3NWWA

P38 alpha kinase complexed with a 2-aminothiazol-5-yl-pyrimidine based inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
349
structure length
339
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Utilization of a nitrogen-sulfur nonbonding interaction in the design of new 2-aminothiazol-5-yl-pyrimidines as p38alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 113
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nwwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nwwA01
4WKQA 4FIIA 3ZHPC 4PTEA 3CD8A 2PVRA 3EQRA 3QL8A 5DVRA 3E3PA 4A9SA 5KMNA 1E1XA 1U5RA 2CGXA 2R3NA 4XG6A 3GCVA 3P9JA 3Q2MA 4Q9SA 3P86A 4R5YA 3TZ9A 3VF9A 2OKRA 3LXNA 4FIFA 5DRBA 1H1PA 5HCYA 4X2KA 4YUQA 4DCEA 1RE8A 4GYIA 1YI3A 4DH1A 4FKIA 4USDA 1YW2A 4FV9A 4FV7A 5HO7A 3QRKA 3M11A 4AU8A 3PVWA 2UZEA 2OI4X 2W1IA 3B8RA 4WOVA 2OWBA 2IZSA 3F3UA 4DLJA 4YMJA 2GQSA 2PULA 4AUAA 3K3JA 3TI1A 4FZAB 2JLDA 4FA2A 1ZLTA 3QZHA 2YIRA 3EKKA 4M14A 5BNJA 4YPDA 5HVJA 3E62A 3BHTA 4DG3E 4EBWA 4RX5A 4Y72A 3BX5A 4DCAA 3R28A 2E9PA 4FODA 5HORA 4UYNA 3RK9A 3FJQE 5LXMA 1WBTA 5C27A 4YJQA 4N4SA 3GCPA 2QG5A 1H07A 5KKRB 1YOMA 4JIKA 2I0HA 3BEGA 4M84A 3NS9A 4FT0A 4XV1A 5CENA 4Z16A 4O82A 2XBAA 3NAYA 2GHGA 2WPAA 3O7LD 5IEVA 1CDKA 3SX9A 4D2RA 4F99A 5KBRA 2PPQA 4FKGA 4L43A 1TQPA 4BBEA 3GC9A 2PUUA 5IDNA 5IH4A 3CLYA 4RRVA 3H9FA 2BTRA 4FV2A 4D1XA 4H05A 3R7EA 5EQYA 3FPMA 4BHZA 5C01A 1ERKA 4JI9A 5BMSA 3VWAA 1BL7A 4P90A 5AAGA 3F3WA 2B9FA 5L6PA 1KE7A 3FMKA 3ALNA 1SVGA 5CWZA 3RBWA 4BIBA 4D2WA 3A7IA 4GRBA 5HEZA 3D14A 5E4HA 3RAHA 5HE2A 4BF2A 2Q83A 3GOPA 3C0IA 4QMWA 4RC2A 4FE2A 4XG9A 2ETRA 3IDBA 4FI1A 3KB7A 3UG2A 2R5TA 3BELA 5BPYA 5HO8A 2KTYA 5J7BA 3Q04A 3WI6A 2G2HA 3N9XA 1Q3WA 2GHMA 3R1YA 4GV1A 2V0DA 3N4TA 4OBPA 2PVJA 3PJ8A 3E87A 3GU6A 5J9ZA 2C5YA 3BGQA 2G15A 4CG9A 4I1ZA 4MXZA 1L3RE 1NT2A 4BY9E 1PXNA 2OZAA 3WIKA 1YKRA 4QTBA 3DZOA 3H0ZA 5CAQA 3RAKA 5IQEA 3KVWA 3GCQA 3COIA 2B4SB 4FKOA 4D4YA 5LVOA 3LMIA 2BILB 5EHOA 4ZLZA 2XIXA 5HCZA 2BZJA 5M4FA 4ZZOA 4KIQA 4M15A 5I5ZA 2XKDA 4RFYA 5J9LA 5HO6A 3TNPC 3UODA 3FMNA 5L4QA 2UZOA 4QMUA 3TTIA 3MB6A 4F09A 3BLRA 3I4BA 4TN6A 2CKEA 3G2FA 3Q9WA 4NUSA 2VTLA 4QMLA 2VX0A 3BU6A 3LXKA 4HZSA 4C35A 4R77A 5CSHA 1G8SA 4B8LA 3SV0A 4FK3A 1O9UA 4IZ5A 5AV3A 4YO6A 4YJPA 1WVYA 1ZYSA 4DGNA 3PP1A 3Q4ZA 4QOXA 4KIPA 4RQKA 5KCVA 5BX0A 4RVKA 2XZSA 5HNBA 4QMXA 2OZOA 4I6QA 1GZOA 1O6YA 5B7VA 1F5QA 5M53A 5K5NA 4D2PA 5IA4A 1TVOA 1H28A 3D94A 4YZDA 4DLIA 5M4UA 5IKWA 3ROCA 2CN8A 2ZOQA 4Y8DA 4ASZA 5D7VA 4FEQA 3DBQA 1JKKA 2WFYA 2QD9A 4JBVA 2OFVA 4JDKA 4JS8A 1U54B 3C50A 4FTRA 4HGEA 4JOAA 5EDQA 3C4CA 4C61A 4M8TA 3GC0A 5EW9A 1JQHA 2DQ7X 1K9AA 2H6DA 4L8MA 4FKJA 4TNDA 5KE0A 3REPA 4AGDA 5HTCA 5D10A 4R7BA 3RJCA 4EK4A 3VULA 1KWPA 4IQ6A 3GOKA 3FUPA 4XMOA 2XNBA 4LQMA 1EH4A 2X4FA 4FTNA 5TE0A 4XUFA 3PJ3A 3H3CA 4E4XA 4FKLA 4P2KA 5H3QA 5CEMA 2W1DA 4DFBA 4IM2A 2VWXA 5FM3A 4ITIA 4O84A 5A6NA 1P5EA 5LVMA 3IONA 2CKQA 2GNLA 2I40A 3MVLA 4L46A 3RPOA 3HUCA 5CVHA 5IQAA 4BVUA 2QOKA 2XYNA 4NW6A 5HCXA 4TT7A 3GQIA 4CLIA 2Y0AA 3ORZA 1YHVA 4O0YA 4RPVA 2IZTA 1Y8YA 4FTJA 3KRLA 2YWPA 4CTCA 5JEBA 1Y6AA 3CY2A 5CAPA 3O8UA 3CKWA 3MIAA 2JFMA 3PWDA 2IVUA 3VC4A 1Q8YA 3EFKA 2PVNA 4I6HA 3UO4A 3W2QA 4CFXA 2J51A 3FLZA 2UW6A 5ANEA 3EYHA 3KQ7A 3V5LA 2YAAA 1O6KA 4FTMA 4S32A 2Y6OA 3HA8A 4UMTA 5DLSA 4EOQA 2ZVAA 2RGPA 3PPKA 3CTQA 1OL6A 4N70A 3UQFA 3VUDA 4EC9A 5AP7A 4WA9A 4GH2A 4WRGA 5BQ0A 2ZDTA 5KUPA 4O81A 4ZZNA 1KOBA 4DEIA 4LYNA 4BGQA 4GFMA 1PXKA 3M42A 4CRSA 2HXLA 2O5KA 5CT7A 3GP0A 1ZZLA 2IW6A 4RGJA 1WBWA 2C69A 2JIUA 4RWJA 3R7IA 3S1HA 3HMPA 5B0XA 4FF8A 5FUTA 3PTGA 4X3JA 5D7AA 3FZ1A 5K9IA 2VTRA 3C4XA 3DK6A 3WF6A 5GIPE 2ZM1A 4KIKB 5HU3A 4IJPA 3BHYA 2PYWA 4UMPA 4WG4A 2J0KA 2BIYA 5HE3A 4AGCA 3FXWA 4D0WA 4LL5A 3DBEA 3G6HA 4DG0E 4NKSA 3V5TA 3FE3A 3F2RA 5L8KA 5CAOA 5KMMA 3UBDA 3KMWA 5FWKK 1HCLA 5HG7A 3SG8A 3ZSGA 4G5JA 5EFQA 1YHWA 4MNEA 3TXOA 5FXQA 4DFZE 4UX9A 4EHEA 3LMHA 4FGRA 1PJKA 2CKPA 4FG8A 4QO9A 1ZMUA 3MFTA 2WAJA 4QTDA 3QUEA 4HJOA 4BCFA 4BCIA 3VBQA 3WYXA 3RPRA 3ET7A 4OW8A 2BAQA 3BLHA 3VS4A 2G2IA 2X39A 3GT8A 1ZYLA 3C4WA 1M7NA 3HRBA 4U79A 3AC3A 5JQ8A 5FRIA 1H24A 2J90A 1TKIA 2X7GA 3KREA 2XCHA 5AP1A 4MF0A 2WMVA 5DNRA 3PA3A 2IVSA 3PSDA 5CI6A 4YLJA 5EOBA 3HLLA 4O0XA 4DFXE 4BDEA 3NGAA 2REIA 4QP4A 1U4DA 3DKGA 1WVWA 4APPA 3PRIA 2BAKA 4NCTC 3FMEA 1W0XC 5LOHA 5JZNA 1FOTA 4WNOA 5FEEA 4MEDA 5AWMA 4BIDA 5CEPA 2O0UA 4O7YA 3S0OA 4D1SA 3AT2A 5EYMA 4PP9A 3HNGA 1OMWA 2ZYBA 3DNDA 3MH1A 4J7BA 2OU7A 4IDVA 5L2QA 2QOFA 4AAAA 4NWMA 4I3ZA 3HX4A 1UU9A 5FLFA 4YP8A 4EC8A 3NIZA 2UVXA 4IC8A 3VW8A 3VS1A 5ANOA 1ATPE 5KMJA 4ID7A 3FMLA 2YABA 3EN9A 3OCTA 4KD1A 3RP9A 5ANIA 5EM7A 1MUOA 3KXMA 5AMNA 3NW5A 5C4LA 5B2MA 3PUPA 4E8AA 2PMOX 3R9OA 2XUUA 4I0SA 4BDBA 4FKVA 3E88A 4R5SA 4ANOA 1P4FA 4YURA 3U87A 3EQPA 4FBXA 4QTAA 2VWVA 4EJ7A 2DWBA 3KN6A 4FIGA 1E9HA 3C13A 3NUXA 4GU9A 4PTGA 5K4IA 3OG7A 3QTIA 4L9IA 4RA5A 3O23A 3PG1A 3MFRA 4FSYA 4C2WA 5CTPA 1P2AA 1SNXA 3ZO2A 4C58A 4E4MA 4EH3A 2VX1A 3QA8A 4I20A 1PXMA 4CVAA 3PXQA 1PMUA 3TIZA 3UZPA 4C4HA 5C4KA 1LEZA 2HW6A 2GNHA 4L3JA 2PVYA 