2YIQA

Structural analysis of checkpoint kinase 2 in complex with inhibitor pv1322
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
280
Chain Sequence
VYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title X-Ray Structures of Checkpoint Kinase 2 in Complex with Inhibitors that Target its Gatekeeper-Dependent Hydrophobic Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiqA01
1OL6A 5TT7A 4ZLYA 1OKZA 4MD9E 3GU5A 5H8BA 4IAAA 2I0HA 4J7BA 1AGWA 2J0JA 3BELA 2WIPA 4XG8A 1Q41A 4FIHA 3TZ8A 1UA2A 3KRJA 3JYAA 4FTOA 3OOMA 4GJ2A 1BL6A 2JAVA 2YN8A 1UWJA 3RNYA 4BVUA 3B2WA 3POOA 2BZIB 3BX5A 1R78A 3CY2A 4FSQA 4F0FA 4LRJA 1W8CA 5IA2A 2YAKA 3OC1A 3KU2A 4ACMA 4O7RA 1IA8A 2BILB 4FK6A 4X6RA 2J50A 3IK3A 1B6CB 3SD0A 4G2FA 3TXOA 3D5VA 4BIDA 5BPYA 2Y4IC 4FGRA 2R7BA 4JDKA 1GZNA 3K54A 4BRXA 2J5FA 4L42A 5IQFA 3FZRA 3W2SA 3ORLA 4KIPA 5JZNA 2UZNA 3LCSA 2F49A 4AA4A 1QPJA 4E20A 3LW0A 1PXPA 2HOGA 3W2PA 1H1QA 3BBTB 2X6DA 4XV3A 4D2VA 4W9WA 4O2PA 3MI9A 3AG9A 4XMOA 1OKYA 3BGQA 1V1KA 4DH7A 3O50A 4H05A 5AR8A 1NT2A 4C57A 1Y57A 4XG7A 5CZIA 3Q52A 3V04A 4ANLA 3S2PA 3WIKA 4Q9ZA 1KSWA 4J97A 4YJTA 5IQDA 1OM1A 2CJMA 5LJJA 5DIAA 3CTJA 2H6DA 2Q83A 4F08A 3A8XA 3P86A 2GU8A 1NVQA 1UU3A 3LMIA 3OWKA 3P0MA 4O91A 2F4JA 2QKWB 5CVGA 2J0MB 3KEXA 1OPLA 5AP3A 4BI2A 4EWQA 4HVSA 4F7SA 3D4QA 3KC3A 3PXYA 3JY9A 3LFFA 4MK0A 4NH1A 3RALA 3TDVA 4XS2A 1P2AA 3GFWA 3PVUA 4BYIA 3GFEA 4JQEA 3UIUA 4HGLA 1ZYCA 3ELJA 1XO2B 3FZ1A 1S9IA 2IVSA 5AUVA 1XKKA 4FTRA 4BCNA 4BTKA 5IQEA 3LFCA 2OG8A 3BKBA 4C4JA 3DGKA 4IACA 2C1AA 3V01A 3SGCA 2WAJA 2J9MA 5J8IA 2W05A 3UG2A 2P33A 3NPCA 3PUPA 2YWVA 3UNZA 3E3BX 3FDNA 4BDFA 4E6CA 5LMBA 4IM0A 2I40A 2I0EA 4BKZA 4H3PA 3LFQA 5L2WA 3ZO4A 1V0OA 3W2RA 2OICA 2BRGA 3AMYA 1UNLA 3F7ZA 4WSYA 4BICA 3UNKA 5CS6A 3AGLA 2PZRA 4YSJA 3OT3A 3FEGA 4DA5A 2Z7RA 3BGPA 4FV5A 3HUCA 4M12A 4E6AA 3LOKA 5LWNA 3L9MA 1LEZA 4YTFA 5HORA 3EQHA 1JSUA 2ESMA 4D4YA 4I5MA 4G9CA 1V0PA 2GFCA 4F7NA 3OW3A 2X7OA 3QUPA 3BWJA 1GIHA 4EC8A 4FIIA 3NMUF 5CAOA 2JDVA 4NKSA 5IH6A 4FL2A 5AV4A 3RJCA 3OF0A 2F57A 4KWPA 1PF8A 2YCQA 2GS6A 4LUDA 5EOLA 2XIZA 3GVUA 4I6FA 4U97A 4AGUA 3CGFA 5H3QA 5LXMA 3REPA 2CN5A 1M7QA 3UOKA 3WI6A 4WNOA 3JR1A 3QA8A 4ZTRA 5M53A 4NIFA 4DINA 2ZMCA 4DITA 4C3PA 4RFZA 2OWBA 4YHJA 2ZMDA 5DI1A 3V5PA 5EYCA 2C5YA 2RSVA 3F2RA 3D83A 4FZAB 5LOHA 5LWMA 1B38A 3HVCA 3ZRLA 5EYKA 3VUHA 1P5EA 4YBJA 4GU6A 4FG8A 3GCQA 4L01A 4MXYA 3NX8A 1ZLTA 5D7AA 5FWKK 4DFBA 4GW8A 4EEVA 4F4PA 3TV4A 1H8FA 1PMNA 4Y85A 3KULB 3M1SA 4O2ZA 4RSSA 3V5WA 1K9AA 3JXWA 3TZMA 2VWYA 3RINA 1Z5MA 3EFJA 4BDBA 4YU2A 4XYFA 3BLHA 2FH9A 4TXCA 1Y8GA 5AUYA 2AYPA 2X39A 2WB8A 4U45A 4DEGA 5HO8A 2C68A 4Y46A 5HE2A 5JZJA 1K2PA 5D11A 3AOXA 5K4IA 4KNBA 4P4CA 3RAIA 3II5A 3OY3A 3ZM4A 2W06A 4XG6A 1Q61A 4O7SA 2J0IA 5AA9A 3H4JA 2WTJA 3R73A 4FKSA 1UKHA 4QMYA 3SLSA 5FP5A 3VS3A 2P2HA 4BDEA 5AADA 4I6BA 4ZSLA 5J5SA 4FV3A 4GT4A 4RVMA 1PJKA 4QMLA 1NXKA 1YWNA 4WBOA 4DEAA 1M7NA 1T45A 1H27A 1JKTA 4FODA 5BVEA 4L3LA 3BRBA 2QVSE 3O8TA 4EHZA 2V7AA 2OH4A 3OW4A 4YZMA 3ZM9A 3CCNA 3IOKA 4RFMA 3TNPC 3DB8A 5ANKA 3VHEA 3Q32A 3KXMA 4ACHA 3F5UA 4TTHB 5EW9A 2PVHA 1W82A 4PPCA 1BMKA 3U87A 3MJ2A 4U7ZA 4HCUA 4I94A 4ENYA 4AT4A 5I9ZA 4EYMA 4O7LA 1DAWA 3FL4A 1KOAA 3GQLA 1YWRA 3A61A 3HRFA 4KSPA 4XRJA 3UMXA 3F9NA 2H8HA 5AAEA 4FG7A 4TYGA 2YM6A 4MXOA 3NVMB 3GXLA 1WZYA 4MQ1A 3FI8A 2JITA 4K11A 2XF0A 4S32A 4XG3A 2CGVA 3DB6A 2GCDA 2WTIA 4APCA 3KF4A 3F3UA 4HJOA 3SC1A 3EOCA 3WF9A 4AW0A 4RX5A 3NIZA 2R3LA 2JDOA 4FTUA 2C69A 1GAGA 4PUZA 1BL7A 5IMXA 3R22A 3UP7A 2XCHA 1FGIA 4EZ3A 2UW4A 3JY0A 1CMKE 5AP2A 5HI2A 1VR2A 4OBPA 4KKHA 3GP0A 5DEWA 4ID7A 4AW1A 3V5JA 3BHTA 2PVLA 2CGWA 1SVEA 2YDIA 3P79A 4ZTSA 4PTCA 2XK4A 3ZMMA 4GL9A 4EHGA 4V05A 3VF8A 3OXZA 2ZV7A 3COMA 2BDWA 5HEZA 4XUFA 5A6NA 2XM9A 3NAXA 4NIFB 2XNOA 3ATTA 3DPKA 4JAIA 3UG1A 2PMOX 4FZFB 4TNDA 1JLUE 4PMMA 5AR4A 2B9IA 3E88A 4FF8A 4TKSA 2EB3A 2VO7A 3OCBA 5CYIA 4O84A 3AC5A 3KF7A 5BYYA 4BZOA 5BVNA 4WOVA 2WMXA 3SOAA 5GIOE 1XQZA 3BYUA 5M06A 5FDPA 3KKVA 4FL3A 5BYZA 2WTKC 2WMSA 3PLSA 3OMVA 4KKEA 2PPQA 3ZEWA 4F1MA 5TKDA 4EUUA 2GTMA 2YLEA 3L1SA 5IUHA 5E91A 3ORZA 2NP8A 4BDGA 4CRLA 2A4LA 5FQDC 4EK8A 3F6XA 3N9XA 5IA5A 3HX4A 4DBXA 2R3RA 4F70A 4GMYA 4ANNA 5AAFA 3HA8A 4UWYA 2VTPA 3C0GA 3ZSHA 4CD0A 4IZAA 2OK1A 3LCKA 4A9TA 3VBVA 1QMZA 1Q8WA 4FT9A 2VX1A 3UMWA 3C50A 4XOZA 3FSFA 5IQCA 3QWKA 4AZFA 4FTNA 4E4LA 3TN8A 3E8DA 5L2SA 2JFMA 5E8WA 2F7EE 4J95A 2HW6A 4I21A 4ZTNA 3UC4A 4C38A 3ALNA 3W18A 4DTKA 5I9WA 4R77A 3SW4A 1V0BA 2C0OA 4TWOA 3ITZA 3R1SA 4AGWA 3GCUA 1UV5A 3IW4A 3KRRA 2OSCA 4G34A 4JBQA 2YIYA 3P7AA 4QQJA 3R30A 5BMSA 4WO5A 5KMJA 1P4OA 4FTMA 3E64A 4FSNA 4HGEA 3S3IA 5A9UA 3UBDA 4QPAA 4XG4A 2C5OA 4N6ZA 4ARKA 2XRUA 2VNYA 5GZ9A 5F20A 4OTGA 2W17A 3R9OA 3TKIA 4AX8A 4MXZA 1WCCA 3UQCA 3TZ7A 2I7QA 2YIQA 5M51A 5DRBA 1PY5A 3MY5A 1STCE 5LCJA 4CG9A 3JVRA 4EK6A 4AU8A 3ZONA 5K4JA 4MXXA 3ZRKA 4PTEA 3NUNA 1WBVA 2QG5A 5KZIA 1NA7A 2UZEA 5CF8A 2Z7LA 3NS9A 2ETRA 1JBPE 1MRVA 2QOBA 3CR0A 4IZYA 5HKMA 3RCJA 4ENXA 5A4QA 5CEKA 5KCVA 1CSNA 2PMNX 3T3UA 4APPA 4UX9A 2QOLA 4IFGA 5J87A 