3NWWA

P38 alpha kinase complexed with a 2-aminothiazol-5-yl-pyrimidine based inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
339
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Utilization of a nitrogen-sulfur nonbonding interaction in the design of new 2-aminothiazol-5-yl-pyrimidines as p38alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nwwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nwwA01
4QP2A 2XNEA 3OY1A 4HGSA 4CG8A 3PPKA 5BX0A 4HPTE 3UDBA 5IA4A 1R39A 1PKDA 4ZZMA 4FSTA 3AG9A 2ZMCA 4LM5A 5TF9A 1E9HA 4I0SA 4K8AA 5AUYA 1YDSE 5HOAA 3SV0A 3SG8A 2WU6A 3FMEA 3DDQA 3ODYX 4GIHA 1P5EA 3P7CA 3Q53A 2OJ9A 4IH8A 4L45A 4TYGA 1ZMUA 4DGOA 1R78A 2WMXA 3R0TA 4FKJA 5AEPA 4I6QA 4MYGA 2ETKA 5KBRA 4J8MA 2SRCA 4OBOA 5H8EA 2W1IA 4MBLA 4DCEA 3ANQA 3JY0A 5BUEA 3PXQA 4RA4A 2H9VA 3TG1A 2ITTA 4O0SA 4CKIA 4FV1A 5BMMA 3FSKA 3GGFA 3NNVA 1H07A 5CAQA 1TVOA 5DPVA 5AV1A 4E5AX 4EI4A 4CCUA 5JFXA 3VW6A 4CZTA 2XIYA 2JITA 4W4WA 3HECA 3Q9XA 3S3IA 5M09A 5K0KA 5CSXA 5HICA 5EW8A 4KRCA 3R1QA 4IAIA 3V5JA 3HP2A 5H9BA 2JIUA 2F9GA 5CSWA 5HO6A 3EFWA 2YJSA 1G8SA 5EH0A 1XBCA 4K0YA 3BYOA 3QKMA 4M12A 2R3FA 5H3QA 4RZWA 4QQJA 2W1DA 4ZZNA 3IKAA 4RFMA 5KUPA 3MB6A 4TN6A 4BL1A 3IOKA 2GPHA 4X3FA 5KZIA 2PPQA 5DH3A 3TJCA 3OXIA 4G9CA 3WE4A 4FEVA 1J1CA 3G6HA 3OT8A 3C4FA 3L8XA 5I5ZA 1TQMA 1F5QA 2ZVAA 2QO9A 3ORLA 4G34A 4KBAA 5LARA 4TWCA 4UWCA 4ANQA 4QRCA 3V8WA 1Q8WA 5A4LA 4AXAA 3NRMA 5DYJA 4IVDA 5B2KA 3PG1A 2FSMX 3OWJA 4J95A 1A06A 4TW9A 1MRYA 4ARKA 1WFCA 1XHAA 2BAQA 3QD3A 5E8SA 2YCFA 3DB6A 3EN7A 4Q9ZA 5LQFA 2ZAZA 3QGYA 4ZLOA 4L46A 3FLSA 1H1QA 4AN3A 5GIPE 4LV5A 2PMNX 5AM6A 3HA8A 4DG2E 3QD2B 3R9HA 3Q5ZA 3ZDUA 3QQHA 4NT4A 3BEGA 3KRLA 3DV3A 4XBUA 4KRDA 3GU6A 5CALA 3BWFA 2BHEA 4OTIA 2WQNA 4FL1A 3G15A 3ZO4A 4FGRA 2X81A 2JD5A 3KC3A 3RCDA 3II5A 2B9JA 3E8EA 2QOFA 3VIDA 3VS6A 5E4HA 1URWA 4G5JA 4IADA 5T3QA 1CSNA 4CVAA 1MP8A 3DFAA 2QKRA 1JSVA 2G1TA 4Q9SA 3COKA 4LRJA 3ZRLA 4AZVA 4UMPA 1A48A 3UIMA 4M67A 4GRBA 2WTVA 1KUTA 4JG6A 4LRMA 2OBJA 2QLQA 3R7OA 4AN2A 4CFFA 1SNXA 4F1TA 1YKRA 2OFVA 3FKNA 4G3CA 4M13A 3O2MA 3EOCA 2OH4A 4ZY5A 5ANGA 5GIOE 4J7BA 2C5VA 4IZ5A 4LUDA 3NNUA 2ACXA 3AT3A 3GU5A 5AP1A 4RQVA 5AP5A 4QMLA 1W7HA 4MEDA 1YHVA 3EFJA 4EOOA 2LAVA 5FXRA 1UWHA 3I6WA 1OECA 5CNOA 5AP4A 4FV5A 3RZBA 5CVGA 4MAOA 2UZTA 3FQSA 4K33A 5J5SA 5LXMA 4YJPA 5I4NA 2YIRA 3SW7A 2ZOQA 2HW7A 3KVWA 3W18A 3NUSA 4GYGA 3QC4A 2XKDA 5HNBA 4WG4A 1YDTE 4PL5A 2ITPA 2J0LA 5EI8A 5TOZA 4E6AA 1XKKA 1WZYA 4D9TA 4CLIA 3CS9A 2UW4A 3K54A 3SQQA 4MD9E 3MGYA 3R8PA 3V04A 4FKIA 2F49A 3PP1A 4UB7A 3NUXA 3KXNA 4DT8A 4K6ZA 2XNMA 3R63A 4NH1A 4EC9A 4XRLA 2NRUA 5FLFA 1ZOHA 3U6HA 4R7BA 2OG8A 3PXYA 4O38A 2R2PA 4D2PA 3HX4A 4FE2A 1KOBA 3OBGA 4HYUA 4KNBA 5M08A 4IANA 2OJJA 4JDHA 4J52A 4WKQA 2BROA 3IQ7A 3QRTA 5HBHA 1MUOA 2UZOA 2Y4IB 2WQBA 2WGJA 3EQGA 4XV9A 2ZV8A 5HTIA 5IEXA 4GUBA 4BWXA 4IIRA 4ACCA 1WBNA 3AD4A 3FPMA 5HU3A 4QTAA 4BCIA 3A4OX 4CZUA 2R9SA 3FY2A 1PXOA 4AU8A 4YLJA 1SYKA 3FQEA 3FEGA 4AOIA 3CGFA 2ZMDA 3OWKA 2ONLA 3DDPA 3R71A 4C8BA 5CANA 5GINE 2C69A 5I9UA 3OHTA 3WZUA 2CGUA 5AP6A 4DITA 3EB0A 1PKGA 4P5ZA 4WOVA 5HLPA 2YJRA 4L8MA 4O82A 3UP2A 4ANLA 5DOSA 1QPCA 4O2PA 2WTKC 5A4EA 4Q5HA 3G51A 3RCJA 2XIZA 4IJ9A 1OKYA 3G0EA 4Q2AA 3A8XA 3KKVA 3OUKA 4UXQA 3NUAA 2R0UA 4CKRA 3C7QA 4OUCA 5AX9A 4UEUA 3F5PA 3O8TA 3KREA 5B2LA 5F4NA 4RVLA 2XK4A 4IZYA 4Y85A 2ITQA 4XOYA 2WIHA 5GZAA 3UOJA 4CQGA 1XH6A 5CEKA 4IZ7A 2JFMA 4H58A 3ZUVA 3GFEA 4B99A 3DBCA 1KE7A 5A46A 2VTLA 4O7NA 3Q60A 2YAKA 4GW8A 4LOQA 3JVSA 4BVUA 4CTBA 1Q3WA 5KKRC 4BDFA 2WQEA 3R28A 5CQUA 2BCJA 5AUXA 3TZ7A 3FJQE 2QC6A 1IAHA 4BDKA 3VRZA 4K2RA 4YHTA 3TL8A 1REJA 3AQVA 5KHWA 1DM2A 4R77A 5EQYA 3AT4A 2YWPA 3O8UA 4BI2A 3LXNA 2J0JA 2CN5A 5IQHA 1UNGA 4I5PA 2W06A 4YBKA 4F1MA 4AZSA 4AT3A 3E88A 4G6OA 4WNOA 5K3YA 4UX9A 1KOAA 3MVHA 4EQCA 4BTKA 4J99A 3KRRA 4FUXA 4FZDB 3MY5A 4J53A 4HCTA 4WNPA 5KMJA 4O83A 5HE0A 4M69B 2HZ0A 4QNYA 4KWPA 4N57A 4DC2A 2WKMA 1OZ1A 2C0IA 2R3LA 1O6YA 4GL9A 4O27B 4GS6A 4DGLC 4OBPA 5HIBA 3L1SA 4KUJA 2QOHA 4Z9LA 1W82A 4PQNA 3VC4A 3BELA 4BDGA 4V0GB 4BWPA 4EL9A 5BVFA 4TYJA 1ZOGA 4R5SA 5E8UA 3QQLA 3FPQA 2XBAA 5D7AA 1YW2A 2HZNA 4DCAA 4R6VA 3ZYAA 2JDRA 3KFAA 5DBXA 2HZ4A 4XJ0A 4AAAA 4BFMA 1PHKA 1ZAOA 4JX7A 4XHKB 2V7OA 3F3ZA 5GJGA 4AGUA 4DH7A 4QT1A 1FBNA 4RRVA 3LLAA 4DF3A 4JRNA 2ITYA 5HHWA 3Q9ZA 4BGGA 4FVQA 5C26A 3BV2A 4XX9A 4AG8A 2UZWE 4YJSA 4CXAA 3RM7A 4HW7A 3SOAA 2OKRA 3HV6A 4O7WA 5C4LA 4KB8A 3LW0A 3ELJA 2C3JA 3RAWA 4RIWA 4XNEA 2BZJA 1XH8A 3V5WA 4EWHA 2PUIA 4A9RA 1Q5KA 1NVQA 3D2IA 4AW2A 4ACMA 3LKMA 2ITXA 4D2TA 3DAJA 4IVCA 4IWQA 2VZ6A 4O6EA 4FNZA 4E4NA 1OIYA 1V0PA 2XK7A 4QP8A 3UPZA 2R3HA 4I22A 4B7TA 2OH0E 3DB8A 3FZ1A 4EOPA 3MJ1A 4PF4A 2OF4A 4M7IA 4C4HA 3JY9A 4GJ2A 4CYJA 5FTGA 4OTHA 4CRSA 4CLJA 5H8GA 2QO7A 3MIYA 2BTRA 3S0OA 5BVKA 3COMA 4HVHA 4KS7A 3JS2A 2FSLX 2GNJA 3VNTA 4AA0A 4CKJA 4FEXA 2RGPA 2W1EA 2GNFA 5AV3A 3MN3A 3ORPA 4YJTA 3TZ9A 3Q9YA 3BBWA 4FT7A 5DT0A 3LQ3A 2R3PA 4MD7E 2UW9A 4BI0A 2ITWA 3NIEA 4NIFA 1YXUA 4JBVA 4B9DA 2WMSA 3WZKA 5BNJA 3QYWA 2OGVA 1ZXEA 4Z55A 3F3TA 