2F57A 3C4EA 5DOSA 2ITOA 4QRCA 3O17A 3GENA 4IJ9A 4LGGA 1YXVA 4OTWA 5AM6A 4LL0A 5HG9A 2VD5A 4IACA 3W33A 2HELA 3MTFA 3PSBA 4EK5A 5EYKA 5FGKA 2FUMA 4G9CA 3DJ5A 4O22A 4D55A 1SMHA 3F3TA 2ZV8A 3VAPA 2BTSA 2PL0A 3EHAA 3EQBA 1Q5KA 3LCKA 4B99A 4PY1A 5J79A 2X2KA 1ZRZA 2FSOX 4GT3A 4TYJA 4Y85A 3V3VA 3QQFA 3W1FA 4LG4A 3EWHA 3FXXA 4HGSA 3NNUA 3R1QA 5CXHA 3TNIA 4QMOA 5BVFA 4BCJA 5AUTA 3I1AA 5JFSA 5E8TA 5EQPA 3TV4A 4K11A 3GCUA 4FV8A 2XM8A 4RVMA 1CKIA 3RHKA 2C1BA 3ZLXA 5LMBA 3WZDA 2V22A 5HIDA 1S9JA 4JAJA 4ZEGA 3E92A 4L44A 2QLUA 3DGKA 3IQ7A 2WTWA 4FTCA 2BAJA 1MQBA 1UKIA 4KKEA 4MVFA 4FT5A 3OXIA 4ACDA 3AD6A 4D9TA 2F2CB 4DC2A 5LMKA 2BRMA 3DQWA 1Q8TA 3MBLA 4QYGA 4AGUA 5I3RA 5JFWA 5AV2A 3NW7A 4BIEA 2XK9A 2G1TA 2G9XA 4H3QA 5DH3A 3U8WA 4DG2E 4HGTA 4X2NA 3Q4TA 5IQFA 5CU6A 5E1EA 3G90X 2CDZA 2C3LA 3G5DA 3ZSHA 4AZVA 2P2IA 4EUUA 1ZWSA 5AP5A 4F0GA 2W9ZB 3R00A 4IM0A 4CD0A 4FKTA 1ZOHA 3FL4A 4ONAA 5DHJA 3BZ3A 5TT7A 4CFVA 2X6DA 4ZJJA 2VO3A 3F61A 4A4LA 3IDCA 2W1GA 1PRYA 3JUHA 2YIYA 5HX6A 4YTIA 2XK6A 1ZY4A 2ZMDA 3PJCA 3KMUA 4UZHA 2OBJA 3HL7A 1HOWA 2E9VA 2YDKA 2RG5A 2YHVA 5AA9A 3DXNA 4H36A 3ROYA 2FB8A 3UOJA 4NYEA 4LFIA 2WMXA 3DCVA 1GAGA 5CS6A 4D4RA 2UZDA 3DU8A 5D41A 4Z9LA 4QQCA 3DKCA 5LCKA 3IW4A 4EWQA 4HCUA 4EKKA 3Q5IA 4FYNA 4KA3A 3P7BA 3BQRA 1BYGA 4TYEA 4X21A 4GG5A 5BVKA 3V04A 3WZJA 2R3LA 2CN5A 3LMGA 3MVJA 2PVFA 1XO2B 2W1EA 2ZB0A 4D2SA 4CT2A 3OEFX 5EYDA 4IWPA 2UZVA 5C8KA 2UZUE 4IAFA 1XH5A 2EB2A 4EZ5A 4YPSA 3KCKA 4Q9ZA 4O1OA 2J0LA 3IW7A 4ITHA 1UNHA 5E8ZA 2WQOA 4RWKA 2F9GA 4UEUA 5A4TA 4KKGA 2H8HA 2OF2A 3ZMMA 3FMDA 3HA6A 2QOOA 2I0YA 2EU9A 2VRXA 4BGGA 3RKBA 5KNJA 2XB7A 4FV1A 3PLSA 1ZYJA 4PQNA 3Q9YA 1OZ1A 1R39A 4U3YA 2R64A 4M68A 4AN3A 2A4LA 4FEXA 5H8GA 2ITVA 4C7TA 4DEGA 2YM7A 2ITUA 2JDTA 5HTBA 2XNGA 4FT9A 4RIOA 1OKZA 5A4LA 1FBNA 2WQEA 3ZM4A 2QG7A 2PHKA 3HZTA 3R8PA 5DGZA 5J7HA 1WBNA 3NYOA 4FV3A 3UPZA 4ZSJA 3VBVA 3QBNA 2Z02A 3K5UA 3ORPA 5HBHA 2Z2WA 4DTAA 2XK4A 5CQUA 3W2CA 1ZXEA 4QYEA 4UN0C 3W2SA 1QMZA 4OTGA 4GCJA 2EUFB 4F64A 5JQ5A 5LJJA 4TYGA 3QHRA 2YLEA 2GTMA 3QFVA 3RCDA 2A0CX 3D5XA 4LUDA 2VTSA 3Q5ZA 1Q8WA 3I6WA 3FKOA 5F20A 2F7ZE 3R71A 1MRUA 2IW8A 5JGDA 2B1PA 3ACJA 3NW6A 3QD3A 4FTTA 1DAYA 3KMMA 5EG3A 3W10A 1U5QA 5DR9A 3FAAA 3TIYA 3GUBA 4ZTLA 3RMFA 4EQCA 2CLXA 1GOLA 3UVPA 3C5IA 3ZBFA 2WO6A 5F9EA 4O7NA 3FC2A 1FMOE 5D11A 2Q0BA 5IUIA 4DBNA 4D4SA 3LFAA 1K2PA 2OIDA 4XJ0A 3D7TB 4X2GA 5EM6A 2BR1A 3VS6A 2PZPA 4I92A 1WBPA 5AUXA 2C6IA 3W2PA 2ZV7A 4U40A 3IO7A 4X7QA 5CASA 3DNEA 4C37A 5IUGA 2C6OA 4K18A 4QPMA 1DS5A 3TCPA 4IAAA 4HNFA 4I6FA 2HOGA 4BDIA 1VYZA 2XEYA 3FMHA 3VQHA 4CNHA 4WBBB 5EH0A 2WMSA 1R1WA 2HY0A 1U54A 1WBVA 3G15A 4FTAA 3QD0A 2XIZA 1F0QA 4L01A 5JFVA 3PYYA 3PXFA 2XRWA 2BPMA 2A19B 3GCSA 3GU8A 4FTKA 1Q97A 5DE2A 2RKUA 3SQQA 4R7IA 3QTSA 4K1BA 4TZRA 4XG8A 5HE1A 4E4LA 3KKVA 3A7GA 3ODZX 3HMOA 4BWKA 3PPJA 3PZEA 4WO5A 4JIAA 5A3XA 3ZFXA 5CSWA 4O0UA 4FK6A 4IB3A 4O6EA 2W99B 4FR4A 4MXXA 2B7AA 3R2YA 4MXOA 4DINA 4DEEA 2VN9A 1ZAOA 2WTVA 1ZOGA 3ORIA 3R22A 3Q9ZA 1SM2A 1XBAA 3EOCA 3JPVA 5AP0A 2WELA 3R7OA 3ZTXA 3C4FA 4NTSA 3DKFA 4DGOA 5HZNA 2QVSE 2YJSA 5AP2A 3V01A 5CU3A 4HVDA 3KRXA 3ZONA 4F9CA 3ATTA 4EOLA 3OY1A 4L45A 4TL0A 2CNUA 3HV6A 1B6CB 2OJJA 4NTTA 4HOKA 4O0VA 4BBFA 5EHLA 4AE9A 4BCOA 3UNKA 5M07A 3HDMA 5J5TA 5E91A 4P5QA 3KXGA 3DXQA 5AR5A 2ITQA 1HCKA 3CQUA 4KSQA 4RX7A 2PUNA 2YITA 3DB6A 3UZRA 4ZAUA 2RFEA 2R4BA 3RALA 2XNMA 4U45A 4O86A 5HD4A 2QOHA 3T9TA 3U51A 3ZH8A 4ASEA 4GJ2A 4ZY4A 1H27A 3DLSA 3P7AA 2G2FA 3QD4A 3ZDUA 1GZKA 4XS2A 2Y4IB 4TW9A 4DGMA 3I6UA 4IEBA 5BVDA 3R9DA 3ORKA 3KVXA 1DAWA 2OJFE 2UZBA 4LMUA 3U54A 5IISA 4X0MA 5E8XA 4IWOA 3LKMA 5M09A 2J9MA 2QCSA 3BCEA 3KA0A 3QX2A 2R0UA 3VBWA 2OXDA 4FUXA 2HWPA 4JDHA 4KIKA 5GIOE 2WMQA 2C0OA 3D5WA 4EORA 3OD6X 4AA4A 3C0GA 3LHJA 3WARA 4JNWA 4BCGA 3QQLA 4KS8A 4QP8A 2VTTA 5ANGA 2W96B 4H58A 2PE0A 4QMVA 3OT3A 4D58A 1R0EA 3LZBA 3U4WA 2GTNA 4YBKA 3TUBA 3LCDA 3UC4A 4BCMA 4AOJA 2C5NA 4WG5A 4AA0A 5GJDA 4G1WA 1OIRA 3LM0A 2C6EA 3TV7A 3BHUA 1OL5A 3ZZWA 3UOLA 3V8SA 2WMTA 5C9CA 4I93A 3FXZA 4C0TA 5M57A 4EI4A 3V51A 1CKJA 4E4NA 4ZLYA 5AV4A 1XBCA 3BYUA 3QTXA 1W7HA 5DG5A 4BGHA 2DS1A 3OZ6A 3ZU7A 4CGAA 2YEXA 4AW1A 5BYYA 4IVDA 3MYGA 3GC7A 4FICA 3ACKA 2PWLA 2BHEA 1GNGA 1NVRA 3OMVA 5DT3A 3RNIA 4CYIA 3CQWA 4BC6A 4LOQA 5GHVA 2CCIA 1B39A 4KRDA 3EQCA 4GFOA 2UW4A 1KE8A 2ITXA 1NVSA 4HZRA 4II5A 4C36A 1Q3DA 4XRJA 3ZDIA 4F6SA 3LFBA 2YCQA 4MH7A 2VWWA 1TQIA 1OECA 4ZP5A 4I0RA 4RIWB 4E3CA 1IAJA 3TZ8A 5ANKA 5I9YA 4PMTA 3H9OA 3TL8A 4UB7A 3WIGA 4WHZA 5FEQA 3BBWA 4J8MA 3AC1A 5BVNA 5FTGA 1BMKA 1OPJA 4DHFA 4X6RA 4ZK5A 3IS5A 4NEUA 4FSMA 3NUAA 1UKHA 2PTKA 4JDJA 4BDCA 2BMCA 4L52A 3FY2A 4MD8E 3BIZA 4HVSA 3NCGA 4YZ9A 4JJRA 2ZB1A 3RZBA 2OXYA 4EK3A 3FMMA 1AD5A 2NO3A 4RLLA 2QU6A 2FO0A 3RWQA 3T3UA 1FGKA 4D5KA 5HX8A 4AS0A 4C4IA 2W4KA 4ZJIA 4RJ4A 5AV1A 3AC5A 4FNWA 5DWRA 5CF4A 3UYSA 4Z7HA 3IG7A 3E7OA 1Y8GA 4OGRA 4M0YA 1AGWA 2R3MA 4A4XA 4OTQA 3ANQA 3DBDA 3ITZA 3V6SA 4E7WA 4CFNA 2XBJA 3ORMA 2VWZA 1WMKA 4XBRA 3JS2A 5EOLA 4IX5A 4FV4A 3ZXTA 1KUTA 2XF0A 3L9NA 2R3FA 3PY3A 5AUWA 3SOCA 4EONA 4PMPA 4ZTMA 