3QUDA 4XP0A 1MUOA 5FM2A 3KVWA 3TNWA 3TUDA 1IAHA 3EQGA 4C8BA 2C6KA 4GT5A 2XKCA 4UMQA 3TIYA 5EQEA 4FNZA 2Y8OA 4ZJIA 4NTTA 2W99B 2CKOA 4G5JA 3TACA 4ZJJA 4BKJA 3QTUA 3P7BA 3V3VA 4TL0A 4IH8A 4LGHA 5EHOA 1F5QA 4MQ2A 2R3IA 1XH5A 3D5UA 2XZSA 3MV5A 3F5XA 4IX5A 4L46A 4YTIA 5H9BA 1WBTA 1H25A 5F95A 5GHVA 1PXKA 2X8DA 3UNJA 5A46A 2W4JA 3E7OA 4E73A 3SVVA 3ANRA 5FDXA 4RIXA 3VN9A 4KBKA 3KVXA 4P2KA 5IU2A 5JQ8A 1U5QA 2I1MA 3PY1A 3MPMA 4BCOA 2YFXA 2PE2A 4PDPA 2W4OA 2YISA 3F2NA 4W4VA 5EKOA 4EOLA 4RZVA 3O17A 4IX6A 3EKNA 5LMAA 4BY9E 2VO0A 3ZLYA 1HCKA 4AA5A 3HV5A 4UYAA 3TG1A 3D9VA 3GQIA 5AV1A 2W4KA 4ERWA 4BCPA 4J96A 4OAUC 2XCKA 4OTIA 3UQFA 4X7QA 3A4PA 3OT8A 4HZRA 3UIBA 3BYMA 4J1RA 5ETAA 2ITYA 3QTRA 4QTCA 3KCKA 4PP7A 2OZAA 4H3QA 4JIKA 5GIPE 4U3ZA 3I7CA 3TCPA 4QMWA 4O6LA 5AUTA 4NKAA 5HE1A 1WBSA 4O0XA 4I6HA 3CSVA 4BIBA 3QXPA 3ACKA 4FSYA 3Q2MA 4AT5A 3CS9A 3F5PA 4EI4A 3F66A 3DZQA 4YPDA 4YJNA 4IB0A 5DLSA 4WG4A 2VD5A 2QG7A 3UODA 4TWPA 4L68A 4EK4A 4C0TA 3EN9A 3SW7A 4JOAA 1LP4A 5DEYA 4AZSA 5CI6A 2OIDA 3DK7A 4C4EA 4NUSA 4QRCA 4EH8A 2FGIA 2BR1A 3EQCA 1MRYA 5H2UA 4EH6A 5M4IA 3P08A 4RRVA 3G33A 5FRIA 2RIOA 5GINE 5HOAA 4I0RA 2VX0A 5A4EA 2RFSA 3LKMA 3LJ2A 4D1ZA 2J51A 1KWPA 4ZTHA 3LFEA 4YJPA 2X6EA 4JS8A 3QCYA 4U43A 2UVZA 4B9DA 4PF4A 5JFWA 1W7HA 4IIRA 3WE4A 4EK5A 5J1WA 3M2WA 1ZOGA 5CZHA 1RE8A 2XNNA 4I5CA 2Y6MA 5CU3A 5J95A 4AUAA 4Z7GA 3OFMA 2E9UA 2JKQA 3PXRA 4YO6A 2B7AA 1IAJA 1E1VA 4TN6A 1P14A 4EONA 1ZWSA 3IKAA 5EI8A 3FXXA 1Q5KA 5E90A 4QQTA 2YDJA 5I9YA 2HY81 2REIA 5LQFA 5M08A 4IBMA 4CCUA 2IPXA 2GNGA 1H0VA 2R2PA 4CFFA 2WPAA 2WMQA 2VWVA 2VTTA 1SVHA 2B9FA 4H36A 1OVEA 2BKZA 2GNHA 2XBJA 4QNAA 1DI9A 2FO0A 4I41A 3KXXA 3OVVA 4UXLA 4RJ5A 4YLLA 3FY2A 4C4HA 4D2SA 2JC6A 4FX3A 3BEAA 4RVTA 5KMKA 3QXOA 3QZGA 2F9GA 5AUZA 4XP2A 2F7ZE 4O7TA 2Y7JA 4IX4A 3MH0A 4TW9A 4R7BA 5FM3A 4H3BA 2XA4A 4DH3A 5CAQA 3MN3A 4DG2E 2XK3A 2YEXA 4RIXB 3BCEA 3RK5A 4JNWA 3UE4A 5HE0A 3B8RA 1M2RA 1PXJA 3FLWA 4YJQA 4QPMA 3R01A 3QX2A 4D4RA 3QF9A 2ZM4A 1M2PA 5LVNA 2JDSA 3HDNA 1UU7A 4GFOA 5GZAA 2XK7A 2OIQA 3R1YA 4AGDA 2EXEA 4CMTA 2VTLA 4O86A 2P55A 4GFMA 3RPYA 4RIOA 1P4FA 3VUMA 4ALUA 3FMJA 5LCKA 4MXCA 4GT3A 1PXIA 4FTLA 2JKKA 3WILA 5HHWA 3DU8A 3PVBA 5IG1A 3O23A 4S34A 5IISA 2PK9A 3FBVA 4FEVA 1GZKA 5CNNA 3Q4TA 3SX9A 4FKPA 2OZAB 1E1XA 5AX3A 3R8ZA 3W8QA 1Q3WA 4PDSA 4OUCA 3WF5A 2BRNA 2UZLA 2ITUA 3F3VA 4QTBA 4KB8A 3HV6A 4DAWA 4CRSA 2BFYA 4UXQA 1M14A 4FTJA 3GBZA 2IVTA 3E5AA 2I0YA 4I0TA 3CIKA 5BVDA 2R4BA 4ITIA 4WA9A 1YHVA 3NNVA 4U44A 5T3QA 3TEIA 4O27B 4ZIMA 4ZLZA 3Q5ZA 1NW1A 2J5EA 4G3EA 2BKKA 1Q8UA 2BRHA 2HXQA 2WO6A 3PE1A 4FNYA 4JG7A 4QMSA 5HIBA 3BYOA 4RJ6A 4G6LA 1OECA 2ETMA 4TRLA 2IW8A 4DE4A 2OFUA 2F2CB 2WTCA 3RGFA 4M97A 4JVGA 4FSWA 3T3VA 3QLGA 5HG5A 4RJ7A 4YUQA 4O7YA 4X21A 4CZYB 2R0UA 2XNBA 1KE5A 4FV0A 3NWWA 1BKXA 1Y8YA 2WEIA 3ZO2A 5E8TA 1IASA 4PY1A 2V62A 4FEQA 5IQGA 4AS0A 2PUUA 1YRPA 3LHJA 4KIOA 4DFLA 5FP6A 3ORNA 5LVOA 1SZMA 4RQVA 5B0XA 3AXWA 3CJGA 5GJFA 1AD5A 2PZIA 2VGPA 4AZEA 4I5PA 4BCJA 5AIRA 1DM2A 5B2MA 2B54A 1PYXA 3QKLA 4UZHA 3DJ5A 5D41A 5IMEA 3VBXA 4KSQA 4CKRA 4DGMA 4R3PA 5TOZA 3OG7A 2GS7A 1O6KA 3U9CA 5ANOA 2XVDA 4DGOA 2VTMA 1L3RE 3FZSA 3ROYA 5IA0A 2QO2A 2PYWA 5C8KA 4CNHA 5DBXA 3FLYA 3D2IA 3CKXA 3R1NA 3ID6C 4O0WA 5TR6A 1H01A 2C0TA 4RJ3A 2J2IB 3FZPA 2BAQA 5EM8A 3QHWA 4PDOA 1OZ1A 4QMVA 2O64A 3ODZX 4NJDA 4QMPA 2B4SB 4LMNA 3PIYA 4BDIA 5KMIA 1UVRA 1R3CA 1URWA 4PPAA 4DT9A 2ITOA 3EMGA 3LVPA 3G15A 4PTGA 1SM2A 3VBWA 4NSTA 4GIHA 2C4GA 2BFXA 4FICA 4F6SA 4L52A 2B9HA 2YM5A 3H9FA 3NNUA 3CLYA 3TV7A 1PRYA 2CKEA 3MDYA 2PHKA 3D94A 5L2IA 5C8NA 5CSXA 4UYNA 4M0YA 2XUUA 4IWPA 3UVRA 5IH4A 1L8TA 5ANDA 4O0VA 3NNWA 2C3KA 3C7QA 4FV4A 5ACKA 4D4VA 4E8AA 2WQMA 3HV3A 2G1TA 3A62A 5FEEA 1OL5A 4Y72A 3V5LA 4K1BA 4O81A 3ZUUA 1OL2A 3EWHA 3Q5IA 4RVLA 5EDPA 5IQIA 2CN8A 3TIZA 3U6JA 5DNRA 1KOBA 1PKGA 2VO3A 4Z16A 4FKGA 5J79A 3FXWA 4NW5A 2NPQA 3P78A 3BE2A 5C8MA 4D9UA 3HNGA 3PJCA 3R63A 5JFXA 2OI4X 3DDPA 4BCHA 4N57A 5CEIA 5CU4A 5C4KA 4FOBA 5HGIA 4Q5HA 1QCFA 3HEGA 4A9UA 4EH4A 1ZRZA 5G6VA 3LIJA 5LMKC 2HWOA 3MS9A 3OCTA 4FV6A 1G5SA 4RWKA 4W4YA 5CEQA 3R9HA 2YIXA 3BYVA 4OBQA 3TL8A 4DTBA 4QO9A 2PU8A 3PSDA 2IW9A 4HCTA 2WMRA 3NNXA 3N51A 4A9RA 4B8LA 2VX3A 3CXWA 5CXZA 2ONLC 3R8MA 1RJBA 2QO9A 2RGPA 4X6QC 5DA3A 1SVGA 2P0CA 4J53A 4U42A 5HG8A 5JGBA 5JFVA 4ZSAA 4DCAA 3BZ3A 4FVRA 4RC3A 2QONA 4ASDA 1VYWA 4YC6A 1M2QA 3F5GA 3O51A 4HNIA 3VUTA 5BYLA 2W5BA 5AAGA 2WXVA 5JKGA 3BU3A 3G9LX 2OGVA 4FKUA 4U8ZA 1UU8A 2YIRA 2YERA 3UJGA 3QZIA 3RPSA 1FBNA 4FUXA 4PL3A 4IDTA 1PYEA 2VTHA 5HO6A 4J52A 3TV6A 2HZ0A 4LG4A 3GT8A 2QKRA 3LM0A 4G16A 4WT6A 2F7XE 5KHWA 4YZCA 3ZUVA 1XH7A 4ZZOA 3D5XA 3GU6A 3TUBA 2CKQA 4FZ6A 5HX6A 3UQGA 4AZTA 4WD5A 4PWNA 1BX6A 1H0WA 3ET7A 4NTSA 3LFAA 1J7UA 3G90X 1ZYDA 2PE1A 3LM5A 3TZ9A 2AC3A 2WU7A 2ERKA 2IVUA 4PV0A 4CFXA 2VN9A 3E8CA 3R04A 4X2GA 4RA5A 1H26A 3C4ZA 4Y83A 4PDYA 3CJFA 3U8WA 1LPUA 4YZDA 5D10A 4RQKA 1ZAOA 2HZNA 2VTIA 3IONA 4XV2A 3KB7A 2IW6A 4NFMA 4II5A 4JRNA 3VS4A 1K3AA 1I09A 2YABA 2E9VA 5FLFA 4IAFA 5HCXA 2XK6A 3A2CA 2C6TA 2UW3A 3EHAA 1OB3A 1YKRA 