4I0RA 4IX3A 4HVSA 4ID7A 3R01A 3EWHA 4L9IA 2C6DA 3O50A 3QCXA 3RWPA 4MF0A 4OT5A 4FK3A 2BTSA 3EIDA 2J90A 4LYNA 4OTFA 1JKLA 4I0TA 3U4UA 1I44A 3O17A 3SGCA 3UQGA 3ZM9A 2YDJA 3C50A 4I41A 4E4XA 3QC9A 4O21A 5E8XA 1P4OA 1OB3A 3QZHA 4NUSA 1S9IA 3F5XA 3OY3A 4JIAA 2FYSA 1PY5A 2C6EA 4DA5A 3E3PA 4RFYA 4B8LA 4C61A 2GDOA 1WBVA 3F66A 4DEEA 2GNLA 3UE4A 4U7ZA 4LL5A 2NPQA 2PZYA 5HI2A 3SC1A 5L8JA 5IQAA 4I21A 4FTQA 2YHVA 3ZSHA 1T46A 4GH2A 3OW4A 4PTGA 4FKVA 3RGFA 1Q41A 2HOGA 4F64A 3QRJA 4R1YA 3CGOA 2JIIA 4YNOA 4FVRA 1WAKA 1OMWA 4AW0A 3I1AA 3LJ0A 3W32A 1OUKA 1WBWA 3D9VA 1URCA 2YIQA 3EFLA 3KK8A 2IW6A 2PZPA 5FGKA 5AP0A 1W98A 2QOLA 2BALA 3DCVA 2PVJA 3NLBA 3M1SA 3KXZA 1FVVA 4I92A 4U8ZA 3TV4A 5EQPA 4FT5A 4ZK5A 3D5WA 5FBNC 3GOKA 3PJ8A 5G1XA 3T8OA 2UW0A 1OI9A 3PIZA 1BI8A 1GIHA 3UODA 4DT9A 2OI4X 1M14A 3QD0A 3WF5A 5HX6A 2R3GA 3RINA 4X2NA 1MQBA 3CLYA 3P79A 3QRKA 4D28A 3AC8A 3SD0A 3GBZA 4I5CA 2WMVA 5IEVA 3A2CA 2WMWA 5AM7A 4BDIA 4NJ3A 5E1SA 3I6UA 3HV7A 3C4ZA 2A2AA 3P0MA 5A54A 4M0ZA 5HZNA 3A60A 2UZUE 4FR4A 3W2OA 3UNKA 2PULA 5M55A 3V6RA 4XBRA 5HG5A 3NUPA 4BCFA 3OUNB 2QODA 3EQIA 2HZIA 3PSCA 4EKKA 1RQQA 5DG5A 1LPUA 3TEIA 2DQ7X 3KRXA 4C62A 4MTAA 4JQEA 2QKWB 4I24A 3P23A 5FEEA 2WNTA 3U87A 2YZLA 4XP2A 4R7HA 3ORTA 4FTMA 5JQ8A 4GEOA 3BKBA 2WOUA 4Y83A 3MIAA 3PZEA 2GQRA 2BZHB 3MFTA 3C0GA 2HWOA 1CKJA 3ERKA 4UXLA 3K5UA 5IA2A 2X8DA 2CMWA 1VYWA 2W17A 2XNGA 3FZPA 3MPTA 3NAXA 4FT9A 5JZNA 3CEKA 2PVFA 3HKOA 2YACA 4YNEA 3BI6A 2VTSA 2V62A 4J97A 4RZVA 2VWIA 4FIEA 2J4ZA 4IC7A 1RJBA 2JLDA 2XM9A 2W4KA 3EYHA 4CFUA 5C1QB 3GEQA 4KKGA 5LMKA 3HVCA 5AP7A 4TNDA 1HCKA 2B55A 1B39A 5EM5A 3RK5A 3ZO1A 3LXKA 4XG6A 2VTJA 3KK9A 4WHZA 3R8LA 2CNQA 2BDJA 5EDRA 1XJDA 4IQ6A 4G5PA 4WBOA 5DIAA 3KN5A 4PRJA 3LM0A 3Q96A 2OO8X 3PJ1A 3F7WA 3UPXA 3EQBA 1H0VA 5AR8A 5M51A 3I4BA 3LCDA 2OF2A 3BGZA 4J98A 4IEBA 3VAPA 4FEUA 4D0XA 2UW8A 4QPMA 3R8UA 2WO6A 2I40A 3A8WA 4Y72A 4F9BA 4G31A 1V0OA 4A9SA 3I0QA 2HELA 1QPEA 4FSQA 4QPAA 4X3FC 4FODA 4O0WA 1H26A 4C57A 1Y8GA 3KXMA 4GU9A 3QBNA 4APCA 4PPAA 4IWOA 3MI9A 3GFWA 4X7QA 4RT7A 2FH9A 3LQ5A 5FUTA 2GS2A 2OZAB 3FMJA 1TKIA 1KE8A 4A9YA 3FMDA 2G2IA 2CKQA 3FE3A 4NW5A 1W0XC 3FDNA 3Q6UA 1YOMA 3E87A 5AIKA 5HE1A 4DH5A 1CMKE 4EC8A 3FI8A 4IVBA 5CSPA 2VTOA 4UALA 3OW3A 4D2SA 1RDQE 3TNHA 4G3FA 5IU2A 3PLAE 3ZCLA 5D10A 4JL9A 5D7VA 4BCQA 1Q3DA 2J50A 1WBOA 4YP8A 2XM8A 4FSYA 3F2AA 2YM5A 2VX3A 3ZUTA 1TQIA 2Z2WA 3R1NA 3KVXA 3S2PA 3V8TA 1ZMVA 3IK3A 4PPBA 4QQTA 1YWVA 3AMBA 4HZSA 3FKOA 1DAYA 2AC3A 5KMLA 2OZOA 2P4IA 4ITIA 2Y7JA 3WF8A 2O2UA 2PTKA 5J8IA 4JI9A 5A9UA 5L3AA 4C36A 3UOHA 1PYEA 4G16A 3NW6A 5DVRA 5LMAA 3W10A 3NUUA 5HESA 4ALWA 4BHNA 3TUBA 3QYZA 4XG3A 3ZEWA 2O0UA 4BCKA 1OBGA 5IQEA 4C37A 4YUQA 1PMUA 2JEDA 3U54A 3QAME 4E8AA 4CFMA 3NNXA 3N4UA 4O7RA 4C4JA 4JS8A 2VRXA 3KCFA 5CSHA 3VVHA 3PY1A 4D4YA 5JRQA 2LGCA 4EK5A 3UIXA 2W4OA 3ALOA 2PMOX 4CQEA 4M14A 4MNEB 3V3VA 3H3CA 4QOXA 3C1XA 2WQMA 2VUWA 4NEUA 3CTQA 4RG0A 3F3UA 3UP7A 3HGKA 3VBXA 4AN9A 4C38A 2XS0A 1Q61A 1SVHA 4YPDA 2ETRA 4NM7A 4AE9A 4W8EA 5EDPA 3W33A 2VWXA 5IISA 4R78A 1OKZA 2YLEA 4FSWA 4LGHA 4FV8A 5FXSA 5CX9A 3R9NA 3V01A 3VF8A 2C5NA 4JOAA 2X9FA 2Z7QA 3KL8A 3L9LA 4IDTA 2GTMA 3T9TA 3G6GA 3SOCA 4A9UA 4YJRA 3CKXA 3PE2A 1QL6A 2XEYA 2XJ1A 4U80A 3RHXA 3C5IA 3OT3A 3E64A 3MVLA 4U44A 3FLQA 4FKOA 1ZRZA 2CPKE 5CU0A 3UTOA 4BCPA 3LFDA 1YXSA 2NO3A 1OL2A 3LFEA 4RFZA 5FDPA 2R3JA 3EQRA 4G1WA 3IECA 4ANBA 2HY81 3OD6X 4HVGA 2YM8A 5EG3A 4RC3A 3PRFA 4EOSA 1DAWA 2Y6MA 4FV7A 2A1AB 3SVVA 3EFKA 3QCSA 5HIDA 1LEZA 3VUDA 5EYCA 3MY1A 4GK2A 4S30A 2YISA 3F61A 3L8SA 3ANRA 3LM5A 4EK4A 2Q83A 2RKUA 1B6CB 3FI4A 3R7GA 1WBSA 2JKQA 5CI7A 5J5TA 5CF5A 4JNWA 4L6QA 3VUIA 3HDNA 3VBQA 2VU3A 2RG6A 4CV8A 4F4PA 5BVWA 1JBPE 4MNFA 5EHLA 3PSDA 3FHIA 3PP0A 3QKKA 4HYHA 1O9UA 2ONLC 5CWZA 3TNPC 4BC6A 4C35A 3I7CA 2WOTA 2AYPA 3PA5A 5M06A 4I93A 5AIRA 2NRYA 4TRLA 3DKOA 3ROYA 4AS0A 5JGBA 2YIXA 3FI2A 4IAKA 3RPVA 3RMFA 4QYYA 3TKUA 2WMTA 3OOMA 4RX5A 3MY0A 2VWYA 4LUEA 5DNRA 2P2IA 4C33A 3QZFA 4DFBA 2CLXA 3VHKA 4X2FA 5KMIA 3LCKA 1GIIA 4X21A 2G15A 3BU6A 4FKQA 3SXRA 4GK3A 3TNQB 4V04A 2R3MA 4M3QA 4M8TA 4GT5A 4UMQA 3LFCA 4UMUA 4CFXA 2ITVA 2BRNA 3PXKA 3BWJA 3FLNC 4M69A 3GOPA 2A4LA 1GIJA 1OM1A 3DFCB 2BMCA 2CGWA 5HG7A 2EUFB 3DLSA 4IWPA 4X2JA 3R00A 3PJ3A 3EJ1A 4U9AA 4IFCA 3UGCA 3N4VA 2C1AA 4E6DA 5AFVA 2CGXA 5M4FA 2FGIA 1KV1A 2OK1A 4FTLA 3VW8A 4NFNA 5JGAA 4C2VA 2OWBA 4V0GA 5EQEA 3IG7A 2RG5A 4DG0E 4OW8A 3PA4A 3ZBFA 4BGHA 3I0OA 2WQOA 4IB0A 2C5OA 1QPDA 4FKPA 4JLCA 4X0MA 5CQWA 3VS0A 4KSPA 2EU9A 2UZNA 3ROCA 2UW3A 2WIPA 3DS6A 3FSFA 4U40A 3ZDIA 5TKDA 1VJYA 2CN8A 2VWZA 5JQ5A 4BYJA 4MQ1A 1NVRA 3ORIA 5LWMA 3M11A 4O0XA 3A7HA 4N70A 4X2GA 2WEIA 4EHZA 4MX9A 4EZ5A 5B2MA 5ETFA 5FP6A 4K1BA 1YI4A 3QX2A 3PPZA 3ULIA 2YITA 3HV3A 4DEHA 5M53A 3ZS5A 4HZRA 5ETCA 3H9RA 4ANNA 4JT3A 2J0IA 3L8PA 4KABA 4RGJA 3SLSA 4ASXA 3LPBA 1JSTA 2QOKA 4RJ4A 4N6YA 5EYDA 5DE2A 3C0HA 3DTWA 3P9JA 2CKOA 3RBWA 3W55A 3QQKA 3BQRA 2WTKB 4DH8A 4EK6A 2WELA 1BLXA 1M17A 4A4XA 3PVBA 3ZU7A 3JXWA 5BPYA 2OSCA 4WT6A 1YRPA 5BVDA 4BGQA 1IASA 3SXSA 4L53A 4NW6A 5BQ0A 3UIUA 3AGLA 