2YIQA

Structural analysis of checkpoint kinase 2 in complex with inhibitor pv1322
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
280
Chain Sequence
VYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title X-Ray Structures of Checkpoint Kinase 2 in Complex with Inhibitors that Target its Gatekeeper-Dependent Hydrophobic Pocket.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiqA01
5A4TA 5JQ5A 2QI8A 2BZJA 4HCUA 3EFWA 3T3UA 2O5KA 5LVPA 3P7AA 4BICA 2JDOA 3QRJA 4FKQA 3L8PA 5AR5A 3UNJA 4E4MA 3F3ZA 4RRVA 4BDEA 4I6BA 1UWHA 2ITXA 3WZUA 2VWUA 4H1MA 2IZSA 5IMEA 4DHFA 2QNJA 4TW9A 2ZM3A 4C2WA 4CLIA 4YJVA 4CSVA 4D1ZA 2J50A 3F5UA 4QTAA 4WRGA 1R1WA 4G9RA 4JS8A 4ZJIA 2IWIA 5EOBA 2QOKA 5GJFA 3ZO4A 3Q04A 4FKWA 2IO6A 2VTAA 1IAHA 2B54A 4WNKA 4BN1A 5J5SA 5KBQA 2OFVA 2ITTA 4Q5HA 3QA8A 4EK5A 3GU8A 3R6XA 4PDOA 5HLPA 4OGRA 4L8MA 5DLSA 3F2AA 3U87A 3NUAA 4CCBA 4AT5A 4GYGA 1U54A 2JFMA 4J53A 3TIYA 3HP2A 3JS2A 3W1FA 5JGBA 2Z8CA 5IDPA 4RWKA 3A8WA 4XP0A 3BYSA 1OGUA 2C68A 3TNPC 4K18A 4YJQA 3RAWA 2EUFB 2HW7A 3QTXA 4ZSEA 4DTBA 5EM5A 1WVWA 1OPKA 2HYYA 4BCNA 4O2ZA 3VO3A 3AOXA 4TYJA 3WIGA 4O96A 4FKIA 4IDVA 3RWQA 4FICA 2WXVA 3R00A 4W8DA 4E1ZA 3QCQA 1YQJA 2X7GA 5FRIA 2NPQA 3C4EA 4H1JA 5G6VA 4TWOA 3U6IA 3A2CA 4W9XA 4X7QA 1FMKA 4X2KA 4E7WA 2I0HA 3GCVA 3FC2A 2QURA 2XMYA 1Q8WA 1CMKE 4XV9A 4M69A 4WG5A 5FTQA 4O22A 3IS5A 5HE1A 3MH0A 3OUNB 5ANGA 5CT7A 4I4EA 4DF3A 4YJSA 4FV5A 3ZBFA 4YSJA 2BUJA 4BWPA 4PUZA 4EOQA 4PPBA 3U9NA 4E6QA 5ANKA 2HZ0A 1FVVA 3JR1A 4V0GB 2JGZA 2C5YA 1FMOE 4NWMA 3POOA 4YJNA 4XG6A 3VC4A 4ZTLA 1PHKA 1V1KA 2R3KA 1XH5A 5D11A 3UIMA 5KX8A 3TUBA 2VNWA 4FV3A 1KOBA 5CTPA 4YJTA 1O9UA 4KA3A 3NNXA 3PA3A 4QP7A 3EWHA 4L67A 3TDVA 1M7NA 4DH5A 4EBWA 2Y4PA 2YM5A 4MXAA 3ZLXA 2GS7A 2C5NA 5DH3A 3R8VA 2XK3A 4CT2A 3DTWA 5CAVA 2XA4A 3MFUA 2C6MA 5ANIA 4JRNA 5AV1A 3PY0A 5HX6A 4K1BA 3KEXA 1A9UA 3EIDA 4KIKA 4UEUA 3EB0A 4C4HA 3SG8A 3KN5A 5M51A 4YLKA 5A46A 4BCOA 3DBEA 3VWAA 2CGVA 5L4QA 3OP5A 3QC4A 4C61A 4FNWA 5AM7A 2OWBA 4BDAA 4GU9A 3NW5A 2BIYA 5AUTA 3DBDA 3C51A 3FDNA 3VS7A 3QKLA 2BZHB 1W8CA 1XHAA 4M13A 2C30A 3P7CA 4RC2A 3I5NA 2BZIB 4R7BA 1RJBA 2Z7QA 3HV4A 3QQKA 2JBOA 2FSOX 2O8YA 2YISA 3LJ2A 4V04A 4XG7A 2VTPA 3VBQA 4CV8A 1JSUA 2W4JA 3GCPA 3B2WA 2JDVA 1OL6A 3AGMA 1WBPA 2XBAA 2ITPA 4EH9A 3V6SA 3KCKA 4PV0A 3FL4A 3DT1A 4EWHA 3GCQA 5IQBA 3FWQA 3PLAE 3QX2A 3QRKA 2IVUA 5CZIA 3HX4A 2GHGA 3Q5ZA 3I0OA 4O1PA 3IW7A 2WOTA 4JNWA 5J1VA 3I6UA 3EFJA 3U4UA 3COHA 1PMVA 4PQNA 3UZTA 2JIVA 1UU3A 2R3IA 2A27A 3OCBA 4YTIA 4YU2A 4GJ3A 2WTCA 4CVAA 3D5UA 4ZSJA 4G34A 4FGRA 3ZLSA 3T3VA 4APPA 2UW3A 2FSMX 3EKKA 4LMUA 3PVBA 1YRPA 3ZFXA 4DH8A 1JVPP 1Y6BA 2A0CX 2V5QA 2YIWA 4M0YA 2QODA 5FEDA 1STCE 4JQ8A 4YZMA 2IZRA 4NW5A 4F7LA 5E8TA 2UZVA 2EWAA 4JX7A 2ZB0A 2O65A 4BTMA 2GQGA 4D5KA 1Y8GA 2VWIA 4A4LA 4AWIA 4ERKA 2ZVAA 1K9AA 3QZIA 4Y83A 2YCFA 5JN2A 4QMXA 4ACDA 2WFYA 4C7TA 2ZOQA 4FTLA 4C4FA 1MRUA 4NU1A 4EKLA 4CD0A 2IVTA 4KKHA 2CGUA 1IR3A 3BU6A 1HOWA 4PL3A 3ZLWA 4PTGA 3B8RA 3UODA 3F2NA 4DEBA 3LMHA 4QTDA 4FEUA 3E8CA 3BHVA 3OWKA 4KINA 3I7CA 4I6HA 4B99A 2OFUA 3FQSA 2YAAA 5KE0A 3ELJA 3IGGA 4LL5A 5FP5A 2B9HA 5BUEA 3NUXA 3HLLA 3R9HA 3FLQA 4WSQA 3QTIA 1E9HA 1BI7A 3H9FA 4FKJA 4HZSA 5LARA 4CZUA 4TN6A 3WF8A 5FWKK 4JR3A 2WO6A 4AGWA 1XKKA 2V7AA 4MNEA 5CU6A 2J6MA 3ERKA 4NK9A 4FUXA 3REPA 4UN0C 3C0IA 5FTOA 4D28A 3FMEA 3E63A 3BHYA 2XK4A 3EQGA 3GEQA 2E9OA 2C0IA 4K9YA 1IRKA 3WZJA 2P2IA 3A7JA 3FHIA 2QOOA 5GINE 4TXCA 2YZLA 2QOLA 3GFWA 5HG7A 4HVDA 1YDRE 1WVYA 2BROA 3R0TA 2YM3A 4A9UA 5AV2A 2C6TA 2WOUA 4MD8E 5IF1A 4B6LA 3UQFA 3CTQA 4BKYA 3ENMA 2P33A 2QKWB 4O0UA 1FPUA 3D7TA 1J91A 3ANRA 3CIKA 3MI9A 3FSKA 5AWMA 1WZYA 2R7IA 1Q41A 1CSNA 3QF9A 2G01A 5D7VA 4IB1A 4NT4A 4B8MA 5JFWA 1SMHA 2R3QA 3A7FA 3K5UA 5J79A 3UPXA 5J7HA 2PSQA 3QD2B 4CRLA 4AE9A 4LMNA 2GTMA 5E8XA 4L6QA 4J8NA 4BGGA 5ACBC 3SXRA 4FT3A 4FTAA 1QPCA 4FL1A 4JI9A 4UWYA 4YHJA 2VTTA 3PVUA 4DYMA 1Q24A 4W4VA 1YDTE 2HWPA 5FXRA 4OLIA 1UKIA 3PXZA 4O81A 3MV5A 2YWPA 