3I5ZA 2XB7A 4ASEA 3OTUA 2P3GX 4LV8A 1REKA 1Q97A 2WIHA 4OTWA 2YM8A 1ZXEA 3OD6X 5IEVA 1ERKA 4ACCA 4F1OA 5IEYA 1G8AA 3MTFA 4B0GA 5EW3A 4Q5EA 2O2UA 5IQHA 2EUFB 2OH0E 1UKIA 2BROA 2EXCX 3E8NA 3R0TA 3R83A 5ICPA 3QTZA 4IAKA 3DZOA 2OXYA 4LMUA 4CCBA 4X3FB 2WOUA 4K6ZA 3HUBA 2B1PA 2W5HA 4DYMA 3ZC6A 2JDTA 4QNYA 2OU7A 4EH5A 2GHMA 3ZLSA 4CV8A 3V8TA 2PVMA 3PZHA 3D0EA 3KXGA 4RWIA 4TNBA 5JSMA 3Q96A 1F3MC 3T9IA 3OWPA 3QGWA 4KS8A 4I4FA 4QMTA 3H30A 3G5DA 4K18A 3KMUA 3CPBA 4RWJA 4OGRA 3FKLA 3MPTA 5CTPA 2WGJA 2HENA 5GJGA 1JKLA 5JGDA 4W4WA 4E5AX 3QRTA 4XOYA 4C34A 4XEYA 3OROA 3IPHA 4GG7A 4EZ5A 4NK9A 4WUAA 4H1MA 4P5ZA 4DFYA 4N0SA 2XMYA 3GC8A 1Q99A 2ZV9A 3D7TA 2VTAA 3DKGA 4F9BA 4AACA 5DT4A 3O96A 4L00A 3QD4A 5H8GA 3BWFA 3KMMA 2BUJA 2RG5A 5A14A 4FEWA 4BCQA 3E8EA 4EHEA 3VHKA 4AE9A 3ORXA 4ZY5A 4RIWA 1QL6A 2YA9A 3MESA 4K2RA 1UU9A 3NYXA 3SQQA 3WF8A 3MW1A 5CNOA 2OJ9A 5FD2A 3KXZA 3PY3A 3HGKA 5E4HA 2WQNA 1OL1A 4FTTA 1GIIA 2IWIA 1KE8A 4QMMA 1LEWA 4M67A 4WG3A 3NGAA 4L9IA 1QPDA 3FMHA 2YJSA 3QTWA 3E92A 3R28A 3VBQA 4CYIA 3PXFA 4CXAA 4C4GA 4NCTC 4FTKA 3N4UA 5FTQA 4BCKA 4FOCA 2PUIA 3LLAA 5KBQA 3DV3A 5L6PA 3L9LA 5CU0A 2HZIA 2PVYA 4OW8A 3SV0A 4O22A 4QYEA 3F3ZA 1I44A 3QBNA 4IM3A 2YLFA 4IMYA 4BWXA 3Q53A 4I0SA 3EIDA 3HKOA 4O7ZA 4IQ6A 1JWHA 4NFNA 2BHHA 4DF3A 3KRLA 1SNUA 3ZU7A 3LMHA 3M11A 2X2MA 5D1JA 4C36A 4PQNA 2QLUA 4Z55A 4FTCA 5DE2A 5JQ5A 4ZS4A 3RZFA 3NEWA 2LAVA 4GKHA 2QHMA 3R71A 5CU6A 2O8YA 3QTXA 2WFYA 4AOIA 2UUEA 3EN5A 4K8AA 5ACBC 4JI9A 3SXFA 5J7HA 3FZOA 4WNPA 3UYTA 4EK3A 5J7BA 2IO6A 4F64A 4KBAA 2WELA 2RFDA 3B8QA 4FZ7A 4YMJA 3LQ5A 4G31A 4LUEA 4C4IA 4O0TA 4CZUA 5KMLA 2OIBA 5KHXA 2WKMA 3QCSA 3SXRA 4I3ZA 2JEDA 4EOKA 3F3WA 4AT3A 2ZAZA 4GG5A 5FXSA 5JN2A 4DT8A 1YDTE 2PZPA 2JD5A 4USFA 4CLJA 4GK4A 3VQHA 4G3FA 5DOSA 2ZV2A 3ZLWA 3S4QA 1GY3A 4UALA 5AEPA 4M13A 2UZTA 3QQUA 1IRKA 2A0CX 3MY1A 4QPSA 4YURA 4MH7A 4R8QA 4EKKA 1CTPE 2IG7A 2CCHA 2PVNA 3PTGA 2BIKB 4GYGA 4RC2A 5DR6A 4ZY6A 3ZRMA 4BR3A 4IWDA 5HCYA 4D5KA 3CP9A 4FIGA 3S1HA 2FYSA 3P1AA 1H07A 4YSMA 4JDJA 4DH1A 2YACA 5IH5A 1H4LA 1KV2A 2BRBA 5T6KA 3F7WA 2HY0A 3FXZA 4E3CA 2BDJA 2QI8A 2WQEA 4LOQA 4LFIA 5JRSA 4R7IA 4XV1A 2R3FA 3ORKA 3PPJA 4ITJA 3V5QA 2YJRA 3CQWA 4ALWA 4DGGA 3MVLA 5I9VA 2CNVA 4M3QA 3MPAA 2Y6OA 3D7TB 4HVHA 4OLIA 3EQDA 4LI5A 4LOOA 3NUYA 3PXKA 1CKPA 5B2KA 4V04A 2OXXA 5LVPA 4YJVA 3I60A 3CEKA 3FQEA 5BMMA 5AA8A 4RIWB 2VGOA 5M4UA 3FPQA 3QHRA 5C27A 3GU7A 4DLJA 1Q8TA 3E63A 4L3JA 3VWAA 3MFSA 4EORA 3EZRA 1ZYLA 3RCDA 1Q4LA 4JJRA 4BDHA 5IQAA 3RVGA 3QKMA 4LL0A 1QPEA 3QRUA 5JH6A 3QC4A 3VW8A 2QURA 4MBLA 2PVFA 4BTJA 4C2VA 3H0YA 3VBTA 2XJ2A 4GKIA 3A7GA 4CEGA 4HVIA 3TNIA 5L3AA 3OY1A 2C5VA 3NCGA 4O1OA 3MFUA 4CV9A 2W1HA 5HE3A 3FLSA 2QR7A 1YHSA 3AD4A 4YJRA 2CNQA 4YJSA 2W1DA 3NUAA 3GCPA 3QKKA 3P9JA 1WBPA 4FGBA 5JMSA 4FI1A 2XKEA 1R0PA 3LXLA 3DTWA 4LOPA 1U54A 3UZRA 2W5AA 3FZTA 5AMNA 4OT6A 3ZC5A 5HIEA 4MNFA 5CSVA 1YOLA 5C1QB 5EQPA 5DGZA 5HU3A 4BGGA 1YVJA 4MBIA 3QALE 3F61A 4IDVA 1Z9XA 4AOJA 5A4CA 5GJDA 3NSZA 4QP9A 4JX7A 4JQ7A 2OF4A 3W2QA 4JR3A 2XNEA 4HYHA 2GPHA 4KBCA 3RK9A 4AF3A 1M52A 4AQCA 5DMZA 2QOOA 4IAZA 4E5BA 3BHUA 4KINA 2HK5A 4KUJA 2ZYBA 1DI8A 4C62A 3Q6WA 4GVAA 3G9NA 5A4LA 3RWQA 3TUCA 4WBBB 2QHNA 1ZZLA 5BVFA 3EFWA 4CZTA 4TYHA 4BGHA 4IB5A 4AGCA 4IX3A 3S95A 3BLQA 4RGJA 3NYOA 3D2KA 1NVSA 4FMQA 4GVJA 4YC8A 2PWLA 2XIYA 2XBAA 3TNQB 4FC0A 2ZDTA 1OKVA 4XBUA 2XEZA 3K3IA 3KCFA 1H1RA 5I9UA 4FT7A 1FINA 2W9ZB 3F2AA 4IM2A 5AM7A 5TF9A 5HVKA 4MNEA 4FNWA 4NU1A 4BYJA 5E7RA 4MF1A 1H28A 3ZBXA 4BKYA 2BZJA 4BB4A 3Q2JA 3PP0A 2C3LA 4UZDA 3BHHA 5CAPA 3OP5A 5J1VA 3ULIA 4HW7A 3IW8A 3D5WA 3H10A 3I5NA 2FVDA 2HIWA 4ZS0A 2XP2A 3ZO3A 5FXRA 5A54A 4S2ZA 3KRXA 4M66A 2VAGA 3FSKA 4FV2A 5D9HA 1XWSA 1JAMA 3EL8A 4DGNA 4AW2A 3BEGA 3W16A 4FG9A 3ATSA 3DQXA 3PG3A 4RA4A 3WZUA 2E9NA 4UMUA 4X0MA 4ANSA 1AQ1A 4MWIA 3TTJA 3LQ8A 5JK3A 5E8UA 4HYUA 1OPKA 4IB3A 5HBEA 5DN3A 1TKIA 3FI4A 4F9YA 2Q0BA 2C6DA 5FTGA 5KKRB 4IJ9A 4R6VA 3PXZA 4QMNA 3ZS5A 3LXNA 2BIYA 4I24A 1RDQE 5KO1A 1JPAA 3K5UA 1WBOA 4AN3A 5EI2A 3CE3A 3SHEA 4JBPA 2RL5A 4MVFA 3F82A 3NW6A 4WRGA 3R7EA 4JXFA 4N70A 3ORIA 3C0HA 5L2QA 4L53A 3NUSA 4YGAA 4U6RA 2R3HA 4XNEA 4M0ZA 3LLTA 3DFCB 5FUTA 3R00A 2XNMA 2QOHA 3NYNA 2GNIA 5ANIA 4DCEA 3HAVA 2QODA 3DAKA 3P7CA 4ONAA 4AW5A 2CLQA 4EKLA 2G15A 2NO3A 5EYMA 3KGAA 3RHKA 2UVYA 2BDFA 1KE7A 3TNHA 5JRQA 3AT3A 4EJNA 2Z8CA 3ZUTA 2PY3A 3AD5A 4FIJA 4G3GA 3VS2A 1G8SA 3ORMA 1U54B 2XEYA 4ZTMA 4EZ7A 2WOTA 4EQUA 5BX0A 3W10A 3K5VA 4PMSA 4Z9LA 5DYJA 2VZ6A 5AUXA 1JKKA 2OBJA 4YP8A 3CKWA 4EH3A 3NRMA 3ZDIA 2R5TA 3KN5A 4J98A 1G3NA 2JKOA 4G5PA 2W0JA 3ZTXA 2CSNA 2YM7A 4O21A 5EOBA 5AR2A 5DVRA 3R9DA 5EM7A 1OBDA 4NEUA 4KRCA 5AIKA 3FLZA 3NUUA 3ORPA 4TWNA 3QQGA 4AOTA 3KMWA 3QGYA 4QP8A 4DGLC 3UIXA 3DKCA 5HLNA 4JQ8A 4TYHB 3KK8A 3FAAA 4D4SA 4ZSGA 3ENMA 3F3TA 4UMTA 1IG1A 4ZSEA 1Z57A 4IVAA 4L45A 3ZCLA 1IR3A 4EWHA 2UZUE 4X3JA 4QP1A 3QFVA 3A7FA 4D5HA 4MNEB 2GQGA 4TYIA 4X2KA 4RMZA 1UNHA 2QO7A 4FKRA 4CT2A 3PWYA 4BDDA 3LJ1A 4XP3A 1J7LA 3R7OA 4FT3A 2UW7A 3GENA 4GS6A 3FMDA 1W0XC 4JRVA 3MB7A 3EYGA 4DBNA 3COKA 4HYSA 2Z7QA 4U5JA 