2PZ5A 5ETIA 3G90X 1M52A 3DXQA 3P7BA 3H9FA 3UVQA 5CENA 1BL6A 1Z9XA 4BDBA 4CMUA 3QQGA 5A14A 5GZ8A 1UVRA 1ZY4A 2C3LA 5LMBA 3CJGA 5AA8A 1PXLA 3LLTA 3GCVA 1JVPP 4MWIA 4OTGA 5CEPA 2VTMA 2OJFE 3ET7A 4NCTA 3TTJA 4NKAA 4D9UA 2V7AA 2C30A 4JJRA 3S1HA 2VX0A 1T45A 2X6DA 4JVGA 2ESMA 2JKMA 2HXQA 1XH5A 2W99B 5DEYA 4BIEA 5KKRB 3WYXA 4RJ6A 4ZJVA 3E5AA 2CNUA 1PMEA 3RK7A 5BYYA 5M57A 4NTTA 4YLKA 5AV0A 2VD5A 3NEWA 4USDA 4X6RA 3KXGA 5A4QA 3RAIA 4WO5A 3QTXA 4FL2A 4AZEA 2XK3A 4JQ8A 2BRMA 1OVEA 3ENHA 4FG8A 5E90A 3Q2JA 2QR8A 5EM6A 2A19B 3KA0A 4I6BA 4QP4A 3IDBA 4I94A 4EH7A 3MPMA 2VNWA 3CXWA 3MWUA 3PFQA 4W9WA 4UZHA 4BN1A 2PZRA 3BU3A 4C58A 2C5XA 4XYFA 4FTNA 3UC4A 5E8ZA 3S95A 3RNYA 1S9JA 4XG2A 3FZOA 3U9CA 5CEOA 4E6QA 4A07A 4CD0A 2GFSA 3C4CA 3F3WA 3QTUA 4FNWA 4M0YA 4AZFA 1IRKA 3GQLA 3G9NA 1MQ4A 3PWDA 4GUEA 4NSTA 1XH7A 5AV2A 4QMNA 4EONA 3OTVA 4KIQA 2C5YA 3BHTA 3N4TA 5AUVA 4FG9A 2R3QA 4AFEA 4BZOA 4WNMA 1YVJA 4AGDA 5J7HA 4PY1A 3GXLA 2R7BA 4PTCA 4AW5A 2GFCA 3MVJA 3FY0A 5ANDA 2X1NA 4FVPA 2WB8A 5G6VA 5H2UA 2B52A 3CD3A 4U6RA 4V01A 2C6OA 4RPVA 3GCUA 3VS5A 3KXXA 4MKCA 1U46A 4EORA 5IKWA 2X2KA 4BBFA 1F0QA 4BTFA 5F9EA 3E3BX 4ZMEA 3DTCA 4FV4A 4ZSEA 4GYIA 4EKLA 3U4WA 5E91A 4RIXB 1YWRA 3LVPA 3DBQA 5J79A 4DBXA 3C5UA 3BLHA 4H36A 3D5VA 4N6ZA 4M97A 4K9YA 4WD5A 2OU7A 4EH5A 4GFOA 4PP7A 4ZSGA 2VWUA 5JMSA 3EKNA 2EB2A 2UVZA 3CD8A 4IAYA 5I9XA 1KE5A 2C3KA 2FB8A 4MWHA 5FTOA 2XKCA 4DH3A 2CLQA 5AUTA 2FO0A 1QPJA 4O96A 1O6LA 3PIYA 3DLZA 3K3JA 1PXNA 5K4JA 4QD6A 4RLKA 3TKIA 2WHBA 3SG9A 5CYIA 3FV8A 3MW1A 3QZGA 4L3LA 3JYAA 4JBQA 4O91A 1WBPA 1U5RA 3UC3A 3NGAA 4FTJA 2C4GA 4G2FA 4H3BA 4N0SA 4YJOA 1GNGA 3P4KA 3R7UA 2BR1A 4UN0C 2QG7A 1JWHA 1PXJA 1KE6A 2CCHA 3F5GA 4U3ZA 2A27A 4IX5A 2JDTA 3LZBA 5HE2A 4FK6A 5EM8A 2YAAA 2O65A 4DN5A 3TUDA 4IX6A 3F5UA 2JDVA 4QTEA 4FI1A 3PJ2A 5BMSA 4FG7A 4RX7A 4EJNA 4D4VA 3KMWA 2R3KA 3Q4UA 3ZO3A 1YQJA 2C6KA 4EYJA 2OXXA 4FNXA 5HX8A 3OXZA 4TZRA 5HD7A 1FVTA 3AMYA 4QMVA 4JRVA 4PDSA 2XIRA 4Y5HA 3ORKA 3RAHA 4AA5A 5CAUA 2R0IA 2ITOA 4MF1A 5F1ZA 5TR6A 4CGAA 1M2PA 2W96B 2VTPA 4G3GA 2HAKA 3O23A 4ZJIA 3NUNA 3EYGA 1Y6BA 2W1GA 3V5PA 3FLYA 2YM6A 3VJNA 1X8BA 3HMMA 4YTHA 1Y91A 2OIQA 2IN6A 4QP7A 4Y5QA 3VUMA 4BTMA 3JR1A 3FKLA 4UWYA 3ZSIA 4D5KA 4S33A 5LMKC 2B53A 1KV2A 2XK9A 5D41A 4AOJA 4HNIA 1PMNA 2BAKA 3MVMA 5E8YA 3AGMA 4TTHB 5JKGA 1H4LA 3KQ7A 4RWJA 3C13A 1PF8A 2O64A 3DJ5A 4FT3A 4LL0A 4F0IA 5IH4A 3MS9A 4DGGA 4YO4A 2ZDTA 5AJQA 3E8DA 3W2QA 2OZAA 2YDIA 3DZQA 1IA9A 1H1SA 3MA3A 4FKGA 2YEXA 3R21A 3FAAA 5GNKA 5A4CA 1UU9A 3BPRA 4HYSA 4L01A 2ERZE 3PRIA 3TTIA 2Z8CA 3HMNA 2ZDUA 3OWLA 3QWJA 4MHAA 4QP6A 4YURA 1YHSA 4PNIA 3Q4ZA 2ZM3A 2H34A 4L00A 4FIJA 5K9IA 3RALA 4E4LA 1AGWA 2QOOA 3GCPA 1DI9A 4U79A 3OG7A 5F95A 4A7CA 5HG9A 3PPJA 4ACDA 4EK3A 4WIHA 2J5EA 4BI1A 4CYIA 2RF9A 4XS2A 2E2BA 5K0XA 3E63A 4YJNA 1DI8A 1JKTA 2F57A 5A6NA 1UA2A 5E92A 3U9NA 3FLZA 4DE4A 2DUVA 5EHOA 2PL0A 3ZO2A 4Z7HA 3IO7A 1PXKA 2O3PA 1P4FA 3B2TA 2ZV9A 3BYSA 4KINA 1ZOEA 4NM3A 1UKIA 3UYTA 3HNGA 3KULB 2C6MA 4YTFA 4FEWA 3ATTA 2YCRA 1Y57A 3LXLA 4ACHA 4EUTA 4RVTA 3PE1A 4EWQA 1K9AA 4HYIA 5DT3A 5EI2A 1G5SA 4ENYA 4QYEA 4EBWA 4PDOA 3OEFX 2WEVA 4TYIA 5M07A 3DKGA 4XMOA 2HY0A 1HCLA 4I23A 4ONAA 5IQDA 4UYNA 4C4IA 4DFLA 3DGKA 5EYKA 5L8KA 4D5HA 5IMXA 1AD5A 4HCVA 4MNEA 4O1PA 4XUFA 4AT5A 4J96A 3KMUA 4AUAA 2QU6A 5CXZA 3WARA 3EN5A 5JZJA 5EW3A 4XV1A 3Q5IA 4CMTA 3W16A 3GI3A 2CJMA 3ZM4A 2J51A 1M7NA 2BPMA 2GS6A 2V22A 4FV3A 4F9CA 2Y0AA 1H1WA 5D1JA 3UO4A 5CEQA 3VWAA 1Q8ZA 4E5WA 5IA5A 3A62A 3A99A 3LQ8A 4FSNA 4AOTA 4GMYA 3NYNA 2J0MB 3RKBA 2Z7RA 2JKOA 4GU6A 2BIYA 5LVPA 4QO9A 3BIZA 4YZDA 3GC9A 5AR7A 3O8PA 3KCKA 3V5LA 4L3PA 4RBLA 4FTTA 4YZ9A 5ANJA 5EDQA 3F69A 5FRIA 2XH5A 3IW6A 4QMTA 4W4XA 2B54A 4EK8A 3BQCA 4QTDA 5ICPA 3LMHA 4MD8E 4D0WA 4C4EA 4S2ZA 4D1ZA 2XK8A 3ZC5A 4BY9E 5I9VA 5DR2A 3DU8A 1BYGA 3M42A 4DTAA 5AAEA 3C51A 3R7IA 5D9HA 2RFDA 3FC2A 3ZLXA 3RI1A 2CHLA 5BYLA 3ZRKA 4YGAA 3EQFA 3NW5A 2W1HA 2F2CB 3TZMA 5I9WA 3QUPA 2YFXA 1GOLA 3MFRA 4CZYB 4EHGA 1BL7A 4GFGA 3GU7A 3ZC6A 3NVMB 2X2LA 4FYNA 3F2RA 5HGIA 1XBBA 3CQEA 3ORZA 1H28A 5DI1A 2KTYA 4MBJA 4AFJA 4FTIA 3MH0A 5JEBA 3E93A 3PXFA 5FQDC 2GQSA 2CDZA 2GNGA 2X0GA 5FG8A 4ASEA 4EH6A 2XIKA 3Q32A 4P5QA 4UMTA 3WIKA 4FIFA 2PE1A 1NVSA 1TQPA 3UG2A 3DAKA 4DLJA 4EH8A 4FTKA 1APME 3I5ZA 4ZTSA 3HV5A 5FP5A 3FBVA 4DEIA 4F9YA 5AA9A 1OKVA 1QMZA 1ZYCA 4O0VA 4RVKA 4CV9A 5EOBA 1XR1A 4CEGA 5J1VA 5LVLA 4FZ7A 3LAUA 2JC6A 3VHEA 4HVIA 2PMIA 2V0DA 2QQ7A 3SRVB 3PDTA 2XYNA 3K2LA 4R7IA 3VN9A 3ZFXA 1ND4A 4L43A 2B7AA 3MSSA 3E92A 4U0IA 3DNEA 5BYZA 3WZJA 4RIOA 5IH6A 3DK6A 2Y6OA 4ZEGA 3E8CA 3QTQA 4FA2A 3UMXA 3EN6A 3AC3A 4I5HA 2OW3A 1IG1A 2JDOA 3WOWA 4H1MA 3WZEA 4EZ3A 1FQ1B 4W9XA 3G9LX 4QMWA 2PY3A 4D58A 4J1RA 5J7BA 4C7TA 5CU2A 1JQHA 3ZSGA 2C0TA 4IB3A 4C59A 1E1XA 4HOKA 3ZLWA 1Q62A 2W1FA 5IDNA 3COIA 2WMRA 3D15A 2PE2A 4HGEA 2R3OA 4I1ZA 4M68A 4ZP5A 4QMOA 1H0WA 4O0RA 4IAFA 4PL4A 4UMRA 3IW8A 4FT0A 1GAGA 3A7IA 4QPSA 3SA0A 2E9VA 3IONA 4MBIA 4F7LA 2QVSE 3PXRA 4F09A 4D1SA 2HIWA 3VBYA 3PWYA 5GZ9A 3NCGA 3EL8A 5FDXA 2VTNA 5FTQA 2IVVA 3WYYA 4KBKA 4AX8A 4CFVA 