A 4EH2A 3R73A 3UO5A 1Y6BA 5J9YA 3D9VA 2YACA 3O17A 4IWPA 4BIDA 2WQBA 4FV2A 2ZOQA 5DH3A 1PYXA 2JDOA 3VUTA 4AOJA 4BKZA 3W1FA 4IWQA 3W18A 2C30A 2WD1A 3KN5A 5ETAA 3GNIB 1Y91A 4OTGA 4CXAA 5BMSA 1A48A 1H8FA 2UW5A 4O0RA 5EW8A 4BHZA 4XV1A 5ANJA 3SKCA 1R3CA 3FAAA 2YCFA 4WG5A 2Y0AA 3BZ3A 2XNOA 2XRUA 5E8SA 3O71A 1VYWA 3KKVA 4OGRA 2QO7A 2OJIA 4GJ3A 1JKLA 2ITXA 4RX5A 3QQLA 4FIIA 2YM8A 2WMVA 4BKYA 5IDPA 2WU6A 5A3XA 5HE2A 3EL8A 3S3IA 2VWUA 4YTIA 3CLYA 5FBOA 2FB8A 4K0YA 5L8LA 2QKWB 1PMEA 2X0GA 3UZPA 1Z57A 2DS1A 3DLZA 3REPA 4M84A 2Y6OA 5CXHA 3COHA 4EK4A 2DQ7X 4K11A 5E8WA 4ACHA 4EHGA 3D5UA 4LGHA 3D5XA 4FTJA 4O96A 2PMNX 3OT3A 3V6SA 3FWQA 5KNJA 4BWXA 5JKGA 4E5BA 1R78A 2PVRA 4NIFB 4GFOA 3LFQA 3AC3A 3BU3A 4MBIA 3KFAA 2V55A 2JDSA 4EHVA 3C4FA 4EBWA 4XG9A 5G1XA 1UWJA 3D2KA 4XRJA 1H1WA 2QOIA 3UE4A 5CQWA 2XK7A 4ZMEA 3A7GA 4ZK5A 1OIUA 2XIRA 5EKNA 4P5ZA 5LVLA 2I40A 3W33A 1KE6A 3NYVA 4XX9A 3WIKA 1OIRA 3AD4A 3RKBA 4EOIA 2E9VA 3LMHA 2YCRA 5M08A 3ENHA 4RQKA 4CYIA 3VS4A 1H28A 3L9PA 1H24A 2OG8A 3E93A 3PXQA 4U81A 4DH5A 4CVAA 5LVNA 3U6JA 5DYJA 3ORNA 4D9UA 2PVNA 2B55A 3T3UA 5T3QA 2ERZE 3LJ0A 2B0QA 4F6UA 1JSVA 1OL7A 2ITTA 4FSUA 4CFNA 3TJDA 4CFFA 2IPXA 3LJ2A 4QTCA 4QPMA 4Y5HA 4D2WA 3DXNA 3WF6A 3V3VA 5I9YA 3C51A 3IPHA 3RP9A 3JY9A 5TR6A 4JOAA 5M06A 1M52A 5IQEA 1YW2A 4EZ5A 1YXXA 4KD1A 4Z55A 2X4FA 3OOMA 3P7AA 3UQGA 5DNRA 3DAEA 3NX8A 3Q96A 4JQ7A 4F09A 2R9SA 4L42A 3VW6A 4ZSJA 3V5PA 4BN1A 2X9FA 2IW9A 5CVGA 5FEQA 3RHKA 2PHKA 2JDVA 5L6PA 5BX0A 3K5VA 4ASZA 2Z7QA 4HZSA 3V8TA 2IG7A 3IQ7A 1JKKA 3P86A 4KSPA 2QOHA 3H9OA 3ANRA 3BQCA 4ALUA 2OH0E 1P4FA 4I1ZA 4J8NA 3ZM9A 3AC5A 3ORIA 2OXYA 4QQCA 2Y6MA 3GVUA 3FI8A 4YZNA 3BYOA 4HPTE 4BICA 4ZTSA 5J5SA 3SGCA 3ATSA 4MCVA 4L3PA 2Y4IC 3RM6A 3COKA 3H9RA 3KA0A 4DGGA 2R7BA 5HTCA 5J1WA 4X21A 2ZB0A 4OBOA 3UZRA 4RGJA 4TNDA 2QG5A 3A8XA 4UXQA 3ZZEA 4FYNA 4QP2A 3D7ZA 2W4OA 3ZUVA 5IUIA 5EQPA 4HJOA 4MBJA 3QRIA 2YJSA 4ZEGA 3RNIA 2XF0A 4BBMA 2GNGA 4I3ZA 3LJ1A 4RLKA 3WE8A 5HEZA 4ZJVA 2WTVA 1W7HA 4Q2AA 4O0TA 1UNLA 5FTGA 5I3OA 2B53A 2W0JA 2W4KA 5AUZA 5FEEA 2WU7A 5LWNA 2EXEA 2XBJA 4BCOA 4JBVA 3RCDA 3N51A 4O82A 2I1MA 4GUBA 2FVDA 3GU6A 3I6UA 4O38A 3VBTA 1MQBA 3OTVA 2ITPA 4XBUA 1NW1A 2O65A 4TT7A 1GIHA 3PIZA 3VBXA 4FG7A 4D1SA 2A27A 1H07A 4EOKA 4TKSA 3O7LB 2HW7A 5ANGA 4RVKA 4FKOA 4O21A 2C6EA 1WVWA 4EK6A 4KB8A 2YISA 4NM7A 4D1XA 3MPTA 4OTHA 4UYNA 2I0YA 5E9EA 4ITIA 4RIXA 1W84A 3T8OA 3DKFA 3PXFA 3MH1A 4GG7A 3H0ZA 4G5PA 4QP8A 3SXSA 1ERKA 4ID7A 1JKTA 1ZYDA 4U7ZA 2FSTX 4L67A 5T68A 1A9UA 2F49A 2HELA 1PXOA 3G90X 4C3PA 4EH4A 1ZZ2A 1H0WA 1YDRE 3TDWA 4DH8A 4E4MA 4I20A 4FX3A 3BU6A 2XNGA 5T6KA 1LUFA 3R8PA 4CKIA 5K4IA 4DLIA 3N4UA 3AC8A 3HV7A 3A7FA 3IO7A 4I5PA 4QOXA 5IUGA 1E9HA 3RWPA 5JGDA 3FI4A 1KSWA 1Q8TA 3CXWA 4FMQA 4E5WA 4OAVB 5HCXA 3ZONA 5FBNC 4U45A 2W06A 4JLCA 