4ANMA 4DEEA 4X3FC 4EH9A 4UB7A 5HTIA 4QYYA 3DBDA 1YDRE 2LGCA 2HWPA 1WVXA 3I6UA 4YJOA 3NCZA 3QD3A 3FJQE 3MWUA 2OFVA 2UW6A 1PXNA 4EUTA 2ZV8A 1EH4A 3UO5A 3HL7A 2Y0AA 3MVJA 2XNPA 4V01A 3U51A 4DLIA 5K0KA 3HP5A 3GCSA 3RP9A 3PE2A 2X9EA 3I81A 2C0IA 1Q8YA 4ANOA 4F7JA 4YO4A 3GGFA 3I79A 2VTOA 2RG6A 2C6EA 2I0VA 3NIEA 4O7NA 4QP7A 3W33A 3T8OA 5HNGA 3RPVA 2IZTA 3HDMA 4DC2A 5C26A 4DFXE 2YDKA 2C5XA 1W98A 2W1FA 4OBOA 2CGXA 2AUHA 4FYNA 4JDHA 5E92A 4K33A 5HG7A 3ZFYA 4IC8A 3MSSA 1H08A 3V6RA 3VO3A 5F94A 4FV8A 4IXPA 4A9YA 3LE6A 4AE6A 2C6OA 5HU9A 4DEBA 3BLRA 1ZYSA 2BZKB 2R7IA 3SKCA 2VTRA 4UMRA 4GUEA 1Q3DA 2XJ0A 3VBYA 2GQRA 5IDNA 2H96A 3TKUA 3AC8A 4YNEA 4FE2A 3VRYA 4UWBA 2G9XA 4MTAA 3UPXA 2QD9A 2XYUA 1XH8A 3WOWA 5CSHA 2IJMA 3FMKA 4IHPA 5CY3A 4PL5A 4J71A 3CGOA 2GNFA 4U80A 2E9PA 4EOJA 2G2HA 5CVFA 2BALA 4YBKA 3EQFA 3UTOA 4R3CA 1U4DA 4L7FA 4CTCA 4E93A 4IVCA 3HRBA 4E4XA 3FE3A 3QYWA 3FQHA 5DRDA 5F9EA 4AWIA 3VNTA 4IVDA 3UOLA 5AP0A 4AAAA 3LFBA 3ZXTA 3HV4A 3FKOA 1LR4A 3PDTA 2OXDA 4O1PA 4HZSA 5IUIA 3TT0A 2VNWA 2YCFA 3CQEA 3QRJA 1JQHA 4N4SA 4QTDA 3VS0A 3ZSIA 4FEUA 1FMKA 2R3MA 1B39A 3OXIA 2ITZA 2QU6A 3GNIB 3KN6A 4J8NA 4JLCA 2GSFA 1WVWA 3MH1A 4Y95A 2HXLA 4D1XA 5DH3A 5CQWA 4FSRA 4EOSA 3NVKI 3SG9A 3MIYA 1Q62A 3R8UA 2A2AA 2EVAA 4AXAA 3NW7A 2BTRA 3WF6A 3PRFA 1JSTA 2R64A 2H9VA 4WHZA 3BV2A 3W32A 3BU6A 3LMGA 4J99A 2UZBA 4YLJA 3U6HA 4D1SA 4TWCA 3QRKA 4FR4A 4O0RA 4IEBA 1J7IA 2C6IA 3Q3BA 1R0EA 4F0GA 4YPSA 5CLPA 2GTNA 3ZFXA 2BAJA 3O2MA 1H1WA 5AP1A 4C4FA 2CKPA 2W1GA 1GZOA 4U41A 1WBNA 4GK2A 2W7XA 3E62A 2XK9A 3A7IA 4DH8A 2YM3A 1BI7A 2KTYA 1JVPP 3DNDA 3ZSGA 4A9SA 5IF1A 1ZOHA 4ZZMA 2ZOQA 3DT1A 4IW0A 4FTIA 4AFJA 5EQYA 3DKOA 3L8PA 2A19B 2PL0A 4FA2A 5JEBA 1ZMVA 2R3PA 3GB2A 3DY7A 3CTQA 4MYGA 2O65A 5KE0A 2IN6A 5ETCA 2VTNA 3QU0A 4DEIA 5HTBA 3QAME 3I7BA 2W1EA 4G6NA 5IPJA 4QD6A 1JOWB 2FA2A 2J7TA 3AD6A 3PRIA 5FG8A 5HBJA 4CMUA 4BFMA 5AUWA 2JKMA 5IA3A 4MD8E 1GOLA 2C30A 5E1EA 4D2PA 4I22A 5FEDA 1XBAA 4F0IA 1WBWA 4RJ4A 3DAJA 3EN4A 3MH2A 4J8MA 4XH6A 5AM6A 3Q9WA 3HRCA 1BUHA 4ZK5A 4FSMA 2EWAA 4CQEA 3IECA 4JBOA 3DCVA 3WBLA 4C2WA 5C01A 4LRKA 4FYOA 2V5QA 3F88A 4YC3A 2ITVA 4ACGA 3SAYA 2ACXA 1OMWA 4BCMA 4FV1A 4BGQA 4GH2A 2YCRA 3H0ZA 3UC3A 4EBVA 3QQLA 2FSOX 3PYYA 4EC9A 3HMOA 1OGUA 2SRCA 4FKTA 4EBWA 5FGKA 3C4EA 1ZY5A 3LXPA 4IZ7A 2GFSA 4MX9A 4ZEGA 4Y5HA 4CKIA 1H24A 4YZBA 4ASXA 3HMIA 2G2IA 1ND4A 3A8WA 4ZXTA 3VS5A 4KIKA 2XNGA 3FMMA 5AWMA 2ITWA 3RM6A 1E9HA 4O0YA 4L6QA 4XHKB 5EDRA 1TQMA 2WQOA 4O82A 1W83A 1HOWA 3HV7A 4GJ3A 4Y5QA 3MB6A 2W1IA 3R7GA 2OKRA 3AQVA 3D15A 3LCTA 3C13A 2UVXA 3BU5A 3CBLA 4QQCA 4WUNA 3FMNA 3MTLA 5EFQA 3A99A 4LQMA 4YTCA 2RFEA 4GYIA 4IWQA 5EK7A 2A27A 1GNGA 5CT0A 3L8SA 4GU9A 4MF0A 4F7LA 1PMVA 3C1XA 3VRZA 4RG0A 4X2FA 4B8MA 3EFKA 4BHZA 4A4LA 4GV1A 4K9YA 3S0OA 2UW8A 3DLSA 4ZOGA 2CNUA 2E2BA 1PXOA 4NM5A 4E6DA 4M8TA 2C6MA 3KFAA 4CFWA 2EXMA 4DFZE 4WNMA 3DK6A 4LV5A 4RJ8A 1PMUA 1YOMA 2Y9QA 3QQHA 3PPZA 4HVDA 2OJJA 3D14A 3HMPA 4E4MA 3MYGA 4PMTA 4PL4A 1WFCA 4WNKA 5I4NA 3MH3A 3QTSA 3MVHA 3EQRA 5E1SA 3UO4A 1GJOA 1FPUA 2PSQA 3ZBFA 3FV8A 3QRIA 3C4CA 2W96B 3COHA 4LGDA 4AN2A 3MBLA 4XJ0A 5LARA 5HNIX 2PE0A 4KKGA 2WMWA 3MVMA 5IEXA 1JKSA 4F9AA 1PXLA 3FI2A 5I0BA 2JAMA 3EN6A 3KULA 2R0IA 3PP1A 1ATPE 5IDPA 4ZJVA 4QP6A 4C7TA 3DBEA 4IVBA 2X8IA 2BZHB 2XKFA 2ZVAA 4FIFA 5KX8A 3DBFA 4MD7E 3ZDUA 2Z02A 5CEPA 2E9OA 4I23A 4U79A 4FKVA 3C5UA 4XCUA 4K77A 2V55A 5EI6A 2PVRA 3MGYA 1VEBA 2BVAA 1SMHA 3DDQA 5L8KA 3PY0A 3R8PA 2HCKA 3OCSA 3NUXA 5CT7A 4ERKA 5T68A 5I5ZA 5D12A 4ANQA 3LFDA 3PVGA 5CU2A 1X8BA 4FKWA 4KRDA 4RC4A 4AG8A 4C35A 4UBAA 2ITPA 4O7VA 3TDWA 2GHGA 5KKRC 3PA5A 2QOKA 4D55A 4E26A 4Q2AA 4RT7A 3G2FA 3SRVA 3FYKX 4TZRA 3OBJA 3C4XA 2H34A 2I6LA 5ANGA 3IDPA 3RAKA 5EDQA 3QD0A 2C5NA 4CFUA 4CFVA 4DHFA 3EYHA 5CF6A 5E8SA 1MRUA 3SDJA 5HO7A 5GNKA 3VW6A 4HYIA 3FHRA 3I6WA 4ZSJA 2JBPA 1J91A 1GZ8A 1XR1A 2PMIA 2WMVA 4FKJA 5HCZA 1XH6A 3WZKA 3D7ZA 2WU6A 4ZMEA 2OW3A 3FWQA 1Q8ZA 2FSLX 3QL8A 3FL5A 3QTQA 4MEDA 4C3RA 2FSMX 4EOMA 4H39A 2FB8A 2ITXA 3BGZA 5KNJA 2WNTA 3N4TA 3CPCA 3GC7A 2RF9A 3R6XA 4KIKB 4R1YA 5DFPA 5AR7A 3V5TA 5KUPA 2UZDA 4MAOA 3EQBA 5L8JA 5CEOA 3L9PA 3ETAA 3CD3A 3ZHPC 3KL8A 4RX7A 3FMLA 1PW2A 4M69A 4G1WA 3ZYAA 4LGGA 5CF4A 3EZVA 4H1JA 3DOGA 4FVPA 4EQCA 4CFMA 2YAAA 5AFVA 3HMMA 4U81A 4ALVA 1FQ1B 2X7GA 5B2LA 4FV7A 2ITNA 3DJ6A 5CQUA 5HD4A 4ORKA 4BBMA 5BUIA 2VO6A 3LZBA 4RX9A 2VWBA 2C3JA 5CVHA 4I1ZA 4XX9A 5HZNA 2HAKA 1CKIA 3KY2A 5G1XA 5KZ0A 2WZJA 1OIRA 5K3YA 2ITTA 2HYYA 1RW8A 2R3KA 3LPBA 4GSBA 1XJDA 4BDKA 2VWIA 2VTJA 3C51A 2JFLA 3KRWA 4L7SA 4R3RA 4R78A 3DA6A 1YI3A 1BI8A 3PFQA 4QMUA 4QP3A 4QT1A 4FEXA 3L9NA 4KD1A 5DT0A 3G0EA 3IS5A 4QOXA 4RX8A 2WMTA 2G01A 3DXPA 4CG8A 4UY9A 3VS7A 4PNIA 4G9RA 1A06A 2C6LA 3VUIA 3OTVA 4TYEA 4U40A 2WQBA 4RLKA 3JPVA 4IJPA 4RIYA 4YR8A 3HP2A 3RBWA 4CSVA 2IZUA 4FSUA 2GNLA 2BMCA 3WE8A 5EG3A 2VWWA 4GUBA 1URCA 2CHLA 3U6IA 4CLIA 5JT2A 4G3DA 2FUMA 3BPRA 4Y8DA 5M55A 2WHBA 1ZY4A 3UZTA 4RVKA 2OJGA 5LMKA 2FSTX 3HMNA 4FBXA 4EOOA 3NZ0A 4JX3A 4MXAA 4O96A 3PSBA 3Q4ZA 5FEQA 3FC2A 4XBRA 5IUGA 3IQ7A 4M14A 5HLPA 4ZZNA 