2YERA 4ZTLA 4KS8A 3R9RA 1GZ8A 2F4JA 3I60A 3DBDA 3ZZEA 3LXPA 4FSMA 4L42A 1PXMA 4BDHA 3KY2A 5J95A 3F6XA 3QX4A 3NUYA 4F6UA 1Q8YA 2Z7LA 1GZKA 4DHFA 2UVXA 1CTPE 4OR5A 2ZYBA 3T9IA 4XV3A 1HOWA 4A06A 3RPSA 4K11A 3KRWA 4FNYA 5CZHA 4AZWA 4AZTA 5AUZA 3FZSA 2CNVA 2XIXA 3LOKA 1UWJA 4KA3A 2AC5A 3OCTA 2WFYA 3FYKX 4QMYA 4FYOA 4FICA 4YTIA 5M4CA 5EKNA 4IVAA 3JPVA 3QWKA 4IBMA 3WBLA 2PZIA 3UG1A 4U5JA 3TNIA 2XNBA 4UY9A 1ZMWA 4FC0A 4LG4A 4G9RA 4PL3A 3D2KA 3HYHA 2P2HA 1U4DA 4S34A 3W2PA 4EOIA 3HAVA 2VGOA 4RJ3A 4YC3A 3AXWA 4U81A 4FUYA 3G2FA 4PPCA 3ZZWA 1OKWA 3Q3BA 2W4JA 2IJMA 3WILA 3BLQA 4FV0A 4IHPA 4ANSA 4GT3A 3QTZA 1PMVA 4AE6A 3RPOA 4MVFA 3C4WA 3OVVA 3VUGA 1J1BA 3IDPA 5M4UA 5KZ0A 4KD1A 2F2UA 3HLLA 4YMJA 4D2RA 4O2ZA 4KSQA 4FKUA 4YTCA 3JUHA 2VWVA 4QMQA 3H0ZA 2PU8A 1J91A 3R22A 5KO1A 2W9ZB 3U51A 3W8QA 4EOKA 2BAJA 4AP7A 3GVUA 2DWBA 4ASZA 4CFNA 3V6SA 4ZZOA 2VTAA 4NCTC 3WF9A 5AV4A 3CBLA 3OMVA 2XP2A 4OLIA 1FMKA 5L6OA 4H39A 5IEYA 3GNIB 4GVAA 4I5MA 4RLLA 4KAOA 4U42A 3R8MA 3V5TA 3ZXZA 5DLSA 4EH9A 5IQFA 1OL1A 3FQHA 3LIJA 1ZYDA 4O0UA 1PYXA 4I4EA 4O6LA 4QTCA 5J9LA 1XO2B 2FVDA 5IA3A 2B0QA 3QLFA 4F7SA 5C8MA 3T3UA 5AUUA 2ZB0A 2W5AA 2O5KA 3CY3A 2P33A 2RFEA 3LCOA 4W8DA 3LFQA 4I20A 5M4IA 3IGOA 3VS7A 4PMMA 4NYEA 2X6EA 1UNHA 3EL7A 2GMXA 4WRSA 2C1BA 3P08A 5E8VA 5KMMA 4R1VA 1KWPA 1OL5A 2ZV2A 3WF7A 3NYXA 4FSUA 3KF7A 3TIYA 4FOBA 1RE8A 2B9FA 4RIXA 4F9WA 4Y46A 4ZJJA 4RC4A 2BRGA 3HRCA 4IMYA 4ZLZA 2OIBA 4TY1A 5E8WA 5HTBA 2R3RA 4APPA 2QCSA 1U54B 3B2WA 3ATSA 5BVNA 2WMQA 1W8CA 4LGGA 3TACA 5C9CA 3UQFA 4P4CA 2UZLA 3UNJA 3QRIA 1U59A 4N4SA 3LCTA 4G17A 3ZH8A 3CKWA 4PDPA 2HYYA 5IDPA 5CF6A 4J71A 1A9UA 2BDWA 2VO0A 4DGMA 1JLUE 3TIZA 2W05A 4PUZA 1CM8A 3T3VA 1YXXA 2X8EA 4JR3A 3Q4TA 3O7LD 3BGQA 4ITHA 4ANMA 3VO3A 2BVAA 4IDVA 3CCNA 4ZS4A 1WVYA 4BDCA 4F99A 4BIBA 4YU2A 1LUFA 3NVKI 3EMGA 2F7ZE 4F08A 3RPRA 4M84A 3R1SA 2ITNA 5EKOA 5CEIA 2J6MA 3NNWA 4C4FA 3CSVA 2PVNA 2XB7A 2X9EA 1FMOE 2XCHA 3LE6A 1DS5A 3LCSA 3PVUA 2QR7A 2B9HA 2PVRA 5GHVA 5FBOA 1WMKA 2ITZA 5CEMA 4A4LA 2R4BA 3DKCA 1Y8YA 2QONA 1W83A 4FEQA 3R8VA 2VO7A 3OCBA 4TWNA 5HBJA 5KHXA 2FA2A 3FXWA 2GSFA 2QOQA 2Z7SA 4PWNA 5DRDA 1Q4LA 5JT2A 4O7YA 3R9OA 3ITZA 4AA4A 4BYIA 3HUCA 4NM5A 4TT7A 5AR2A 4EHEA 2GHLA 2XJ2A 4UYAA 1FINA 3UVPA 4RMZA 3ZFYA 4DG3E 4E26A 4L44A 5IUGA 5IQBA 3KU2A 4U3YA 3DQWA 4YSJA 1H08A 3U55A 4YJQA 3P78A 2XYUA 4G6NA 5K5XA 3QCYA 2OXDA 4ZY4A 4BTJA 4M66A 2IZSA 3QRUA 3NAYA 4BCOA 3ZBXA 2X8IA 1YHWA 4FGBA 5HBEA 4FIIA 5F94A 2ZJWA 3KMMA 4ZXTA 3HMPA 3TM0A 2C6LA 5FWKK 5E9EA 4AT4A 5C4KA 3MESA 3R04A 2EVAA 2YCSA 2BUJA 1H8FA 2X7GA 4O7LA 5HTCA 2BFYA 4F7JA 2GCDA 2NNWB 3GCQA 1IEPA 1XQZA 3BGPA 2BIKB 3CPBA 2C6IA 4WSYA 3PSBA 2ZB1A 2VAGA 3O51A 2C0OA 5CVHA 4NFMA 3MA6A 2IPXA 5HKMA 5KBQA 3Q2MA 3NR9A 4H05A 2EXCX 1XH4A 3ZLYA 3VS1A 1KSWA 2E9PA 5DMZA 4RSSA 2HCKA 3OROA 5IZFA 5LOHA 4D2WA 4C0TA 2EB3A 2GHGA 3O0GA 4NU1A 4BCMA 1O6KA 3I5NA 3PY3A 4FKWA 4PMTA 4FV2A 2WMUA 4EQMA 3GP0A 5HVKA 3NX8A 4E6CA 3AD6A 3QUEA 2YM3A 2H6DA 4B4LA 4IJPA 2WTCA 1VZOA 2J5FA 4Z7GA 5ANOA 2CKEA 3O7LB 4R3PA 3KULA 4FMQA 3LFFA 4BCGA 3OCGA 2XMYA 4U41A 3WI6A 4AGCA 1VYZA 3PXZA 4RJ7A 5IA1A 4DLIA 4HJOA 3FC1X 3DNDA 3R30A 1YXTA 3DZOA 3F88A 4CMOA 5IMEA 4CG9A 5E8TA 5E1EA 2IZRA 2BKZA 5IPJA 5K5NA 3MH2A 5HCXA 3AT2A 2YN8A 3D4QA 4QP1A 4ZY6A 5HEZA 4O0YA 3QQFA 2JAMA 5L2WA 5HU9A 1P14A 2I0EA 4USFA 4TXCA 2XNNA 2IWIA 3CTHA 4EUUA 5LCJA 3FLWA 3QHWA 2UVYA 2EXMA 4EQUA 1B38A 4BICA 3MTFA 4MXAA 3EHAA 3QTSA 4GK4A 1W84A 5AP3A 3RK9A 3VS2A 2R3IA 4IAZA 1UKHA 1WBTA 2QLUA 4XG8A 1YWNA 3CR0A 3RJCA 2HXLA 2QOBA 4XV2A 3DY7A 4X3JA 2IVSA 4NZWB 1BMKA 1G3NA 2IZTA 3IDCA 1XBAA 3IOPA 4XOZA 4Y73A 2I1MA 4F70A 4O0TA 5JRSA 3DBFA 3FMKA 2R7IA 1VR2A 3QKLA 1H1RA 2DS1A 4MXOA 3RTPA 3H4JA 1UU8A 5EFQA 4BR3A 2JBPA 2G2FA 4E1ZA 4FKSA 4UV0A 4PMPA 4M15A 3U6JA 2W1ZA 4TYHB 3ZEPA 4ZSJA 2R5TA 5AR4A 4IAAA 5DR9A 4OGRA 3ACJA 4EH4A 2CSNA 5DN3A 4E5BA 4ZAUA 4V05A 2ITUA 3CC6A 3Q9WA 3UJGA 1U5QA 2I6LA 3QTWA 3MV5A 1Q99A 3GU8A 5JH6A 3VBVA 3EN9A 3QL8A 2VO6A 1Q97A 4BDEA 4NL0A 4B8MA 4DTBA 3R2BA 5L6WL 1IA8A 1FOTA 2E9NA 3DAEA 4W4VA 5DR6A 1Q8UA 4DEBA 4EHVA 3G0FA 5HLWA 3D5XA 5I3OA 3DXPA 2FSOX 3POOA 2GQGA 4KKEA 3W2SA 2UW5A 2VTQA 4EBVA 4UZDA 5C27A 2WTIA 3GCSA 3HZTA 5L2IA 4RIYB 5C01A 3H0YA 2VTIA 4UWBA 5IQCA 2PE0A 3IW5A 2YIWA 4CSVA 1R3CA 1REKA 3Q52A 4QP3A 4ORKA 4OT6A 3VJOA 4GV1A 3ORNA 4FL3A 4PTEA 5H8BA 4EEVA 3F3VA 5LVOA 5AAFA 3PVWA 4BCHA 2C6TA 1K3AA 2YABA 5CAOA 2I0YA 4D2VA 4I6FA 1E1VA 1PXIA 3MFUA 4HNFA 2WZJA 3V8SA 3FXZA 5BUIA 2CCIA 3SRVA 3G5DA 4C3PA 1G8AA 3A7JA 3KGAA 3BBTB 1H27A 4JDJA 4R3RA 3RPYA 2Z02A 4C02A 3TT0A 2PVHA 2WPAA 4PP9A 3D7TB 4PMSA 4IW0A 4YPSA 3S00A 1MRVA 4NTSA 4A9TA 3FYJX 4ZTNA 2C3IB 5KX8A 4WUAA 3VUKA 3TV7A 2WD1A 5DGZA 5FEQA 3SDJA 4BBMA 3WZDA 3R2YA 4TL0A 4E73A 4JXFA 4RJ5A 2GTNA 5HO8A 3U8WA 4ERKA 3EKKA 4OBQA 5FM2A 4RQKA 5CTPA 4ZSLA 5IUIA 3R7YA 3SKCA 2PVYA 3TDVA 2J0KA 1M7QA 3A4PA 3LJ2A 3A61A 4F6SA 4E7WA 2OJIA 3N51A 4QYFA 5CASA 4IC8A 3B8QA 5A4TA 5HCZA 4DEDA 4CCBA 4F0GA 5L6PA 3CQWA 4IM2A 4EOLA 3FI3A 3FMMA 1I09A 3H30A 3HP5A 4MH7A 4G3DA 2X4FA 4H1JA 3QQUA 2XUUA 3R9DA 