4X2FA 4D1ZA 4FKRA 4RQVA 3TNQB 3U6JA 3SLSA 2C0TA 2X7FA 4RVTA 3VO3A 4DGGA 4CXAA 4EKLA 5HLWA 4CCUA 4NM7A 4C3FA 4YSMA 3ERKA 4O83A 3KRJA 1JKLA 5AR4A 3PXZA 4NT4A 3RPSA 3SG9A 5KX8A 3QKKA 2GCDA 5TO8A 3RNYA 2FGIA 3C9WA 4XG3A 4RJ6A 2BKZA 5CVFA 1GIIA 4BZDA 2WTJA 4K9YA 3SVVA 5L2IA 2W05A 1M17A 2ONLC 4CMTA 3A60A 4W9WA 3KN5A 4IC7A 1DI8A 2UZLA 4IZ7A 2XK3A 4MBLA 3DLZA 3IK3A 3LCTA 4ITJA 4RWLA 2BIKB 4XLVA 3LOKA 4MD7E 4R3CA 5LVLA 5CU0A 2YJRA 3IOPA 4I5HA 5AX9A 5HLPA 1Q4LA 5HVYA 3TDWA 4V05A 4EOMA 4YTCA 2GS7A 3FSFA 3IDPA 5FTOA 5EM5A 3B8QA 2R0IA 3PXRA 3R6XA 1ZYDA 3CTHA 4FSQA 5J8IA 1OI9A 2FYSA 1CKPA 2W06A 3FQSA 3RAWA 2XIRA 2DYLA 2UUEA 4TWOA 4GVAA 2VU3A 4R78A 4EK6A 4DT9A 5IUHA 4JRVA 1O6LA 5IA1A 2W1FA 4MNFA 4BYJA 5I9XA 2OSCA 3HEGA 5J5SA 3UQGA 3KULA 3OP5A 4XV3A 2VWUA 3FI4A 4L00A 2X9EA 2QHMA 2ZM3A 3R7UA 5G1XA 4F9WA 4IVBA 5CALA 5HIBA 3JVRA 3ORLA 3K2LA 3ZC5A 3I60A 5HD7A 4CMOA 4RBLA 5EI6A 3BHVA 4FEWA 1JSTA 2H96A 4ARKA 3ZEWA 3F2AA 4U3ZA 1JSUA 3LLTA 3MB7A 5I9UA 5ACKA 4BYIA 5LQFA 1XKKA 3SAYA 4O7LA 2QHNA 3QGYA 3QRTA 3PVGA 4YNOA 5AUVA 3FWQA 3I7BA 3MSSA 3DJ7A 4OTDA 4RJ5A 4FT7A 3TZ7A 5M4IA 3MFSA 3RTPA 4IB1A 3SC1A 4EQUA 4IXPA 4P5ZA 5DEYA 4EH2A 3LM5A 1Q24A 3CJGA 5BYLA 2XJ0A 2W5HA 5DMZA 4OLIA 2EB3A 3R01A 5I0BA 2XA4A 3LFEA 3PZHA 3FZTA 4TYHB 4F7LA 4EK8A 2RF9A 3VS7A 3OF0A 3RI1A 5AAEA 1GIJA 3D0EA 2B52A 4YHTA 3H4JA 4Z7GA 2QI8A 1F3MC 2HW7A 1OL7A 1R3CA 3NUNA 3QC4A 4Q2AA 4EHGA 1E1VA 4ANSA 1WZYA 4RFMA 2PMNX 4NJ3A 5L2WA 3NEWA 4GS6A 4ACCA 1YWVA 4C4EA 3AD4A 4MX9A 3ZYAA 2HYYA 4D2VA 5J95A 2PUPA 1P4OA 4NIFB 3G6GA 4YC3A 4HVHA 5I9WA 2OH4A 4FSRA 2EVAA 3KEXA 2XM9A 4OBOA 5TF9A 4B0GA 3W8LA 4JR3A 2XK8A 4NM3A 5HU9A 3FL5A 3U9NA 5JKGA 3MH3A 1M52A 3G0FA 3MPMA 3SXSA 4BCQA 1OBDA 2X6EA 3EN4A 2QURA 4JR7A 3R04A 2ETKA 4V0GB 2WIPA 2Z60A 5F94A 1WBOA 4ZLOA 5HQ0A 2GHLA 2XKEA 2PVHA 1MRYA 3EQIA 4WIHA 2YZAA 4F0IA 1JAMA 4W4VA 4ZTHA 5AA8A 4G3EA 4EH4A 3ZUTA 4HYSA 4FG9A 2B53A 3D15A 3QCYA 3BYMA 3R83A 3PA5A 4FMQA 4CZUA 4OTFA 1YRPA 3F3ZA 5FG8A 3DY7A 4PV0A 4RX8A 1BI8A 4CFFA 1H1WA 5KZ0A 5DN3A 3JXWA 4OTPA 5BUEA 2W4OA 2VGPA 3KCFA 3FY0A 4W9XA 5CEKA 1PYXA 4FYOA 2R3OA 4ENXA 5HLNA 2GNIA 3DBCA 4RIXB 3OTUA 3QYWA 5IDPA 2HZIA 3GGFA 2UW9A 3I81A 2PVLA 2BFYA 4BCHA 2R3JA 1JPAA 3AD5A 3M2WA 3MIYA 3FYKX 2Z8CA 5TKDA 3FSKA 1A9UA 2GNJA 3GU4A 3R7GA 4F6UA 4S30A 1VZOA 5AEPA 3EYGA 4JLCA 3T8OA 5EDRA 2R3GA 2VO0A 4BDDA 4DFYA 5KHXA 2PUIA 1OIUA 2GQGA 4HCTA 2UW5A 2HIWA 2O3PA 2WU6A 3TKUA 3D7TA 5EI8A 3Q52A 1I44A 1Q99A 3AC8A 3LQ3A 4K77A 4WD5A 4AGWA 4YJSA 5CANA 4O0WA 4BI2A 3NUUA 4AZTA 2WIHA 3OUKA 5CYIA 4DBXA 4ZZMA 3ORNA 2B0QA 1J1CA 1YXXA 2X81A 1WBSA 5DA3A 5A14A 4BI0A 4AW5A 2XNOA 3LAUA 4CG8A 4APCA 4GYGA 2IO6A 3TACA 3CE3A 4NCTA 3PVUA 3WE8A 2NNWB 2QLQA 3WILA 2PVMA 5IEYA 2OH0E 2VO7A 4WNKA 5AIRA 3JY9A 4ANNA 4D9UA 3V5QA 3H10A 4QP9A 4RT7A 1W8CA 3HAVA 2C0IA 2YCRA 4TWNA 3EZRA 3FLSA 2CGWA 5AR3A 4WSYA 4E20A 4LV8A 3BU5A 1XR1A 4HYUA 2O64A 4N0SA 5CSVA 4EUTA 3MTLA 4PRJA 2YM3A 4FEUA 4CTBA 4D5HA 4IAYA 1VR2A 2QOBA 4FZ6A 3AC4A 5EKNA 5AR8A 1BUHA 2ZAZA 3CEKA 4Y83A 5DI1A 4G16A 4GUEA 3SXRA 1ZYCA 5C8MA 2XMYA 3CS9A 3LJ2A 5ETFA 1QCFA 4RIYA 3QA0A 3TWJA 5LWNA 2OLCA 3A8WA 4QD6A 3OWJA 2QO9A 3HMNA 3OBJA 5I3OA 4FSNA 3ULIA 1PKGA 1OIYA 3UP7A 5JH6A 5GZ8A 2WQMA 3ZLWA 2Y9QA 4ALVA 5TR6A 4IAZA 2PY3A 2I7QA 1OL2A 1VYWA 1KOAA 2WNTA 4EOJA 4XHKB 4KUJA 4XX9A 4BDAA 4ZMEA 2JEDA 4OR5A 2EWAA 2WZJA 5BMMA 5ETIA 1XH4A 2WMBA 1J7LA 4ZTNA 3AT3A 4E6AA 4ORKA 3CCNA 4OTRA 3E3BX 3LFQA 3OY3A 2CGUA 3T3VA 2UVZA 3LFCA 3UOKA 4M97A 3QRJA 3Q2JA 5CI7A 4IZAA 4BN1A 4F7NA 4CMUA 3NYVA 3PSCA 2ITTA 4NL0A 1NXKA 4C62A 4UMQA 2WMRA 3DA6A 3TZMA 1M7QA 3W18A 3MPTA 4ANBA 4NSTA 2Z7QA 3OOGA 1PMVA 4G17A 4FGBA 3BV2A 3P08A 5IQCA 3UIUA 4IX6A 4A07A 2WTKB 4NK9A 4QTCA 2Y4IC 3WF7A 1PXOA 3BBTB 4KWPA 3WF5A 1GJOA 5L2SA 3JVSA 4BCNA 3HAMA 2XIYA 1CSNA 4LOPA 2C6DA 5IPJA 4JVGA 5I9VA 1IA8A 5HICA 4QPAA 4ZJVA 1IA9A 2IPXA 4GKIA 4U42A 2BHHA 4IB0A 1REKA 3DV3A 3UIBA 3OT8A 4PPBA 5H9BA 3HV7A 4FL3A 3LVPA 3SW4A 5L2TA 5LCJA 2BKKA 4N57A 3EQHA 1PXLA 3KXNA 3VN9A 2CGVA 2R7BA 3QTWA 4UZDA 2QOQA 5IG1A 3HMMA 3CD3A 4U43A 4DH7A 5IA3A 4RMZA 4H39A 3FDNA 4FG7A 4U9AA 4YC8A 1LR4A 3PJ1A 5FEDA 4HNIA 2P2HA 5B2KA 2ESMA 2P55A 3L9MA 3EJ1A 3VVHA 1T45A 3QTZA 4MK0A 3L8PA 4QP7A 3DFCB 3TNWA 5M06A 1NVQA 3D4QA 4FV5A 4I6BA 4AZWA 3Q96A 3FLQA 3N51A 3FHIA 3RINA 4NM0A 4L3PA 2OK1A 5HHWA 4NFMA 3OUNB 3R0TA 4FKUA 5HKMA 5BUIA 2HZ0A 2W1ZA 1FQ1B 1Z5MA 2R3IA 4QMZA 3UIXA 3NPCA 3UDBA 4YJRA 2YAKA 3WZKA 5HTIA 4ASXA 2GS2A 5L6WL 3NMUF 2E9NA 4EOIA 1PXPA 3AGMA 3I5NA 4JG7A 3BWFA 3RAIA 3WYYA 2WTIA 3F5GA 4EOKA 2CNQA 4KBAA 1CM8A 5DYJA 2GDOA 3AC2A 3FKLA 3D5VA 5CF5A 4JQEA 4ZS4A 1PKDA 3V8TA 3ETAA 4U7ZA 5FXRA 5E8WA 5JRQA 4FTIA 4IB5A 4ERKA 4FV6A 3KY2A 3CJFA 3PFQA 2X8DA 3EN6A 2QOIA 3PRFA 5ANDA 2B9HA 3QHWA 4O38A 2XK7A 3F9NA 3O50A 4GVJA 2C6MA 3V6RA 1OKYA 4H1JA 3EQGA 5CNNA 3COMA 2WQBA 4C59A 4R6VA 2FH9A 3ZO3A 2VWBA 4E1ZA 1KSWA 5JT2A 3R21A 4XG2A 1PF8A 3RPYA 3VRYA 3ATSA 2XP2A 1XBBA 3LFNA 3KK9A 4HYIA 4O91A 3SRVB 4ALWA 2YDIA 1P14A 5FXSA 5CEQA 4G5PA 4EH8A 4PDSA 4ZTSA 4EH6A 4K0YA 5F4NA 2JKMA 4QP2A 2LAVA 3TKHA 3JR1A 1LP4A 