2ETKA 3K3JA 3P08A 1U59A 5CEQA 3HECA 5AUZA 3MIAA 4USEA 3UIBA 2AC5A 3V8WA 3IPHA 3ZU7A 4EK4A 5BVNA 1XJDA 4GVJA 2GDOA 2G1TA 4NZWB 2QOQA 3R8LA 5AA9A 4J71A 5EYMA 5J95A 1RQQA 3O7LB 3BELA 4X2NA 1H0WA 5GJDA 3H0YA 3PA4A 3W33A 1TQMA 4ZJVA 4GW8A 3ORXA 5LOHA 3IONA 4ACHA 3F88A 3PG1A 2R5TA 5DN3A 5CF5A 4ZS4A 5AP7A 4BB4A 5JKGA 3CY2A 3U6JA 2BDFA 1W0XC 2QO9A 4IADA 5IUGA 1SVGA 4ONAA 4OAUC 4P2KA 3CPCA 3R01A 2BAQA 4UMRA 4OW8A 4AZVA 3O8PA 1WBNA 2QHNA 1WVXA 3D14A 2CJMA 3L1SA 5D12A 4GT4A 1OIRA 1ZZ2A 2QR8A 4C3PA 5IA1A 5EYCA 2OZOA 4F63A 5HO7A 4MNFA 3NR9A 5E7RA 5GIPE 4O7WA 3LFSA 2YIRA 5IQDA 3BV2A 2YA9A 3DAJA 3KK8A 2PE0A 2PVJA 5HO8A 5HOAA 3FHRA 3KQ7A 4RJ8A 5LVLA 2V62A 3FMMA 4U9AA 4KUJA 4I3ZA 3QQHA 4M66A 3KKVA 2OJIA 4W4WA 2WQBA 4ZS0A 3N4TA 2W99B 4BYJA 2VWXA 2XNEA 5KCVA 4D58A 1GZKA 2X6DA 4FSUA 3RAIA 3CTJA 4MH7A 4EH7A 1OIQA 4EORA 4CT1A 4AOIA 4C3FA 5IA2A 3R7VA 3G9LX 4KBCA 3BCEA 4CFFA 4WRSA 3LPBA 3RPSA 3SAYA 5CT0A 4F0GA 2XUUA 3ULIA 4QMTA 4AN3A 4ANBA 3ORTA 4JAIA 3AC4A 2NRUA 2QU6A 4PNKA 3K5VA 3ZO2A 5KMLA 4RBLA 4H58A 3V6RA 3DY7A 5FQDC 2BILB 4QMLA 4AFJA 3W2SA 3LFFA 2W05A 2R3HA 3FAAA 4DFBA 4U40A 2HY81 2IJMA 2OBJA 3QUPA 3OF0A 2BTRA 3NLBA 4J98A 4XV2A 5M53A 5HVKA 4CG8A 3BGZA 5TKDA 5I3RA 2C4GA 3DJ6A 3UYSA 4FTMA 4JOAA 2Z7LA 5IQGA 4F9WA 4BCKA 3FI4A 3WZKA 4FEXA 1ZRZA 5EDRA 5FG8A 2YM6A 5CU2A 5J9LA 4RIOA 2VTIA 1Q4LA 4N4SA 2BKKA 3AC3A 3LQ5A 3V5TA 3LQ3A 2OO8X 3GXLA 2VUWA 3G0EA 2H96A 3MVJA 2UZDA 3P86A 4FTOA 4FZAB 5LWNA 4FZ6A 4QP6A 1BLXA 3QLFA 3AT3A 4ANLA 5DEYA 3VBYA 4H3PA 5AUYA 3TUDA 2BKZA 4EHVA 2X8IA 1KE9A 1Q8UA 2X0GA 2GFCA 4TNBA 5CNOA 1CDKA 3LXNA 5TO8A 4I22A 5FXQA 2JITA 2R3PA 3FKOA 3KMMA 4U42A 4M7IA 4CFVA 3DXNA 5A6NA 3LFCA 4EC8A 4FKUA 5ANOA 4C4IA 3R1NA 4TKSA 2UW4A 2UVYA 3LFAA 1QPJA 2R9SA 3VW8A 2B4SB 5ANJA 3V5QA 4BF2A 3OTUA 2OXXA 5BQ0A 3LMGA 3ALOA 4XOZA 4F0FA 4FGBA 4Q9ZA 2BRGA 4I0RA 3TCPA 4JG7A 5FP6A 3RHKA 2W7XA 3D7ZA 1R0PA 2W1CA 4FG7A 1BL7A 2I40A 2WTKC 5A4LA 4C34A 4OAVB 4FKTA 4TWNA 2W5AA 2YCQA 4QQ5A 5L2SA 3UPZA 4UALA 5LQFA 4M97A 5I9UA 2BFYA 2HXQA 5IUHA 4F9CA 4DLJA 4TTHB 4WHZA 4EK8A 3D5VA 1JOWB 1MUOA 4E26A 3O2MA 1DM2A 2XK9A 5CX9A 2CNVA 2ETMA 3QZFA 3PXQA 1DAYA 2IN6A 1MP8A 2ERKA 2OJJA 3DCVA 4LL0A 3LXLA 1MRVA 4BYIA 2BALA 3JXWA 3HMPA 3CP9A 5EM7A 1VYWA 2UZEA 5KMMA 1G8SA 4D4YA 5EDQA 4AX8A 1S9JA 2YM8A 3Q9ZA 4X6RA 4BDBA 3R1QA 2F7EE 3OG7A 5CAPA 4PTCA 3FY0A 2WKMA 3DA6A 2X2LA 3GI3A 3W18A 3V5JA 4L68A 5IQHA 4IVCA 2F2CB 3RAKA 2CHLA 4OT5A 4ACMA 5IEXA 3DK6A 4HVHA 1JKLA 2PHKA 2XEZA 3DNDA 1E1XA 2J0JA 1ATPE 1H28A 5CU3A 4B8LA 4RX8A 1UU9A 2BDJA 4I93A 2VV9A 3TT0A 2VWBA 4YTFA 1M2QA 4YZ9A 4I92A 4D4VA 4KIKB 4L43A 4AA0A 5CSWA 4EOSA 5HTBA 3Q4TA 3DU8A 3KFAA 4RVMA 4I1ZA 3S3IA 5JZJA 2QKRA 1QCFA 4DFXE 5FXSA 2ONLA 1IAJA 4GYIA 3LMIA 2I0VA 3P0MA 3HUCA 3MH3A 3MW1A 3EQDA 4JDJA 4AW1A 4ZTHA 4RZWA 1QMZA 2UW8A 4HGEA 4AT4A 4IJPA 4M14A 5EDPA 2WAJA 3KK9A 2I7QA 3FV8A 2PUUA 3KY2A 3F69A 1TQPA 4ZSAA 3GU6A 3PXKA 4PWNA 3UNZA 2X7FA 2C6IA 1FQ1B 4ANMA 2XJ2A 3NNWA 4ZLOA 4E5AX 5LMKA 4RWJA 4BHZA 3I5ZA 4AOTA 1ZXEA 3VUGA 1QPEA 3G6GA 3NS9A 5ICPA 2GQRA 3LJ0A 5DYJA 5C8NA 3KULA 2IW8A 3RPRA 1UKHA 3RM6A 2VNYA 5H3QA 2C0TA 3F3UA 3ZSHA 3AD5A 2UW9A 5IUIA 4YURA 2Y0AA 2R0IA 4MEDA 3UQCA 3LLTA 3PPJA 1PXLA 3W10A 2G15A 3GC0A 2CN8A 4QP8A 4FTIA 4FTRA 3R9RA 4IE9A 2FH9A 5CS6A 5AR8A 1OUYA 3WF5A 4L3LA 2BR1A 3DOGA 4QYHA 3PPZA 4FIIA 5EM8A 5C4LA 1KUTA 3R22A 2IZUA 4AZWA 4PL5A 2HXLA 4M15A 4YJPA 3OTVA 4I20A 5CSXA 3H0ZA 4BCPA 3UIXA 2VO0A 3V5WA 4ID7A 4XNEA 2BVAA 3KN6A 4BZDA 1CM8A 5AV0A 3FI8A 3ZS5A 5KMKA 4QMWA 4N6ZA 5M56A 4PP7A 3QYWA 5GJGA 1ZOGA 4E6CA 4LFIA 3ORZA 2WQMA 3RTPA 1TVOA 2HOGA 3TG1A 4ARKA 4EZ7A 4RMZA 4ZP5A 5EYKA 3R8UA 2W4OA 4L7FA 4F9YA 1Q5KA 3ET7A 5DPVA 3MPAA 5AUWA 3ZXZA 4FTCA 4EYJA 3QTSA 5BVOA 3HAMA 4RA5A 3BU3A 3M11A 3EYGA 2E9UA 2WMUA 4LGHA 5KNJA 1CKIA 1OM1A 1W83A 3IW8A 3KXXA 4DBXA 5E8SA 3Q2JA 3FEGA 3MBLA 2YJRA 5JRQA 2WIHA 3O8TA 4BDGA 1OL7A 3DPKA 3BWJA 1S9IA 3AGLA 3DDPA 4C62A 1PKDA 3TTJA 1UNHA 2PZIA 3FZPA 4I6FA 4TWPA 3ORLA 