5LWNA 5J9ZA 3MPAA 2X4ZA 4J8NA 3VQUA 1SM2A 2BDFA 4LI5A 3UIBA 3GU4A 3UVRA 3HA6A 3R73A 1OPLA 3B8RA 5HLNA 4WG5A 3OF0A 2RSVA 3MYGA 1YI6A 3JVRA 4NKSA 3SW4A 5CXHA 2BKKA 2Y8OA 3LFAA 4U43A 3VRYA 3R7VA 2VWWA 3RHKA 3AC4A 3NYVA 1GZOA 3I81A 3OS3A 2HW6A 4GCJA 3OFMA 3RWQA 2GS7A 5CF8A 3CTJA 1Q24A 3GUBA 4E93A 1LEWA 4FIHA 4BDDA 3REPA 3G33A 3LFNA 3BEAA 1VEBA 3UOKA 3VBWA 5LVNA 2UW7A 3DOGA 4ASDA 4S32A 3N9XA 3ZMMA 4BKYA 4DINA 1FVRA 2YIYA 4D55A 3CP9A 2C47A 3QD4A 2QHMA 4FTCA 3DJ7A 3F2NA 3P1AA 1GJOA 3AOXA 4XEYA 2UV2A 4CRLA 2HK5A 4FOCA 4WA9A 4FTUA 5IG1A 1V1KA 1L8TA 4CFWA 5JFVA 1NT2A 1JKSA 1LR4A 1AQ1A 4QP9A 4KIKB 3VF9A 4GFMA 1H25A 1XH9A 4EOJA 2GNHA 4F6WA 1PRYA 2VWBA 5CAPA 4XP0A 3ZHPC 1Z5MA 5L2QA 4ZTMA 5J9YA 4HVDA 4H3QA 3ACKA 4YZCA 5T6KA 4KIPA 2RL5A 2F7XE 1SVGA 4QQ5A 1V0BA 5L4QA 4GVJA 3C4EA 1PXPA 4C34A 3BYVA 4H3PA 4TKSA 2PUNA 2KULA 3PLSA 2XF0A 3PVGA 5FD2A 2IG7A 4GKIA 3W2RA 3W1FA 1NA7A 4LMNA 4ENXA 3HAMA 2W9FB 3OCSA 4EZ7A 4IX4A 4YZBA 4E20A 3BYMA 2UZVA 4JBOA 4JX3A 3TCPA 2ZM4A 4DEAA 3QTRA 2BILB 4G3EA 3DPKA 5ITAA 2I7QA 1JNKA 4FKRA 3COHA 3QU0A 3C0IA 5AUWA 2G2HA 1ZY5A 3QA0A 4Q5EA 4ZIMA 3DK7A 3WF6A 3FMNA 4MCVA 3IS5A 3BRBA 3MJ2A 4X6QC 2XBJA 3OWPA 3HUBA 3K5VA 1OPJA 4ZS0A 4JBPA 4P90A 4BZDA 2W5BA 3P7AA 1SVEA 4ZOGA 1ERKA 1JSUA 3M2WA 3D83A 5DA3A 4FTRA 2VTRA 1J7IA 3PYYA 3DA6A 1P2AA 4BWKA 3BU5A 4FSRA 3R83A 3EQCA 2PVLA 4CTCA 5KMOA 4RA5A 2OLCA 2RFNA 4FTAA 5LCKA 3POZA 5GJDA 4HCUA 3FL4A 3V51A 1OBDA 2W7XA 4NM0A 3R8ZA 3I79A 1JAMA 4IM0A 4XLVA 1ZWSA 5DHJA 2V55A 1OGUA 1KE9A 3AMAA 3E7VA 3PUPA 4QTBA 3MTLA 4WUNA 4ANOA 5EOLA 4O7ZA 4JQ7A 2E9OA 2X2MA 2X39A 1Q8TA 2RIOA 1U54A 4RWLA 3TKHA 2YM4A 4XRJA 4Z16A 1STCE 2PUPA 3MBLA 3GC7A 2O63A 4RJ8A 4LFIA 4DFNA 3NPCA 4EH3A 4CT1A 3QA8A 3R6XA 5DFPA 3AC1A 5I0BA 2JKKA 4QNAA 3KRJA 4O22A 2OFUA 1OIUA 3UOLA 3DK3A 3ZLSA 2FSTX 4RX9A 1WVWA 3F9NA 5CI6A 5D11A 3VUTA 4FSZA 3H9OA 4DFXE 5JFSA 2XRUA 3DQXA 2WU7A 1NXKA 3NSZA 3IW4A 3OBJA 3GC8A 2HWPA 3FHRA 2ZM1A 5HVYA 5AADA 4WSQA 4O86A 3QTIA 5EHYA 3BHUA 3PG3A 4QYGA 4OAVB 3A7FA 1YOJA 4QMZA 5AP2A 3PTGA 3EN4A 3HDMA 3TI1A 1K2PA 2WTWA 3ORMA 3TDWA 3HEGA 3CE3A 2CKPA 2QI8A 2OXYA 1FPUA 3KN6A 3ZTXA 2XNPA 3C9WA 4JDKA 1BKXA 2EXEA 3GC0A 4XH6A 4YHJA 3DT1A 2IW9A 3UNZA 4X3FB 4LRKA 5AWMA 3O71A 5BVEA 4LOOA 1SMHA 3IPHA 2UZEA 2JBOA 3ENMA 4FKLA 4F63A 2NP8A 5K4IA 4ZMFA 3TN8A 4LOPA 4GG7A 2PMLX 2Y4IC 5M56A 4E4MA 3FZRA 1OIQA 3OEZA 3HMOA 5LVMA 3IW7A 5EYMA 4IFGA 4MK0A 4OTPA 2J9MA 4FV9A 3FMHA 4WRGA 4YBJA 5CNNA 5CSVA 3UZPA 4B0GA 3QHRA 1WCCA 3QXOA 3UO5A 3HL7A 3LJ1A 3NW7A 4FZFB 4A4OA 3F7ZA 2REIA 2OIDA 2V5QA 1R1WA 5ANIA 4EH2A 3E8NA 4YSMA 1OUYA 3H10A 5DEWA 3Q04A 4XG4A 2XKEA 3RM6A 3E7OA 5I3RA 5DWRA 5KNJA 3A7GA 4XLIA 4RX8A 3QF9A 4EYMA 2ETMA 3HMIA 4DFUA 1J3HA 4NK9A 2VV9A 5CU3A 4W4YA 5FM3A 2PVMA 2VN9A 4ALVA 5ANKA 4B6LA 2RFSA 4L52A 1ZLTA 1RW8A 5L2TA 2IZUA 3NIZA 2YA9A 4FZ6A 2PYWA 4YO6A 4BBEA 5C8NA 3PIXA 4II5A 4YC8A 2JGZA 1GZNA 4O7TA 5TE0A 2QURA 3IGGA 2FUMA 2IVTA 1BI7A 2Q0BA 4XG7A 5J87A 3D5UA 3MFSA 2GHMA 3AD5A 5B0XA 3TV6A 4AGWA 1H00A 4RWIA 2BFXA 2P3GX 3CQUA 4IM3A 4TWOA 5BUJA 3MH3A 4WG3A 1ZYLA 4F9AA 5HNIX 5IUHA 3OTUA 1PJKA 4AW1A 4O84A 1XWSA 3BV3A 3ZOSA 2H8HA 4EOQA 4G6LA 2YDKA 5L8LA 3SXFA 3OP5A 2QD9A 3QALE 4CT2A 5AX3A 3RZFA 4D1XA 4BDAA 4QMSA 3BZ3A 4PDYA 5A3XA 4FKTA 4BHZA 1IAJA 2Z60A 4I4FA 2UW6A 3VS4A 5TT7A 5KMNA 3BE9A 2H96A 2P0CA 2P55A 3OXTA 4IB5A 5J1WA 3FZTA 1OL7A 4O7VA 4JDIA 1J7UA 1H1PA 1OIRA 5ACKA 5LJJA 3EH9A 1YOLA 3BHHA 4JG8A 5HG8A 4JG7A 1Z57A 3K3IA 4DH1A 4DTKA 3VQHA 2O8YA 3LHJA 3OC1A 2QOIA 2VTHA 2W5HA 3I7BA 4D4RA 2QO2A 2BRHA 4Z3VA 2XJ0A 3CJFA 4RC2A 4YC6A 4YJUA 5AAGA 4QQCA 3FL5A 5CS6A 2W1CA 2BRBA 3ZRMA 2VO3A 4BKJA 4F65A 4GT4A 5CAVA 1OPKA 4AACA 5IF1A 3ORXA 4O1OA 3D14A 1PW2A 4BF2A 2I0HA 3E62A 5JN2A 3FXXA 5C8KA 2UZDA 1CDKA 2JIVA 4WNKA 4QMUA 4QMPA 2DYLA 5IQGA 2XRWA 3HRFA 4TYEA 5JFWA 3L9PA 3OOGA 5HORA 5CVFA 1FGKA 4EOMA 3KEXA 3ID6C 1GY3A 1IR3A 3THBA 5JGDA 3D7ZA 3HV4A 4GIIA 4F7NA 2VX1A 3VS3A 4OTDA 5D12A 2AUHA 1YXVA 3UQCA 4BIDA 4IB1A 3RAKA 2IO6A 4MXCA 4ZLYA 3AC2A 1OITA 3SX9A 4TYHA 4I3ZA 5M44A 4Y95A 2PK9A 2XZSA 2UZBA 3NDMA 3RVGA 5I9YA 3FUPA 3LMGA 4BKZA 5EK7A 4MQ2A 2YM7A 4U97A 1LP4A 2B4SB 3CY2A 4L7SA 4AF3A 4AQCA 5L2SA 3BYUA 5HVJA 3D0EA 3DBEA 3QQJA 4C4GA 4D4SA 5JK3A 2ZV7A 5HNGA 1J7LA 2YWVA 3KF4A 4GSBA 4L67A 3C4XA 4LGDA 4BB4A 3SAYA 1ZYSA 2J2IB 3PA3A 3QLGA 2QHNA 4I6HA 3ULZA 3LMIA 4USEA 2WTJA 2JAVA 1UV5A 4UBAA 3BX5A 4JAJA 1EH4A 2BZIB 2G9XA 2UUEA 3BE2A 3PY0A 4IACA 3TXOA 5CLPA 4FBXA 5HIEA 2JDSA 4RIYA 3UZRA 4BRXA 3R02A 3WE8A 4IE9A 5AMNA 2Y9QA 1NY3A 2C68A 4PNKA 2HENA 3BHVA 5CZIA 4XP3A 3ZONA 5HO7A 2I0VA 3S4QA 1ZZLA 3ZUUA 4ERWA 3RNIA 3TJDA 4TNBA 5FXQA 3NWWA 2XCKA 1OL6A 5E7RA 4ALUA 2Q0NA 3MH1A 2G01A 4BCNA 4NWMA 2WXVA 5C03A 4YHFA 3ZXTA 3QFVA 4OTWA 3GB2A 1MRUA 4ITJA 3LFSA 4TPTA 5IA0A 5KCVA 4XG9A 2WMBA 4P2KA 4C2WA 2XA4A 4ZTQA 2R64A 2F7EE 3ALNA 1F3MC 3D7TA 1SNUA 1ATPE 3MDYA 4R8QA 4BDJA 4LV8A 4YJVA 2OJGA 2BHHA 3EQPA 5HE3A 4GJ3A 4FF8A 2WAJA 4DGNA 4DFYA 4MXZA 4YZMA 5F20A 5A6OA 4F0FA 3LFBA 3L9NA 4L68A 1H01A 5EM7A 5TO8A 5AR5A 1R0EA 3P86A 3Q4CA 5ANEA 4AWIA 1BUHA 3EQDA 