2R3FA 4W4VA 3PDTA 2FSLX 4FR4A 4AT5A 3G9NA 4MTAA 2UZDA 3G51A 5D11A 5HD4A 2W9ZB 3Q3BA 2XK4A 4LGGA 4RC3A 2PUUA 1NA7A 4PF4A 5D1JA 2YM7A 4IEBA 4YC8A 3MW1A 3RPSA 3DTCA 2B7AA 2QO2A 2QHNA 2OWBA 4L3LA 3GC8A 3FZ1A 3V5JA 3EFKA 4GVAA 3G15A 3CTQA 3L8VA 5J79A 3RCJA 3MFTA 1PMNA 3HGKA 3LFSA 3QL8A 1OZ1A 1ZY4A 2IWIA 1AQ1A 4FGRA 2ITQA 3SDJA 3SG8A 4WHZA 5K5NA 4RPVA 3R8LA 4CZTA 3QZFA 2EB3A 4JIAA 4G6LA 2HZIA 3FY2A 1PF8A 3LKMA 3I0QA 1T46A 4BCIA 3I1AA 3BBTB 4F08A 3ZRLA 3ATTA 3FLNC 2CSNA 4M8TA 4U8ZA 4G9RA 5LMAA 4BI0A 2W1ZA 2OU7A 3FSFA 3Q9XA 2XVDA 4I6BA 3TIZA 3RPYA 3UGCA 3RPRA 3D15A 1J1BA 3RWQA 3ZS5A 5HG7A 4LFIA 4U0IA 1OPKA 1Y8YA 4CFWA 3OMVA 3FLSA 4FV4A 5HO6A 4JR3A 4S33A 3TKUA 4CMUA 4AX8A 2J7TA 3PXKA 5TE0A 3D5VA 4O0YA 3UIXA 2QURA 5D7AA 1Z5MA 2XK3A 4QMOA 3UOHA 3C7QA 1I09A 3MN3A 4QNYA 4XG8A 3KRRA 4FKJA 4AXAA 2BDWA 3GC0A 3UC4A 2X7GA 4GIHA 3QX2A 4XLIA 3SXRA 5GNKA 5B2LA 3TIYA 3DA6A 4UY9A 4MAOA 2OJGA 4C3RA 2IZUA 4G3CA 2RL5A 4M0ZA 3HRBA 1IAJA 2WXVA 4C57A 3OCBA 3WZJA 4K33A 4TWPA 3Q9YA 5HG8A 2EB2A 3CS9A 4QPSA 5FXSA 5FD2A 3CGFA 4JRNA 5E91A 2W9FB 4O86A 5I3RA 4GFMA 4KKGA 4CV8A 2CKEA 4H3BA 5BVFA 2JFMA 3AMYA 3SRVA 4B6LA 4ACDA 1OUKA 3LFBA 4F99A 5BNJA 3HV5A 3BHYA 4IAYA 2ONLA 3ENMA 5DT4A 5HG5A 5ANIA 2C6TA 2WKMA 3QC4A 3E3BX 4QTAA 4QYEA 3VBWA 1SVHA 2W05A 2ITZA 2OICA 4O0UA 5AIRA 2I0EA 4BTFA 5F20A 3R2YA 5M56A 3CCNA 3E8NA 3NRMA 4DH1A 1YXSA 4O7YA 5GJDA 2XA4A 2WMBA 4ZIMA 3GFEA 3LPBA 3VNTA 3U9CA 3ZXTA 3H9FA 4ITJA 3EN5A 2BKKA 3EQIA 3UNZA 4UBAA 1M14A 2W5HA 4DTKA 2IZSA 4L8MA 5KMJA 2GNHA 1S9IA 4DTAA 3BHTA 3CC6A 4KRCA 4NK9A 3PZHA 3WARA 3QTUA 3HZTA 4K8AA 5I5ZA 2CLXA 2BRNA 3LXKA 2B9HA 4FZ7A 2GHLA 3C4WA 4ZXTA 4TYJA 4BKJA 4W4YA 3ZFXA 1J91A 3QQJA 5E4HA 1YVJA 3HX4A 2ESMA 5AV0A 3EL7A 4AZFA 4FEUA 4I0SA 4UWYA 1RE8A 3E63A 4E4LA 3NDMA 2WQMA 3BEGA 3GENA 4W4XA 4QO9A 2XKEA 3MWUA 4O0XA 4DFXE 2XM9A 4YC3A 4APPA 4C37A 3S95A 4A4OA 3QRTA 5H2UA 3S4QA 5AP7A 5BYLA 2UV2A 3FV8A 4I6QA 2OLCA 2H34A 5AIKA 3EFLA 3NLBA 3R9OA 3PLAE 5F9EA 3ETAA 2C1AA 2PVJA 2QODA 2WO6A 4FNYA 4ZTHA 5CU6A 2B54A 3UC3A 4DFYA 4FSZA 2KULA 3EZVA 1REJA 1PW2A 3QTQA 5AR7A 3RNYA 4F9WA 2YAKA 3FYJX 5FQDC 1FBNA 4LI5A 5AEPA 1RJBA 4F1TA 4ZSLA 4C62A 3H3CA 5CF4A 4CTBA 4IHPA 1DM2A 4PL4A 2DYLA 3QQUA 5CAUA 4B4LA 3LOKA 2W1FA 2BR1A 3RAWA 2OZAA 4IZYA 3MY1A 3PA4A 2OH4A 3D4QA 3PG3A 2WTWA 1XH5A 2I0HA 4IAAA 3QD4A 4BDCA 3FLZA 5K3YA 3WI6A 3F2AA 1H26A 1IG1A 2C3JA 2YM3A 4E4XA 5CANA 3Q2JA 4RJ3A 2WHBA 1QPDA 3W2RA 3A60A 3ZXZA 3KK8A 3A4OX 5ITAA 1U54A 2PTKA 3PG1A 4K9YA 4OT6A 5HNIX 2HENA 2W5AA 4X3FC 3QQHA 5BUJA 4O0WA 4U3ZA 4IAKA 3P23A 4IW0A 3TUDA 5CY3A 3DXQA 4Z3VA 5J9ZA 2J50A 3AQVA 2C1BA 2IZTA 2QG7A 4UEUA 4J96A 3RAKA 3HV4A 4BY9E 4WOVA 4FTTA 5AA8A 2JKMA 3BYVA 3OWKA 4YO6A 5ANDA 4ZZNA 3PJ1A 4CKRA 1KE7A 1WBVA 2PY3A 2UW6A 5FTQA 3IGOA 1ZMUA 4LRMA 3NIZA 4AT3A 