2OJIA 3QWKA 4B7TA 3JY0A 3SD0A 4AFEA 4Y73A 5GNKA 5HIEA 3LXPA 2J5EA 3VUIA 2GFCA 2CSNA 2ITWA 2VTNA 1UWJA 1Q62A 2WQNA 4JT3A 5FDXA 4TTHB 3PE1A 5G6VA 4DFLA 3V5JA 3AQVA 1OGUA 3MA3A 4EH9A 4KABA 3WZUA 4EHVA 4G3FA 4QMQA 1QPCA 3DZQA 3KF7A 5H8EA 3DS6A 3ZO4A 2I0EA 4DEHA 3ODYX 1V0BA 3F5UA 4FOCA 5HNIX 4Q5EA 5KO1A 3SW7A 3MN3A 4FIJA 3Q9XA 3ELJA 2XEZA 5E92A 4IE9A 4P4CA 4XRLA 1OUYA 4DE4A 2AUHA 3TG1A 4PNIA 4YU2A 3RVGA 2WMAA 4AT4A 1H1SA 1LUFA 2FSLX 3GNIB 3SOAA 4FVPA 4LGHA 5EI2A 2YM6A 4E6QA 1RJBA 2J0MB 4PPCA 4RC4A 5JZJA 5IMXA 3BGPA 2UZWE 4B9DA 4CFMA 3QQKA 3QALE 3NDMA 4OT6A 4IH8A 4RWIA 4P7EA 2YISA 2GNGA 2C3KA 1YDSE 2X9FA 3PE2A 3LCSA 4L3LA 3DBFA 5TOZA 4AE6A 3I7CA 3F69A 3NYXA 4U0IA 3OHTA 5HG5A 3LPBA 5HVKA 3ALOA 3WE4A 3VS0A 5JGBA 2Q0NA 1H26A 3UOHA 2BRNA 4IWDA 1YOLA 2JITA 2QODA 3D2KA 5LVNA 3PLAE 1YVJA 2CHLA 2YIWA 1S9IA 4QTEA 3O7LB 3NLBA 3EKNA 4O7VA 2QO2A 4I5PA 3IOKA 3CKXA 1FVTA 2YACA 2QOCA 3LFSA 4J1RA 1L8TA 3CR0A 4C4JA 4HVGA 4R1YA 3GFEA 1JVPP 2PZIA 1ZMVA 2IVTA 2A27A 3QTRA 3R02A 4X3FC 5JGAA 4LUEA 2VTJA 3EFLA 4I5MA 4NKAA 4JX3A 4YHJA 4YHFA 4F08A 3NVKI 3IW5A 2VNWA 4ZTRA 3TTJA 4PP7A 3VUTA 4C3RA 4A9TA 4AACA 1YXUA 3LIJA 4U41A 3PPZA 3HV3A 4JG8A 1XQZA 4FVQA 4JBPA 5A4CA 5AIKA 3PY1A 4FKPA 3ZCLA 2RSVA 4GEOA 4EEVA 4YLKA 3E8DA 3MA6A 3NR9A 4FV0A 4QQ5A 5E90A 2IW9A 4U6RA 3R7YA 4F63A 5IQDA 1DM2A 1Q8UA 4UWYA 4BZNA 4BTFA 2W0JA 2JC6A 3Q60A 3FKNA 4HW7A 4O7ZA 1IAHA 1KE5A 4TYHA 5EK7A 2RFDA 3RPVA 4EZ7A 2X8IA 4ANQA 2VZ6A 1OPLA 3U6HA 4BRXA 2QKWB 3WF9A 2B54A 5LARA 4ALUA 1YHSA 3RHXA 3UQCA 1ZOEA 4FIHA 4L67A 4S2ZA 4FT3A 5F1ZA 2JIIA 2YM4A 4G6NA 4CQEA 1J3HA 2O8YA 2ERZE 2CMWA 4UV0A 3LLAA 4K6ZA 1KE6A 3UZTA 2GPHA 5IZFA 4YZNA 4NIFA 4Y5QA 5CZHA 1BI7A 2OIQA 3A7FA 3OCSA 2XS0A 4WRSA 3UO6A 4W4YA 4MXYA 4MWHA 4DA5A 4Z3VA 4F9YA 2ACXA 3QZFA 4UY9A 4JBQA 4IX3A 4TWPA 4PL5A 3P79A 2R3QA 4W4WA 4K8AA 4QNYA 1R0PA 3QKLA 4G2FA 4IVCA 4PF4A 5HNGA 2BZIB 5T68A 4ANLA 3EB0A 1SVHA 4EZ3A 4DTBA 4RJ3A 3QQGA 4EHZA 4YTFA 3VUMA 4UXQA 4AG8A 4G3GA 2VTIA 1H08A 4CZYB 3MY5A 4V0GA 3Q53A 4D2TA 4CCBA 4GW8A 4DFUA 3W2RA 3NIEA 4L6QA 2W1CA 5IQBA 5A54A 3CPCA 2WHBA 3LFFA 3MI9A 3P4KA 4IANA 3R8ZA 3ZFYA 5EKOA 4IIRA 3U6IA 2UV2A 3UO5A 4R7HA 2IN6A 4E73A 2GNFA 3QUDA 4FC0A 2IWIA 3POOA 4ZSGA 4G9RA 2JDSA 3ZM9A 1MQ4A 1XJDA 5M55A 2W17A 5AUYA 4J98A 3VHEA 4FKQA 3FI3A 5IEXA 1NY3A 1BKXA 4PDYA 3EN7A 3QCSA 4RIXA 4OT5A 4S33A 1JLUE 2BZHB 3PG3A 2YIQA 2VTOA 3W32A 4HVIA 3U9CA 1OKWA 5D9HA 2Y4PA 3GU7A 3I79A 3IGGA 3ANRA 2ERKA 3A8XA 4NM5A 3QYZA 5DEWA 2X0GA 4ACGA 4XBUA 4G34A 4UXLA 5BYZA 5IQHA 1MP8A 1H0WA 2C68A 5HBJA 5EHYA 4JBOA 5AJQA 1OKVA 4TWCA 5H2UA 1LEWA 3RK5A 2PMIA 4M12A 3FZSA 3QF9A 4O0SA 4GUBA 5CLPA 4FZFB 2Y8OA 2P3GX 3NZ0A 4J8NA 3VUKA 2YFXA 4BDGA 2BDJA 3QXPA 3R73A 4PTCA 5HOAA 3WOWA 3S4QA 3EN5A 4X6QC 5DRDA 1JNKA 1XWSA 3I0QA 1UV5A 1FGIA 2YLFA 3BGZA 2NRUA 3EH9A 3QKMA 4AN2A 3P23A 4OTIA 3DXPA 3OOMA 1GY3A 3G0EA 5K3YA 1UWHA 3BV3A 4L42A 1RDQE 3VBTA 5CAVA 3DQXA 3L9PA 3P78A 5EW8A 1JBPE 3L8VA 3L8XA 4TY1A 3S3IA 2V7AA 2AC5A 3ORXA 3I5ZA 1H1RA 2YM5A 4BTMA 4PNKA 4MHAA 4F1OA 4M69B 4YJOA 3U55A 2NPQA 4FTOA 3GBZA 2OJGA 4FTUA 3ZFMA 1V1KA 3KF4A 4IW0A 3LE6A 4YLLA 5ACBC 2YCFA 4BWXA 4DITA 4BI1A 4MCVA 3A4OX 4IAKA 4L53A 4BKZA 4FSTA 4QT1A 3Q4UA 4EJNA 2Z7SA 5EQEA 2RFSA 2UW7A 4FSZA 3UC3A 4M66A 3ZSIA 3OTVA 4R8QA 3R9RA 1SVEA 3CP9A 4IFGA 3AG9A 3NAXA 3KK8A 4IM3A 3DK3A 3D7ZA 3EQDA 3FEGA 4BB4A 4AFJA 3QXOA 4LRMA 5CSXA 3TNHA 4I22A 2F7XE 2E9UA 4CQGA 2F2UA 5GINE 3AOXA 3QQJA 4QYYA 4XCUA 3NVMB 1IEPA 4FTLA 4FSWA 3O71A 4FZ7A 2OO8X 5B2LA 5AAFA 3PJ2A 5GZ9A 3WZEA 4XEYA 5IH5A 5AUZA 3S2PA 3NWWA 4MQ2A 5A9UA 3BQCA 4O2PA 3UP2A 2ITNA 5M51A 4XOYA 4AXAA 5KZIA 3IECA 2I0VA 4UYAA 3QCXA 4IADA 2AYPA 3AGLA 3EL7A 1JOWB 3R9HA 1PXIA 3W8QA 4UMRA 5ETAA 2ONLA 2R3KA 4D28A 1A06A 2QR7A 3EFJA 4W8EA 5FM2A 3C7QA 3F88A 3PIXA 4LI5A 5AV0A 1OBGA 2PSQA 3C4ZA 3E8NA 5A4EA 2O63A 3E5AA 3R7VA 4C3PA 4DH8A 2FA2A 5AADA 2QO7A 1JSVA 3UVRA 4QP3A 5A4QA 4JAIA 4F7JA 1SNUA 5DBXA 3UMWA 2JBOA 3OW4A 2X2LA 2C5XA 4AZSA 2ZMCA 2R3HA 4GG7A 3RM6A 4BTJA 2B9JA 3HV5A 4AWIA 3FQHA 4AN9A 3PVBA 4USFA 3ZZEA 3LQ8A 4O2ZA 4V01A 4OAUC 3Q32A 2QC6A 2GQRA 5HG8A 1J7IA 1PMEA 2WTKC 4CLJA 3DDQA 3EL8A 2BALA 2R3RA 2SRCA 3V8WA 2RG6A 1PXJA 4BHNA 4ZMFA 4X3FB 3AXWA 3QQHA 1UNLA 4J99A 4C8BA 2BZKB 4KKHA 4FOBA 1UU3A 3ULZA 2XVDA 2VWIA 3DPKA 3EZVA 2J0JA 3BYOA 2YM8A 4ZTQA 4EOPA 2PU8A 4WUAA 3S00A 3QLFA 4UMUA 2ZV9A 2XNNA 4JXFA 4B8MA 4DTKA 4GK4A 2KULA 2UVYA 4JDIA 1QPDA 2VO6A 3GFWA 4H1MA 2GS6A 4ZSEA 4RVLA 3VJNA 3PY0A 4Y5HA 3F7WA 4XP2A 1QPEA 2BRHA 3A7JA 5DFPA 5HESA 3PIZA 1DI9A 1WFCA 3DTWA 3QGWA 4IBMA 4TXCA 4U80A 3OBGA 4YJUA 3SA0A 4KAOA 4RSSA 4RZWA 2VTPA 3UTOA 4U81A 3FBVA 2QOLA 5HBEA 4I24A 5ITAA 4OTHA 5FP5A 2R3PA 4KS7A 4J97A 5AFVA 5K0KA 3H0YA 3HMIA 4FL2A 1OVEA 3AMBA 4PX6A 2A1AB 5D12A 5FD2A 4J95A 5FTQA 5GJFA 1NA7A 2J0IA 3MVHA 3TN8A 5DIAA 5IA0A 4MF1A 4F65A 3IW6A 4I5CA 4XV9A 2YCSA 3VS3A 4AQCA 5IQIA 4A9RA 4DH3A 4K33A 1U59A 2PE2A 3K5VA 4WT6A 4O6LA 4ZIMA 3UG1A 3MGYA 2V5QA 4BCPA 4CRLA 1W98A 2UZNA 5E7RA 3TJDA 2WTCA 3F2NA 1H4LA 4MXAA 4AOIA 4EL9A 4FEVA 5EDPA 1CMKE 5CXZA 3NYNA 4ZSLA 3E7VA 4AW2A 4F4PA 