4H05A 3NZ0A 4MNEB 5C8KA 1CTPE 1L3RE 4FF8A 4I41A 4N6YA 1CKJA 5IKWA 3GB2A 4FV8A 4E20A 3HUBA 1DS5A 4ZXTA 3MTLA 5EHLA 3FBVA 2YM4A 3ANQA 4O7TA 3JPVA 4ASEA 3LM5A 4WG4A 5IMXA 4JL9A 4RLLA 2VX1A 4PPAA 3HV6A 5E8WA 4C4GA 4RG0A 5CI7A 3OY1A 2J2IB 3DJ7A 5AX3A 2Y6MA 3AC8A 3S95A 2WU7A 1XO2B 2GMXA 2A4LA 3IO7A 2XIRA 3D7TB 5L8LA 1XBAA 3ZM9A 4X3FA 2A1AB 2BRHA 3L9NA 2NP8A 5JFSA 5E8UA 2F49A 2GCDA 2OH0E 5FEQA 1XR1A 4R1VA 3MH1A 4QP4A 3SVVA 2RIOA 1W82A 3NWWA 2GS2A 2UV2A 3EFLA 3KU2A 4L7SA 4P4CA 3UO6A 4CFWA 2Y7JA 5K0XA 1ZYDA 1J1CA 3AXWA 4BL1A 4OTRA 3K2LA 4FT7A 4I0TA 3RK9A 3MWUA 4I94A 3ZUVA 2J0IA 3DKFA 4QP2A 2PYWA 5TOZA 3VUMA 2WMQA 3QRIA 4ZIMA 1GY3A 1NXKA 3O7LD 4S30A 3DLSA 4GV1A 5A4CA 1RE8A 3OW4A 4BDHA 3ATTA 3FXZA 4FZDB 3U8WA 3FI3A 1ZWSA 3QCXA 2RG6A 4KS7A 2X6EA 3BHUA 5AR7A 2OXDA 2YJSA 1OKVA 2G2FA 5M08A 2BAJA 1B38A 3I0QA 4CRSA 3VS4A 2W5HA 2ONLC 1SYKA 4GT3A 4OTHA 4F09A 3NYNA 4XHKB 2YDKA 4W4YA 3FUPA 4FV0A 4IB0A 4R5YA 2C6DA 1SM2A 5IQIA 3E3PA 4MKCA 4QQCA 4RC4A 5B0XA 2HWOA 2X9FA 3ACJA 5HESA 2B1PA 2QR7A 2R3LA 2XVDA 1UU7A 5JQ8A 4YBKA 5CASA 2FSLX 3ZRMA 1H1QA 3CQEA 5K4IA 5KO1A 4D4RA 3HRFA 3HMMA 4KKGA 5C01A 3PA5A 3QHRA 3LXPA 1M2RA 4JG8A 4OTQA 3LHJA 3FQEA 1OKWA 3KF7A 4OBQA 4XCUA 3DKGA 3W2RA 5L2TA 5KKRC 5H8GA 2YDJA 2QLQA 2XM9A 2WMBA 4XBUA 5FEEA 4KBKA 4XG8A 3FXWA 4J8MA 2C3IB 2OICA 2R3GA 5KUPA 4QMNA 2JC6A 4G5PA 5TR6A 1YWNA 5LCJA 4J7BA 5F1ZA 4FMQA 2JKOA 1JAMA 2IVVA 3ZC5A 2G2IA 5EFQA 4O7YA 4IJ9A 4RIWA 2VO3A 3FPMA 2NNWB 2Q83A 3OROA 3CQUA 4O21A 4YPDA 3COMA 5KMNA 4QTBA 4YGAA 3EN7A 3VBVA 4U6RA 3HRBA 3OXTA 4TYIA 4IB5A 4NJDA 2UW0A 2GNLA 2V7OA 3G51A 3ORMA 3GP0A 3RNIA 3VUKA 3WE4A 3KRXA 4HVGA 2YFXA 4IZ7A 1Y91A 2P4IA 5AR2A 4ACCA 2YIYA 3D5WA 2GFSA 5I9YA 3EH9A 4U3YA 3DK7A 3TUCA 4OT6A 4FSZA 2QD9A 3VQHA 3AC5A 4QOXA 4ZK5A 4NM5A 1GZOA 3LVPA 4AE6A 4AQCA 3N51A 4IEBA 4LYNA 3NGAA 1APME 3FZOA 4DE4A 3A7GA 2O64A 4WKQA 3HNGA 2BHHA 2Y6OA 4QMMA 2OKRA 1NY3A 1G8AA 3DAKA 4WNMA 4X6QC 1UNLA 2FA2A 5HD4A 5CEMA 4JIAA 3WILA 4O6LA 1PYEA 4LRJA 1MQBA 2QVSE 4I5PA 3DFCB 4QQTA 4YZCA 4JRVA 3ZZEA 4M8TA 1XBBA 3OEFX 1K3AA 2B0QA 2P3GX 3LIJA 2P0CA 4GVAA 4YC8A 5DRBA 1KE6A 3DXPA 2WMVA 5C03A 2FYSA 3IW5A 4DG3E 4ZY4A 3PYYA 5ANDA 4NFMA 3FZTA 4F4PA 1F5QA 2BTSA 3EOCA 5T6KA 4NCTC 4W9WA 3RVGA 4EH5A 3SDJA 3QGWA 4F1TA 4G3FA 2J0MB 2UZWE 5IEVA 4FIFA 4RIYA 4IX6A 4RJ5A 5AUVA 3ATSA 5GZ9A 4O27B 4IVAA 4BRXA 1ZYJA 4FBXA 4YTCA 2VTSA 5M07A 2P2HA 5J7BA 3GOPA 4II5A 4LI5A 4EK6A 3PXFA 3II5A 4X3FC 2OU7A 4UYAA 4E5WA 3CLYA 4FV9A 4U0IA 2OIBA 4BWXA 4C58A 4PY1A 4E93A 5IQFA 1H1WA 3QTZA 4WSYA 3BE2A 4KIQA 5L2QA 5K5XA 4DFLA 4BCHA 3DB6A 3SG9A 2YWVA 4Z3VA 3FKNA 4IAYA 4IZYA 1WFCA 2W1GA 4U44A 5I5ZA 3H3CA 3ZUUA 3OW3A 2JFLA 4FOBA 4Y72A 3POZA 4XRLA 5DWRA 1VYZA 4BZNA 1B39A 3GU5A 5ETIA 5CEOA 4EJNA 4XLIA 4IZAA 3Q5IA 2CKQA 4CGAA 3MB7A 4G3EA 2GNJA 4CNHA 1PXPA 4CYIA 4D1SA 2OI4X 1ZY4A 2PK9A 3T9IA 3BKBA 2GS6A 3QWJA 2GQSA 2YZAA 1YHVA 4FZFB 3UMXA 4NSTA 2RG5A 1FINA 4AN2A 4CTBA 2J5EA 5AP6A 2R3NA 1REKA 3FY2A 5AIKA 4BBEA 1BX6A 4B7TA 4J99A 1M7QA 5EM6A 5AR4A 2VRXA 3OOGA 3DKOA 3F7ZA 4YHTA 5CI6A 4C37A 5M06A 2GNHA 3QXOA 4L46A 4YZNA 2HK5A 4XLVA 1YWRA 3ZZWA 4LG4A 4OTPA 4OBOA 5ACKA 3C4FA 3EMGA 5K3YA 4PPCA 3LFEA 4FKLA 3W8QA 1ZLTA 5H9BA 2F7XE 4ALWA 3EZRA 4QTEA 5BUIA 3OS3A 4N70A 3S4QA 3BBTB 2OJFE 4AUAA 4IX5A 2DWBA 2WMAA 3OOMA 4QD6A 4XV1A 3C0HA 4JDKA 4KRCA 3SW7A 4HYSA 4YR8A 4YTHA 3RCDA 3BLQA 2G2HA 2XCHA 4A9YA 5CANA 1WMKA 3M1SA 4ZJJA 3KMUA 3QU0A 2B52A 5HIBA 1DI8A 5FGKA 4OTGA 3PUPA 4XEYA 4IBMA 4BBFA 4PDPA 4KIPA 4YBJA 2ITUA 2JLDA 5IH5A 3KULB 4JAJA 2OG8A 2VTHA 5JFXA 5HLWA 2GU8A 4NUSA 2REIA 2XNBA 4M84A 5CWZA 4CXAA 4AXAA 2V22A 2VWWA 1KOAA 4WBOA 4CFXA 3FMHA 4K6ZA 4IAAA 3TNIA 5E9EA 3EQHA 4D0WA 5M55A 4P5QA 5M4IA 1J7IA 2J5FA 4IHPA 1SVEA 2GNFA 1M14A 4ZTMA 3QYZA 4YO4A 1SZMA 1PMEA 5K9IA 4O84A 1IEPA 4MWHA 4ZZOA 3JVSA 5L6PA 1YVJA 4FSQA 1Q8ZA 1H08A 2PVHA 4FTTA 5LCKA 3F3TA 1URCA 3OHTA 1JPAA 4IM3A 1H00A 3KRWA 3LW0A 1EH4A 4MWIA 5HIDA 4ZLZA 4XP3A 4UZHA 3QWKA 4BDIA 4NW6A 4AA4A 3Q32A 