4AP7A 1KE6A 4R7HA 4P90A 2ONLA 2X81A 3U9NA 4FKLA 1OIYA 3UOJA 1FGKA 3T9TA 5BUEA 2UZVA 3IDBA 3OWLA 1YXVA 3IO7A 2R3JA 3BYSA 2O3PA 3DS6A 3ALOA 4UWCA 1APME 2DYLA 3KQ7A 4I5HA 4O0UA 3Q9ZA 3QCQA 5M44A 5TE0A 3SRVB 4BZNA 3ROCA 5JGAA 2VTSA 4JL9A 3FC1X 5K0XA 4BN1A 4U0IA 5E8ZA 1H00A 5AR5A 2ZM3A 3EL7A 3UIMA 3OBGA 5BNJA 4GK3A 4B6LA 3AMAA 5ANEA 2GNJA 4BL1A 4F65A 3POZA 5KMOA 2C47A 1Y6AA 4LL5A 3U4UA 4MKCA 4XRLA 5ANJA 5J9YA 3OXTA 4EOIA 5EHLA 1OI9A 4O0SA 4HVGA 3DXQA 2BPMA 3CTHA 3GEQA 1ZYJA 2GS2A 2R3QA 3MY0A 3UP2A 1MP8A 1U46A 3NUPA 1OIQA 4FSZA 3WARA 5CAUA 3M42A 2G2FA 4QMXA 1R39A 3FY0A 3PPKA 3F69A 5D7VA 4O7WA 4ZLOA 5A4TA 2OZOA 5A6OA 2AC5A 2QOCA 3S00A 2X1NA 4KAOA 4W8DA 2C1BA 3PG1A 3UOHA 3PJ3A 4BDJA 2VV9A 1U59A 4IB1A 4ZTQA 2YZLA 4M69B 3BBWA 1ZMUA 4IWOA 4WRSA 4I20A 1NVRA 4JG8A 3UYSA 4YZ9A 5ETFA 1OIUA 2GHLA 4O38A 3IG7A 2IVVA 4B99A 3Q9XA 3R1QA 4B7TA 1YXTA 3DTCA 2R3GA 4U9AA 3B2TA 3O7LD 4I6QA 5HG9A 1W84A 4FVQA 5I3OA 1OKWA 1DS5A 3ZO1A 5J5TA 4BDCA 3BHVA 3ZFMA 4NJ3A 5B7VA 3V6SA 3NYVA 5BVOA 5DT3A 5CI7A 4I92A 1VJYA 2PVKA 1ZMWA 3HZTA 3UPZA 5L8LA 2ERZE 4CMOA 5CWZA 5L6OA 3Q04A 2J4ZA 4Z7HA 4DG3E 1FOTA 3QYZA 3RWPA 2B9JA 4HPUE 3RNIA 4F1TA 4JAJA 4DEDA 2X2LA 4HGTA 2XRWA 4X2JA 4C02A 4IAYA 4LYNA 5E8YA 4E1ZA 3RHXA 2B0QA 3SOCA 3TWJA 3OEFX 2OJFE 2QCSA 2R3OA 3E87A 5L6WL 4DFUA 2UV2A 2JIVA 4RIYB 5DPVA 1KE9A 4ZTLA 5CSPA 4OTDA 4NWMA 3AC3A 5EKNA 3V51A 3QD2B 4YTHA 5IA4A 2UZOA 3DLZA 3IW5A 3ORTA 4RWLA 2DQ7X 4M84A 4BZDA 4KA3A 5IKWA 3DKFA 2Y4PA 1YI6A 2BRMA 2V7OA 3UDBA 1KV1A 1S9JA 4M7IA 4RZWA 4S31A 4DH5A 4BWPA 3G51A 1IA9A 3ZLXA 4G3CA 3EJ1A 4EHVA 5L4QA 2O0UA 3COIA 3EQIA 2UW5A 3K3JA 3Q4UA 5AP7A 4IAIA 1KUTA 1QPCA 2W1ZA 4A7CA 3ANQA 4BHNA 4AZWA 3ERKA 2OJIA 4FNXA 5K5XA 1J3HA 5ETIA 3DK3A 4EH2A 4BI1A 5AP5A 2CGUA 3FMEA 1WMKA 4WIHA 5HTCA 1YWVA 4XLIA 2CMWA 4N6YA 4GFGA 5IA1A 5CEMA 4JR7A 2YZAA 5AX9A 3QQJA 4I4EA 4ANBA 2Y4IB 3OHTA 5EH0A 1M17A 3UVQA 2QNJA 3DNEA 3BI6A 3TTIA 2VUWA 3Q9YA 4FV9A 4G6OA 4A4OA 4FK3A 5FBOA 4V0GA 4BCFA 3PJ1A 3R8VA 4TYJA 2CCIA 4MBJA 3E7VA 2WTDA 2X7FA 1XBCA 2XJ1A 3TKHA 5M4FA 4NCTA 3KXNA 5CAVA 3G0FA 4CFNA 4L3PA 3NDMA 1YDSE 2ETKA 2XYNA 2Z60A 4YHFA 3SA0A 5HVJA 4D2RA 3QA0A 2XK8A 2YWPA 3TJDA 3JUHA 3QZFA 4P7EA 1H1SA 4WKQA 5HVYA 2J6MA 5AV2A 2R3NA 4QTAA 4W4XA 3ZH8A 4F6UA 2GDOA 5CENA 3C4WA 3W55A 4A06A 3IGOA 3IW7A 4GRBA 3PXQA 4HGSA 2X4FA 2B55A 3AC1A 3IGGA 1O6YA 4U3YA 3R9RA 4BI0A 4I93A 3CY3A 4Y73A 4ZMFA 5J9LA 3PVWA 4IFCA 3RM7A 1YI4A 2UW0A 1OUYA 1RQQA 4F9WA 2XM8A 3QTIA 4UEUA 3WF7A 3OEZA 2QU5A 5ITAA 2IZSA 2P2IA 5CXHA 3RTPA 3VQUA 3VC4A 1DAYA 4C3FA 5AJQA 3SG8A 1OPJA 3MA3A 4OR5A 5KBRA 4W9XA 3PSCA 4F63A 4QTEA 2PVJA 3R8LA 3VUGA 1JNKA 3CD8A 3G6HA 4RLLA 2YHVA 5M4CA 1ZOEA 1O9UA 4KS7A 4XV9A 3WZDA 3FYJX 4K0YA 4JIAA 2WEVA 2JBOA 5CF5A 4L67A 5HBHA 3SXSA 4YNOA 1REJA 3MIAA 4ZAUA 1IEPA 3O8UA 1FVVA 4UV0A 4R5SA 4NW6A 5DWRA 5HQ0A 1OBGA 4F9CA 4OTQA 4Q9SA 3UZPA 3DBCA 4F09A 5L2TA 5TO8A 2IZRA 2YCSA 2ZDUA 1CDKA 2XIKA 5HLWA 3NAYA 3WYXA 4BWKA 5M56A 2VWUA 3I0QA 3LCDA 4FUYA 2VRXA 3BQCA 3GCVA 3KREA 5AP6A 3NLBA 2JDRA 2RFNA 3KXHA 5DHJA 1PMEA 3MJ1A 2PMLX 3TM0A 3RMFA 5C4LA 5CANA 1F0QA 3R7VA 2CLXA 3NR9A 4AZVA 3FQSA 4BIEA 4KABA 4LM5A 4FTAA 2NNWB 3OCGA 3GOKA 4JT3A 4L44A 3MA6A 1T46A 4OTPA 4AFEA 4GEOA 4A07A 4YHTA 4EL9A 1OL7A 3QCXA 4DEHA 3JS2A 4YJUA 4R5YA 1CKJA 4XG9A 3VS1A 3HA6A 4FZDB 1PKDA 3H9OA 5AR3A 4FT5A 1UWHA 3ZOSA 3LQ3A 3HLLA 3GUBA 4ACDA 1YQJA 2XIRA 4B4LA 2EB2A 5HD7A 3RK7A 4C58A 5GZ8A 2XKDA 3P4KA 4NM7A 2OLCA 3VVHA 1OITA 1HCLA 4X2NA 5FBNC 1LUFA 2JLDA 3ZZEA 2HW7A 5KMMA 4OTRA 4D0XA 2WTVA 4OT5A 3GC0A 4D2TA 1BYGA 5C9CA 3ZZWA 1J1CA 4V0GB 4BCIA 3R02A 2CPKE 3EN7A 3U55A 4PMPA 3DAEA 2X9FA 3VJOA 5I9XA 2BTSA 5FTOA 3RAHA 5J9ZA 3MFTA 4S30A 2O5KA 4FKOA 4PPBA 3RI1A 4QP2A 3OOGA 3DQWA 1YW2A 3VIDA 3WZJA 4D58A 1XH9A 4NM0A 5K9IA 3ODYX 3N4VA 2NRUA 3PJ2A 5E9EA 2B52A 3RAWA 1PHKA 2VTQA 4CT1A 4M15A 3W2OA 4AN9A 3LAUA 4BTMA 3RZBA 3DBQA 4BF2A 4JDIA 1YXUA 1ZZ2A 1PXMA 1WVYA 2VU3A 2WD1A 1MQBA 4GCJA 2QOFA 4NT4A 4Z3VA 4NL0A 3ACJA 3P23A 4LRMA 4D9TA 4USEA 3VF9A 4XG2A 3QWJA 2W9FB 3EQPA 3KA0A 1NY3A 3CC6A 4GIIA 4F6WA 1XH4A 2QLQA 3DFAA 5EW8A 3VJNA 3VULA 5E8VA 5DG5A 3C4FA 4BCGA 5DR9A 3LJ0A 4QYFA 5E8XA 3OUKA 3FLQA 3OZ6A 4BBFA 4L8MA 2ZM1A 3QUEA 4IE9A 5BUJA 3AGMA 4YLKA 3FHIA 2BHEA 4R1VA 4WSQA 4FT0A 3L8VA 4E6QA 3E93A 4NM3A 2CDZA 3IW6A 3BV3A 3EFLA 4FKQA 5M07A 3HAMA 3FPMA 2PUPA 4MCVA 4W8EA 3UVPA 2BCJA 5KMNA 3U54A 5M57A 3JVSA 4IC7A 4FL1A 3C0IA 2HZ4A 4P5QA 2DWBA 2BAKA 2UZWE 4QP4A 3R7YA 3E3PA 4JBVA 2XIXA 2QC6A 1FMOE 2WMBA 2WMUA 2QQ7A 5AV0A 1OUKA 2R9SA 5EM5A 3EH9A 5BVKA 3QC9A 5EYDA 3PWDA 4BTFA 3A7JA 2ITQA 3UO6A 3QQFA 3QZHA 4OTFA 5IQBA 5AV3A 3V8SA 4O83A 2DS1A 3O7LB 3VS6A 3MFRA 3HECA 5EM6A 1FVTA 4UMPA 5K5NA 3LFNA 4AA0A 4FSTA 4OAVB 2VWZA 3PJ8A 2OO8X 4CGAA 3AC2A 3RPRA 3PA4A 4PRJA 3TJCA 2Z7SA 5DR2A 1Q24A 3ZXZA 2PZYA 4NZWB 5F1ZA 4A4XA 4HCVA 3U4WA 4BC6A 4D28A 4DFNA 4E7WA 4PNKA 2PULA 5CSWA 3CQUA 3PLAE 5HNBA 3LCOA 2Z2WA 4L43A 4C61A 3FUPA 2WTWA 4CQGA 3WZEA 1YOJA 3O8PA 3GI3A 3PIXA 2YM4A 2P4IA 4IANA 2WTKB 4PX6A 4RFYA 5EHYA 1YHWA 2GMXA 2XH5A 1CM8A 3BE9A 3I4BA 4IADA 