5D1JA 2GU8A 2AC3A 3FLWA 4BR3A 3MH0A 3SRVA 4U5JA 2W7XA 4JQ8A 3OW3A 4S34A 4QMYA 4DEAA 3TM0A 2WU7A 2F49A 5GZAA 5CX9A 4XOZA 4A7CA 1UU7A 3II5A 3ZUVA 5EM8A 1FVRA 3NX8A 3U4UA 3DKOA 2EXEA 4JL9A 4R3RA 4EOOA 5CEOA 2PVKA 2C30A 3L8SA 1WVXA 2X1NA 4M67A 4O21A 4XP3A 2XKCA 4GSBA 3ZOSA 1ND4A 3R8UA 3C0HA 2VNYA 2JBPA 4NU1A 5C8NA 3FI2A 3QZGA 2QR8A 4DEBA 4DF3A 1Y57A 4YGAA 4CFWA 5CT0A 3R1SA 2C3JA 3E63A 2VTHA 4AZFA 5BUJA 4CKIA 4YR8A 2QONA 5I4NA 3BPRA 1X8BA 3VS5A 4FSUA 3ZRLA 3E93A 5K5XA 2O2UA 4OUCA 2P4IA 3A62A 2Y6MA 3THBA 3UJGA 4U97A 2NP8A 2F4JA 3R1NA 1XHAA 2VAGA 4LV5A 1Q61A 4FKWA 1U46A 2OF4A 1PHKA 2OW3A 4KBCA 4KSPA 2JGZA 3NCZA 2VTQA 2EXCX 1YWRA 4DT8A 3MS9A 3KXHA 4GT5A 5C03A 3DDPA 4RC3A 3SXFA 5JSMA 3H9RA 4MKCA 4EOSA 3UNJA 4AW0A 4V04A 3T9IA 5KMIA 4LGDA 2XCKA 3FYJX 3IGOA 2WOTA 4FL1A 4G3DA 3BHHA 4AX8A 2DUVA 2WMWA 4F6WA 1M2QA 2F7EE 2OFUA 4QMTA 5AX3A 2WXVA 4G6LA 2G01A 3MV5A 4FTQA 5J1WA 4QQTA 4I23A 3HDNA 2BROA 3MY0A 3OCGA 1J1BA 3DB8A 3GC8A 4H3BA 5CQWA 4BDJA 5IF1A 3ENMA 3P5KA 3FLYA 3UGCA 3CIKA 5M4CA 5CY3A 1G8AA 3HVCA 4O1PA 1ZY5A 5CAUA 3BU3A 3IW8A 2WKMA 4D4VA 3R30A 5AR7A 2HAKA 3G33A 3FZOA 4CKJA 3H30A 3NNXA 4EQMA 3HRCA 4PDPA 1JKSA 3NNVA 2C6KA 4HYHA 2GSFA 5DT4A 3VF8A 1H01A 5BVEA 4KINA 5C1QB 2BCJA 4FNYA 4CEGA 3ZO1A 3COHA 2IZUA 1IG1A 2XRUA 3GI3A 4A9UA 4CKRA 1M2PA 4WG3A 4JG6A 3CC6A 3KU2A 3O8TA 3BKBA 4G31A 4IDTA 4E26A 3CSVA 4HGLA 4XG4A 5JRSA 2J2IB 3F7ZA 3LXLA 3ZRMA 2PMLX 3CPBA 4TKSA 4Y95A 4YBJA 3KC3A 4KNBA 3ENHA 3I0OA 2ITYA 3UPXA 4NW5A 3ZC6A 1WAKA 3QCQA 4F1TA 5J9YA 5LVPA 3FLNC 4CZTA 1G5SA 2WEVA 3UVQA 3ZLYA 5E8SA 4G3CA 4O0TA 4ZY5A 5I9ZA 2GMXA 4GJ3A 3FC1X 5J87A 5E1SA 4BZOA 4ERWA 1RW8A 4RJ8A 2BVAA 2V55A 4LRJA 4ANMA 4F7SA 3UYTA 3POZA 3HV4A 5DR6A 1W82A 1Q41A 3N4UA 4J96A 2W1HA 2VWYA 1UA2A 3OWPA 3P7CA 3LJ0A 4RZVA 1M2RA 3DTCA 1XH9A 4QMMA 4YC6A 3PXYA 3VBYA 1PMNA 2JDRA 3MWUA 4GKHA 4PPAA 4R3PA 4A9YA 3VS2A 3MFUA 5GJGA 3VUHA 3QD2B 2QU5A 1H1QA 4XLIA 3ZS5A 2YWVA 4C4FA 4BCKA 3D5UA 4U44A 3SGCA 2YDJA 3O51A 2VV9A 1APME 2XJ1A 4YZMA 3EQFA 2CNVA 2Z7LA 3DT1A 5LWMA 3LW0A 5CVGA 5E8UA 4HCVA 2YA9A 3PIYA 1YDTE 3D2IA 2B55A 4O7RA 2HENA 2HWOA 2WTDA 4RA4A 5CF6A 3VNTA 5E8VA 1Y91A 3MESA 2V7OA 3D9VA 5M08A 4TYIA 4IX4A 4QP6A 2CPKE 4O0RA 3FQEA 3ZUUA 2PZRA 2BFXA 1GZNA 3KGAA 5L3AA 3P1AA 3F82A 3E8CA 4ENYA 3A7HA 5DR2A 3AMYA 5C26A 3QRUA 4C34A 4BWPA 1FPUA 2XJ2A 4NFNA 4FZDB 4CFUA 3G51A 2PK9A 1CTPE 1TQMA 2XNPA 3PWYA 4IVAA 5KMKA 3PA4A 5BVWA 4WNPA 1YXTA 3FZRA 3HGKA 1YQJA 5AR2A 2RIOA 3F5XA 4C4GA 4YNEA 4I21A 4ACMA 2PZYA 4FNZA 2HY81 4IMYA 4F1MA 1Z9XA 2FVDA 2CJMA 1IASA 2XNEA 2OZAB 4DN5A 2QNJA 3M1SA 3LCOA 4B4LA 4IFCA 3N4VA 4XG7A 4KIOA 4XH6A 5CNOA 4C57A 2FSMX 1KE9A 5L6OA 4G6OA 3A61A 3F5PA 4AP7A 4CV8A 4EYMA 3TKIA 4OAVB 3ZRKA 3OCBA 4BTKA 5HGIA 5K0XA 4F9BA 2HCKA 1OB3A 1QL6A 4FIEA 1KV1A 3CTJA 4IAIA 4BBMA 4M13A 1AQ1A 1FVVA 3Q6WA 4YO4A 2FSTX 3C51A 5LMAA 2RFNA 4IWQA 5A6OA 3O96A 4USEA 2X4ZA 2C1AA 3KXZA 2BRBA 3NSZA 5CU4A 2C3IB 3QRIA 3DJ6A 3W55A 2ZDUA 5FBOA 5IQGA 1NW1A 1H8FA 4GL9A 4RIWA 3W2OA 2JAVA 1YI6A 3KULB 1PYEA 3NRMA 4CSVA 5M56A 3VQUA 4Y46A 2WD1A 2JFLA 4BDHA 2YN8A 3VRZA 3BE9A 1A48A 4MYGA 4MD9E 4PDOA 2C6LA 4QMNA 2VTMA 4W4XA 2XH5A 1H00A 3NUPA 4XNEA 2OJ9A 1PY5A 2BDWA 3KRWA 3BRBA 5DT0A 2HZ4A 4F0FA 4M69A 3NNWA 5IH6A 2JKKA 5J1VA 2OGVA 1OUKA 4ZY6A 5IA2A 5LMKC 3HKOA 4QQJA 5CU2A 3MY1A 2H9VA 5ETCA 5H8BA 1UVRA 4KB8A 3G9LX 5K4JA 1PW2A 3R2BA 4BKJA 4K2RA 3O2MA 4DGLC 2ITZA 2XIKA 3B2TA 4FVRA 1JKTA 1W84A 3TV6A 2BUJA 1H25A 3AT4A 3BYVA 3Q4CA 3QZIA 4PMMA 1RQQA 3QU0A 5AUUA 3LFDA 2XKFA 4O96A 3TUCA 2X2MA 3OVVA 4L7SA 4M7IA 4DAWA 3BI6A 3CBLA 4YJTA 4FKSA 4YZBA 2JIVA 2VGOA 4PMSA 3BE2A 5CEIA 4MWIA 4O7WA 1KV2A 2XYUA 1MRVA 3EFWA 1G3NA 5IU2A 5HI2A 3MPAA 3QC9A 5CF8A 3HYHA 3SKCA 2C5VA 3MJ1A 4GFGA 4YJNA 3SHEA 5FDPA 3K3IA 2V62A 4GU6A 4NJDA 3IPHA 4QMSA 2ETMA 3NUYA 3V5WA 3WBLA 1IR3A 1URWA 2YIXA 2HXQA 3EIDA 3LQ5A 4Q5HA 2R7IA 3OWLA 1GZ8A 2BRGA 1YWNA 4UALA 4BICA 1YI4A 5KBQA 2HK5A 3DAJA 4QMPA 1B38A 2I1MA 4W8DA 1XH7A 4FNXA 2JD5A 1ZARA 4NH1A 5KKRC 3TDVA 3FPQA 4WBOA 4XV2A 4FX3A 3MW1A 4RG0A 4QPSA 2C5OA 2GFSA 2UW8A 3VBXA 3VW6A 1R78A 2J6MA 3AMAA 4J71A 4E6CA 5JFXA 3OROA 3RWPA 4EWHA 2A2AA 1GIHA 1FMKA 5AP3A 5ICPA 4MTAA 4RFZA 3COKA 2CKOA 3PDTA 1ZZ2A 3C5UA 1BL6A 1WCCA 4AOTA 2IZRA 3B2WA 2IG7A 2LGCA 4AA5A 3MVMA 2JAMA 1OPKA 5KMLA 2ZJWA 4PUZA 2ZV2A 1UNGA 3HRFA 2VTAA 2WEIA 4F9AA 4IZYA 4O7TA 4LOOA 4WNMA 1URCA 4AZEA 4CT1A 4JRNA 1OITA 4N6YA 4AT5A 4YTHA 3ZBXA 1XH8A 2OXXA 4A06A 2BDFA 3BWJA 1LPUA 5IA5A 4BL1A 3S95A 4DH5A 2J4ZA 5FP6A 4XP0A 1BLXA 4RLKA 4U8ZA 5ANJA 4EYJA 5EW3A 4M3QA 3UE4A 3GQLA 4RX9A 5JN2A 4ASDA 3DFAA 3QTUA 3LJ1A 1Q8ZA 3UIMA 1SZMA 1ZMWA 4X3FA 2JDOA 2E2BA 2WB8A 1Y6BA 4GIHA 5T6KA 3QX4A 4MBJA 4LMNA 4E5AX 4ZSAA 1J7UA 3OC1A 3RZFA 2W5BA 3CY3A 3R8VA 4E5BA 1QPJA 3L1SA 4MNEB 3VUGA 4EH5A 5M44A 4GT4A 3HP5A 5JK3A 3KL8A 4HPTE 2W4JA 1YOJA 3D83A 4I41A 2C47A 1K3AA 3PXKA 2EXMA 3A99A 4RJ7A 4L68A 2YERA 3EMGA 4J52A 3V5PA 1UU8A 4HPUE 4J53A 2RL5A 3F3VA 3IKAA 4MXCA 3UNZA 5IMEA 3VJOA 3A4PA 2E9OA 4GMYA 3FV8A 1OIQA 4I94A 1JWHA 3NUSA 2IJMA 3QUPA 3VIDA 2ZM4A 3SDJA 3BEAA 4BFMA 5FBNC 3GU5A 