3MH0A 2OFUA 4BTMA 4FYOA 4PNKA 4UALA 3HECA 4RG0A 4J7BA 4C7TA 3BWJA 3JVSA 2WQEA 1GIJA 1QPCA 3KC3A 3CD8A 2BILB 4QMLA 5A6OA 1Q3DA 4FGBA 4IE9A 2CMWA 3DQXA 3UDBA 4XRLA 2GNFA 2J5EA 5HKMA 2HZ0A 5E90A 3G33A 4YJRA 5DPVA 3E8CA 3ZZWA 5FRIA 2R3OA 3ITZA 4RJ8A 3VW8A 4FBXA 4BRXA 5J1VA 5JRSA 4FTIA 3VQUA 5J7HA 3E3PA 2OIBA 4JX3A 5FGKA 2VWYA 2BHHA 4NWMA 5HIDA 2REIA 4H3QA 2CHLA 5AP0A 4J95A 1PMUA 1M2RA 5JEBA 2X1NA 4KABA 4AFEA 5M4IA 3G6GA 4RIWB 2YJRA 4L53A 4IJ9A 3D7TB 4P7EA 2OF2A 2PZRA 4X2NA 3V6RA 4A9SA 4D55A 3DBFA 3FXXA 2R64A 4C4IA 3C50A 3SD0A 4K18A 1TVOA 4YJSA 4YZMA 4FNXA 3R7GA 2VO3A 2VGOA 1OPLA 1PHKA 2ZV2A 3TWJA 5E1SA 3W2QA 4FSNA 3HNGA 4WUNA 2XJ1A 4EH5A 4UZDA 5A4EA 4RWIA 2A1AB 2PWLA 1CKJA 5DR2A 4H05A 2JBPA 4RIYA 3WF8A 4FUXA 4GT3A 3CEKA 2ZV7A 5FM3A 5CQUA 4UX9A 5HORA 5LXMA 4I4EA 5CXZA 5E8ZA 5JZJA 4MHAA 3ANQA 4EUUA 4MD7E 1OGUA 3OCTA 3GGFA 4KIKB 1Q62A 3ZM4A 5I0BA 5KMLA 2VWWA 3GUBA 4WRGA 5HESA 4B7TA 2VWZA 2PUNA 3FQEA 3RMFA 3VUKA 5D10A 4TY1A 3EWHA 5ETIA 3DZQA 4EOQA 3LCTA 3QLGA 1U59A 2BPMA 2XIXA 4W8DA 5DIAA 5KO1A 4MXOA 1STCE 5HTBA 4MWIA 1IA9A 4BDJA 1CKIA 3W16A 3N4TA 3HRFA 1YOMA 1FGIA 5HBEA 5B2MA 2JKQA 4FOCA 2X8DA 3VS6A 3VBQA 3UPXA 4HVDA 5J7BA 3WZKA 4ONAA 5BUEA 1Q8YA 2V0DA 3TT0A 1OBGA 2NNWB 2A4LA 1HCLA 1KE5A 4F6SA 2QCSA 2GCDA 4O0VA 5CVFA 3QD0A 2XYNA 4BCFA 4EJNA 1GOLA 4LQMA 4X2KA 4WSYA 4O22A 4ZLOA 2GQRA 2UVXA 5C8KA 2C0TA 2CDZA 2HXQA 3P79A 4AZEA 2ITNA 3KB7A 4YSMA 2W1HA 3MS9A 3FHIA 1TQIA 4FZAB 4FV5A 2UZWE 4G17A 4IANA 1KUTA 2QHMA 5ANOA 2JAMA 4A06A 4CLIA 4BDEA 4JXFA 5HE3A 1JBPE 1XBBA 3EN9A 5KCVA 1QCFA 3DOGA 5DWRA 4CRLA 1FVTA 1URCA 2UZTA 3PPZA 5I9WA 4UWBA 3MB6A 4EYJA 2WPAA 5C4KA 4KS8A 3HAVA 4FC0A 3DNEA 4YHJA 3MIAA 4UB7A 4Z9LA 1GNGA 2Z60A 2YITA 3DXPA 5CZHA 2BHEA 5IH4A 1Y6AA 2VTIA 4U3YA 4AG8A 2VTLA 5AUYA 3Q6UA 1FGKA 4IAIA 5FG8A 3KF4A 4IB3A 3LQ8A 4DYMA 4IJPA 4PQNA 3L8XA 2UUEA 4CMOA 4FVPA 3I60A 2GNJA 1G8SA 4FG8A 2A0CX 4NKAA 4E73A 3FI2A 1XH9A 4C34A 2JIIA 4FTQA 4KS7A 3GU8A 4C58A 4HYUA 4K1BA 3ZBFA 4EBVA 2CLQA 3R30A 1ZY5A 4ZJIA 3QGYA 4YNOA 3WZUA 5IH6A 2QD9A 3CKWA 3K54A 3PTGA 4FT5A 5EM5A 3M42A 1OM1A 4CZUA 2C3LA 4GFGA 2ZM1A 4CG8A 4TYHA 2W1IA 4QP4A 5IA2A 2ITWA 2BDJA 1JWHA 3OW3A 2AC5A 4MK0A 3LFCA 3UTOA 4DGOA 4IZ5A 4QMYA 3U55A 2VZ6A 4DEHA 3QD3A 4RWLA 4G3FA 4GK2A 4XP2A 5DI1A 4X2JA 4E26A 3UPZA 3MESA 4EC8A 1VYZA 4MQ1A 4E3CA 3VF9A 4YJUA 3F2RA 2G1TA 4QYGA 3TACA 5M55A 4QTBA 2YERA 1XQZA 4I41A 3ET7A 4U43A 2PVHA 5DR6A 5A9UA 1P5EA 2FGIA 2I0VA 2R7IA 2VTPA 4FT0A 3EQRA 3FZSA 3IOKA 2VRXA 5KE0A 4DG2E 5C9CA 5DRBA 3SV0A 3FC2A 4BWPA 4RBLA 3UIMA 3BLHA 5AR4A 4EUTA 2EWAA 3P7CA 3DJ7A 3QC9A 4D5KA 2YDJA 3AT3A 3QQKA 1YKRA 2QR8A 2QR7A 1ZYJA 1YOJA 2WMRA 5FTOA 1TQMA 3VHEA 4MNFA 3FY0A 1J3HA 3S0OA 5GINE 2IN6A 3Q4CA 4FK6A 4U41A 3ZU7A 3DKOA 4AAAA 1UU9A 3G0FA 4E4NA 3DU8A 3U54A 1F5QA 1YI6A 3IS5A 5BVWA 3OUNB 3UODA 1FMKA 4B99A 2O3PA 1Y57A 2YWPA 2RGPA 4YZBA 5IQAA 3V04A 3PXYA 3LMGA 2W99B 3UP2A 5M53A 3JPVA 3PVUA 2ZYBA 4MEDA 5L4QA 4E8AA 2X8IA 3F7WA 4M15A 2UZVA 3DBDA 3V51A 2Y8OA 3EQGA