3UP2A 5HBEA 4PL4A 3PVWA 3HA8A 3SA0A 3G90X 3AC1A 3UVRA 3PIYA 4HZRA 2GPHA 3H10A 3ZDUA 1J7UA 3D9VA 3TV4A 3WYXA 5M57A 1JQHA 1SVHA 1WBWA 5CY3A 1NVRA 3DGKA 5CEKA 5GZ8A 3MVLA 3PSDA 4XP2A 3NRMA 4O0TA 2XIKA 3G33A 3I81A 3TM0A 2YDIA 2ITYA 4L44A 3TJCA 2NO3A 1REJA 3OUKA 3OCTA 3I1AA 3A61A 4ZSGA 2AUHA 3BZ3A 4AU8A 3C5IA 4HGTA 4LV5A 3VUTA 5DT0A 4JBOA 2OIQA 4R5SA 5BVKA 5HBHA 3UOJA 4FV6A 3MFSA 2B55A 2BCJA 4FV2A 4B4LA 3HGKA 5L2IA 3TV6A 3P5KA 2BRMA 2XKDA 3ORIA 4YC6A 3U51A 2YCRA 4BKJA 3HVCA 2J0LA 3BHTA 2VZ6A 4USFA 3GNIB 2BHEA 1ZMVA 4NIFB 4M12A 3R1YA 3KXNA 4WT6A 2EXMA 4N0SA 3PLSA 3QUDA 4YLJA 4JDIA 4Z9LA 3EL7A 5JEBA 1R39A 4DG2E 4BCGA 3KXMA 4C33A 4CQGA 5IQEA 5ETFA 1Q3DA 4UMPA 1NW1A 3QRUA 2Y4IC 3O71A 4X0MA 2F57A 1K2PA 2HW6A 2XJ1A 3ODZX 2E9PA 4CKRA 4BWKA 2UW5A 1YHWA 4KB8A 4BDKA 2BFXA 2UZBA 3EQIA 1J3HA 5FM3A 3RMFA 3D0EA 4DEEA 2R64A 4WNOA 4L01A 2JIIA 4E3CA 3UTOA 3LKMA 3HP5A 5D9HA 4EYMA 5I9WA 1ERKA 4AA5A 3P4KA 5AP4A 2F4JA 1Q61A 4BFMA 2I0YA 4ZTSA 2E9NA 1YDSE 4MQ1A 4DC2A 4TL0A 3N4UA 2X4ZA 3DDQA 4L3PA 4ALVA 4ALUA 1W98A 3UYTA 1ND4A 4XBRA 4ZEGA 4RIXA 4TYGA 3OT3A 3PSCA 5DG5A 1YXVA 5DEWA 3UC4A 4C02A 4HCTA 4O0WA 2WELA 4YLLA 4JLCA 2AYPA 2PVYA 4D5HA 3EN4A 5I9VA 2PE2A 4S32A 5M4FA 1P5EA 5HCYA 4GKIA 3KC3A 5DR9A 4EUUA 3NPCA 3IDCA 3EQPA 1UA2A 1ZOHA 3SKCA 5CSPA 4YNOA 3E64A 2QOHA 5HG8A 5LMAA 3VUIA 5B2KA 2EXCX 4CV9A 2PVMA 5I9XA 3VNTA 5L6OA 3QTRA 2UZLA 2EB3A 1OL1A 2UW6A 2X39A 3DQWA 4IVDA 5EOLA 4AOJA 4FVRA 3DS6A 3AT4A 2J4ZA 4JVGA 4MXXA 5H8BA 3W2OA 4WOVA 3C4CA 4GUBA 3W2CA 3L8VA 2ZYBA 3F3WA 3TTIA 4JR7A 4S31A 4EI4A 3MFRA 4C59A 5BX0A 4Y5QA 5ETAA 2YHVA 3O17A 2PE1A 3SLSA 5IISA 4O0SA 3LCOA 4DEIA 3R7EA 3NYOA 3W32A 4AAAA 3E8NA 5BVWA 4KSPA 3FMJA 3NW6A 4IWOA 5JRSA 4ZY5A 2R7BA 3VULA 1HCLA 3NVMB 4DFZE 3S1HA 3WOWA 3K54A 2XB7A 3L9MA 3RBWA 3F9NA 3PXRA 2VAGA 1GZNA 3CQWA 3CY3A 3PJ8A 3O51A 5JT2A 1ZY5A 4AW5A 3WF6A 3VHKA 5DRDA 2I0EA 3COKA 4IQ6A 1ZMWA 3PJ1A 2OIDA 5EQPA 5KHXA 1OZ1A 1ZOEA 3EN9A 4K0YA 1QL6A 1OITA 2GHLA 2OZAA 4PMPA 2W1ZA 4LV8A 5HTIA 1F3MC 4EOIA 4F99A 2CSNA 2JEDA 4FR4A 3HL7A 3MGYA 5K0KA 2VN9A 4RWIA 1PXMA 3QBNA 3RCJA 1XQZA 3SC1A 4BGHA 4EQCA 4TPTA 1Q99A 4FNZA 1RW8A 1U54B 3Q4CA 3VF8A 3HMNA 4QPSA 3OMVA 2R3JA 1OECA 2WHBA 3G9NA 3I60A 4AW0A 2XRWA 4DT8A 3L9LA 2OLCA 1DI9A 4J95A 3V8TA 4ANNA 5BNJA 5HNGA 2QOBA 4A07A 1GIJA 4R1YA 3QC9A 3R8ZA 3COIA 4BBMA 2XNGA 2Y8OA 3FXXA 3M2WA 2OK1A 3U55A 1PKGA 1R0EA 4E4LA 3UO5A 4FT9A 2XK7A 2ITWA 4NM3A 4OTIA 2O3PA 4KKEA 4Y73A 1W84A 3D4QA 3MJ2A 4E5BA 1VEBA 4BI1A 4C38A 1OB3A 2W4KA 4QYFA 4IC8A 4BCIA 5DBXA 3ZOSA 4M69B 4I5CA 3E7VA 4U8ZA 3VS0A 2BRBA 3F2RA 2CLQA 3BWFA 2XRUA 5E1SA 3BEAA 4R77A 2O63A 2I1MA 3FLWA 3IECA 4G17A 4DGLC 4AGDA 3V5PA 4DEHA 4TY1A 4ANOA 2XK6A 3ZSGA 4WA9A 3PRIA 1OVEA 4BR3A 4BVUA 2V0DA 4JJRA 5J87A 5AP5A 4B0GA 1YOMA 4TWCA 3ORKA 3CGOA 1JKSA 3JY0A 1A06A 4BDJA 1FOTA 2VTNA 3BBWA 4O2PA 4FEWA 4D0XA 4HW7A 3ZH8A 5EQYA 4D2PA 2YLFA 2PZYA 3I4BA 2PVRA 4DTAA 3ZC6A 2X4FA 3JYAA 4Q9SA 2IW9A 3QL8A 1O6LA 1XH9A 4D2VA 4DEAA 2WEVA 1H26A 1H4LA 2Y9QA 2W9ZB 3FYKX 3O23A 3C1XA 1OIYA 2JKKA 3CC6A 4H39A 1A48A 4I23A 4GIHA 4R7IA 1FVRA 5FDPA 3JUHA 3GUBA 4WUNA 4FSNA 4ZSLA 3QUEA 1WBOA 4CZYB 3Q4UA 4FEVA 5HORA 2CNQA 1E1VA 5EI8A 4R78A 3SOCA 3NDMA 3OC1A 5CQWA 3CBLA 2JKQA 3DXQA 1YOJA 3WARA 3UZPA 3PY1A 4P7EA 4MK0A 2XIYA 1KV1A 4WUAA 3UE4A 5AV3A 5EHOA 4EZ3A 2HCKA 2JDRA 3ZDIA 4EKKA 2DYLA 1V0OA 4G1WA 4Q2AA 4YPSA 1T46A 3L9PA 2VTQA 4C36A 2C6OA 2QOCA 4LOOA 3FZSA 2JAVA 1PW2A 3PZEA 3SOAA 5AAEA 4XMOA 2UW7A 5IU2A 1FGKA 3E7OA 3OBJA 3VS5A 5GZAA 4HGLA 4QP1A 2W5BA 2XKFA 3QA0A 5IA4A 4EZ5A 1Q62A 4EOLA 1PJKA 3EJ1A 3LE6A 3PWDA 2C6KA 3F66A 5JMSA 4TYHA 2QONA 4LUDA 5A54A 2VD5A 4A9TA 1M52A 4MXZA 3IKAA 4W8EA 3A8XA 4L9IA 2EXEA 4UWCA 3ROYA 4DGMA 4YZDA 3BYVA 5CSVA 3BRBA 3LFQA 5EH0A 4F9BA 1XH8A 5DR2A 5H8EA 4IM2A 4D9TA 4MX9A 4FZ7A 3R7IA 3OWPA 2W9FB 4FEQA 3RZFA 3TEIA 3WIKA 1ZYSA 4RC3A 3R2YA 3E8EA 4DT9A 3MPTA 5DI1A 4XS2A 5CXHA 1YHSA 5FTGA 5BYLA 3IDPA 5C8MA 2DUVA 1U5QA 5T3QA 1H0VA 3GU7A 3NSZA 1XBCA 