3GB2A 4UWCA 2YZLA 3ID6C 3TJCA 4CYJA 4B6LA 4I4EA 1J91A 2HZNA 4LM5A 2I6LA 4LRKA 5FQDC 5T3QA 3MJ2A 4PL3A 1OM1A 4QYFA 2J50A 4M0ZA 3CGOA 1XH6A 4CV9A 4DEDA 2WMUA 3HUBA 4GK2A 3Q6UA 3RGFA 2P0CA 4O7SA 4O27B 4E93A 5A46A 4A4OA 3TEIA 2J7TA 2X8EA 3HP2A 1YDRE 2J5FA 3G9NA 2QKRA 4XYFA 3JYAA 5BVOA 4PWNA 4TNBA 1Z57A 2UW0A 3DAEA 2UW3A 3K54A 4C02A 3CXWA 4EBVA 3HECA 4BDKA 3L9LA 3O0GA 4UWBA 3ZLSA 4ACHA 1FINA 3OXTA 3R8LA 5F95A 3O8PA 4C33A 5DPVA 3OWKA 2JKQA 4GK3A 3RM7A 4RIYB 4MAOA 1YXSA 4Z55A 2WGJA 4C2VA 4N6ZA 5E8YA 3RK7A 5AP4A 3FI8A 4I4FA 4ZXTA 1I09A 3MH2A 3ZEPA 3OFMA 4D0XA 2IVVA 3QAME 2WOUA 4KBKA 3C1XA 2W5AA 4GIIA 2QQ7A 3W16A 3WF8A 2Y7JA 2JKOA 3CGFA 2CCHA 2P33A 3F66A 1IRKA 4MBIA 4KRCA 4NZWB 3OXZA 3Q3BA 5E9EA 2OG8A 4YJVA 3BLQA 4OBQA 3OEZA 3TT0A 4BDFA 2R2PA 2Z7RA 3E8EA 3R63A 2ITPA 3KXXA 4E6DA 5L8LA 1H0VA 4L7FA 3F6XA 2O65A 4TRLA 5KMOA 3QLGA 1T46A 4IHPA 4X2JA 5KHWA 3KFAA 1W83A 5EYCA 3DAKA 4UBAA 1VEBA 4C38A 2VUWA 3A2CA 2OIBA 4PL4A 2NRYA 4QP1A 1M14A 4DYMA 2C4GA 4TPTA 4E5WA 2C6TA 4DFNA 2VX3A 4MQ1A 4ZOGA 3QTQA 5L8JA 2H34A 1STCE 4YSJA 1OL1A 3QQUA 3GEQA 4ZS0A 3TUDA 1V0PA 4JX7A 5AP6A 3MDYA 3R9NA 4H3PA 4FUYA 4AT3A 2X7OA 2B9IA 3GXLA 3FMJA 1SYKA 3QWJA 1BX6A 5JMSA 4QNAA 3FHRA 4QYHA 4YZCA 3OS3A 2OICA 3KRRA 2PZ5A 4S31A 5AM7A 5HE0A 3ORTA 3ZXZA 3P0MA 4F70A 3VHKA 3PP0A 1VJYA 2JDVA 4WUNA 4AF3A 2W9FB 2CLQA 1REJA 3FZPA 3CQEA 3R8MA 3DOGA 3RCJA 4BKYA 2PE1A 4JQ7A 3BYSA 3E64A 3GVUA 4WSQA 3DK7A 1V0OA 4R1VA 5CZIA 2R9SA 4I0TA 3UMXA 5CSPA 2UZTA 4EH7A
chains in the Genus database with same CATH superfamily
4WKQA 4FIIA 3ZHPC 4PTEA 3CD8A 2PVRA 3EQRA 3QL8A 5DVRA 3E3PA 4A9SA 5KMNA 1E1XA 1U5RA 2CGXA 2R3NA 4XG6A 3GCVA 3P9JA 3Q2MA 4Q9SA 3P86A 4R5YA 3TZ9A 3VF9A 2OKRA 3LXNA 4FIFA 5DRBA 1H1PA 5HCYA 4X2KA 4YUQA 4DCEA 1RE8A 4GYIA 1YI3A 4DH1A 4FKIA 4USDA 1YW2A 4FV9A 4FV7A 5HO7A 3QRKA 3M11A 4AU8A 3PVWA 2UZEA 2OI4X 2W1IA 3B8RA 4WOVA 2OWBA 2IZSA 3F3UA 4DLJA 4YMJA 2GQSA 2PULA 4AUAA 3K3JA 3TI1A 4FZAB 2JLDA 4FA2A 1ZLTA 3QZHA 2YIRA 3EKKA 4M14A 5BNJA 4YPDA 5HVJA 3E62A 3BHTA 4DG3E 4EBWA 4RX5A 4Y72A 3BX5A 4DCAA 3R28A 2E9PA 4FODA 5HORA 4UYNA 3RK9A 3FJQE 5LXMA 1WBTA 5C27A 4YJQA 4N4SA 3GCPA 2QG5A 1H07A 5KKRB 1YOMA 4JIKA 2I0HA 3BEGA 4M84A 3NS9A 4FT0A 4XV1A 5CENA 4Z16A 4O82A 2XBAA 3NAYA 2GHGA 2WPAA 3O7LD 5IEVA 1CDKA 3SX9A 4D2RA 4F99A 5KBRA 2PPQA 3PUFC 4FKGA 4L43A 1TQPA 4BBEA 3GC9A 2PUUA 5IDNA 5IH4A 3CLYA 4RRVA 3H9FA 2BTRA 4FV2A 4D1XA 4H05A 3R7EA 5EQYA 3FPMA 4BHZA 5C01A 1ERKA 4JI9A 5BMSA 3VWAA 1BL7A 4P90A 5AAGA 3F3WA 2B9FA 5L6PA 1KE7A 3FMKA 3ALNA 1SVGA 5CWZA 3RBWA 4BIBA 4D2WA 3A7IA 4GRBA 5HEZA 3D14A 5E4HA 3RAHA 5HE2A 4BF2A 2Q83A 3GOPA 3C0IA 4QMWA 4RC2A 4FE2A 3W0SA 4XG9A 2XALA 2ETRA 3IDBA 4FI1A 3KB7A 3UG2A 2R5TA 3BELA 5BPYA 5HO8A 2KTYA 5J7BA 3Q04A 3WI6A 2G2HA 3N9XA 1Q3WA 2GHMA 3R1YA 4GV1A 2V0DA 3N4TA 4OBPA 2PVJA 3PJ8A 3E87A 3GU6A 5J9ZA 2C5YA 3BGQA 2G15A 4CG9A 4I1ZA 4MXZA 1L3RE 1NT2A 4BY9E 1PXNA 2OZAA 3WIKA 1YKRA 4QTBA 3DZOA 3H0ZA 5CAQA 3RAKA 5IQEA 3KVWA 3GCQA 3COIA 2B4SB 4FKOA 4D4YA 5LVOA 3LMIA 2BILB 5EHOA 4ZLZA 2XIXA 5HCZA 2XAOA 2BZJA 5M4FA 4ZZOA 4KIQA 4M15A 5I5ZA 2XKDA 4RFYA 5J9LA 5HO6A 3TNPC 3UODA 3FMNA 5L4QA 2UZOA 4QMUA 3TTIA 3MB6A 4F09A 3BLRA 3I4BA 4TN6A 4AQKA 2CKEA 3G2FA 3Q9WA 4NUSA 2VTLA 4QMLA 2VX0A 3BU6A 3LXKA 4HZSA 4C35A 4R77A 5CSHA 1G8SA 4B8LA 3SV0A 4FK3A 1O9UA 4IZ5A 5AV3A 4YO6A 4YJPA 1WVYA 1ZYSA 4DGNA 3PP1A 3Q4ZA 4QOXA 4KIPA 4RQKA 5KCVA 5BX0A 4RVKA 2XZSA 5HNBA 4QMXA 2OZOA 4I6QA 1GZOA 1O6YA 5B7VA 1F5QA 5M53A 5K5NA 5BV3A 4D2PA 5IA4A 1TVOA 1H28A 3D94A 4YZDA 4DLIA 5M4UA 5IKWA 3ROCA 2CN8A 2ZOQA 4Y8DA 4ASZA 5D7VA 4FEQA 3DBQA 1JKKA 2WFYA 2QD9A 4JBVA 2OFVA 4JDKA 4JS8A 1U54B 3C50A 4FTRA 4HGEA 4JOAA 5EDQA 3C4CA 4C61A 4M8TA 3GC0A 5EW9A 1JQHA 2DQ7X 1K9AA 2H6DA 4L8MA 4FKJA 4TNDA 5KE0A 3REPA 4AGDA 5HTCA 5D10A 4R7BA 3RJCA 4EK4A 4DHIB 3VULA 1KWPA 4IQ6A 3GOKA 3FUPA 4XMOA 2XNBA 4LQMA 1EH4A 2X4FA 4FTNA 5TE0A 4XUFA 3PJ3A 3H3CA 4E4XA 4FKLA 4P2KA 5H3QA 5CEMA 2W1DA 4DFBA 4IM2A 2VWXA 5FM3A 4ITIA 4O84A 5A6NA 1P5EA 5LVMA 3IONA 2CKQA 2GNLA 2I40A 3MVLA 4L46A 3RPOA 3HUCA 5CVHA 5IQAA 4BVUA 2QOKA 2XYNA 4NW6A 5HCXA 4TT7A 3GQIA 4CLIA 2Y0AA 3ORZA 1YHVA 4O0YA 4RPVA 2IZTA 1Y8YA 4FTJA 3KRLA 2YWPA 4CTCA 5JEBA 1Y6AA 3CY2A 4QDVA 5CAPA 3O8UA 3CKWA 3MIAA 2JFMA 3PWDA 2IVUA 3VC4A 1Q8YA 3EFKA 2PVNA 4I6HA 3UO4A 3W2QA 4CFXA 2J51A 3FLZA 2UW6A 5ANEA 3EYHA 3KQ7A 3V5LA 2YAAA 1O6KA 4FTMA 4S32A 2Y6OA 3HA8A 4UMTA 5DLSA 4EOQA 2ZVAA 2RGPA 3PPKA 3CTQA 1OL6A 4N70A 3UQFA 3TYKA 3VUDA 4EC9A 5AP7A 4WA9A 4GH2A 4WRGA 5BQ0A 2ZDTA 5KUPA 4O81A 4ZZNA 1KOBA 4DEIA 4LYNA 4AXFA 4BGQA 4GFMA 1PXKA 3M42A 4CRSA 2HXLA 2O5KA 5CT7A 3GP0A 1ZZLA 2IW6A 4RGJA 1WBWA 2C69A 2JIUA 4RWJA 3R7IA 3S1HA 3HMPA 5B0XA 4FF8A 5FUTA 3PTGA 4X3JA 5D7AA 3FZ1A 5K9IA 2VTRA 3C4XA 3DK6A 3WF6A 3UDTA 2ZM1A 4KIKB 5HU3A 4IJPA 3BHYA 2PYWA 4UMPA 2XAMA 4WG4A 2J0KA 2BIYA 5HE3A 4AGCA 3FXWA 4D0WA 4LL5A 3DBEA 3G6HA 4DG0E 4NKSA 3V5TA 3FE3A 3F2RA 5L8KA 5CAOA 5KMMA 3UBDA 3KMWA 5FWKK 1HCLA 5HG7A 3SG8A 3ZSGA 4G5JA 2IEWA 1YHWA 4MNEA 5EFQA 5FXQA 3TXOA 4DFZE 4UX9A 4EHEA 3LMHA 4FGRA 1PJKA 2CKPA 4FG8A 4QO9A 2XANA 1ZMUA 