chains in the Genus database with same CATH superfamily
5JFSA 5BVKA 1K2PA 2C5NA 2E9UA 4TRLA 2JBOA 4DH3A 4BHNA 3I7CA 3E88A 4BCQA 2GFSA 3FQSA 4D0WA 4G5JA 3V5LA 4EH7A 3W0MA 3PE1A 4YZ9A 3WE4A 2J51A 1OKVA 2QOLA 2XK6A 3UIUA 4ANMA 3WF9A 5EFQA 4IFGA 1H1PA 1PXLA 4HYSA 5CI6A 4JAIA 2YLFA 3ELJA 4RA4A 3W2OA 4BDFA 1CTPE 4GYGA 3W2CA 5LMBA 3QCXA 5JZNA 4L9IA 2OGVA 3KRJA 3GXLA 2OK1A 4QQ5A 3VUDA 4DDIA 5HU9A 3R7YA 4TPTA 4NEUA 4QMQA 4KRDA 1K9AA 1TFFA 4YLLA 4D2VA 3A7JA 4XG2A 2OJJA 3NUNA 4D2SA 1OBDA 4XP0A 2QKRA 4EYMA 4JR7A 3R9NA 4TZRA 2BKZA 3F3ZA 3R1YA 4B0GA 2B52A 3MDYA 4D2TA 4HCTA 1T45A 1ZMWA 3Q4ZA 4LRJA 3R1QA 1PKDA 2BAJA 3C4CA 3O50A 2RG6A 4TNBA 4O1PA 2X81A 3MIYA 5KHXA 5LCKA 4QPAA 3I7BA 3VC4A 4BGQA 1PYEA 1OIYA 3CPCA 2X0OA 2F7ZE 4IMYA 5I9ZA 4N4SA 2J5FA 2J0KA 2XP2A 1DAWA 3TM0A 3II5A 3F3TA 4JBOA 4MKCA 4RC2A 3V01A 4O4FA 3DB6A 3UOLA 3EKNA 4Q9ZA 2C3KA 1ZYSA 2QLUA 2PK9A 4ORKA 3IKAA 3VUGA 2XYUA 3BQRA 3NW6A 3CJGA 5I9VA 4ZMFA 4IXPA 1E1VA 3UG2A 2G2FA 2WMSA 4V05A 3NNVA 4CLJA 2IJMA 1P4OA 3LM5A 4H39A 3PUPA 3BEAA 4XCUA 3QHWA 4YPDA 4F64A 3FSKA 5M07A 4PTEA 3EZRA 4MWHA 2EXCX 4WNKA 3ULIA 5CAPA 3GEQA 3RINA 3DGKA 3EN4A 3FL4A 4M69A 2WEVA 4HYIA 4HNFA 5GZAA 1F3MC 4TWCA 2HWPA 3EQCA 3U51A 2VWIA 3ZRKA 1OL5A 2NRYA 4YLKA 4DG3E 5ICPA 2XNMA 3Q32A 4MNEA 3QAME 3L8SA 1FMOE 3VIDA 3DV3A 4H1MA 4NL0A 4N70A 5IEVA 2X2MA 4AXFA 3FMNA 3QTRA 3FMEA 3RZBA 5CALA 2VX3A 1G8JA 4CFXA 5LMKC 2ITVA 4MYGA 2PE1A 4RZVA 4EQMA 4O7ZA 3F69A 2ITUA 4G16A 3BLRA 3ZFYA 2W4JA 1BYGA 3T3VA 1W2DA 4YJNA 4PV0A 3V8SA 3BPRA 3JYAA 4M12A 4XBRA 3MFRA 5H9BA 1OPJA 2OJFE 3I81A 4XHKB 5CF5A 4H58A 4JDIA 4LUEA 4BGHA 3IDCA 4CFUA 2JIVA 3NYNA 4QMTA 5HD7A 3FMMA 4BDBA 4MXXA 2CN5A 3QUEA 3MI9A 3LZBA 3PIYA 3PPKA 4YMJA 1GZ8A 4DF3A 4IX5A 2ETMA 3PWYA 5IH5A 4ZTNA 3R1SA 2IF8A 3K3JA 3E8DA 5IQDA 2H6DA 3MH2A 4KBKA 4CFMA 3FI3A 3C4ZA 1BKXA 3HV6A 5AV1A 3UVPA 4EKKA 4B8MA 3NNWA 5J95A 3HP5A 1BUHA 4IZAA 2O64A 4J71A 4AXEA 4GK4A 2PZ5A 4DBNA 5D41A 5CEQA 1ZZLA 4G2FA 3ZDIA 3B2WA 4JG7A 4F9AA 4RIOA 5FP6A 4I92A 3QZGA 3ZFMA 1RQQA 1YDSE 5DA3A 1Y8GA 5GJGA 4FK3A 2PVLA 1H1SA 1OI9A 3UQCA 4NW5A 5HIEA 2YIYA 2UVZA 2XKCA 2R0UA 1R39A 3VS1A 1YDTE 4XS2A 3W2SA 4BL1A 3QD2B 2J0JA 4ZSGA 4AUAA 4ENXA 3COMA 4FIEA 4GU9A 2FO0A 3R83A 3W0QA 3Q60A 4ERWA 5EW9A 3DBCA 2C6KA 3LFEA 4EH8A 2XALA 5LOHA 3ZC5A 2OW3A 2YWVA 3L8PA 2UZOA 3O8UA 3C5UA 5C1QB 4ZAUA 4K77A 5DT3A 4MXCA 4NFNA 3ZUTA 3QRJA 4EL9A 5LARA 4C33A 3D2IA 1H27A 4PUZA 3HMMA 4IAFA 1V1KA 3QLFA 3UYTA 1H0VA 2UW9A 2XNEA 3QX4A 4IX4A 3KMMA 4A9UA 4ANLA 4E7WA 2VU3A 3B2TA 4ZS4A 4RX9A 1BL6A 1R1WA 3CQEA 4TWNA 4ACMA 3EKKA 3PLSA 4O4BB 3GC7A 