4QYHA 3VUDA 3ZEPA 4CVAA 3HYHA 3AT4A 3P5KA 3EKKA 1GIJA 3I1AA 3RPOA 1BLXA 5IZFA 1A48A 4CKJA 5F4NA 3ENHA 2EU9A 4S33A 3R9NA 3W2CA 3GU8A 4KIQA 5CX9A 5CALA 3IOPA 5BVWA 4QMOA 4TT7A 4E5WA 4TY1A 5CASA 2J90A 4MHAA 3QX4A 2QOIA 4QYGA 1A9UA 2X0GA 4BDAA 4XLVA 1VZOA 3BIZA 2JIUA 4ZY4A 4DTAA 4HOKA 2PZ5A 4D2WA 1SYKA 2DUVA 2Q0NA 1JSVA 2RKUA 3QQKA 4WG5A 3K2LA 5C03A 4ASZA 4DG0E 2XS0A 3TI1A 4RBLA 3LFSA 2HELA 3BHYA 5AUUA 5HIDA 2NRYA 4JG6A 3OWJA 1MQ4A 3WYYA 3GU4A 3V8WA 1TQIA 4FTQA 4USDA 3O71A 3GC9A 4PP9A 5JFSA 2W1CA 3R21A 4M68A 5H8EA 4YZNA 2WMAA 1J1BA 4ITHA 4C37A 4MWHA 4OTHA 3C9WA 3UGCA 3O0GA 2QR8A 2X4ZA 3A7HA 5BQ0A 5A3XA 3A4OX 2C3IB 4EJ7A 2B53A 2ZB1A 3AT2A 2YITA 4C59A 3EB0A 4C33A 2X2KA 4D0WA 3W8LA 3AC4A 3OUNB 1TVOA 1U5RA 4HPTE 4CTBA 5M09A 2V0DA 4EYJA 4QMQA 3R7IA 1Y91A 4TPTA 3FLNC 5HICA 5LVMA 1XBBA 3PIZA 1YXSA 2PTKA 2JGZA 1TQPA 3VAPA 2F2UA 2VWXA 1YXXA 4E4NA 3VUKA 4FKIA 3IDCA 3LXKA 3RKBA 4ZP5A 4G17A 2YIWA 4HNFA 5HX8A 2JIIA 5AP4A 1SNXA 3PA3A 4CYJA 2A1AB 1FVRA 3DXNA 4QMZA 4EH7A 1ZARA 2ZJWA 3OS3A 2V22A 3C5IA 1XHAA 3FI3A 3QLFA 3R2BA 3Q4CA 1R1WA 2J0KA 3NW5A 3R7UA 4X3FA 3THBA 3FKNA 4F99A 3ULZA 4QQ5A 3G6GA 1Y6BA 3A60A 3KK9A 4DN5A 4RPVA 1VYZA 2KULA 2O63A 3WIGA 3Q60A 1WAKA 4BBEA 4EOQA 2J0LA 4EQMA 5I3RA 1H1PA 3L8XA 2PUNA 3R2YA 2ZB0A 3H9RA 2UW9A 3DJ7A 3GOPA 4O6EA 3H3CA 2GQSA 4EOPA 3W1FA 3I0OA 5HESA 1O6LA 2OF2A 3Q6UA 2X8EA 5LVLA 3PZEA 4FIEA 4NYEA 2QOQA 4UN0C 4H58A 1UNGA 4IZ5A 5FXQA 3BQRA 3AMBA
chains in the Genus database with same CATH superfamily
1OL6A 5TT7A 4ZLYA 1OKZA 4MD9E 3GU5A 5H8BA 4IAAA 2I0HA 4J7BA 1AGWA 2J0JA 3BELA 2WIPA 4XG8A 1Q41A 4FIHA 3TZ8A 1UA2A 3KRJA 3JYAA 4FTOA 3OOMA 4GJ2A 1BL6A 2JAVA 2YN8A 1UWJA 3RNYA 4BVUA 3B2WA 3POOA 2BZIB 3BX5A 1R78A 3CY2A 4FSQA 4F0FA 4LRJA 1W8CA 5IA2A 2YAKA 3OC1A 3KU2A 4ACMA 4O7RA 1IA8A 2BILB 4FK6A 4X6RA 2J50A 3IK3A 1B6CB 3SD0A 4G2FA 3TXOA 3D5VA 4BIDA 5BPYA 2Y4IC 4FGRA 2R7BA 4JDKA 1GZNA 3K54A 4BRXA 2J5FA 4L42A 5IQFA 3FZRA 3W2SA 3ORLA 4KIPA 5JZNA 2UZNA 3LCSA 2F49A 4AA4A 1QPJA 4E20A 3LW0A 1PXPA 2HOGA 3W2PA 1H1QA 3BBTB 2X6DA 4XV3A 4D2VA 4W9WA 4O2PA 3MI9A 3AG9A 4XMOA 1OKYA 3BGQA 1V1KA 4DH7A 3O50A 4H05A 5AR8A 1NT2A 4C57A 1Y57A 4XG7A 5CZIA 3Q52A 3V04A 4ANLA 3S2PA 3WIKA 4Q9ZA 1KSWA 4J97A 4YJTA 5IQDA 1OM1A 2CJMA 5LJJA 5DIAA 3CTJA 2H6DA 2Q83A 4F08A 3A8XA 3P86A 2GU8A 1NVQA 1UU3A 3LMIA 3OWKA 3P0MA 4O91A 2F4JA 2QKWB 5CVGA 2J0MB 3KEXA 1OPLA 5AP3A 4BI2A 4EWQA 4HVSA 4F7SA 3D4QA 3KC3A 3PXYA 3JY9A 3LFFA 4MK0A 4NH1A 3RALA 4I6LA 3TDVA 4XS2A 1P2AA 3GFWA 3PVUA 4BYIA 3GFEA 4JQEA 3UIUA 4HGLA 1ZYCA 3ELJA 1XO2B 3FZ1A 1S9IA 2IVSA 5AUVA 1XKKA 4FTRA 4BCNA 4BTKA 5IQEA 3LFCA 2OG8A 2AEGA 3BKBA 4C4JA 3DGKA 4IACA 2C1AA 3V01A 3SGCA 2WAJA 2J9MA 5J8IA 2W05A 3UG2A 2P33A 3NPCA 3PUPA 2YWVA 3UNZA 3E3BX 3FDNA 4BDFA 4E6CA 5LMBA 4IM0A 2I40A 2I0EA 4BKZA 4H3PA 3LFQA 5L2WA 3ZO4A 1V0OA 3W2RA 2OICA 2BRGA 3AMYA 1UNLA 3F7ZA 4WSYA 4BICA 3UNKA 5CS6A 3AGLA 2PZRA 4YSJA 3OT3A 3FEGA 4DA5A 2Z7RA 3BGPA 4FV5A 3HUCA 4M12A 4E6AA 3LOKA 5LWNA 3L9MA 1LEZA 4YTFA 5HORA 3EQHA 1JSUA 2ESMA 4D4YA 4I5MA 4G9CA 1V0PA 2GFCA 4F7NA 4DHZA 3OW3A 2X7OA 3QUPA 3BWJA 1GIHA 4EC8A 4FIIA 3NMUF 5CAOA 2JDVA 4NKSA 5IH6A 4FL2A 1XMMA 5AV4A 3RJCA 3OF0A 2F57A 4KWPA 1PF8A 2YCQA 2GS6A 4LUDA 5EOLA 2XIZA 3GVUA 4I6FA 4U97A 4AGUA 3CGFA 5H3QA 5LXMA 3REPA 2CN5A 1M7QA 3UOKA 3WI6A 4WNOA 3JR1A 3QA8A 4ZTRA 5M53A 4NIFA 4DINA 2ZMCA 4DITA 4C3PA 4RFZA 2OWBA 4YHJA 2ZMDA 4O4CA 5DI1A 3V5PA 5EYCA 2C5YA 2RSVA 3F2RA 3D83A 4FZAB 5LOHA 5LWMA 1B38A 3HVCA 3ZRLA 5EYKA 3VUHA 1W2FA 1P5EA 4YBJA 4GU6A 4FG8A 3GCQA 4L01A 4MXYA 3NX8A 1ZLTA 5D7AA 5FWKK 4DFBA 4GW8A 4EEVA 4F4PA 3TV4A 1H8FA 1PMNA 4Y85A 3KULB 3M1SA 4O2ZA 4RSSA 3V5WA 1K9AA 3JXWA 3TZMA 2VWYA 3RINA 1Z5MA 3EFJA 4BDBA 4YU2A 4XYFA 3BLHA 2FH9A 4TXCA 1Y8GA 5AUYA 2AYPA 2X39A 2WB8A 4U45A 4DEGA 1W2DA 5HO8A 2C68A 4Y46A 5HE2A 5JZJA 1K2PA 5D11A 3AOXA 5K4IA 4KNBA 4P4CA 3RAIA 3II5A 3OY3A 3ZM4A 2W06A 4XG6A 1Q61A 2XAMA 4O7SA 2J0IA 5AA9A 3H4JA 2WTJA 3R73A 4FKSA 1UKHA 4QMYA 3SLSA 5FP5A 3VS3A 2P2HA 4BDEA 5AADA 4I6BA 4ZSLA 5J5SA 4FV3A 4GT4A 4RVMA 1PJKA 4QMLA 1NXKA 1YWNA 4WBOA 4DEAA 1M7NA 1T45A 1H27A 1JKTA 4FODA 5BVEA 4L3LA 3BRBA 2QVSE 3O8TA 4EHZA 2V7AA 2OH4A 3OW4A 4YZMA 3ZM9A 3CCNA 3IOKA 4RFMA 3TNPC 3DB8A 5ANKA 3VHEA 3Q32A 3KXMA 4ACHA 3F5UA 4TTHB 5EW9A 2PVHA 1W82A 4PPCA 1BMKA 3U87A 3MJ2A 4U7ZA 4HCUA 4I94A 4ENYA 4AT4A 5I9ZA 4EYMA 4O7LA 1DAWA 3FL4A 1KOAA 3GQLA 1YWRA 3A61A 3HRFA 4KSPA 4XRJA 3UMXA 3F9NA 2H8HA 5AAEA 4FG7A 4TYGA 2YM6A 4MXOA 3NVMB 3GXLA 1WZYA 4MQ1A 3FI8A 2JITA 4K11A 2XF0A 4S32A 4XG3A 2CGVA 3DB6A 3NFFB 2GCDA 2WTIA 4APCA 3KF4A 3F3UA 4HJOA 3SC1A 3EOCA 3WF9A 4AW0A 4AXFA 4RX5A 3NIZA 2R3LA 2JDOA 4FTUA 2C69A 1GAGA 4PUZA 1BL7A 5IMXA 3R22A 3UP7A 2XCHA 1FGIA 4EZ3A 2UW4A 3JY0A 1CMKE 5AP2A 5HI2A 1VR2A 4OBPA 4KKHA 3GP0A 5DEWA 4ID7A 4AW1A 3V5JA 3BHTA 2PVLA 2CGWA 1SVEA 2YDIA 3P79A 2XAOA 4ZTSA 4PTCA 2XK4A 3ZMMA 4GL9A 4EHGA 4V05A 3VF8A 3OXZA 2ZV7A 3COMA 2BDWA 5HEZA 4XUFA 5A6NA 2XM9A 3NAXA 4NIFB 2XNOA 3ATTA 3DPKA 4JAIA 3UG1A 2PMOX 4FZFB 4TNDA 1JLUE 4PMMA 4JMQA 5AR4A 2B9IA 3E88A 4FF8A 4TKSA 2EB3A 