3MFTA 2WAJA 4QTDA 3QUEA 4HJOA 4BCFA 4BCIA 3VBQA 3WYXA 3RPRA 3ET7A 4OW8A 2BAQA 3BLHA 3VS4A 2G2IA 2X39A 3GT8A 1ZYLA 3C4WA 1M7NA 3HRBA 4U79A 3AC3A 5JQ8A 5FRIA 1H24A 2J90A 1TKIA 2X7GA 3KREA 2XCHA 5AP1A 4MF0A 2WMVA 5DNRA 3PA3A 2IVSA 3PSDA 5CI6A 4YLJA 5EOBA 3HLLA 4O0XA 4DFXE 4BDEA 3NGAA 2REIA 4QP4A 1U4DA 3DKGA 1WVWA 4APPA 3PRIA 2BAKA 4NCTC 3FMEA 1W0XC 5LOHA 5JZNA 1FOTA 4WNOA 5FEEA 4MEDA 5AWMA 4BIDA 5CEPA 2O0UA 4O7YA 3S0OA 4D1SA 3AT2A 5EYMA 4PP9A 3HNGA 1OMWA 2ZYBA 3DNDA 3MH1A 4J7BA 2OU7A 4IDVA 5L2QA 2QOFA 4AAAA 4NWMA 4I3ZA 3HX4A 1UU9A 5FLFA 4YP8A 4EC8A 3NIZA 2UVXA 4IC8A 3VW8A 3VS1A 5ANOA 1ATPE 5KMJA 4ID7A 3FMLA 2YABA 3EN9A 3OCTA 4KD1A 3RP9A 5ANIA 5EM7A 1MUOA 3KXMA 5AMNA 3NW5A 5C4LA 5B2MA 3PUPA 4E8AA 2PMOX 2A98A 3R9OA 2XUUA 4I0SA 4BDBA 4FKVA 2IF8A 3E88A 4R5SA 4ANOA 1P4FA 4YURA 3U87A 3EQPA 4FBXA 4QTAA 2VWVA 4EJ7A 2DWBA 3KN6A 4FIGA 1E9HA 3C13A 3NUXA 4GU9A 4PTGA 5K4IA 3OG7A 3QTIA 4L9IA 4RA5A 3O23A 3PG1A 3MFRA 4FSYA 4C2WA 5CTPA 1P2AA 1SNXA 3ZO2A 4C58A 4E4MA 4EH3A 2VX1A 3QA8A 4I20A 1PXMA 4CVAA 3PXQA 1PMUA 3TIZA 3UZPA 4C4HA 5C4KA 1LEZA 2HW6A 2GNHA 4L3JA 2PVYA 2F57A 3C4EA 5DOSA 2ITOA 4QRCA 3O17A 3GENA 4IJ9A 4LGGA 1YXVA 4OTWA 5AM6A 4LL0A 5HG9A 4LDTA 2VD5A 4IACA 3W33A 2HELA 3MTFA 3PSBA 4EK5A 5EYKA 5FGKA 2FUMA 4G9CA 3DJ5A 4O22A 4D55A 1SMHA 3F3TA 2ZV8A 3VAPA 2BTSA 2PL0A 3EHAA 3EQBA 1Q5KA 3LCKA 4B99A 4PY1A 5J79A 2X2KA 1ZRZA 2FSOX 4GT3A 4TYJA 4Y85A 3V3VA 3QQFA 3W1FA 4LG4A 3EWHA 3FXXA 4HGSA 3NNUA 3R1QA 5CXHA 3TNIA 4QMOA 5BVFA 4BCJA 5AUTA 3I1AA 5JFSA 5E8TA 5EQPA 3TV4A 4K11A 3GCUA 4FV8A 2XM8A 4RVMA 1CKIA 3RHKA 2C1BA 3ZLXA 5LMBA 3WZDA 2V22A 5HIDA 1S9JA 4JAJA 4ZEGA 3E92A 4L44A 2QLUA 3DGKA 3IQ7A 2WTWA 4FTCA 2BAJA 1MQBA 1UKIA 4KKEA 4MVFA 4FT5A 3OXIA 4ACDA 3AD6A 4D9TA 2F2CB 4DC2A 5LMKA 2BRMA 3DQWA 1Q8TA 3MBLA 4QYGA 4AGUA 5I3RA 5JFWA 5AV2A 3NW7A 4BIEA 2XK9A 2G1TA 2G9XA 4H3QA 5DH3A 3U8WA 4DG2E 4BJJB 4HGTA 4X2NA 3Q4TA 5IQFA 5CU6A 5E1EA 3G90X 2CDZA 2C3LA 3G5DA 3ZSHA 4AZVA 2P2IA 4EUUA 1ZWSA 5AP5A 4F0GA 4AXCA 2W9ZB 3R00A 4IM0A 4CD0A 4FKTA 1ZOHA 3FL4A 4ONAA 5DHJA 3BZ3A 5TT7A 4CFVA 2X6DA 4ZJJA 2VO3A 3F61A 4A4LA 3IDCA 2W1GA 1PRYA 3JUHA 2YIYA 5HX6A 4YTIA 2XK6A 1ZY4A 2ZMDA 3PJCA 3KMUA 4UZHA 2OBJA 3HL7A 1HOWA 2E9VA 2YDKA 2RG5A 2YHVA 5AA9A 3DXNA 4H36A 3ROYA 2FB8A 3UOJA 4NYEA 4LFIA 2WMXA 3DCVA 1GAGA 5CS6A 4D4RA 2UZDA 3DU8A 5D41A 4Z9LA 4QQCA 3DKCA 5LCKA 3IW4A 4EWQA 4HCUA 4EKKA 3Q5IA 4FYNA 4KA3A 3P7BA 3BQRA 1BYGA 4TYEA 4X21A 4GG5A 5BVKA 3V04A 3WZJA 2R3LA 2CN5A 3LMGA 3MVJA 2PVFA 1XO2B 2W1EA 2ZB0A 4D2SA 4CT2A 3OEFX 5EYDA 4IWPA 2UZVA 5C8KA 2UZUE 4IAFA 1XH5A 2EB2A 4EZ5A 4YPSA 3KCKA 4Q9ZA 4O1OA 2J0LA 3IW7A 4ITHA 1UNHA 5E8ZA 2WQOA 4RWKA 2F9GA 4UEUA 5A4TA 4KKGA 2H8HA 2OF2A 3ZMMA 3FMDA 3HA6A 2QOOA 2I0YA 2EU9A 2VRXA 4BGGA 3RKBA 5KNJA 4AXDA 2XB7A 4FV1A 4O4FA 3PLSA 1ZYJA 4PQNA 3Q9YA 1OZ1A 1R39A 4U3YA 2R64A 4M68A 4AN3A 2A4LA 4FEXA 5H8GA 2ITVA 4C7TA 4DEGA 2YM7A 2ITUA 2JDTA 5HTBA 2XNGA 4FT9A 4RIOA 1OKZA 5A4LA 1FBNA 2WQEA 3ZM4A 2QG7A 2PHKA 3HZTA 3R8PA 5DGZA 5J7HA 1WBNA 3NYOA 4FV3A 3UPZA 4ZSJA 3VBVA 3QBNA 2Z02A 3K5UA 3ORPA 5HBHA 2Z2WA 4DTAA 2XK4A 5CQUA 3W2CA 1ZXEA 4QYEA 4UN0C 3W2SA 1QMZA 4OTGA 4GCJA 2EUFB 4F64A 5JQ5A 5LJJA 4TYGA 3QHRA 2YLEA 2GTMA 3QFVA 3RCDA 2A0CX 3D5XA 4LUDA 2VTSA 3Q5ZA 1Q8WA 3I6WA 3FKOA 5F20A 2F7ZE 3R71A 1MRUA 2IW8A 5JGDA 2B1PA 3ACJA 3NW6A 3QD3A 4FTTA 1DAYA 3KMMA 5EG3A 3W10A 1U5QA 5DR9A 3FAAA 3TIYA 3GUBA 4ZTLA 3RMFA 4EQCA 2CLXA 1GOLA 3UVPA 3C5IA 3ZBFA 2WO6A 5F9EA 3BL9A 4O7NA 3FC2A 1FMOE 5D11A 2Q0BA 5IUIA 4DBNA 4I6LA 4D4SA 3LFAA 1K2PA 2OIDA 4XJ0A 3D7TB 4X2GA 5EM6A 2BR1A 3VS6A 2PZPA 4I92A 1WBPA 5AUXA 2C6IA 3W2PA 2ZV7A 4U40A 3IO7A 4X7QA 5CASA 3DNEA 4C37A 5IUGA 2C6OA 4K18A 4QPMA 1DS5A 3TCPA 4IAAA 4HNFA 4I6FA 2HOGA 4BDIA 1VYZA 2XEYA 3FMHA 3VQHA 4CNHA 4WBBB 5EH0A 2WMSA 1R1WA 2HY0A 1U54A 1WBVA 3G15A 3NFGB 4FTAA 3QD0A 2XIZA 1F0QA 4L01A 5JFVA 3PYYA 3PXFA 2XRWA 2BPMA 2A19B 3GCSA 3GU8A 4FTKA 1Q97A 3AKJA 5DE2A 2RKUA 3SQQA 4R7IA 3QTSA 4K1BA 4TZRA 4XG8A 5HE1A 4E4LA 3KKVA 3A7GA 3ODZX 3HMOA 4BWKA 3PPJA 3PZEA 4WO5A 4JIAA 5A3XA 3ZFXA 5CSWA 4O0UA 4FK6A 4IB3A 4O6EA 1VLRA 2W99B 4FR4A 4MXXA 2B7AA 3R2YA 4MXOA 4DINA 4DEEA 2VN9A 1ZAOA 2WTVA 1ZOGA 3ORIA 3R22A 3Q9ZA 1SM2A 1XBAA 3EOCA 3JPVA 5AP0A 2WELA 3R7OA 3ZTXA 3C4FA 4NTSA 3DKFA 4DGOA 5HZNA 2QVSE 2YJSA 5AP2A 3V01A 5CU3A 4HVDA 3KRXA 3ZONA 4F9CA 3ATTA 4EOLA 3OY1A 4L45A 4TL0A 2CNUA 3HV6A 1B6CB 2OJJA 4NTTA 4HOKA 4O0VA 4BBFA 5EHLA 4AE9A 4BCOA 3UNKA 4QDEA 3HDMA 5J5TA 5M07A 5E91A 4P5QA 3KXGA 3DXQA 5AR5A 3VONA 2ITQA 1HCKA 3CQUA 4KSQA 4RX7A 2PUNA 2YITA 3DB6A 3UZRA 4ZAUA 2RFEA 2R4BA 3RALA 2XNMA 4U45A 4O86A 5HD4A 2QOHA 3T9TA 3U51A 3ZH8A 4ASEA 4GJ2A 4ZY4A 1H27A 3DLSA 3P7AA 2G2FA 3QD4A 3ZDUA 1GZKA 4XS2A 2Y4IB 4TW9A 4DGMA 3I6UA 4IEBA 5BVDA 3R9DA 3ORKA 3KVXA 1DAWA 2OJFE 2UZBA 4LMUA 3U54A 5IISA 4X0MA 5E8XA 4IWOA 3LKMA 5M09A 2J9MA 2QCSA 3BCEA 3KA0A 3QX2A 2R0UA 3VBWA 2OXDA 4FUXA 2HWPA 4JDHA 4KIKA 5GIOE 2WMQA 2C0OA 3D5WA 4EORA 3OD6X 4AA4A 3C0GA 3LHJA 3WARA 4JNWA 4BCGA 3QQLA 3AKKA 4KS8A 4QP8A 2VTTA 5ANGA 2W96B 4H58A 2PE0A 4QMVA 3OT3A 4D58A 1R0EA 3LZBA 