3A60A 3KRJA 4K2RA 1OUKA 2YLEA 3KVXA 3TV7A 3VF9A 5J5TA 4C57A 1G3NA 4G3CA 4UZDA 3SQQA 2UZNA 3Q2MA 4XX9A 2E9VA 3R7UA 3TWJA 4A9SA 1M2PA 3AT2A 5L8JA 4Y95A 4J52A 3VRZA 4PMTA 4EOJA 4G3DA 2IW6A 4QNAA 4RT7A 5CNNA 3CJGA 3VS6A 4RJ7A 3FKLA 4FKPA 4U45A 3ID6C 4AZEA 4RX9A 3EQFA 4EHZA 3QTWA 4UV0A 5HEZA 3ZMMA 1ZARA 2X7OA 4LGGA 3QD3A 1XH7A 4CCUA 3QLGA 4DGNA 3OBGA 4HGSA 2EB2A 3E8DA 3QALE 1P4FA 4GH2A 5HCXA 3S00A 2CDZA 1VZOA 2F7ZE 3R7YA 4DFUA 4KWPA 5J9YA 2HZNA 3A7HA 4MXOA 2X8DA 2RF9A 2ZDTA 3SW4A 4DGGA 3TIZA 3I7BA 3R63A 4NCTA 4MD7E 4C2VA 4HYIA 2W1IA 4PTEA 2GHMA 4K33A 4IFGA 4JXFA 3TN8A 4G6LA 5TF9A 3PY3A 5EK7A 4KNBA 3DBFA 5FBNC 4L3JA 4O91A 2WTVA 4R3CA 3AMAA 4AW2A 3ITZA 5HVYA 2PZPA 3QX4A 5E8ZA 3OT8A 4FIHA 3PJ3A 5CENA 3EYHA 5HU9A 3TNHA 4LRKA 4L45A 4FVQA 2JIUA 3PXYA 2ZV9A 4GJ2A 4XH6A 3R7OA 3I6WA 5A4EA 2WTKB 2UVXA 3NUSA 3FMDA 4M3QA 2HY0A 4L42A 2WPAA 1MRYA 3KXZA 3OCSA 2PVKA 4U43A 3FLNC 2A2AA 1BUHA 2XZSA 4FIEA 4IB3A 5HLNA 1H07A 5HE0A 4NYEA 4FV7A 1URWA 3SRVA 4DBNA 3RHXA 3TKHA 3KVWA 4TZRA 4NKSA 1H27A 4J1RA 3PP0A 3W16A 3QQGA 4BZOA 5CAQA 4J97A 1Q3WA 1YXUA 3G5DA 4ITJA 4R3PA 5DOSA 3TKIA 2F2UA 5HVJA 2J0KA 4QYEA 3TZ9A 4KS8A 1Y6AA 4KABA 2UZTA 4ZTNA 4Z16A 4H3BA 4QYYA 4GG5A 2VTLA 3OZ6A 1YI3A 4R3RA 5AV4A 4HOKA 1BL6A 2OF2A 5F4NA 4YMJA 1JNKA 2WMRA 2RFEA 4YSMA 1I09A 3TNWA 1YWVA 3FI2A 1UV5A 2B9IA 3UGCA 4A06A 3NMUF 1FGIA 4B9DA 2EVAA 4UWBA 4AG8A 3FMNA 2W1EA 3F3VA 4RIXB 2V55A 1JWHA 4AZSA 3ACKA 1BYGA 3FLZA 4O0YA 3PRFA 5FLFA 3ZONA 5BYYA 5JZNA 3TI1A 3OXZA 4KBAA 4YJRA 3OCGA 5CAOA 4IAKA 1IA9A 3VJOA 4QO9A 5HNIX 1J1BA 4HYUA 2WTDA 3RGFA 2C1BA 3QKMA 5H2UA 1TKIA 4G31A 2KULA 4IW0A 2RGPA 2GTNA 4FKOA 3UMWA 4AGCA 2VGOA 4QMPA 3R83A 4O86A 4ENYA 2QO2A 3U9CA 2X9EA 3UDBA 5AA8A 4JX3A 4PDSA 2OF4A 3FZRA 3FZ1A 3VUHA 5CF4A 3KMWA 4D1XA 3ENHA 4MF0A 3UG1A 3F61A 2PUPA 3NNVA 4KRDA 2R3RA 3HDNA 3NUYA 1XWSA 3BHHA 4YC3A 1HCKA 2P55A 5FDXA 1UWJA 3LM0A 4GIIA 2PULA 4UMQA 4U7ZA 3UOKA 4JDHA 2PUIA 4F0IA 3HMOA 2OJ9A 1PY5A 2QOIA 3LCDA 3ZUTA 4YUQA 4PMSA 5DGZA 1CKPA 4MXYA 1QPDA 4LM5A 5HE2A 3GC8A 3HKOA 3PG3A 4F6SA 4CFMA 1L8TA 1IG1A 5EI6A 2FSTX 4IM0A 3UIUA 1KWPA 4QMUA 2ZV8A 3BIZA 3MY1A 3RKBA 3T8OA 2JDTA 3RPYA 4ORKA 5KBRA 5LVNA 3OY3A 4PF4A 5DFPA 3FSFA 4G6NA 5IA0A 3WBLA 4XG3A 3RWPA 5AFVA 2GSFA 2BZKB 3KA0A 4FL2A 4HYHA 3EQBA 4BIBA 4GEOA 3D2KA 3ZRLA 2XYNA 4AN9A 5M4UA 5HQ0A 1I44A 2YITA 3LXKA 4NL0A 3RAHA 2XKCA 2OZAB 2C5XA 4LQMA 2CLXA 5BVDA 3EN6A 3A4PA 4LOPA 3WE8A 5GIOE 2C47A 4KD1A 3W2QA 5HU3A 4IH8A 1OI9A 3ZTXA 3PWYA 2B7AA 5FD2A 3PE1A 1ZAOA 3F5GA 4TRLA 3CEKA 3KREA 1JLUE 1UNGA 2ITZA 1V0BA 4Y5HA 5GHVA 2X2MA 5IDNA 5HGIA 5CEPA 4QPAA 3G15A 4MD9E 3ZM4A 1PMUA 3CE3A 2H6DA 3CD8A 5BMSA 1M17A 2ZMDA 4MBIA 3CPBA 3ZHPC 3Q52A 4O1OA 4HNIA 3NEWA 3GCUA 4BKZA 2QHMA 2XIZA 4D9UA 2FUMA 4UMTA 2XS0A 4F65A 4ZMEA 2QO7A 3V3VA 2ESMA 1ZZLA 4F6UA 3U6HA 3MB6A 3DAEA 2B9FA 2ZB1A 1H1RA 3QQUA 5C9CA 2ITQA 3QAME 4RA4A 3Q6WA 4FKSA 4ASDA 5A6OA 4FT5A 1O6YA 4M68A 5ITAA 3KXHA 5EQEA 3FMLA 2OXYA 3MVMA 3UP7A 3GGFA 4TT7A 3M42A 4RSSA 4GT5A 1YW2A 1LUFA 3O0GA 4DH1A 4BCFA 4O82A 3GENA 4G2FA 3FQHA 3QQJA 2VX3A 5F94A 4U41A 1VJYA 3F7WA 4DITA 4IC7A 2PUNA 5HG5A 3RNYA 4IX4A 4NH1A 3ZO3A 4CKJA 4CTCA 4G3GA 3MESA 2WU6A 5FBOA 3A7IA 3R8MA 3IQ7A 4X3JA 1RDQE 2C69A 5AP1A 4FC0A 3D5XA 2PMOX 2R3MA 1MQ4A 3LCSA 4RWLA 3HMIA 3BYOA 5HKMA 4D4SA 4MVFA 4U80A 3UOHA 4XG4A 4EH6A 2X1NA 2ITVA 1ZYLA 4AZTA 4IXPA 4FKVA 3RPVA 2HELA 1R3CA 5AEPA 4I6QA 4DFNA 5KMIA 2PVLA 2UUEA 2JKMA 5HE3A 5IZFA 5K4JA 1V0PA 2YCSA 3QQFA 3WF7A 4J96A 2RFNA 3OXIA 3AMYA 5FUTA 3Q53A 3B2TA 1Z57A 3DBQA 3Q9YA 4DG0E 4EH3A 3KL8A 2WMXA 1GIHA 3GC7A 3MTFA 2QC6A 5DNRA 3W55A 2ZM4A 5HI2A 3C13A 2WTJA 4ZLYA 5IG1A 2C1AA 2C5OA 3SHEA 4EWQA 4EK3A 4GUEA 1LR4A 2IPXA 3BQCA 4C0TA 5JFVA 4XRJA 3A4OX 3H9OA 3TZMA 3C4WA 3WZDA 2C6EA 4Y8DA 4FTKA 4O7SA 3OWLA 3TDWA 3AG9A 4CEGA 4RLKA 4EQUA 5C27A 3H30A 4MF1A 4FODA 3UJGA 4K8AA 4E8AA 3PP1A 3R28A 1F0QA 3BQRA 4FTJA 3DTCA 3EN5A 3O96A 1WAKA 3CXWA 4V01A 4XOYA 4PX6A 5KKRB 5AP2A 2WNTA 4ZTRA 3BX5A 5IQCA 3LQ8A 