2VO7A 3OCBA 5CYIA 4O84A 3AC5A 3KF7A 5BYYA 4BZOA 5BVNA 4WOVA 2WMXA 3SOAA 5GIOE 1XQZA 3BYUA 5M06A 5FDPA 3KKVA 4FL3A 5BYZA 2WTKC 3W0NA 2WMSA 3PLSA 3OMVA 4KKEA 2PPQA 3ZEWA 4F1MA 5TKDA 4EUUA 2GTMA 2YLEA 3L1SA 5IUHA 5E91A 3ORZA 2NP8A 4BDGA 4CRLA 2A4LA 5FQDC 4EK8A 3F6XA 3N9XA 5IA5A 3HX4A 4DBXA 2R3RA 4F70A 4GMYA 4ANNA 5AAFA 3HA8A 4UWYA 2VTPA 3C0GA 3ZSHA 4CD0A 4IZAA 2OK1A 3LCKA 4A9TA 3VBVA 1QMZA 1Q8WA 4FT9A 2VX1A 3UMWA 3C50A 4XOZA 3FSFA 5IQCA 3QWKA 4AZFA 4FTNA 4E4LA 3TN8A 3E8DA 5L2SA 2JFMA 5E8WA 2F7EE 4J95A 2HW6A 4I21A 4ZTNA 3UC4A 4C38A 3ALNA 3W18A 4DTKA 5I9WA 4R77A 3SW4A 1V0BA 2C0OA 4TWOA 3ITZA 3R1SA 4AGWA 3GCUA 1UV5A 3IW4A 3KRRA 2OSCA 4G34A 4JBQA 2YIYA 3P7AA 4QQJA 3R30A 5BMSA 4WO5A 5KMJA 1P4OA 4FTMA 3E64A 4FSNA 4HGEA 3S3IA 5A9UA 3UBDA 3W0MA 4QPAA 4XG4A 2C5OA 4N6ZA 4ARKA 2XRUA 2VNYA 5GZ9A 5F20A 4OTGA 2W17A 3R9OA 3TKIA 4AX8A 4MXZA 1WCCA 3UQCA 3TZ7A 2I7QA 2YIQA 5M51A 5DRBA 1PY5A 3MY5A 1STCE 4FRFA 5LCJA 4CG9A 3JVRA 4EK6A 4AU8A 3ZONA 5K4JA 4MXXA 3ZRKA 4PTEA 3NUNA 1WBVA 2QG5A 5KZIA 1NA7A 2UZEA 5CF8A 2Z7LA 3NS9A 2ETRA 1JBPE 1MRVA 2QOBA 3CR0A 4IZYA 5HKMA 3RCJA 4ENXA 5A4QA 5CEKA 5KCVA 1CSNA 2PMNX 3T3UA 4APPA 4UX9A 2QOLA 4IFGA 5J87A 3QUDA 4XP0A 1MUOA 5FM2A 3KVWA 3TNWA 3TUDA 1IAHA 3EQGA 4C8BA 2C6KA 4GT5A 2XKCA 4UMQA 3TIYA 5EQEA 4FNZA 2Y8OA 4ZJIA 4NTTA 2W99B 2CKOA 4G5JA 3TACA 4ZJJA 4BKJA 3QTUA 3P7BA 3V3VA 4TL0A 4IH8A 4LGHA 5EHOA 1F5QA 4MQ2A 2R3IA 1XH5A 3D5UA 2XZSA 3MV5A 3F5XA 1TZDA 4IX5A 4L46A 5H9BA 4YTIA 1WBTA 1H25A 5F95A 5GHVA 1PXKA 2X8DA 3UNJA 5A46A 2W4JA 3E7OA 4E73A 3SVVA 3ANRA 5FDXA 4RIXA 3VN9A 4KBKA 3KVXA 4P2KA 5IU2A 5JQ8A 1U5QA 2I1MA 3PY1A 3MPMA 4BCOA 2YFXA 2PE2A 4PDPA 2W4OA 2YISA 3F2NA 4W4VA 5EKOA 4EOLA 4RZVA 3O17A 4IX6A 3EKNA 5LMAA 4BY9E 2VO0A 3ZLYA 1HCKA 4AA5A 3HV5A 4UYAA 3TG1A 3D9VA 3GQIA 5AV1A 2W4KA 4ERWA 4BCPA 4J96A 4OAUC 2XCKA 4OTIA 3UQFA 4X7QA 3A4PA 3OT8A 4HZRA 3UIBA 3BYMA 2IF8A 4J1RA 5ETAA 2ITYA 3QTRA 4QTCA 3KCKA 4PP7A 2OZAA 4H3QA 4JIKA 5GIPE 4U3ZA 3I7CA 3TCPA 4QMWA 4O6LA 5AUTA 4NKAA 5HE1A 1WBSA 4O0XA 4I6HA 3CSVA 4BIBA 3QXPA 3ACKA 4FSYA 3Q2MA 4AT5A 3CS9A 3F5PA 4EI4A 3F66A 3DZQA 4YPDA 4YJNA 4IB0A 5DLSA 4WG4A 2VD5A 2QG7A 3UODA 4TWPA 4L68A 4EK4A 4C0TA 3EN9A 3SW7A 4JOAA 1LP4A 5DEYA 4AZSA 5CI6A 2OIDA 3DK7A 4C4EA 4NUSA 4QRCA 4EH8A 4MUQA 4AXDA 2FGIA 1TFFA 2BR1A 3EQCA 1MRYA 5H2UA 4EH6A 5M4IA 3P08A 4RRVA 3G33A 5FRIA 2RIOA 4QDVA 5HOAA 4I0RA 2VX0A 5A4EA 2RFSA 3LKMA 3LJ2A 4D1ZA 2J51A 1KWPA 4ZTHA 3LFEA 4YJPA 2X6EA 4JS8A 3QCYA 4U43A 2UVZA 4B9DA 4PF4A 5JFWA 1W7HA 4IIRA 3WE4A 4EK5A 5J1WA 3M2WA 1ZOGA 5CZHA 1RE8A 2XNNA 4I5CA 2Y6MA 5CU3A 5J95A 4AUAA 4Z7GA 3OFMA 2E9UA 2JKQA 3PXRA 4YO6A 2B7AA 1IAJA 1E1VA 4TN6A 1P14A 4EONA 1ZWSA 3IKAA 5EI8A 3FXXA 1Q5KA 5E90A 4QQTA 2YDJA 5I9YA 5BV3A 2HY81 2REIA 5LQFA 5M08A 4IBMA 4CCUA 2IPXA 2GNGA 1H0VA 2R2PA 4CFFA 2WPAA 2WMQA 2VWVA 2VTTA 1SVHA 2B9FA 4H36A 1OVEA 2BKZA 2GNHA 2XBJA 4QNAA 1DI9A 2FO0A 4I41A 3KXXA 3OVVA 4UXLA 4RJ5A 4YLLA 3FY2A 4C4HA 4D2SA 2JC6A 4FX3A 3BEAA 4RVTA 5KMKA 3QXOA 3QZGA 2F9GA 5AUZA 4XP2A 2F7ZE 4O7TA 2Y7JA 4IX4A 3MH0A 4TW9A 4R7BA 5FM3A 4H3BA 2XA4A 4DH3A 5CAQA 3MN3A 4DG2E 2XK3A 2YEXA 4RIXB 3BCEA 3RK5A 4JNWA 3UE4A 5HE0A 3B8RA 1M2RA 1PXJA 3FLWA 4YJQA 4QPMA 3R01A 3QX2A 4D4RA 3QF9A 2ZM4A 1M2PA 5LVNA 2JDSA 3HDNA 1UU7A 4GFOA 5GZAA 2XK7A 2OIQA 3R1YA 4AGDA 2EXEA 4CMTA 2VTLA 4O86A 2P55A 4GFMA 3RPYA 4RIOA 1P4FA 3VUMA 4ALUA 3FMJA 5LCKA 4MXCA 4GT3A 1PXIA 4FTLA 2JKKA 3WILA 5HHWA 3DU8A 3PVBA 5IG1A 3O23A 4S34A 5IISA 2PK9A 3FBVA 4FEVA 1GZKA 5CNNA 3Q4TA 3SX9A 4FKPA 2OZAB 1E1XA 5AX3A 3R8ZA 3W8QA 1Q3WA 4PDSA 4OUCA 3WF5A 2BRNA 2UZLA 2ITUA 3F3VA 4QTBA 3AKJA 4KB8A 3HV6A 4DAWA 4CRSA 2BFYA 4UXQA 1M14A 4FTJA 3GBZA 2IVTA 3E5AA 2I0YA 4I0TA 3CIKA 5BVDA 2R4BA 4ITIA 4WA9A 1YHVA 3NNVA 4U44A 5T3QA 3TEIA 4O27B 4ZIMA 4ZLZA 3Q5ZA 1NW1A 2J5EA 4G3EA 2BKKA 4QEBA 1Q8UA 2BRHA 2HXQA 2WO6A 3PE1A 4FNYA 4JG7A 4QMSA 5HIBA 3BYOA 4RJ6A 4G6LA 1OECA 2ETMA 4TRLA 2IW8A 4DE4A 2OFUA 2F2CB 2WTCA 3RGFA 4M97A 4JVGA 4FSWA 3T3VA 3QLGA 5HG5A 4RJ7A 4YUQA 4O7YA 4X21A 4CZYB 2R0UA 2XNBA 1KE5A 4FV0A 3NWWA 1BKXA 1Y8YA 2WEIA 3ZO2A 5E8TA 1IASA 4PY1A 2V62A 4FEQA 5IQGA 4AS0A 2PUUA 1YRPA 3LHJA 4KIOA 4DFLA 5FP6A 3ORNA 4LV7A 5LVOA 1SZMA 4RQVA 5B0XA 3AXWA 3CJGA 5GJFA 1AD5A 2PZIA 2VGPA 4AZEA 4I5PA 4BCJA 5AIRA 1DM2A 5B2MA 2B54A 1PYXA 3QKLA 4UZHA 3DJ5A 5D41A 5IMEA 3VBXA 4KSQA 4CKRA 4DGMA 4R3PA 5TOZA 3OG7A 2GS7A 1O6KA 3U9CA 5ANOA 2XVDA 4DGOA 2VTMA 1L3RE 3FZSA 3ROYA 5IA0A 2QO2A 2PYWA 5C8KA 4CNHA 5DBXA 3FLYA 3D2IA 3CKXA 3R1NA 3ID6C 4O0WA 5TR6A 1H01A 2C0TA 4RJ3A 2J2IB 3FZPA 2BAQA 5EM8A 3QHWA 4PDOA 1OZ1A 4QMVA 2O64A 3ODZX 4NJDA 4QMPA 2B4SB 4LMNA 3PIYA 4BDIA 5KMIA 1UVRA 1R3CA 1URWA 4PPAA 4DT9A 2ITOA 3EMGA 3LVPA 3G15A 4PTGA 1SM2A 3VBWA 4NSTA 4GIHA 2C4GA 2BFXA 4FICA 4F6SA 4L52A 2B9HA 2YM5A 3H9FA 3NNUA 3CLYA 3TV7A 1PRYA 2CKEA 3MDYA 2PHKA 3D94A 5L2IA 5C8NA 5CSXA 4UYNA 4M0YA 2XUUA 4IWPA 3UVRA 5IH4A 1L8TA 5ANDA 4O0VA 3NNWA 2C3KA 3C7QA 4FV4A 5ACKA 4D4VA 4E8AA 2WQMA 3HV3A 2G1TA 3A62A 5FEEA 1OL5A 4Y72A 3V5LA 4K1BA 4O81A 3ZUUA 1OL2A 3EWHA 3Q5IA 4RVLA 5EDPA 5IQIA 2CN8A 3TIZA 