3KXHA 4IZAA 2IVUA 4GG5A 3SHEA 2QG5A 4BCJA 5HQ0A 2IW8A 5T68A 2VGPA 2PSQA 4P7EA 4FV6A 3EZVA 1JKKA 2YZAA 1QCFA 3PJCA 4PX6A 4RIWB 4U45A 1H24A 3L8VA 4QMMA 4ACGA 3BLRA 4HGLA 4CNHA 3NMUF 3UBDA 2E9UA 2A0CX 4C3FA 1Y6AA 4TWPA 3NYOA 4OTQA 2PHKA 2XVDA 5ACBC 4QYHA 4IWDA 4DEGA 5ETAA 2JFLA 3O96A 4L7FA 5IH5A 5KMKA 2R3NA 4HGTA 4LMUA 1WVXA 4JIKA 5DT4A 4F1OA 2XKFA 3UYSA 4MXXA 2W0JA 4LQMA 4DBNA 2X7FA 3DJ6A 3R1YA 4DAWA 5JSMA 1SZMA 5HD4A 3DXNA 3EQHA 4KKHA 5CY3A 4HPUE 3D94A 5DRBA 3CPCA 4DFZE 3W2CA 2GU8A 1L3RE 4S31A 2WMAA 3QXPA 5HCYA 4EJ7A 3AC5A 1YI3A 1NW1A 4JAIA 4PV0A 4R5YA 4DYMA 5CU6A 3NZ0A 5EI6A 4GKHA 1BX6A 1JPAA 4XCUA 2EWAA 3GENA 5AR3A 5CF4A 2XK6A 3WIGA 1JOWB 3F82A 2VTTA 3OZ6A 4K77A 3HRBA 2BZKB 4O81A 2YCQA 4KIKA 2CGVA 4NIFB 2QOCA 4NJDA 3CIKA 3FMLA 5I9ZA 2B9IA 2YLFA 4R3CA 3P5KA 1FGIA 2OICA 4FIGA 3ETAA 3MB7A 5CT0A 3UO6A 1UU3A 3QGWA 3ODZX 4FZAB 4MXYA 4RWKA 3TWJA 1M2QA 3EZRA 3BHYA 5IQIA 1ZYJA 2PWLA 3UMWA 3PZHA 2Y4PA 4YLLA 1CKPA 4E3CA 3L9MA 4YR8A 2X7OA 3Q6WA 4ZTHA 4ZSAA 5FEDA 3NS9A 3UZTA 4O7SA 2VNYA 4YZNA 4ZTRA 4Y8DA 2XNOA 4FTOA 5CU4A 1UU7A 4JR7A 2QNJA 5CT7A 3TNWA 5GJFA 5BVOA 3RP9A 5B7VA 3TZ8A 1UNLA 3U6IA 3GQIA 3BCEA 2XEZA 3QUDA 2GNIA 1YDRE 3V5QA 1ZARA 4IXPA 4BZNA 5EW9A 4FX3A 4L3JA 2ERKA 3DKFA 4C3RA 2PVKA 3VBTA 4KIOA 3VUHA 3FWQA 3GT8A 4OTRA 5KE0A 2J7TA 1R0PA 3QZIA 3VULA 2WTDA 2B1PA 1ZZ2A 1M2RA 4QMXA 2PUUA 3W8LA 3QCQA 3NCZA 1CKIA 3KB7A 4X2KA 3R7EA 2QU5A 4WBBB 4OAUC 4K18A 3ZFMA 4KBCA 4RVMA 3TUCA
chains in the Genus database with same CATH superfamily
4QP2A 2XNEA 3OY1A 4HGSA 4CG8A 3PPKA 5BX0A 4HPTE 3UDBA 5IA4A 1R39A 1PKDA 4ZZMA 4FSTA 3AG9A 2ZMCA 4LM5A 5TF9A 1E9HA 4I0SA 4K8AA 5AUYA 1YDSE 5HOAA 3SV0A 3SG8A 2WU6A 3FMEA 3DDQA 3ODYX 4GIHA 1P5EA 3P7CA 3Q53A 2OJ9A 4IH8A 4L45A 4TYGA 1ZMUA 4DGOA 1R78A 2WMXA 3R0TA 4FKJA 5AEPA 4I6QA 4MYGA 2ETKA 5KBRA 4J8MA 2SRCA 4OBOA 5H8EA 2W1IA 4MBLA 4DCEA 3ANQA 3JY0A 5BUEA 3PXQA 4RA4A 2H9VA 3TG1A 2ITTA 4O0SA 4CKIA 4FV1A 5BMMA 3FSKA 3GGFA 3NNVA 1H07A 5CAQA 1TVOA 3W0MA 5DPVA 5AV1A 4E5AX 4EI4A 4CCUA 5JFXA 3VW6A 4CZTA 2XIYA 2JITA 4W4WA 3HECA 3Q9XA 3S3IA 5M09A 5K0KA 5CSXA 5HICA 5EW8A 4KRCA 3R1QA 4IAIA 3V5JA 3HP2A 5H9BA 2JIUA 2F9GA 5CSWA 5HO6A 3EFWA 2YJSA 1G8SA 5EH0A 1XBCA 4K0YA 3BYOA 3QKMA 4M12A 2R3FA 5H3QA 4RZWA 4QQJA 2W1DA 4ZZNA 3IKAA 4RFMA 5KUPA 3MB6A 4TN6A 4BL1A 3IOKA 2GPHA 4X3FA 5KZIA 2PPQA 5DH3A 3TJCA 3OXIA 4G9CA 3WE4A 4FEVA 1J1CA 3G6HA 3OT8A 3C4FA 3L8XA 5I5ZA 1TQMA 1F5QA 2ZVAA 2QO9A 3ORLA 4G34A 4KBAA 5LARA 4TWCA 4UWCA 4ANQA 4QRCA 3V8WA 1Q8WA 5A4LA 4AXAA 3ML1A 3NRMA 5DYJA 4IVDA 5B2KA 3PG1A 2FSMX 3OWJA 4J95A 1A06A 4TW9A 1MRYA 4ARKA 1WFCA 1XHAA 2BAQA 3QD3A 5E8SA 2YCFA 3DB6A 3EN7A 4Q9ZA 5LQFA 2ZAZA 3QGYA 4ZLOA 4L46A 3FLSA 1H1QA 4AN3A 5GIPE 4LV5A 2PMNX 5AM6A 3HA8A 4DG2E 4QDVA 3QD2B 3R9HA 3Q5ZA 3ZDUA 3QQHA 4NT4A 3BEGA 3KRLA 3AKJA 3DV3A 4XBUA 4KRDA 3GU6A 5CALA 3BWFA 2BHEA 4OTIA 2WQNA 4FL1A 3G15A 3ZO4A 4FGRA 2X81A 2JD5A 3KC3A 3RCDA 3II5A 2B9JA 3E8EA 2QOFA 3VIDA 3VS6A 5E4HA 1URWA 4G5JA 4IADA 5T3QA 3UDZA 1CSNA 4CVAA 1MP8A 3DFAA 2QKRA 1JSVA 2G1TA 4Q9SA 3COKA 4LRJA 3ZRLA 4AZVA 4UMPA 1A48A 3UIMA 4M67A 4GRBA 2WTVA 1KUTA 4JG6A 4LRMA 2OBJA 2QLQA 3R7OA 4AN2A 4CFFA 1SNXA 4F1TA 1YKRA 2OFVA 3FKNA 4G3CA 4M13A 3O2MA 3EOCA 2OH4A 4AXFA 4ZY5A 5ANGA 5GIOE 4J7BA 2C5VA 4IZ5A 4LUDA 3NNUA 2ACXA 3AT3A 3GU5A 5AP1A 4RQVA 5AP5A 4QMLA 1W7HA 4MEDA 1YHVA 3EFJA 4EOOA 2LAVA 5FXRA 1UWHA 3I6WA 1OECA 5CNOA 5AP4A 4FV5A 3RZBA 5CVGA 4MAOA 2UZTA 3FQSA 4K33A 5J5SA 5LXMA 4YJPA 5I4NA 2YIRA 3SW7A 2ZOQA 2HW7A 3KVWA 3W18A 3NUSA 4GYGA 2NYAA 3QC4A 2XKDA 5HNBA 1W2FA 4WG4A 1YDTE 4PL5A 2ITPA 2J0LA 5EI8A 5TOZA 4E6AA 1XKKA 1WZYA 3BL7A 4D9TA 4CLIA 3CS9A 2UW4A 3K54A 3SQQA 4MD9E 3MGYA 3R8PA 3V04A 4FKIA 2F49A 3PP1A 4UB7A 3NUXA 3KXNA 4DT8A 4K6ZA 2XNMA 3R63A 4NH1A 4EC9A 4XRLA 2NRUA 5FLFA 1ZOHA 3U6HA 4R7BA 2OG8A 3PXYA 4O38A 2R2PA 4D2PA 3HX4A 4FE2A 1KOBA 3OBGA 4HYUA 4KNBA 5M08A 4IANA 2OJJA 4JDHA 4J52A 4WKQA 2BROA 3IQ7A 3QRTA 5HBHA 1MUOA 2UZOA 2Y4IB 2WQBA 2WGJA 3EQGA 4XV9A 2ZV8A 5HTIA 5IEXA 4GUBA 4BWXA 4IIRA 4ACCA 1WBNA 3AD4A 3FPMA 5HU3A 4QTAA 4BCIA 3A4OX 4CZUA 2R9SA 3FY2A 1PXOA 4AU8A 4YLJA 1SYKA 3FQEA 3FEGA 4AOIA 3CGFA 2ZMDA 3OWKA 2ONLA 3DDPA 3R71A 4C8BA 5CANA 5GINE 2C69A 5I9UA 3OHTA 3WZUA 2CGUA 5AP6A 4DITA 3EB0A 1PKGA 4P5ZA 4WOVA 5HLPA 2YJRA 4L8MA 4O82A 3UP2A 4ANLA 5DOSA 1QPCA 4O2PA 2WTKC 5A4EA 4Q5HA 3G51A 3RCJA 2XIZA 4IJ9A 1OKYA 3G0EA 4Q2AA 3A8XA 3KKVA 3OUKA 4UXQA 3NUAA 2R0UA 4CKRA 3C7QA 4OUCA 5AX9A 4UEUA 3F5PA 3O8TA 3KREA 5B2LA 5F4NA 4RVLA 2XK4A 4IZYA 4Y85A 2ITQA 4XOYA 2WIHA 5GZAA 3UOJA 4CQGA 1XH6A 5CEKA 4IZ7A 2JFMA 4H58A 3ZUVA 3GFEA 4B99A 3DBCA 1KE7A 5A46A 2VTLA 4O7NA 3Q60A 2YAKA 4GW8A 4LOQA 3JVSA 4BVUA 4CTBA 1Q3WA 5KKRC 4BDFA 2WQEA 3R28A 5CQUA 2BCJA 5AUXA 3TZ7A 3FJQE 2QC6A 1IAHA 4BDKA 3VRZA 4K2RA 4YHTA 3TL8A 1REJA 3AQVA 5KHWA 1DM2A 4R77A 5EQYA 3AT4A 2YWPA 3O8UA 4BI2A 3LXNA 2J0JA 2CN5A 5IQHA 1UNGA 4I5PA 2W06A 4YBKA 4F1MA 4AZSA 4AT3A 3E88A 4G6OA 4WNOA 5K3YA 4UX9A 1KOAA 3MVHA 4EQCA 4BTKA 4J99A 3KRRA 4FUXA 4FZDB 3MY5A 4J53A 4HCTA 4WNPA 5KMJA 4O83A 5HE0A 4M69B 2HZ0A 4QNYA 4KWPA 