4EOMA 2VWYA 4FVPA 4GS6A 4WNPA 5E91A 3UVPA 2QQ7A 3VW6A 2VTRA 2ZV7A 4TYHB 4ERWA 4H3QA 4IACA 4QMSA 4USDA 5CF6A 3S0OA 4NEUA 4OTFA 1H8FA 3F6XA 3V5LA 3PPKA 3DK3A 4FUYA 3MYGA 3ORNA 2WQOA 4BCJA 4A7CA 1GNGA 3DV3A 5DIAA 5HNBA 3OFMA 5BMMA 4M67A 4EOKA 2YAKA 3GT8A 5D41A 1SNXA 3RJCA 4HNFA 3VUDA 4O6EA 2WZJA 5LWMA 1G5SA 2W96B 4IWQA 4ZZMA 3GOKA 5J8IA 3RALA 2HZ4A 1PXJA 5EYDA 3R04A 3NUPA 4M0ZA 4O0RA 4ZMFA 3Q9WA 3CSVA 2JAMA 4L53A 4CMUA 3HAVA 3G0FA 3R71A 4MAOA 1PXNA 5CSHA 3WF9A 3HV3A 2VTJA 2BRNA 4QQJA 2F9GA 4RVKA 5CYIA 3VIDA 3DB8A 3EQRA 3N9XA 2ZJWA 3DBCA 3VQUA 1PXIA 4PRJA 3DKCA 4DAWA 1GIIA 4CMTA 3ZFYA 3BE9A 4KIOA 5AAFA 2FVDA 3O50A 3VS3A 4CLJA 3ROCA 5L3AA 4IAZA 5CF8A 2W0JA 4C4JA 3L8XA 3LCKA 3E3BX 4AZFA 2J7TA 1OIUA 1OPJA 2Z2WA 5CVGA 5LVOA 3KCFA 2ITOA 4EH2A 4LUEA 5CALA 4R6VA 1W7HA 3NIZA 5HG9A 2YIXA 3VBWA 5A4QA 4RJ4A 2O2UA 3Q4ZA 4FYNA 3TL8A 3GBZA 1YXXA 2RKUA 3D83A 1YOLA 5AUUA 2JBPA 5M44A 5AIRA 4UMUA 3LZBA 3TACA 3OEZA 4U97A 2J90A 5I4NA 1Z9XA 5LJJA 5M4CA 4D2SA 4EC9A 3AQVA 3NUNA 5A9UA 3IGOA 4XYFA 5TE0A 3AD4A 5EKNA 1KV2A 4CYJA 3W2PA 3NYXA 3RPOA 4YZBA 1P4OA 3E88A 5BPYA 3HV5A 5LVMA 4W4XA 4EBVA 4FIGA 3KRLA 4YP8A 1Y8YA 2VGPA 2XBJA 4L52A 4X3FB 2PMNX 3R8PA 2VTOA 4CQEA 4CG9A 1Q97A 5HBJA 3UVQA 2IZTA 5BYZA 2OH4A 3ETAA 5EG3A 3IOKA 3D94A 2H9VA 3R1SA 3IDBA 2HENA 2LAVA 2PL0A 4H36A 2J9MA 2PZRA 2XNMA 2NRYA 3PFQA 4JQEA 4QP3A 3BLRA 3MA6A 3P23A 3SRVB 3BGQA 2PVFA 4D2WA 4U5JA 2XNOA 3UZRA 3ZO1A 2XIXA 4O7NA 3KGAA 4FG9A 1GOLA 4G16A 2ZMCA 3C4XA 4QRCA 3LFDA 5CVHA 4MQ2A 3NX8A 5AP3A 3NAXA 1BKXA 4FX3A 3A99A 4IDTA 4BIDA 2DS1A 3GU4A 3CGFA 2PY3A 4GFGA 5AX9A 3G2FA 3P79A 4MBLA 4BC6A 4QMQA 3HV7A 1VR2A 2B9JA 2YERA 3MFTA 4WG3A 5T68A 4Z7HA 5B2LA 3R7GA 5JH6A 5J1WA 5ANEA 1TQIA 1Y57A 2WD1A 5HZNA 3GC9A 4EONA 3QHWA 2W1FA 4JBPA 3QCSA 4G5JA 2VX0A 4Q5EA 3VRYA 3RK7A 2UVZA 4ITIA 4IWDA 3MY0A 3ZRKA 2VTMA 2Z02A 4BCQA 2R2PA 2OJGA 3IW6A 5DA3A 4LOQA 4RJ6A 1KE7A 2H34A 5D7AA 3CKWA 5IA3A 5CLPA 3PZHA 3RZBA 1AD5A 5HCZA 3G6HA 2X81A 3DZOA 1WBSA 4EHGA 5JSMA 3R9NA 1OKZA 4FSYA 4U3ZA 4PMMA 5G1XA 2CMWA 2VU3A 4Z55A 5C26A 5KMJA 3OD6X 3OWJA 4U81A 4FOCA 4YJUA 3IW4A 2PMLX 4YJOA 4FL3A 5F95A 2W06A 4RJ3A 4YHFA 2WMTA 4HVIA 4O7LA 4ZOGA 4I4FA 4BI0A 3PJCA 4F08A 3EHAA 2R0UA 5AADA 5JGDA 3ZFMA 3FYJX 5HTCA 2HIWA 1JSTA 2OGVA 2ITNA 3FJQE 2Q0NA 3DFAA 4FKRA 4MBJA 2BMCA 2GNIA 4S2ZA 5M09A 3SV0A 2EU9A 3VBTA 2C0OA 5L2WA 3OVVA 1KE8A 2Z7SA 4PDYA 3NIEA 5E1EA 5K5NA 4Y46A 4BI2A 2BPMA 3MS9A 4DEGA 1R78A 2BAKA 3R2BA 4TNDA 2WGJA 3V01A 4AACA 3VVHA 3DNEA 2XF0A 2R3OA 3BI6A 3FE3A 4RIWB 3AC2A 3GQIA 4ANSA 4F7JA 4Y85A 4QMVA 3THBA 5B2MA 5E92A 1WBVA 3FLSA 1U5RA 5DR6A 4KSQA 4CZTA 5DMZA 2CGWA 1PYXA 3KB7A 4EOOA 4E6DA 3U54A 5A14A 1GAGA 2WB8A 3T9TA 3ODYX 3DQXA 4D2TA 4PNIA 2CGXA 4QMOA 5FM2A 3MIYA 3F5PA 4FK3A 2FO0A 5EW9A 4ANQA 4JBVA 5HIEA 5E4HA 5AMNA 4AGUA 4RQKA 4GU6A 3Q60A 4X2FA 1AGWA 4QP9A 1PMNA 4RVLA 3IOPA 3QGYA 4D55A 3MA3A 5I3OA 3HEGA 3VJNA 4UX9A 4I5HA 5GNKA 4DEDA 4GK3A 4XG2A 5F9EA 3E93A 5AR3A 2XEYA 4Z7GA 5JGAA 5LXMA 2PTKA 3KF4A 1YXSA 2RFDA 4IFCA 1JKKA 4GMYA 3CD3A 1BMKA 3LJ1A 3S2PA 4NM7A 4RX7A 4F9AA 3TNQB 4DCAA 5D10A 4IWPA 3V8SA 4GFOA 3H4JA 4WBBB 4XJ0A 1OBDA 4GL9A 3VBXA 4CMOA 3DLZA 4NM0A 3PE2A 4DGOA 2HZIA 2BIKB 4EH4A 3MVHA 2RL5A 4IIRA 4O83A 2VO6A 2R3FA 3C7QA 5DHJA 1UU8A 3CCNA 4RFMA 4FKGA 1H01A 4P90A 2IG7A 2WIPA 4V0GA 3DZQA 4DTKA 4QPMA 4HJOA 5KZIA 4WD5A 3SXSA 4RIYB 5IH6A 2IVSA 3EQCA 3MPMA 3RP9A 4A4OA 4ASXA 2ZV2A 4DH7A 4WIHA 4ZY6A 1FVTA 3NCGA 3QQLA 3KXGA 4OBPA 2Z60A 4U79A 1U46A 2C5VA 4KAOA 2GNGA 2QCSA 4V05A 2FGIA 4BDCA 4C8BA 4EQMA 3AD6A 4FA2A 2BDWA 2WQEA 4DH3A 5HD7A 1H24A 5DVRA 5CU0A 1JBPE 5EHYA 3GQLA 4FG8A 4ASZA 3Q3BA 3QRTA 2XH5A 2Y4IB 1YKRA 4N57A 5HX8A 4BTFA 2CKEA 5IPJA 1XH6A 1H25A 4FTUA 4IANA 4C35A 1PF8A 4FK6A 3TKUA 2PVNA 3W8LA 3ORPA 3NUUA 1NVSA 4JIKA 2QLUA 3LAUA 4G9CA 4X2JA 3ULZA 2CKPA 4EL9A 4O7ZA 5IQAA 3E5AA 4IAFA 4OUCA 4QMYA 3BPRA 3C4ZA 4BIEA 4QT1A 3PJ2A 4DA5A 2XK8A 3BLHA 4EJ7A 3NAYA 3QD4A 3NCZA 4K11A 1ZMUA 2CCHA 2XJ0A 2XP2A 3PIZA 