3U4WA 2GTNA 4YBKA 3TUBA 3LCDA 3UC4A 4BCMA 4AOJA 2C5NA 4LV7A 4WG5A 4AA0A 5GJDA 4G1WA 1OIRA 3LM0A 2C6EA 3TV7A 3BHUA 1OL5A 3ZZWA 3UOLA 3V8SA 2WMTA 5C9CA 4I93A 3FXZA 4C0TA 5M57A 4EI4A 3V51A 1CKJA 4E4NA 4ZLYA 5AV4A 1XBCA 3BYUA 3QTXA 1W7HA 5DG5A 4BGHA 2DS1A 3OZ6A 3ZU7A 4CGAA 2YEXA 4AW1A 5BYYA 4IVDA 3MYGA 3GC7A 4FICA 3ACKA 2PWLA 2BHEA 1GNGA 1NVRA 3OMVA 5DT3A 3RNIA 4CYIA 3CQWA 4BC6A 4LOQA 5GHVA 2CCIA 1B39A 4KRDA 3EQCA 4GFOA 2UW4A 1KE8A 2ITXA 1NVSA 4HZRA 4II5A 4C36A 1Q3DA 4XRJA 3ZDIA 4F6SA 3LFBA 2YCQA 4MH7A 2VWWA 1TQIA 1OECA 4ZP5A 4I0RA 4RIWB 4E3CA 1IAJA 3TZ8A 5ANKA 5I9YA 4PMTA 3H9OA 3TL8A 4UB7A 3WIGA 4WHZA 5FEQA 3BBWA 4J8MA 3AC1A 5BVNA 5FTGA 1BMKA 1OPJA 4DHFA 4X6RA 4ZK5A 3IS5A 4NEUA 4FSMA 3NUAA 1UKHA 2PTKA 4JDJA 4BDCA 2BMCA 4L52A 3FY2A 4MD8E 3BIZA 4HVSA 3NCGA 4YZ9A 4JJRA 2ZB1A 3RZBA 2OXYA 4EK3A 3FMMA 1AD5A 2NO3A 4RLLA 2QU6A 2FO0A 3RWQA 3T3UA 1FGKA 4D5KA 5HX8A 4AS0A 4C4IA 2W4KA 4ZJIA 4RJ4A 5AV1A 3AC5A 4FNWA 5DWRA 5CF4A 2X0OA 3UYSA 4Z7HA 3IG7A 3E7OA 1Y8GA 4OGRA 4M0YA 1AGWA 2R3MA 4A4XA 4OTQA 3ANQA 3DBDA 3ITZA 3V6SA 4E7WA 4CFNA 2XBJA 3ORMA 2VWZA 1WMKA 4XBRA 3JS2A 5EOLA 4IX5A 4FV4A 3ZXTA 1KUTA 2XF0A 3L9NA 2R3FA 3PY3A 5AUWA 3SOCA 4EONA 4PMPA 4ZTMA 4X2FA 4D1ZA 4FKRA 4RQVA 3TNQB 3U6JA 3SLSA 2C0TA 2X7FA 4RVTA 3VO3A 4DGGA 4CXAA 4EKLA 5HLWA 4CCUA 4NM7A 4C3FA 4YSMA 3ERKA 4O83A 3KRJA 1JKLA 5AR4A 3PXZA 4NT4A 3RPSA 3SG9A 5KX8A 3QKKA 2GCDA 5TO8A 3RNYA 2FGIA 3C9WA 4XG3A 4RJ6A 2BKZA 5CVFA 3PFYA 4MUQA 1GIIA 4BZDA 2WTJA 4K9YA 3SVVA 5L2IA 2W05A 1M17A 2ONLC 4CMTA 3A60A 4W9WA 3KN5A 4IC7A 1DI8A 2UZLA 4IZ7A 2XK3A 4MBLA 3DLZA 3IK3A 3LCTA 4ITJA 4RWLA 2BIKB 4XLVA 3LOKA 4MD7E 4R3CA 5LVLA 5CU0A 2YJRA 3IOPA 4I5HA 5AX9A 5HLPA 1Q4LA 5HVYA 3TDWA 4V05A 4EOMA 4YTCA 2GS7A 3FSFA 3IDPA 5FTOA 5EM5A 1G8KA 3B8QA 2R0IA 3PXRA 3R6XA 1ZYDA 3CTHA 4FSQA 5J8IA 1OI9A 2FYSA 1CKPA 2W06A 3FQSA 3RAWA 2XIRA 2DYLA 2UUEA 4TWOA 4GVAA 2VU3A 4R78A 4EK6A 4DT9A 5IUHA 4JRVA 1O6LA 5IA1A 2W1FA 4MNFA 4BYJA 5I9XA 2OSCA 3HEGA 5J5SA 3UQGA 3KULA 3OP5A 4XV3A 2VWUA 3FI4A 4L00A 2X9EA 2QHMA 2ZM3A 3R7UA 5G1XA 4F9WA 4IVBA 5CALA 5HIBA 3JVRA 3ORLA 3K2LA 4BJJA 3ZC5A 3I60A 5HD7A 4CMOA 4RBLA 5EI6A 3BHVA 4FEWA 1JSTA 2H96A 4ARKA 3ZEWA 3F2AA 4U3ZA 1JSUA 3LLTA 3MB7A 5I9UA 5ACKA 4BYIA 5LQFA 1XKKA 3SAYA 4O7LA 2QHNA 3QGYA 3QRTA 3PVGA 4YNOA 5AUVA 3FWQA 3I7BA 3MSSA 3DJ7A 4OTDA 4RJ5A 4FT7A 3TZ7A 5M4IA 3MFSA 4O4EA 4IB1A 3RTPA 3SC1A 4EQUA 4IXPA 4P5ZA 5DEYA 4EH2A 3LM5A 1Q24A 3CJGA 5BYLA 2XJ0A 2W5HA 5DMZA 4OLIA 2EB3A 3R01A 5I0BA 2XA4A 3LFEA 3PZHA 3FZTA 4TYHB 4F7LA 4EK8A 2RF9A 3VS7A 3OF0A 3RI1A 5AAEA 1GIJA 3D0EA 2B52A 4YHTA 3H4JA 4Z7GA 2QI8A 1F3MC 2HW7A 1OL7A 1R3CA 3NUNA 3QC4A 4Q2AA 4EHGA 1E1VA 4ANSA 1WZYA 4RFMA 2PMNX 4NJ3A 5L2WA 3NEWA 4GS6A 4ACCA 1YWVA 4C4EA 3AD4A 4MX9A 3ZYAA 2HYYA 4D2VA 5J95A 2PUPA 1P4OA 4NIFB 3G6GA 4YC3A 4HVHA 5I9WA 2OH4A 4FSRA 2EVAA 3KEXA 2XM9A 4OBOA 5TF9A 4B0GA 3W8LA 4JR3A 2XK8A 4NM3A 5HU9A 3FL5A 3U9NA 5JKGA 3MH3A 1M52A 3G0FA 3MPMA 3SXSA 4BCQA 1OBDA 2X6EA 3EN4A 3W0OA 2QURA 4JR7A 3R04A 2ETKA 4V0GB 2WIPA 2Z60A 5F94A 1WBOA 4ZLOA 5HQ0A 2GHLA 2XKEA 2PVHA 1MRYA 3EQIA 4WIHA 2YZAA 4F0IA 1JAMA 4W4VA 4ZTHA 5AA8A 4G3EA 4EH4A 3ZUTA 4HYSA 4FG9A 2B53A 3D15A 3QCYA 3BYMA 3R83A 3PA5A 4FMQA 4CZUA 4OTFA 1YRPA 3F3ZA 5FG8A 3DY7A 4PV0A 4RX8A 1BI8A 4CFFA 1H1WA 5KZ0A 5DN3A 3W0NA 3JXWA 4OTPA 5BUEA 2W4OA 2VGPA 3KCFA 3FY0A 4W9XA 5CEKA 1PYXA 4FYOA 2R3OA 4ENXA 5HLNA 2GNIA 3DBCA 4RIXB 3OTUA 3QYWA 5IDPA 2HZIA 3GGFA 2UW9A 3I81A 2PVLA 2BFYA 4BCHA 2R3JA 1JPAA 3AD5A 3M2WA 3MIYA 3FYKX 2Z8CA 5TKDA 3FSKA 1A9UA 2GNJA 3GU4A 3R7GA 4F6UA 4S30A 4DHZA 1VZOA 5AEPA 3EYGA 4JLCA 3T8OA 5EDRA 2R3GA 2VO0A 4BDDA 4DFYA 5KHXA 2PUIA 1OIUA 2GQGA 4HCTA 2UW5A 2HIWA 2O3PA 2WU6A 3TKUA 3D7TA 5EI8A 3Q52A 1I44A 1Q99A 3AC8A 3LQ3A 4K77A 4WD5A 4AGWA 4YJSA 5CANA 4O0WA 4BI2A 3NUUA 4AZTA 2WIHA 3OUKA 5CYIA 4DBXA 4ZZMA 3ORNA 2B0QA 1J1CA 1YXXA 2X81A 1WBSA 5DA3A 5A14A 4BI0A 4AW5A 2XNOA 3LAUA 4FJVA 4CG8A 4APCA 4GYGA 2IO6A 3TACA 3CE3A 4NCTA 3PVUA 3WE8A 2NNWB 2QLQA 3WILA 2PVMA 5IEYA 2OH0E 2VO7A 4WNKA 5AIRA 3JY9A 4ANNA 4D9UA 3V5QA 3H10A 4QP9A 4O4DA 4RT7A 1W8CA 3HAVA 2C0IA 2YCRA 4TWNA 3EZRA 3FLSA 2CGWA 5AR3A 4WSYA 4E20A 4LV8A 3BU5A 1XR1A 4HYUA 2O64A 4N0SA 5CSVA 4EUTA 3MTLA 4PRJA 2YM3A 4FEUA 4CTBA 4D5HA 4IAYA 1VR2A 2QOBA 4FZ6A 3AC4A 5EKNA 5AR8A 1BUHA 2ZAZA 3CEKA 4Y83A 5DI1A 4G16A 4GUEA 3SXRA 1ZYCA 5C8MA 2XMYA 3CS9A 3LJ2A 5ETFA 1QCFA 4RIYA 3QA0A 3TWJA 5LWNA 2OLCA 3A8WA 4QD6A 3OWJA 2QO9A 3HMNA 3OBJA 5I3OA 4FSNA 3ULIA 1PKGA 1OIYA 3UP7A 5JH6A 5GZ8A 2WQMA 3ZLWA 2Y9QA 4ALVA 5TR6A 4IAZA 2PY3A 2I7QA 3BL7A 1OL2A 1VYWA 1KOAA 2WNTA 4EOJA 4XHKB 4KUJA 4XX9A 4BDAA 4ZMEA 2JEDA 4OR5A 2EWAA 2WZJA 5BMMA 5ETIA 1XH4A 2WMBA 1J7LA 4ZTNA 3AT3A 4E6AA 4ORKA 3CCNA 4OTRA 3E3BX 3LFQA 3OY3A 2CGUA 3T3VA 2UVZA 3LFCA 3UOKA 4M97A 3QRJA 3Q2JA 5CI7A 4IZAA 4BN1A 4F7NA 4CMUA 3NYVA 3PSCA 2ITTA 4NL0A 1NXKA 4C62A 4UMQA 2WMRA 3DA6A 3NFFB 3TZMA 1M7QA 3W18A 3MPTA 4ANBA 4NSTA 2Z7QA 3OOGA 1PMVA 4G17A 4FGBA 3BV2A 3P08A 5IQCA 3UIUA 4IX6A 4A07A 2WTKB 4NK9A 4QTCA 2Y4IC 3WF7A 1PXOA 3BBTB 4KWPA 3WF5A 1GJOA 5L2SA 3JVSA 4BCNA 3HAMA