3U6JA 5DNRA 1KOBA 1PKGA 2VO3A 4Z16A 4FKGA 5J79A 3FXWA 4NW5A 2NPQA 3P78A 3BE2A 5C8MA 4D9UA 3HNGA 3PJCA 3R63A 5JFXA 2OI4X 3DDPA 4BCHA 4N57A 5CEIA 5CU4A 5C4KA 4FOBA 5HGIA 4Q5HA 1QCFA 3HEGA 4A9UA 4EH4A 1ZRZA 5G6VA 3LIJA 5LMKC 2HWOA 3MS9A 3OCTA 4FV6A 1G5SA 4RWKA 4W4YA 5CEQA 3R9HA 2YIXA 3BYVA 4OBQA 3TL8A 4DTBA 4QO9A 2PU8A 3PSDA 2IW9A 4HCTA 2WMRA 3NNXA 3N51A 4A9RA 4B8LA 2VX3A 3CXWA 5CXZA 2ONLC 3R8MA 1RJBA 2QO9A 2RGPA 4X6QC 5DA3A 1SVGA 2P0CA 4J53A 4U42A 5HG8A 5JGBA 5JFVA 4ZSAA 4DCAA 3BZ3A 4FVRA 4RC3A 2QONA 4ASDA 1VYWA 3PFYA 4YC6A 1M2QA 3F5GA 3O51A 4HNIA 3VUTA 5BYLA 2W5BA 5AAGA 2WXVA 5JKGA 3BU3A 3G9LX 2OGVA 4FKUA 4U8ZA 1UU8A 2YIRA 2YERA 3UJGA 3QZIA 3RPSA 1FBNA 4FUXA 4PL3A 4IDTA 1PYEA 2VTHA 5HO6A 4J52A 3TV6A 2HZ0A 4LG4A 3GT8A 2QKRA 3LM0A 4G16A 4WT6A 2F7XE 5KHWA 4YZCA 3ZUVA 1XH7A 4ZZOA 3D5XA 3GU6A 3TUBA 2CKQA 4FZ6A 5HX6A 3UQGA 4AZTA 4WD5A 4PWNA 1BX6A 1H0WA 3ET7A 4NTSA 3LFAA 1J7UA 3G90X 1ZYDA 2PE1A 3LM5A 3TZ9A 2AC3A 2WU7A 2ERKA 2IVUA 4PV0A 4CFXA 2VN9A 3E8CA 3R04A 4X2GA 4RA5A 1H26A 3C4ZA 4Y83A 4PDYA 3CJFA 3U8WA 1LPUA 4YZDA 5D10A 3O5AA 4RQKA 1ZAOA 2HZNA 2VTIA 2X0PA 3IONA 3KB7A 2IW6A 4NFMA 4II5A 4JRNA 4XV2A 1K3AA 1I09A 3VS4A 2YABA 2E9VA 5FLFA 4IAFA 5HCXA 2XK6A 3A2CA 2C6TA 2UW3A 3EHAA 1OB3A 1YKRA 3I5ZA 2XB7A 4ASEA 4DDGA 3OTUA 2P3GX 4LV8A 1REKA 1Q97A 2WIHA 4OTWA 2YM8A 1ZXEA 3OD6X 5IEVA 1ERKA 4ACCA 4F1OA 5IEYA 1G8AA 3MTFA 4B0GA 5EW3A 3BL7A 4Q5EA 2O2UA 5IQHA 2EUFB 2OH0E 1UKIA 2BROA 2EXCX 3E8NA 3R0TA 4O4DA 3R83A 5ICPA 3QTZA 4IAKA 3DZOA 2OXYA 4LMUA 4CCBA 4X3FB 2WOUA 4K6ZA 3HUBA 2B1PA 2W5HA 4DYMA 3ZC6A 2JDTA 4QNYA 2OU7A 4EH5A 2GHMA 3ZLSA 4CV8A 3V8TA 2PVMA 3PZHA 3D0EA 3KXGA 4RWIA 4TNBA 5JSMA 3Q96A 1F3MC 3T9IA 3OWPA 3QGWA 4KS8A 4I4FA 4QMTA 3H30A 3G5DA 4K18A 3KMUA 3CPBA 4RWJA 4OGRA 3FKLA 3MPTA 5CTPA 2WGJA 2HENA 5GJGA 1JKLA 5JGDA 3BL9A 4W4WA 4E5AX 3QRTA 4XOYA 4C34A 4XEYA 3OROA 3IPHA 4GG7A 4EZ5A 4NK9A 4WUAA 4H1MA 4P5ZA 4DFYA 4N0SA 2XMYA 3GC8A 1Q99A 2ZV9A 3D7TA 2VTAA 3DKGA 4F9BA 4AACA 5DT4A 3O96A 4L00A 3QD4A 5H8GA 3BWFA 3KMMA 2BUJA 2RG5A 5A14A 4FEWA 4BCQA 3E8EA 4EHEA 3VHKA 4AE9A 3ORXA 4ZY5A 4RIWA 1QL6A 2YA9A 3MESA 4K2RA 1UU9A 3NYXA 3SQQA 3WF8A 3MW1A 5CNOA 2OJ9A 5FD2A 3KXZA 3PY3A 3HGKA 5E4HA 2WQNA 1OL1A 4FTTA 1GIIA 2IWIA 1KE8A 4QMMA 1LEWA 4M67A 4WG3A 3NGAA 4L9IA 1QPDA 3FMHA 1W2CA 2YJSA 3QTWA 3E92A 3R28A 3VBQA 4CYIA 3PXFA 4CXAA 4C4GA 3NFGB 4NCTC 4FTKA 3N4UA 5FTQA 4BCKA 4FOCA 2PUIA 3LLAA 5KBQA 3DV3A 5L6PA 3L9LA 5CU0A 2HZIA 2PVYA 4OW8A 3SV0A 4O22A 4QYEA 3F3ZA 1I44A 3QBNA 4IM3A 2YLFA 4IMYA 4BWXA 4O4BB 3Q53A 4I0SA 3EIDA 3HKOA 4O7ZA 4IQ6A 1JWHA 4NFNA 2BHHA 4DF3A 3KRLA 1SNUA 3ZU7A 3LMHA 3M11A 2X2MA 5D1JA 4C36A 4PQNA 2QLUA 4Z55A 4FTCA 5DE2A 5JQ5A 4ZS4A 3RZFA 3NEWA 2LAVA 4GKHA 2QHMA 3R71A 5CU6A 2O8YA 3QTXA 2WFYA 4AOIA 2UUEA 3EN5A 4K8AA 5ACBC 4JI9A 3SXFA 5J7HA 3FZOA 4WNPA 3UYTA 4EK3A 5J7BA 2IO6A 4F64A 4KBAA 2WELA 3BLAA 2RFDA 3B8QA 4FZ7A 4YMJA 3AKLA 3LQ5A 4G31A 4LUEA 4C4IA 4O0TA 4CZUA 5KMLA 2OIBA 5KHXA 2WKMA 3QCSA 3SXRA 4I3ZA 2JEDA 4EOKA 3F3WA 4AT3A 2ZAZA 4GG5A 5FXSA 5JN2A 4DT8A 1YDTE 2PZPA 2JD5A 4USFA 4CLJA 4GK4A 3VQHA 4G3FA 5DOSA 2ZV2A 3ZLWA 3S4QA 1GY3A 4UALA 5AEPA 4M13A 2UZTA 3QQUA 1IRKA 2A0CX 3MY1A 4QPSA 4YURA 4MH7A 4R8QA 4EKKA 1CTPE 2IG7A 2CCHA 2PVNA 3PTGA 2BIKB 4GYGA 4RC2A 5DR6A 4ZY6A 3ZRMA 4BR3A 4IWDA 5HCYA 4D5KA 3CP9A 4FIGA 3S1HA 2FYSA 3P1AA 1H07A 4YSMA 4JDJA 4DH1A 2YACA 5IH5A 1H4LA 1KV2A 2BRBA 5T6KA 3F7WA 2HY0A 3FXZA 4E3CA 2BDJA 2QI8A 2WQEA 4LOQA 4LFIA 5JRSA 4R7IA 4XV1A 2R3FA 3ORKA 3PPJA 4ITJA 3V5QA 2YJRA 3CQWA 4ALWA 4DGGA 3MVLA 5I9VA 2CNVA 4M3QA 3MPAA 2Y6OA 3D7TB 4HVHA 4OLIA 3EQDA 4LI5A 4LOOA 3NUYA 3PXKA 1CKPA 5B2KA 4V04A 2OXXA 5LVPA 2X0OA 4YJVA 3I60A 3CEKA 3FQEA 5BMMA 5AA8A 4QDEA 4RIWB 2VGOA 5M4UA 4AAYA 3FPQA 3QHRA 5C27A 3GU7A 4DLJA 1Q8TA 3E63A 4L3JA 3VWAA 3MFSA 4EORA 3EZRA 1ZYLA 3RCDA 1Q4LA 4JJRA 4BDHA 5IQAA 3RVGA 3QKMA 4LL0A 1QPEA 3QRUA 5JH6A 3QC4A 3VW8A 2QURA 4MBLA 2PVFA 4BTJA 4C2VA 3H0YA 3VBTA 2XJ2A 4GKIA 3A7GA 4CEGA 4HVIA 3TNIA 5L3AA 3OY1A 2C5VA 3NCGA 4O1OA 3MFUA 4CV9A 2W1HA 5HE3A 3FLSA 2QR7A 1YHSA 3AD4A 4YJRA 2CNQA 4YJSA 2W1DA 3NUAA 3GCPA 3QKKA 3P9JA 1WBPA 4FGBA 5JMSA 4FI1A 2XKEA 1R0PA 3LXLA 3DTWA 4LOPA 1U54A 3UZRA 2W5AA 3FZTA 5AMNA 4OT6A 3ZC5A 5HIEA 4MNFA 5CSVA 1YOLA 5C1QB 5EQPA 5DGZA 5HU3A 4BGGA 1YVJA 4MBIA 3QALE 3F61A 4IDVA 1Z9XA 4AOJA 5A4CA 5GJDA 3NSZA 4QP9A 4JX7A 4JQ7A 2OF4A 3W2QA 4JR3A 2XNEA 4HYHA 2GPHA 4KBCA 3RK9A 4DDIA 4AF3A 1M52A 4AQCA 5DMZA 2QOOA 4IAZA 4E5BA 3UDZA 5GINE 3BHUA 4KINA 2HK5A 4KUJA 2ZYBA 1DI8A 4C62A 3Q6WA 4GVAA 3G9NA 5A4LA 3RWQA 3TUCA 4WBBB 2QHNA 1ZZLA 5BVFA 3EFWA 4CZTA 4TYHA 4BGHA 4IB5A 4AGCA 4IX3A 3S95A 3BLQA 4RGJA 3NYOA 3D2KA 1NVSA 4FMQA 4GVJA 4YC8A 2PWLA 2XIYA 2XBAA 3TNQB 4FC0A 2ZDTA 1OKVA 4XBUA 2XEZA 3K3IA 3KCFA 1H1RA 5I9UA 4FT7A 1FINA 2W9ZB 3F2AA 4IM2A 5AM7A 5TF9A 5HVKA 4MNEA 4FNWA 4NU1A 4BYJA 5E7RA 4MF1A 1H28A 3ZBXA 4BKYA 2BZJA 4BB4A 3Q2JA 3PP0A 2C3LA 4UZDA 3BHHA 5CAPA 3OP5A 5J1VA 3ULIA 4HW7A 3IW8A 3D5WA 3H10A 3I5NA 2FVDA 2HIWA 4ZS0A 2XP2A 3ZO3A 5FXRA 5A54A 4S2ZA 3KRXA 4M66A 2VAGA 3FSKA 4FV2A 5D9HA