4N57A 4DC2A 2WKMA 1OZ1A 2C0IA 2R3LA 1O6YA 4GL9A 4O27B 4GS6A 4DGLC 4OBPA 5HIBA 3L1SA 4KUJA 2QOHA 4Z9LA 1W82A 4PQNA 3VC4A 3BELA 4BDGA 4V0GB 4BWPA 4EL9A 5BVFA 4TYJA 1ZOGA 4R5SA 5E8UA 3QQLA 3FPQA 2XBAA 5D7AA 1YW2A 2HZNA 4DCAA 4R6VA 3ZYAA 2JDRA 3KFAA 5DBXA 2HZ4A 4XJ0A 4AAAA 4BFMA 1PHKA 1ZAOA 4JX7A 4XHKB 2V7OA 3F3ZA 5GJGA 4AGUA 4DH7A 4QT1A 1FBNA 4RRVA 3LLAA 4DF3A 4JRNA 2ITYA 5HHWA 3Q9ZA 4BGGA 4FVQA 5C26A 3BV2A 4XX9A 4AG8A 2UZWE 4YJSA 4CXAA 3RM7A 4HW7A 3SOAA 2OKRA 3HV6A 4O7WA 5C4LA 4KB8A 3LW0A 3ELJA 2C3JA 3RAWA 4RIWA 4XNEA 2BZJA 1XH8A 3V5WA 4EWHA 2PUIA 4A9RA 1Q5KA 1NVQA 3D2IA 4AW2A 4ACMA 3LKMA 2ITXA 4D2TA 3DAJA 4IVCA 4IWQA 2VZ6A 4O6EA 4FNZA 4E4NA 1OIYA 1V0PA 2XK7A 4QP8A 3UPZA 2R3HA 4I22A 4B7TA 2OH0E 3DB8A 3FZ1A 4EOPA 3MJ1A 4PF4A 2OF4A 4M7IA 4LV7A 4C4HA 3JY9A 4GJ2A 4CYJA 5FTGA 4OTHA 4CRSA 4CLJA 5H8GA 2QO7A 3MIYA 2BTRA 3S0OA 5BVKA 3COMA 4HVHA 4KS7A 3JS2A 2FSLX 2GNJA 3VNTA 4AA0A 4CKJA 4FEXA 2RGPA 2W1EA 2GNFA 5AV3A 3MN3A 3ORPA 4YJTA 3TZ9A 3Q9YA 3BBWA 4FT7A 5DT0A 3LQ3A 2R3PA 4MD7E 2UW9A 4BI0A 2ITWA 3NIEA 4NIFA 1YXUA 4JBVA 4B9DA 2WMSA 3WZKA 5BNJA 3QYWA 2OGVA 1ZXEA 4Z55A 3F3TA 4I0RA 4IX3A 4HVSA 4ID7A 3R01A 3EWHA 4L9IA 2C6DA 3O50A 3QCXA 3RWPA 4MF0A 4OT5A 4FK3A 2BTSA 3EIDA 2J90A 4LYNA 4OTFA 1JKLA 4I0TA 3U4UA 1I44A 3O17A 3SGCA 3UQGA 3ZM9A 2YDJA 3C50A 4I41A 4E4XA 3AKLA 3QC9A 4O21A 5E8XA 1P4OA 1OB3A 3QZHA 4NUSA 1S9IA 3F5XA 3OY3A 4JIAA 2FYSA 1PY5A 2C6EA 4DA5A 3E3PA 4RFYA 4B8LA 4C61A 2GDOA 1WBVA 3F66A 4DEEA 2GNLA 3UE4A 4U7ZA 4LL5A 2NPQA 2PZYA 5HI2A 3SC1A 5L8JA 5IQAA 4I21A 4FTQA 2YHVA 3ZSHA 4O4BB 1T46A 4GH2A 3OW4A 4PTGA 4FKVA 3RGFA 1Q41A 2HOGA 4F64A 3QRJA 4R1YA 3CGOA 2JIIA 4YNOA 4FVRA 1WAKA 1OMWA 4AW0A 3I1AA 3LJ0A 3W32A 1OUKA 1WBWA 3D9VA 1URCA 2YIQA 3EFLA 3KK8A 2ZFYA 2IW6A 2PZPA 5FGKA 5AP0A 1W98A 2QOLA 2BALA 3DCVA 2PVJA 3NLBA 3M1SA 3KXZA 1FVVA 4I92A 4U8ZA 3TV4A 5EQPA 4FT5A 4ZK5A 3D5WA 5FBNC 3GOKA 3PJ8A 5G1XA 3T8OA 2UW0A 1OI9A 3PIZA 1BI8A 1GIHA 3UODA 4DT9A 2OI4X 1M14A 3QD0A 3WF5A 5HX6A 2R3GA 3RINA 4X2NA 1MQBA 3CLYA 3P79A 3QRKA 4D28A 3AC8A 3SD0A 3GBZA 4I5CA 2WMVA 5IEVA 3A2CA 2WMWA 5AM7A 4BDIA 4NJ3A 5E1SA 3I6UA 3HV7A 3C4ZA 2A2AA 3P0MA 5A54A 4M0ZA 5HZNA 3A60A 2UZUE 4FR4A 3W2OA 3UNKA 3NFGB 2PULA 5M55A 3V6RA 4XBRA 5HG5A 3NUPA 4BCFA 3OUNB 2QODA 3EQIA 2HZIA 3PSCA 4EKKA 1RQQA 5DG5A 1LPUA 3TEIA 2DQ7X 3KRXA 4C62A 4MTAA 4JQEA 2QKWB 4I24A 3P23A 5FEEA 2WNTA 3U87A 2YZLA 4XP2A 4R7HA 3ORTA 4FTMA 5JQ8A 4GEOA 3BKBA 2WOUA 4Y83A 3MIAA 3PZEA 2GQRA 2BZHB 3MFTA 3C0GA 2HWOA 1CKJA 3ERKA 4UXLA 3K5UA 5IA2A 1XMMA 2X8DA 2CMWA 1VYWA 2W17A 2XNGA 3FZPA 3MPTA 3NAXA 4FT9A 5JZNA 3CEKA 2PVFA 3HKOA 2YACA 4YNEA 3BI6A 2VTSA 2V62A 4J97A 4RZVA 2VWIA 4FIEA 2J4ZA 4IC7A 1RJBA 2JLDA 2XM9A 2W4KA 3EYHA 4CFUA 5C1QB 3GEQA 4KKGA 5LMKA 3HVCA 5AP7A 4TNDA 1HCKA 2B55A 1B39A 5EM5A 3RK5A 3ZO1A 3LXKA 4XG6A 2VTJA 3KK9A 4WHZA 3R8LA 2CNQA 2BDJA 5EDRA 1XJDA 4IQ6A 4G5PA 4WBOA 5DIAA 3KN5A 4PRJA 3LM0A 3Q96A 2OO8X 3PJ1A 3F7WA 3UPXA 2AQXA 3EQBA 1H0VA 5AR8A 5M51A 3I4BA 3LCDA 2OF2A 3BGZA 4J98A 4IEBA 3VAPA 4FEUA 4D0XA 2UW8A 4QPMA 3R8UA 2WO6A 2I40A 3A8WA 4Y72A 4F9BA 4G31A 1V0OA 4A9SA 3I0QA 2HELA 1QPEA 4FSQA 4QPAA 4X3FC 4FODA 4O0WA 1H26A 4C57A 1Y8GA 3KXMA 4GU9A 3QBNA 4APCA 4PPAA 4IWOA 3MI9A 3GFWA 4X7QA 4RT7A 2FH9A 3LQ5A 5FUTA 2GS2A 2OZAB 3FMJA 1TKIA 1KE8A 4A9YA 3FMDA 2G2IA 2CKQA 3FE3A 4NW5A 1W0XC 3FDNA 3Q6UA 1YOMA 3E87A 5AIKA 5HE1A 4DH5A 1CMKE 4EC8A 3FI8A 4IVBA 5CSPA 2VTOA 4UALA 3OW3A 4D2SA 1RDQE 2XALA 3TNHA 4G3FA 5IU2A 3PLAE 3ZCLA 5D10A 4JL9A 5D7VA 4DHIB 4BCQA 1Q3DA 2J50A 1WBOA 4YP8A 2XM8A 4FSYA 3F2AA 2YM5A 2VX3A 3ZUTA 1TQIA 2Z2WA 3W0QA 3R1NA 3KVXA 3S2PA 3V8TA 1ZMVA 3IK3A 4PPBA 4QQTA 1YWVA 3AMBA 4HZSA 1ST4A 3FKOA 1DAYA 2AC3A 5KMLA 2OZOA 2P4IA 4ITIA 2Y7JA 3WF8A 2O2UA 2PTKA 5J8IA 4JI9A 5A9UA 5L3AA 4C36A 3UOHA 1PYEA 4G16A 3NW6A 5DVRA 5LMAA 3W10A 3NUUA 5HESA 4ALWA 4BHNA 3TUBA 3QYZA 4XG3A 3ZEWA 2O0UA 4BCKA 1OBGA 5IQEA 4C37A 4YUQA 1PMUA 2JEDA 3U54A 3QAME 4E8AA 4CFMA 3NNXA 3N4UA 4O7RA 4C4JA 4JS8A 2VRXA 3KCFA 5CSHA 3VVHA 3PY1A 4D4YA 5JRQA 2LGCA 4EK5A 3UIXA 2W4OA 3ALOA 2PMOX 4CQEA 4M14A 4MNEB 3V3VA 3H3CA 4QOXA 3C1XA 2WQMA 2VUWA 4NEUA 3CTQA 4RG0A 3F3UA 3UP7A 3HGKA 3VBXA 4AN9A 4C38A 2XS0A 1Q61A 1SVHA 4YPDA 2ETRA 4NM7A 4AE9A 4W8EA 5EDPA 3W33A 2VWXA 5IISA 4R78A 1OKZA 2YLEA 4FSWA 4LGHA 4FV8A 5FXSA 5CX9A 3R9NA 3V01A 3VF8A 2C5NA 4JOAA 2X9FA 2Z7QA 3KL8A 3L9LA 4IDTA 2GTMA 3T9TA 3G6GA 3SOCA 4A9UA 4YJRA 3CKXA 3PE2A 1QL6A 2XEYA 2XJ1A 4U80A 3RHXA 3C5IA 3OT3A 3E64A 3MVLA 4U44A 3FLQA 4FKOA 1ZRZA 2CPKE 5CU0A 3UTOA 4BCPA 3LFDA 1YXSA 2NO3A 1OL2A 3LFEA 4RFZA 5FDPA 2R3JA 3EQRA 4G1WA 3IECA 4ANBA 2HY81 3OD6X 4HVGA 2YM8A 5EG3A 4RC3A 3PRFA 4EOSA 1DAWA 2Y6MA 4FV7A 2A1AB 3SVVA 3EFKA 3QCSA 5HIDA 1LEZA 3VUDA 5EYCA 3MY1A 4GK2A 4S30A 2YISA 3F61A 3L8SA 3ANRA 3LM5A 4EK4A 2Q83A 2RKUA 1B6CB 3FI4A 3R7GA 1WBSA 2JKQA 5CI7A 5J5TA 5CF5A 4JNWA 4L6QA 3VUIA 3HDNA 3VBQA 2VU3A 2RG6A 4CV8A 4F4PA 5BVWA 1JBPE 4MNFA 5EHLA 3PSDA 3FHIA 3PP0A 3QKKA 4HYHA 1O9UA 2ONLC 5CWZA 3TNPC 4BC6A 4C35A 3I7CA 2WOTA 2AYPA 3PA5A 5M06A 4I93A 5AIRA 2NRYA 4TRLA 3DKOA 3ROYA 4AS0A 