3R22A 4NH1A 2C4GA 5GIPE 3AG9A 1XR1A 4F7LA 3R63A 4BJJB 4QP1A 1PXKA 3QF9A 4PY1A 4YUQA 4ANQA 1FVVA 4PDSA 5JSMA 3QTZA 5ETCA 4DCAA 5FWKK 1OL2A 3R9RA 1VJYA 2CGXA 3NAYA 4DEEA 4DEGA 2W1GA 4BCPA 1GZOA 4IQ6A 3ORLA 1AGWA 3KMUA 5CTPA 4FV3A 3ZSHA 4KWPA 2W96B 2WGJA 3TCPA 5EHLA 2HCKA 2BTRA 4FTAA 4GCJA 3MTLA 3SG9A 1FVRA 1PXIA 2BRMA 3BCEA 3F3WA 1UNGA 2BRBA 4O4CA 4ZSAA 4J1RA 3ZO2A 5KBRA 1IA8A 2IVVA 2Y9QA 3S00A 3IECA 2Z8CA 3UIBA 4IAZA 3UO6A 5EYCA 3OT8A 3IGGA 4RWJA 3R8VA 4QYYA 4RX7A 4NM3A 4NW6A 3QYZA 4I23A 2NPQA 4BC6A 4BB4A 4EC9A 5IQBA 3PY0A 2IVSA 3PVGA 3KEXA 4MF0A 5AUUA 3KXNA 2PVYA 4A07A 4I24A 4IVBA 4O7VA 1JOWB 3PVWA 2PE0A 4AZSA 1TQPA 2IVTA 5IUHA 3COIA 4Y8DA 4KINA 2G2HA 3CD3A 4EQUA 2H96A 5KUPA 2NYAA 4BDIA 3ULZA 3FQHA 4ZY6A 4GV1A 4W8EA 2PVFA 5JT2A 4G1WA 4QP7A 2EUFB 3TNPC 4FTLA 4C36A 5LJJA 2ZV9A 3UJGA 1G8AA 4P90A 2J90A 4ARKA 5BVNA 4XG6A 4AA0A 3PJ2A 5I9UA 3AKJA 3LCOA 5GZ8A 3U87A 3P5KA 4AZVA 4F4PA 4CZYB 4XG3A 1ATPE 3RALA 3QYWA 3OTUA 4FTUA 5C01A 4W9WA 4F7JA 3MB7A 3IOPA 1ZMVA 2C6DA 4AGUA 4FEVA 5EYDA 3BYUA 2FH9A 2VTTA 2WOUA 4FG9A 4PP9A 2YFXA 4A7CA 2WELA 3BLAA 4OAUC 3Q53A 3BGQA 4LRKA 3NVMB 4JI9A 1SNXA 3L9MA 3NUAA 1ST4A 2GDOA 4EH3A 3FEGA 4BCMA 3UBDA 4AAYA 5A4QA 2OXDA 1Q41A 4YTCA 5M51A 4IB5A 5K9IA 4H1JA 3V5QA 5IU2A 2G9XA 2W17A 4X3FA 3WZDA 2VO0A 4FV1A 4KIQA 1LR4A 1REKA 4MXYA 2IO6A 1ZOGA 4NYEA 4AQCA 4QMWA 4DE4A 3A61A 1OL1A 2R3NA 5BVEA 5EH0A 3CBLA 3NUSA 5J87A 3IK3A 3OWJA 3Q4TA 5KHWA 4IWOA 4D4VA 1SYKA 3C9WA 4FSWA 5I4NA 5IA4A 4R5SA 3EIDA 4AGWA 3NNXA 5AM6A 3R00A 5KZIA 5AAFA 3Q5ZA 5DG5A 4O2ZA 3FZPA 3BWFA 2PUIA 4O81A 3ZMMA 3T9IA 4IWDA 5B0XA 4AWIA 2E9NA 2J2IB 1H4LA 1YXVA 2VTJA 3L9NA 5EI2A 4OTIA 1NVQA 3HL7A 1LEWA 3HMPA 2ZDTA 5CU3A 4FKPA 4O83A 1MUOA 2JITA 3DT1A 4USDA 4I0TA 5J9LA 4LMUA 3NIEA 4CGAA 1FINA 3BHVA 5FXQA 3QCYA 4YO4A 1JAMA 1XBCA 4ANOA 1YXUA 1FOTA 3H4JA 5CAQA 3MVLA 4BYIA 2WMXA 2VTAA 2O63A 3HMIA 4GIIA 4XLVA 3QCQA 3TZ8A 3HA6A 5B2KA 3HMOA 4RIXB 3TXOA 3TZ9A 3KF7A 2CNVA 2GNIA 4CG9A 1LEZA 4QP9A 4EH9A 4MF1A 3QTIA 2J0MB 5H8EA 3PJ8A 3R8ZA 5CAVA 2P0CA 3U4WA 1VLRA 5AA9A 4AZWA 3DDQA 1NVRA 3ZRMA 1FPUA 1UV5A 4DLJA 1M2PA 3R28A 4IDTA 4UZHA 3AGLA 1U46A 4P4CA 4RFYA 5LVMA 2DUVA 2QI8A 5DR9A 3MFSA 4PDPA 2ACXA 5JQ8A 2WIHA 1ZRZA 5TOZA 5HBHA 2X6DA 5L2WA 2HY81 4DTBA 2QU5A 1UNHA 5LVPA 1PJKA 4F7NA 3FL5A 4YHFA 4ALWA 3EN6A 3A2CA 3PVBA 5HHWA 3BV3A 3DKGA 2VN9A 4ZZOA 4U6RA 3B8QA 4FZFB 4AZTA 4XH6A 3MJ2A 1WBWA 3OUKA 3TNHA 4WNOA 1MRVA 4H3PA 4LV5A 1XH8A 4R3PA 3RK7A 5CEOA 1R0EA 4JG6A 3GFWA 3ROCA 4BCNA 3DS6A 2VTQA 2BCJA 4Q9SA 4QNAA 4R3RA 3OBJA 3RI1A 1M17A 3TNWA 1G5SA 3ACJA 4CMTA 5EM6A 3F6XA 3KU2A 4L46A 3O7LD 3EYHA 4BIBA 4QT1A 4MUQA 1RDQE 2OSCA 3GQLA 4WBBB 4G34A 4E6DA 2GNLA 1YI4A 1WAKA 3KL8A 1K3AA 3L1SA 5ANEA 2JKOA 3QUDA 4GT5A 5CENA 3Q52A 5IQIA 5HCYA 3LW0A 1KWPA 4L52A 1Q5KA 4L45A 