5CVFA 4HCVA 4HPTE 3TJDA 1PXOA 3Q6UA 3LOKA 4I5MA 5HHWA 3C0GA 4FSRA 3ALNA 4JQ7A 2CN5A 4AT3A 4E73A 4X21A 3VHEA 1AQ1A 1Q8TA 3KRRA 2YEXA 1XH4A 3C5UA 3NYVA 2W17A 3MSSA 3LFBA 3PTGA 1WCCA 4IMYA 4RFYA 2CCIA 3IG7A 4O7VA 3HDMA 1O6KA 3VAPA 4MXCA 5EKOA 3CJFA 4MTAA 4E4NA 4QYGA 5AM6A 2KTYA 1J7LA 3GVUA 1BI8A 2OSCA 3CS9A 4K77A 3R02A 3VS1A 4UXLA 4HVSA 2W1HA 4WO5A 4BY9E 4GRBA 2XNPA 1JKTA 5EW8A 4S33A 4BDDA 4AF3A 2YN8A 5E8VA 4ENXA 4L00A 5F20A 3O8UA 3PSBA 3QTUA 2RSVA 4LGDA 4TYEA 4FNXA 4ACGA 1PRYA 4AFEA 3ZEPA 5E90A 3Q96A 3E92A 4YNEA 4G6OA 4RFZA 3LFNA 3VS2A 2H8HA 4DINA 2UZUE 4YO6A 4A9RA 5A3XA 3NNUA 3I79A 4F1MA 4CFNA 5CAUA 4BDFA 2JD5A 3LCTA 2WTIA 5HO6A 1OMWA 3BYMA 3BGPA 2YABA 2QG5A 3JY9A 4FTNA 5DT4A 4RPVA 3QZHA 5CZHA 3MN3A 5B7VA 4FNYA 5I9ZA 3NVKI 2JDSA 3HA6A 4OTWA 2FB8A 4GCJA 4O38A 2X8EA 4QTCA 3TZ7A 2I6LA 3BEGA 3UQGA 4BGQA 4GSBA 4RQVA 4NTTA 4FE2A 3WI6A 1YI4A 4JG6A 3UO4A 3LLAA 3GFEA 4IAIA 4R8QA 2O0UA 1X8BA 4LRMA 5BUJA 2PZ5A 4IZ5A 4OR5A 1YI6A 4AS0A 1SNUA 4E6AA 3HZTA 3P7BA 4F7NA 1UVRA 4FTQA 4EHEA 3A62A 3BV3A 4R7HA 1P2AA 1OPLA 3QTQA 3VN9A 3F82A 2WTWA 1LPUA 1T45A 2AC3A 3V51A 3E62A 3L8SA 3ZCLA 3AMBA 4BCMA 4DFYA 1NVQA 2XNNA 4D2RA 3ZSIA 5J9ZA 4HPUE 5AUXA 1U4DA 2PPQA 3C9WA 2PMIA 4BTKA 2OW3A 3HYHA 5ETCA 2ZM1A 3BYUA 3QZGA 4S34A 2E2BA 2WMWA 3R9OA 5AAGA 2SRCA 2YIQA 3MJ1A 1LEWA 4XG9A 3CR0A 3FLYA 3ZBXA 4F6WA 4EH8A 5C1QB 3K3IA 4O0VA 4QNYA 5E8YA 4UYNA 1GJOA 2VO7A 2WEIA 3GCSA 4MCVA 4DLIA 4NJ3A 3UOLA 3V04A 3R9DA 2A19B 3P1AA 4GG7A 4RVTA 5D1JA 3WYYA 4UB7A 4FIJA 4FSTA 4I21A 2G9XA 2YACA 3D15A 1OL5A 3ZYAA 4UBAA 3TZ8A 4EOPA 3FC1X 5IEYA 1NT2A 2J51A 2C3JA 2XCKA 3CTHA 4NIFA 3P78A 3ZLYA 3SXFA 5I0BA 4GK4A 3C50A 2DQ7X 2QOFA 3HRCA 1IA8A 2C3LA 4XV3A 2QG7A 4ZZNA 3B8QA 4F70A 2R4BA 3Q9XA 1LP4A 4O0XA 2XYUA 4GK2A 3EL8A 2XM8A 4DCEA 5CXZA 3PDTA 5DT3A 4F1OA 3R21A 4BTJA 3RI1A 4FV4A 3U4WA 2VWZA 5IH4A 4PP9A 2YM7A 4QMZA 3DJ5A 3FMKA 4ZAUA 3MDYA 5DE2A 2C3KA 3R73A 1DAWA 1H1PA 4GFMA 5JK3A 3RINA 3TXOA 1OKYA 1Z5MA 2WQNA 4JBQA 1KSWA 2CKOA 5TT7A 1YXTA 3R30A 3QKKA 4XUFA 3WZEA 4C4EA 1Q8YA 5KHWA 3UBDA 5AJQA 4F64A 2B53A 3P9JA 1OBGA 5LMBA 2ETRA 5BVFA 4OTDA 3UG2A 4MHAA 3BU5A 2XKEA 2X2KA 3E87A 1GZ8A 3QFVA 4FT0A 3QD0A 4APCA 4E4XA 5L8KA 2RFSA 4RZVA 2C6LA 1FBNA 4FSWA 5CU4A 3ZXTA 3NW7A 4FSMA 3MH2A 4NFNA 5C4KA 4ITHA 2WMSA 5KZ0A 2PU8A 4ZTQA 5CQUA 4IVBA 4JT3A 4EEVA 1KE5A 3UC3A 4BHNA 4O7RA 4FV1A 4FYOA 5IA5A 4A4XA 2ZAZA 4NKAA 4AP7A 2ERZE 3N4VA 5EI2A 3FL5A 3D2IA 4F7SA 3SX9A 5AP0A 4IX3A 2W1DA 4RX5A 4NTSA 1B6CB 2CNUA 3IK3A 2Z7RA 3H9RA 2Q0BA 1LEZA 2VWVA 4X2GA 3SGCA 3SD0A 2QU5A 3ZEWA 1P14A 1WBTA 3CKXA 3F5XA 1JSVA 3FPQA 1ZYCA 3JVRA 3RM7A 4DN5A 5EW3A 2ACXA 4I24A 5LMKC 3UNKA 1IASA 3EFKA 5CEIA 1NA7A 1PXKA 3PIXA 4UY9A 3QCYA 3RK5A 4CKIA 2ZDUA 5HICA 4RGJA 3EKNA 2UZOA 1OL2A 2HAKA 1H1SA 3MY5A 4UXQA 4MYGA 3QXPA 4C3RA 5L6WL 2LGCA 2PWLA 3PVGA 3EZVA 2CPKE 4FI1A 4CFUA 5BVEA 4GKHA 5KMOA 4I0SA 4EUTA 4P5ZA
chains in the Genus database with same CATH superfamily
5A4TA 5JQ5A 2QI8A 2BZJA 4HCUA 3EFWA 3T3UA 2O5KA 5LVPA 3P7AA 4BICA 2JDOA 3QRJA 4FKQA 3L8PA 5AR5A 3UNJA 4E4MA 3F3ZA 4RRVA 4BDEA 4I6BA 1UWHA 2ITXA 3WZUA 2VWUA 4H1MA 2IZSA 5IMEA 4DHFA 2QNJA 4TW9A 2ZM3A 4C2WA 4CLIA 4YJVA 4CSVA 4D1ZA 2J50A 3F5UA 4QTAA 4WRGA 1R1WA 4G9RA 4JS8A 4ZJIA 2IWIA 5EOBA 2QOKA 5GJFA 3ZO4A 3Q04A 4FKWA 2IO6A 2VTAA 1IAHA 2B54A 4WNKA 4BN1A 5J5SA 5KBQA 2OFVA 2ITTA 4Q5HA 3QA8A 4EK5A 3GU8A 3R6XA 4PDOA 5HLPA 4OGRA 4L8MA 5DLSA 3F2AA 3U87A 3NUAA 4CCBA 4AT5A 4GYGA 1U54A 2JFMA 4J53A 3TIYA 3HP2A 3JS2A 3W1FA 5JGBA 2Z8CA 5IDPA 4RWKA 3A8WA 4XP0A 3BYSA 1OGUA 2C68A 3TNPC 4K18A 4YJQA 3RAWA 2EUFB 2HW7A 3QTXA 4ZSEA 4DTBA 5EM5A 1WVWA 1OPKA 2HYYA 4BCNA 4O2ZA 3VO3A 3AOXA 4TYJA 3WIGA 4O96A 4FKIA 4IDVA 3RWQA 4FICA 2WXVA 3R00A 4W8DA 4E1ZA 3QCQA 1YQJA 2X7GA 5FRIA 2NPQA 3C4EA 4H1JA 5G6VA 4TWOA 3U6IA 3A2CA 4W9XA 4X7QA 4AAYA 1FMKA 4X2KA 4E7WA 3W0MA 2I0HA 3GCVA 3FC2A 2QURA 2XMYA 1Q8WA 1CMKE 4XV9A 4M69A 4WG5A 5FTQA 4O22A 3IS5A 5HE1A 3MH0A 3OUNB 5ANGA 5CT7A 4I4EA 4DF3A 4YJSA 