5JGBA 2YIXA 3FI2A 4IAKA 3RPVA 3RMFA 4QYYA 3TKUA 2WMTA 3OOMA 4RX5A 3MY0A 2VWYA 4LUEA 5DNRA 2P2IA 4C33A 3QZFA 4DFBA 2CLXA 3VHKA 4X2FA 5KMIA 3LCKA 1GIIA 4X21A 2G15A 3BU6A 4FKQA 3SXRA 4GK3A 3TNQB 4V04A 2R3MA 4M3QA 4M8TA 4GT5A 4UMQA 3LFCA 4UMUA 4CFXA 2ITVA 2BRNA 3PXKA 3BWJA 3FLNC 4M69A 3GOPA 2A4LA 1GIJA 1OM1A 3DFCB 2BMCA 2CGWA 4O4CA 5HG7A 2EUFB 3DLSA 4IWPA 4X2JA 3R00A 3PJ3A 3EJ1A 4U9AA 4IFCA 3UGCA 3N4VA 2C1AA 4E6DA 5AFVA 2CGXA 5M4FA 2FGIA 1KV1A 2OK1A 4FTLA 3VW8A 4NFNA 5JGAA 4C2VA 2OWBA 4V0GA 5EQEA 3IG7A 2RG5A 4DG0E 4OW8A 3PA4A 3ZBFA 4BGHA 3I0OA 2WQOA 4IB0A 2C5OA 1QPDA 4FKPA 4JLCA 4X0MA 5CQWA 3VS0A 4KSPA 2EU9A 2UZNA 3ROCA 2UW3A 2WIPA 3DS6A 3FSFA 4U40A 3ZDIA 5TKDA 1VJYA 2CN8A 2VWZA 5JQ5A 4BYJA 4MQ1A 1NVRA 3ORIA 5LWMA 3M11A 4O0XA 3A7HA 4N70A 4X2GA 2WEIA 4EHZA 1W2DA 4MX9A 4EZ5A 5B2MA 5ETFA 5FP6A 4K1BA 1YI4A 3QX2A 3PPZA 3ULIA 2YITA 3HV3A 4DEHA 5M53A 3W0PA 3ZS5A 4HZRA 5ETCA 3H9RA 4DHZA 4ANNA 4JT3A 2J0IA 3L8PA 4KABA 4RGJA 3SLSA 4ASXA 3LPBA 1JSTA 2QOKA 4RJ4A 4N6YA 5EYDA 5DE2A 3C0HA 3DTWA 3P9JA 2CKOA 3RBWA 3W55A 3QQKA 3BQRA 2WTKB 4DH8A 4EK6A 2WELA 1BLXA 1M17A 4A4XA 3PVBA 3ZU7A 3JXWA 5BPYA 2OSCA 4WT6A 1YRPA 5BVDA 4BGQA 1IASA 3SXSA 4L53A 4NW6A 5BQ0A 3BL9A 3UIUA 3AGLA 2X0PA 2PZ5A 5ETIA 3G90X 1M52A 3DXQA 3P7BA 3H9FA 3UVQA 5CENA 1BL6A 1Z9XA 4BDBA 4CMUA 3QQGA 5A14A 5GZ8A 1UVRA 1ZY4A 2C3LA 5LMBA 3CJGA 5AA8A 1PXLA 3LLTA 3GCVA 1JVPP 4MWIA 4OTGA 5CEPA 2VTMA 2OJFE 3ET7A 4NCTA 3TTJA 4NKAA 4D9UA 2V7AA 2C30A 4JJRA 3S1HA 2VX0A 1T45A 2X6DA 4JVGA 2ESMA 2JKMA 2HXQA 1XH5A 2W99B 5DEYA 4BIEA 5KKRB 2AEGA 3WYXA 4AAYA 4RJ6A 4ZJVA 3E5AA 2CNUA 1PMEA 3RK7A 5BYYA 5M57A 4NTTA 4YLKA 5AV0A 2VD5A 3NEWA 4USDA 4X6RA 3KXGA 5A4QA 3RAIA 4WO5A 3QTXA 4FL2A 4AZEA 4F78A 2XK3A 4JQ8A 2BRMA 1OVEA 3ENHA 4FG8A 5E90A 3Q2JA 2QR8A 5EM6A 2A19B 3KA0A 4I6BA 4QP4A 3IDBA 4I94A 4EH7A 3MPMA 2VNWA 3CXWA 3MWUA 3PFQA 4W9WA 4UZHA 4BN1A 2PZRA 3BU3A 4C58A 2C5XA 4XYFA 4FTNA 3UC4A 5E8ZA 3S95A 3RNYA 1S9JA 4XG2A 3FZOA 3U9CA 5CEOA 4E6QA 4A07A 4CD0A 2GFSA 3C4CA 3F3WA 3QTUA 4FNWA 4M0YA 4AZFA 1IRKA 3GQLA 3G9NA 3BLAA 1MQ4A 3PWDA 4GUEA 4NSTA 1XH7A 5AV2A 4QMNA 4EONA 3OTVA 4KIQA 2C5YA 3BHTA 3N4TA 5AUVA 3P5JC 4FG9A 2R3QA 4AFEA 4BZOA 4WNMA 1YVJA 4AGDA 5J7HA 4PY1A 3GXLA 2R7BA 4PTCA 4AW5A 2GFCA 3MVJA 3FY0A 5ANDA 2X1NA 4FVPA 2WB8A 5G6VA 5H2UA 2B52A 3CD3A 4U6RA 4V01A 2C6OA 4RPVA 3GCUA 3VS5A 3KXXA 4MKCA 1U46A 4EORA 5IKWA 2X2KA 4BBFA 1F0QA 4BTFA 5F9EA 3E3BX 4ZMEA 3DTCA 4FV4A 4ZSEA 4GYIA 4EKLA 3U4WA 5E91A 4RIXB 1YWRA 3LVPA 3DBQA 5J79A 4DBXA 3C5UA 3BLHA 4H36A 3D5VA 4N6ZA 4M97A 4K9YA 4WD5A 2OU7A 4EH5A 4GFOA 4PP7A 4ZSGA 2VWUA 5JMSA 4BJJB 3EKNA 2EB2A 2UVZA 3CD8A 4IAYA 5I9XA 1KE5A 2C3KA 2FB8A 4MWHA 5FTOA 2XKCA 4DH3A 2CLQA 5AUTA 2FO0A 1QPJA 4O96A 1O6LA 3PIYA 3DLZA 3K3JA 1PXNA 5K4JA 4QD6A 4RLKA 3TKIA 2WHBA 3SG9A 5CYIA 3FV8A 3MW1A 3QZGA 4L3LA 3JYAA 4JBQA 4O91A 1WBPA 1U5RA 3UC3A 3NGAA 4FTJA 2C4GA 4G2FA 4H3BA 4N0SA 4YJOA 1GNGA 3P4KA 3R7UA 2BR1A 4UN0C 2QG7A 1JWHA 1PXJA 1KE6A 2CCHA 3F5GA 4U3ZA 2A27A 4IX5A 2JDTA 3LZBA 5HE2A 4FK6A 5EM8A 2YAAA 2O65A 4DN5A 3TUDA 4IX6A 3O5AA 3F5UA 2JDVA 4QTEA 4FI1A 3PJ2A 5BMSA 4FG7A 4RX7A 4EJNA 4D4VA 3KMWA 2R3KA 3Q4UA 3ZO3A 1YQJA 2C6KA 4EYJA 2OXXA 4FNXA 4O4DA 5HX8A 2XAMA 3OXZA 4TZRA 5HD7A 1FVTA 3AMYA 4QMVA 4JRVA 4PDSA 2XIRA 4Y5HA 3ORKA 3RAHA 4AA5A 5CAUA 2R0IA 2ITOA 4MF1A 5F1ZA 5TR6A 4CGAA 1M2PA 2W96B 2VTPA 4G3GA 2HAKA 3O23A 4ZJIA 3NUNA 3EYGA 1Y6BA 2W1GA 3V5PA 3FLYA 2YM6A 3VJNA 3W0NA 1X8BA 4AQKA 3HMMA 4YTHA 1Y91A 2OIQA 2IN6A 4QP7A 4Y5QA 3VUMA 4BTMA 3JR1A 3FKLA 4UWYA 3ZSIA 4D5KA 4S33A 5LMKC 2B53A 1KV2A 2XK9A 5D41A 4AOJA 4HNIA 1PMNA 2BAKA 3MVMA 5E8YA 3AGMA 4TTHB 5JKGA 1H4LA 3KQ7A 4RWJA 3C13A 1PF8A 2O64A 3DJ5A 4FT3A 4LL0A 4F0IA 5IH4A 3MS9A 4DGGA 4YO4A 2ZDTA 5AJQA 3E8DA 3W2QA 2OZAA 2YDIA 3DZQA 1IA9A 1H1SA 3MA3A 4FKGA 2YEXA 3R21A 3FAAA 5GNKA 5A4CA 4AXDA 1UU9A 3BPRA 4HYSA 4L01A 2ERZE 3PRIA 3TTIA 2Z8CA 3HMNA 2ZDUA 3OWLA 3QWJA 4MHAA 4QP6A 4YURA 1YHSA 4PNIA 3Q4ZA 2ZM3A 2H34A 4L00A 4FIJA 5K9IA 3RALA 4E4LA 1AGWA 2QOOA 3GCPA 1DI9A 4U79A 3OG7A 5F95A 4A7CA 5HG9A 3PPJA 4ACDA 4EK3A 4WIHA 2J5EA 4BI1A 4CYIA 2RF9A 4XS2A 2E2BA 5K0XA 3E63A 4YJNA 1DI8A 1JKTA 2F57A 5A6NA 3NFFB 1UA2A 5E92A 3U9NA 3FLZA 4DE4A 2DUVA 5EHOA 2PL0A 3ZO2A 4Z7HA 3IO7A 1PXKA 2O3PA 1P4FA 3B2TA 2ZV9A 3BYSA 4KINA 1ZOEA 4FRFA 1UKIA 4NM3A 3HNGA 3KULB 2C6MA 4YTFA 4FEWA 3ATTA 2A98A 2YCRA 1Y57A 3LXLA 4ACHA 4EUTA 4RVTA 3PE1A 4EWQA 1K9AA 4HYIA 5DT3A 5EI2A 1G5SA 4ENYA 4QYEA 4EBWA 4PDOA 3OEFX 2WEVA 4TYIA 5M07A 3DKGA 4XMOA 2HY0A 1HCLA 4I23A 4ONAA 5IQDA 4UYNA 4C4IA 4DFLA 3DGKA 5EYKA 5L8KA 4D5HA 5IMXA 1AD5A 4HCVA 4MNEA 4O1PA 4XUFA 4AT5A 4J96A 3KMUA 1OGYA 4AUAA 2QU6A 5CXZA 3WARA 3EN5A 5JZJA 5EW3A 4XV1A 3Q5IA 4CMTA 3W16A 3GI3A 2CJMA 3ZM4A 2J51A 1M7NA 2BPMA 2GS6A 2V22A 4FV3A 4F9CA 2Y0AA 2XARA 1H1WA 5D1JA 3UO4A 5CEQA 3VWAA 1Q8ZA 4E5WA 5IA5A 3A62A 3A99A 3LQ8A 4FSNA 4AOTA 4DDIA 4GMYA 3NYNA 2J0MB 4O4EA 3RKBA 2Z7RA 2JKOA 4GU6A 2BIYA 5LVPA 4QO9A 3BIZA 4YZDA 3GC9A 5AR7A 3O8PA 3KCKA 3V5LA 4L3PA 4RBLA 4FTTA 4YZ9A 5ANJA 5EDQA 3F69A 5FRIA 2XH5A 3IW6A 4QMTA 4W4XA 2B54A