5DBXA 4O7LA 4EORA 2Z02A 3AMAA 5CLPA 1KV2A 4RLLA 4G3EA 4IX3A 5E1EA 2IZRA 5AP5A 4YTHA 2A2AA 2ZV8A 3NSZA 3FMLA 1Q97A 4NSTA 5TT7A 4ASEA 1IASA 4GEOA 3E7OA 4JQEA 2CN8A 2VTHA 1JPAA 3FDNA 4II5A 4YJVA 2V62A 4C4FA 4I5MA 3OC1A 5CEKA 3MVHA 3TL8A 1M7NA 2C6LA 4YPSA 5D9HA 2WMTA 2BVAA 3P0MA 4EOMA 3ZSIA 2YM5A 2CKOA 3GOKA 4Z7HA 4YJQA 2VX1A 3EQHA 3BGPA 2XNNA 3K3IA 3VQHA 4FSTA 5LVOA 3Q4UA 3AC1A 4IM0A 4J97A 4XYFA 1Q61A 4IH8A 3OXZA 5DN3A 3VUHA 2FSOX 4DITA 4Y85A 2BZHB 2UZUE 4FTKA 3V8WA 4V04A 3AMBA 5DT0A 4QMXA 3EJ1A 3TUCA 3ZO3A 1PXNA 3A99A 3ALNA 2YA9A 4QMZA 4FF8A 3DJ6A 3VO3A 3G2FA 3DQWA 4AGDA 5KMMA 2R5TA 4XOZA 4U97A 2CKPA 1L8TA 3BL7A 1F0QA 4I21A 4EOPA 5KKRB 3LXNA 3CPBA 5K4JA 3NMUF 5HU3A 2GTMA 4BDDA 3E64A 4NCTC 5CEPA 5BUIA 2LGCA 4V0GA 5M4UA 3FBVA 3GCSA 3MA6A 2B9IA 3Q6WA 3PRIA 3DK6A 4UV0A 4NTSA 3SRVB 5I9XA 3F5PA 4QEBA 4DT8A 2JFLA 1OB3A 2VNYA 4C0TA 3LAUA 2XS0A 2XBAA 3EHAA 4U44A 3SW4A 1BX6A 3OG7A 1W83A 1XH4A 2WTDA 3PSBA 3F61A 4FSMA 3BE9A 4KA3A 1OECA 4MVFA 3UMXA 3ORMA 1VEBA 2O2UA 2QOKA 3LQ5A 5AFVA 4D28A 3NUYA 4RX8A 3PDTA 2BZJA 4AOTA 4PP7A 4PPBA 2UZLA 4O7SA 3DFAA 4FKIA 4NJ3A 4MD9E 2AUHA 4RRVA 5FDXA 5IMEA 2YHVA 3D94A 4AACA 4QQJA 3U4UA 4CTCA 4PDOA 3LHJA 2YAAA 5E8XA 2W1EA 4ANSA 5CZIA 5EW3A 1APME 4BGGA 4EKLA 2PMOX 3CQUA 3DZOA 5LCJA 2HK5A 4GVJA 4PTCA 4BYJA 3RK5A 5CF6A 3AC2A 5HG9A 4WG4A 2BFXA 1W8CA 4I22A 1G3NA 1WFCA 4C4GA 3PE2A 4TW9A 4BVUA 2RFEA 4RJ7A 4UMRA 5EKOA 3P78A 4L44A 1SZMA 5JRQA 4IADA 4PL3A 3ZLWA 2PZYA 2F57A 4OBPA 2BFYA 4RJ4A 3WF5A 3KULA 2YCQA 4BDGA 4OUCA 4EZ7A 3JUHA 4JBQA 3HAMA 3R6XA 2VTSA 3QHRA 3DTWA 3OBGA 3NFGB 3V5WA 4PL5A 1BI8A 4M66A 4PNIA 4ASDA 1OL6A 4NT4A 3DY7A 4EK3A 2V5QA 2HY0A 3ORZA 4HVIA 4IC7A 1OITA 1W98A 2VV9A 2X7OA 2OIQA 2VTNA 5FP5A 5EK7A 3CSVA 1WVXA 3PY1A 2QONA 4Y73A 2VGPA 3UOJA 3PJCA 4JX7A 3C0IA 2XRWA 2WTKC 4HGLA 3T9TA 4C3FA 5L6OA 2IW8A 4E93A 2OZAB 3O0GA 5IA5A 3W10A 2G01A 4AN2A 3QFVA 4QMNA 4BTJA 5L2TA 1GY3A 3OW4A 4XJ0A 2BTSA 2QOOA 3F2NA 3VWAA 2ZJWA 4OBQA 4C4EA 4GUEA 2RFSA 4ZY4A 2X0PA 4W9XA 4BFMA 5HTIA 3A8WA 3BI6A 3MFUA 5L8KA 4RT7A 2CGWA 1DS5A 1VZOA 2R3JA 2VD5A 4Y5QA 1U54B 3ZO4A 5CYIA 1GJOA 3FLWA 4O84A 3O8TA 3OWLA 4TTHB 1CM8A 3DKCA 4L68A 4QRCA 3ZLXA 3UDSA 1X8BA 2BROA 4IB0A 5DFPA 3SXFA 3OY3A 2J6MA 2YZLA 4LOPA 4CT2A 2BUJA 2XIYA 4AW1A 4RMZA 2HZ4A 4NIFA 2OF4A 4OR5A 5D7VA 2R0IA 3PIXA 3N9XA 3TEIA 4DFBA 4ACCA 2E2BA 1UU7A 2WEIA 2XUUA 3DK3A 4L3JA 4LM5A 2XAOA 2E9OA 2W5BA 4WUAA 3I5ZA 3FUPA 1LP4A 3LFDA 3GCUA 3WF7A 3ORTA 1M7QA 1Q3WA 3ODZX 2AQXA 2H8HA 3QXPA 1UVRA 2XIKA 4MXAA 3H0YA 3FMDA 2WB8A 3RM7A 1KOAA 4A9TA 3MSSA 3WILA 4KBAA 3WYYA 3SAYA 1WVYA 3FE3A 4OTRA 4D2RA 4KKHA 1IEPA 4FA2A 5AUWA 2WMWA 5AM7A 2GFCA 3P9JA 4DINA 4LL0A 2XCKA 4R1VA 3RTPA 5L2IA 2W1DA 4RVTA 4GT4A 3NAXA 1WBPA 5HI2A 4PPCA 4DEIA 3HUBA 5CU4A 4GKIA 3R04A 5E7RA 5AP6A 3LQ3A 2XCHA 3ZCLA 5AP2A 4AU8A 1B39A 4XG7A 1Q99A 1HCKA 2IW6A 3GOPA 4TN6A 4YHTA 5A54A 1UU8A 2CGVA 2QO9A 3HA8A 5IDNA 4R78A 3BBWA 2CCHA 2YM6A 3OHTA 3D5WA 4JIKA 2P3GX 4IM2A 2B4SB 4CV9A 5CS6A 4FZ6A 4L43A 5FLFA 4ZY5A 4JDHA 4DHZA 4L7SA 3QQFA 4OW8A 3LFNA 2HOGA 2X8EA 1XJDA 3QWJA 5HX8A 4FOBA 4UN0C 2YZAA 1NXKA 2R3GA 4JS8A 4QMSA 4EK8A 5KMIA 4FKTA 4D1ZA 1ND4A 3F5UA 4RC4A 5J8IA 5HQ0A 3QA8A 4FODA 2WOTA 5DLSA 5FEDA 1U5QA 2V7OA 3GI3A 4NFMA 1IRKA 3AT4A 3CP9A 4RSSA 3KK9A 4RIYB 5F4NA 4ZTMA 2G2IA 4FIJA 3BLQA 2I6LA 1XH7A 4DHJA 2B9FA 3EQDA 5JK3A 4PPAA 4OT5A 1KE9A 2XNBA 4BCJA 5LMKA 2P4IA 4QYFA 2WMAA 2ITOA 5F95A 5EOBA 5DGZA 3AGMA 4FL2A 2WTJA 3C1XA 3R7OA 3WYXA 1Z9XA 4GRBA 3KY2A 4IACA 2WQNA 3WIGA 4F63A 3MBLA 4LOOA 1Q8ZA 3F9NA 5HIBA 4D9TA 2XJ2A 4YJOA 4DGLC 5CEMA 2Q0NA 5KMNA 1SMHA 5E92A 4DG0E 4ZLZA 3Q5IA 4GS6A 1UU3A 3FLYA 5JGAA 2B9JA 3NW5A 3O23A 5HBJA 4S34A 2JGZA 5AADA 1OKYA 5DHJA 4F9CA 5F94A 3AOXA 4NJDA 4O4EA 3PZEA 2CKQA 3W0PA 2GMXA 3EQPA 4G6OA 5CSWA 3DAJA 4X2FA 2ERKA 4CFVA 4FTRA 4M7IA 4JDKA 3QXOA 4C02A 1KOBA 1UA2A 3BGZA 1YXTA 4N57A 4IVDA 3NWWA 4EOOA 5EYKA 3SA0A 1PXJA 1XKKA 2LAVA 2X6EA 4JAJA 4YR8A 5FDPA 1WBNA 2XIZA 3LCSA 4KNBA 4XOYA 5CSHA 4EK5A 3HMNA 4HVGA 5KMOA 4ZS0A 1O9UA 3CTHA 2CJMA 2FSMX 4JRVA 4ACGA 4EZ3A 1JSTA 5CVHA 5CAOA 4ZSEA 3R2BA 4GSBA 3R7EA 3HV3A 3ZO1A 1ZLTA 4DFNA 4PTGA 2PVKA 4S30A 4UMPA 3S2PA 4XV2A 2VWVA 4EOLA 3F88A 1OIQA 4HOKA 4BI2A 1SNUA 2QU6A 3CTJA 5JFVA 2FYSA 2PPQA 5AUTA 3WZEA 3NNUA 4CEGA 2ETKA 4WNMA 5AP1A 4RWKA 5CWZA 5IQGA 5C27A 4FSRA 4C61A 2Z7SA 3DBEA 1ZAOA 1XHAA 3DFCB 3ORXA 4FL1A 2WTCA 4LYNA 1YWNA 4FV7A 4ZOGA 3SQQA 4FV8A 4BBFA 4U42A 3JR1A 2RIOA 3F3UA 3QA0A 4U5JA 3PYYA 4YTFA 2YN8A 3IW7A 2XK9A 4I5CA 2BZIB 5CSPA 5BVDA 3W32A 4NM0A 3NR9A 3KVWA 4IVCA 4B9DA 1B38A 4ZTLA 4AT4A 4EEVA 5HLNA 4KUJA 3I4BA 5HX6A 4OTDA 2XM8A 3UOKA 3SHEA 5LQFA 3LFFA 3MPMA 4XEYA 4TYHB 5HOAA 2WMQA 2GTNA 3Q9WA 2C3IB 1YWVA 2PU8A 1UWHA 5A4LA 3E8EA 3Q9ZA 4QMMA 4FT9A 4AP7A 2HXLA 4GYIA 2X4ZA 5HLPA 4FSYA 4R3CA 5IG1A 3VVHA 4HZRA 4I5HA 5CX9A 2O0UA 3JXWA 4CYJA 3E5AA 3PPJA 2RF9A 2BIKB 2R3MA 4DGNA 2X2KA 3NUUA 4UXLA 3HDMA 5EM8A 1OMWA 4BI1A 4BZDA 4TL0A 2XKDA 2XEYA 3TNQB 4CCBA 4FKSA 3I79A 4MBLA 4WIHA 3VUMA 4IVAA 2YIWA 4GU6A 2UW3A 5JMSA 5AR5A 2XH5A 1PKGA 4ZJJA 2IVUA 3Q04A 4X3JA 5A4TA 4O7RA 3UG1A 3LVPA 2JEDA 4FKWA 4JDJA 3MGYA 2OBJA 2XANA 3ZC6A 4KKEA 2C69A 5EI8A 4KSQA 5C03A 5EHYA 4USFA 4ITHA 4PX6A 1AD5A 3VRZA 4TXCA 2GHMA 3A62A 4OTPA 2UW8A 3TKHA 3VJNA 3RK9A 3CGOA 2ZVAA 3AC4A 3IDBA 4BZNA 3DAKA 1A06A 4H36A 1BLXA 4XV9A 4FKUA 2VWBA 4XP3A 5CF8A 4HCUA 5A6NA 4Y46A 5AR2A 2JLDA 4XNEA 3BYSA 4DFZE 2NRUA 2EXMA 1ZOEA 3ORPA 3AXWA 3OXIA 5EDQA 4G3DA 3SOAA 3VULA 3KMWA 2HW6A 4C4HA 3SC1A 3ACKA 4IZ7A 3VS0A 2VO7A 4AS0A 1JSUA 4R6VA 4FV0A 2HAKA 3PSCA 3KXZA 3BU5A 3N4VA 3OZ6A 4O7WA 3MVJA 4YBKA 3S1HA 3UQFA 4CSVA 2YM4A 1UKIA 2EU9A 3LCKA 3SLSA 4KAOA 2GS7A 2J0IA 5M09A 2J9MA 2JKKA 3B8RA 2R3LA 4J52A 4I94A 4YBJA 3BIZA 2XB7A 3U8WA 3ZDUA 3GP0A 4O1OA 3QRKA 4BDKA 2Y4IB 3BX5A 4F1MA 4M0YA 2WMUA 2Z7RA 1YRPA 4FICA 3RJCA 5M44A 2WIPA 2R3KA 4D4SA 1JNKA 1KE8A 2PMLX 4IBMA 4YC6A 4BF2A 3FMHA 4FVRA 3OWPA 4LOQA 4QYHA 3FMKA 4RFMA 1U5RA 4RVMA 4C4JA 2X7FA 1KV1A 4FIHA 2C6OA 4QTDA 4ZTQA 3BL9A 2OJ9A 3PSDA 4AN3A 3C13A 1QL6A 5EG3A 4FKLA 3KN6A 3R7IA 3FZTA 2P2HA 4LMNA 2X9EA 2XKFA 5IKWA 5EQEA 3QRUA 3TJCA 3BE2A 3QTXA 4ALVA 5DE2A 5EQYA 2PL0A 4O6LA 4NZWB 4HCVA 5IA1A 5AUXA 5CT7A 2BRHA 3NVKI 3MVMA 2OI4X 3MPAA 5HVJA 3UZTA 1O6LA 4YGAA 2X0QA 3EB0A 4CT1A 5IA0A 4E1ZA 3LXPA 4DGMA 5HNBA 4WBOA 4YURA 3K2LA 5C4LA 1VR2A 3FPQA 2ZB1A 1QMZA 1JVPP 3UDZA 4DA5A 1TKIA 4FT3A 4FEXA 1EH4A 3JY0A 3OY1A 3KRXA 4D4YA 3BKBA 4MX9A 4WG3A 1WBSA 2BZKB 1MRUA 2OIDA 1SVEA 1J7LA 2Y4PA 1MRYA 1B6CB 4YJTA 1V0PA 4Z7GA 4PRJA 3ZHPC 4GL9A 3SW7A 4CNHA 4OLIA 5HVYA 3MTFA 4JNWA 1Q24A 2F9GA 2VTMA 3HDNA 3QTSA 3VS5A 4PMPA 4HGEA 5KX8A 4I6FA 2QOBA 2GQGA 3I5NA 3QKLA 4DCEA 1H08A 2UZEA 1Q4LA 5IISA 3IW8A 4P5QA 3OD6X 4J53A 3R0TA 4J98A 3LFAA 4U80A 4KIPA 4L00A 4RJ6A 4UWCA 5ACKA 1CSNA 4V01A 2GQSA 4YLJA 3TN8A 2XEZA 3I0OA 3FZRA 5KMKA 4IX6A 5HLWA 4WA9A 5A46A 4E5AX 3LMIA 4JL9A 4UMUA 3EQBA 3I6WA 3G5DA 3QU0A 1QPJA 3EOCA 2XMYA 4M69B 5L2SA 4APCA 1YWRA 3CY3A 3IW4A 1DI9A 5FXRA 4TWOA 2NO3A 2QOFA 3M1SA 4N6YA 1W82A 5H3QA 5M4CA 3FC1X 5JQ5A 1J7UA 3ID6C 4MNEB 5BPYA 5A4CA 2PZPA 3F5XA 4IM3A 5B7VA 5CSVA 5ACBC 4EOJA 4BIEA 5DRDA 4O6EA 3PXRA 4M67A 2VO6A 1XO2B 1YI3A 4HVSA 5IEXA 1J7IA 3CJFA 3ZLSA 3FLQA 3R8UA 1G8KA 4U40A 3NS9A 3TI1A 3IW6A 2JDTA 3HYHA 4FEWA 2YABA 4O7TA 4CRSA 3DPKA 3F7ZA 1ZYCA 5CU0A 3PA5A 2XK8A 5K0KA 3BHHA 4P2KA 4U79A 3PXZA 5CSXA 3VHKA 4JJRA 4WRSA 3UVQA 3C4EA 4I93A 3IG7A 3QZIA 3MV5A 5BMMA 5K5XA 4E6CA 4QP6A 1PMVA 3KIOC 2C5YA 3PA3A 3QTWA 4O91A 1XWSA 3D0EA 3ZUUA 2R3QA 3NUXA 3LE6A 2SRCA 2Z7LA 4KIOA 3O51A 2C0IA 3GQIA 4M14A 4R7IA 5F1ZA 2OFVA 3UYSA 4DEBA 4GH2A 5JN2A 3HVCA 3FXWA 2R3HA 3VS7A 1IR3A 1Q8UA 4ZTRA 4EOSA 4Q5EA 2ITYA 2P55A 4F0FA 4MH7A 4EH6A 2PMIA 4JQ8A 2A19B 4YU2A 1XMMA 5AAGA 4X6QC 4L01A 4GG5A 4MXZA 4AGCA 3OOGA 3F82A 1BI7A 3P1AA 4XG4A 4FZDB 3OS3A 4OTWA 3DJ5A 5TO8A 3NW7A 3FHRA 4Y95A 4QDVA 2Z2WA 2W7XA 2PE2A 2VAGA 3ZYAA 4XMOA 3VRYA 4EWQA 5A14A 4AF3A 3JVRA 4GMYA 4AE9A 1SM2A 2Q83A 1PXPA 2O8YA 5E8VA 2G15A 2VUWA 4RIWA 4XUFA 3UP7A 5GZ9A 5CASA 1YHVA 2OXXA 3D7TA 3NYOA 3HRCA 3MH3A 3BV2A 4X2GA 2OO8X 2YDKA 4DH7A 4WD5A 4Y72A 2VWXA 5BQ0A 5IPJA 2AC3A 2PSQA 3GU4A 4AW5A 3PJ3A 4C38A 3U6HA 3ORKA 3ZSGA 4W4WA 5HNGA 4I4FA 3QCSA 2Q0BA 4TYIA 2F7XE 2UW7A 3TDVA 3MYGA 5D12A 5DMZA 2CNQA 5CU2A 2PVMA 5AP4A 5HE0A 4CCUA 3WBLA 1WBTA 4BDHA 3OROA 4M68A 4X6RA 3RAIA 4EHEA 2YIQA 4R77A 1HOWA 3H10A 3KRLA 3TMOA 3R71A 4QMUA 2VTOA 4NCTA 1XBAA 2WFYA 1Q8WA 3HUCA 2JAVA