4FV5A 3ZBFA 4YSJA 2BUJA 4BWPA 4PUZA 4EOQA 4PPBA 3U9NA 4E6QA 5ANKA 2HZ0A 1FVVA 3JR1A 4V0GB 2JGZA 2C5YA 1FMOE 4NWMA 3POOA 4YJNA 4XG6A 3VC4A 4ZTLA 1PHKA 1V1KA 2R3KA 1XH5A 5D11A 3UIMA 5KX8A 3TUBA 2VNWA 4FV3A 1KOBA 5CTPA 4YJTA 1O9UA 4KA3A 3NNXA 3PA3A 4QP7A 3EWHA 4L67A 3TDVA 1M7NA 4DH5A 4EBWA 2Y4PA 2YM5A 4MXAA 3ZLXA 2GS7A 2C5NA 5DH3A 3R8VA 2XK3A 4CT2A 3DTWA 5CAVA 2XA4A 3MFUA 2C6MA 5ANIA 4JRNA 5AV1A 3PY0A 5HX6A 4K1BA 3KEXA 1A9UA 3EIDA 4KIKA 4UEUA 3EB0A 4C4HA 3W0OA 3SG8A 3KN5A 5M51A 4YLKA 5A46A 4BCOA 3DBEA 3VWAA 2CGVA 5L4QA 3OP5A 3QC4A 4C61A 4FNWA 5AM7A 2OWBA 4BDAA 4GU9A 3NW5A 2BIYA 5AUTA 3DBDA 3C51A 3FDNA 3VS7A 3QKLA 2BZHB 1W8CA 1XHAA 4M13A 2C30A 3P7CA 4RC2A 3I5NA 2BZIB 4R7BA 1RJBA 2Z7QA 3HV4A 3QQKA 2JBOA 2FSOX 2O8YA 2YISA 3LJ2A 4V04A 4XG7A 2VTPA 3VBQA 4CV8A 1JSUA 2W4JA 3GCPA 3B2WA 2JDVA 1OL6A 3AGMA 1WBPA 2XBAA 2ITPA 4EH9A 3V6SA 3KCKA 4PV0A 3FL4A 3DT1A 4EWHA 3GCQA 5IQBA 3FWQA 3PLAE 3QX2A 3QRKA 2IVUA 5CZIA 3HX4A 2GHGA 3Q5ZA 3I0OA 4O1PA 3IW7A 2WOTA 4JNWA 5J1VA 3I6UA 3EFJA 3U4UA 3COHA 1PMVA 4PQNA 3UZTA 2JIVA 1UU3A 2R3IA 2A27A 3OCBA 4YTIA 4YU2A 4GJ3A 2WTCA 4CVAA 3D5UA 4ZSJA 4G34A 4FGRA 3ZLSA 3T3VA 4APPA 2UW3A 2FSMX 3EKKA 4LMUA 3PVBA 1YRPA 3ZFXA 4DH8A 1JVPP 1Y6BA 2A0CX 2V5QA 2YIWA 4M0YA 2QODA 5FEDA 1STCE 4JQ8A 2X0QA 2IZRA 4YZMA 4NW5A 4F7LA 5E8TA 2UZVA 2EWAA 4JX7A 2ZB0A 2O65A 4BTMA 2GQGA 4D5KA 1Y8GA 2VWIA 4A4LA 4AWIA 4ERKA 2ZVAA 1K9AA 3QZIA 4Y83A 2YCFA 5JN2A 4QMXA 4ACDA 2WFYA 4C7TA 2ZOQA 4FTLA 4C4FA 1MRUA 4NU1A 4EKLA 4CD0A 1ST4A 2IVTA 4KKHA 2CGUA 1IR3A 3BU6A 1HOWA 4PL3A 3ZLWA 4PTGA 3B8RA 3UODA 3F2NA 4DEBA 3LMHA 4QTDA 4FEUA 3E8CA 3BHVA 3OWKA 4KINA 3I7CA 4I6HA 4B99A 2OFUA 3FQSA 2YAAA 5KE0A 3ELJA 3IGGA 4LL5A 5FP5A 2B9HA 5BUEA 3NUXA 3HLLA 3R9HA 3FLQA 4WSQA 3QTIA 1E9HA 1BI7A 3H9FA 4FKJA 4HZSA 5LARA 4CZUA 4TN6A 3WF8A 5FWKK 4JR3A 2WO6A 4AGWA 1XKKA 2V7AA 4MNEA 5CU6A 2J6MA 3ERKA 4NK9A 4FUXA 3REPA 4UN0C 3C0IA 5FTOA 4D28A 3FMEA 3E63A 3BHYA 2XK4A 3EQGA 3GEQA 2E9OA 2C0IA 4K9YA 1IRKA 3WZJA 2P2IA 3A7JA 3FHIA 2QOOA 5GINE 4TXCA 2YZLA 2QOLA 3GFWA 5HG7A 4HVDA 1YDRE 1WVYA 2BROA 3R0TA 2YM3A 4A9UA 5AV2A 2C6TA 2WOUA 4MD8E 5IF1A 4B6LA 3UQFA 3CTQA 4BKYA 3ENMA 2P33A 2QKWB 4O0UA 1FPUA 3D7TA 1J91A 3ANRA 3CIKA 3MI9A 3FSKA 5AWMA 1WZYA 2R7IA 1Q41A 1CSNA 3QF9A 2G01A 5D7VA 4IB1A 4NT4A 4B8MA 5JFWA 1SMHA 2R3QA 3A7FA 3K5UA 5J79A 3UPXA 5J7HA 2PSQA 3QD2B 4CRLA 4AE9A 4LMNA 2GTMA 5E8XA 4L6QA 4J8NA 4BGGA 5ACBC 3SXRA 4FT3A 4FTAA 1QPCA 4FL1A 4JI9A 4UWYA 4YHJA 2VTTA 3PVUA 4DYMA 1Q24A 4W4VA 1YDTE 2HWPA 5FXRA 4OLIA 1UKIA 3PXZA 4O81A 3MV5A 2YWPA 2ETKA 3K3JA 3P08A 1U59A 5CEQA 3HECA 5AUZA 3MIAA 4USEA 3UIBA 2AC5A 3V8WA 3IPHA 3ZU7A 4EK4A 5BVNA 3TMOA 1XJDA 4GVJA 2GDOA 2G1TA 4NZWB 2QOQA 3R8LA 5AA9A 4J71A 5EYMA 5J95A 1RQQA 3O7LB 3BELA 4X2NA 1H0WA 5GJDA 3H0YA 3PA4A 3W33A 1TQMA 4ZJVA 4GW8A 3ORXA 5LOHA 3IONA 4ACHA 3F88A 3PG1A 2R5TA 5DN3A 5CF5A 4ZS4A 5AP7A 4BB4A 5JKGA 3CY2A 3U6JA 2BDFA 1W0XC 2QO9A 4IADA 5IUGA 1SVGA 4ONAA 4OAUC 4P2KA 3CPCA 3R01A 2BAQA 4UMRA 4OW8A 4AZVA 3O8PA 1WBNA 2QHNA 1WVXA 3AKKA 3D14A 2CJMA 3L1SA 5D12A 4GT4A 1OIRA 1ZZ2A 2QR8A 4C3PA 5IA1A 5EYCA 2OZOA 4F63A 5HO7A 4MNFA 3NR9A 5E7RA 5GIPE 4O7WA 3LFSA 2YIRA 5IQDA 3BV2A 2ZFYA 2YA9A 3DAJA 3KK8A 2PE0A 2PVJA 5HO8A 5HOAA 3FHRA 3KQ7A 4RJ8A 5LVLA 2V62A 3FMMA 4U9AA 4KUJA 4I3ZA 3QQHA 4M66A 3KKVA 2OJIA 4W4WA 2WQBA 4O4EA 4ZS0A 2W99B 3N4TA 4BYJA 2XALA 2VWXA 2XNEA 5KCVA 4D58A 1GZKA 2X6DA 4FSUA 3RAIA 3CTJA 4MH7A 4EH7A 1OIQA 4EORA 4CT1A 4AOIA 4C3FA 5IA2A 3R7VA 3G9LX 4KBCA 3BCEA 4CFFA 4WRSA 3LPBA 3RPSA 3SAYA 5CT0A 4F0GA 2XUUA 3ULIA 4QMTA 4AN3A 4ANBA 3ORTA 4JAIA 3AC4A 2NRUA 2QU6A 4PNKA 3K5VA 3ZO2A 5KMLA 4RBLA 4H58A 3V6RA 3DY7A 5FQDC 2BILB 4QMLA 4AFJA 3W2SA 3LFFA 2W05A 2R3HA 3FAAA 4DFBA 4U40A 2HY81 2IJMA 2OBJA 3QUPA 3OF0A 2BTRA 3NLBA 4J98A 4XV2A 5M53A 5HVKA 4CG8A 3BGZA 5TKDA 5I3RA 2C4GA 3DJ6A 3UYSA 4FTMA 4JOAA 2Z7LA 5IQGA 4F9WA 4BCKA 3FI4A 3WZKA 4FEXA 1ZRZA 5EDRA 5FG8A 2YM6A 5CU2A 5J9LA 4RIOA 2VTIA 1Q4LA 4N4SA 2BKKA 3AC3A 3LQ5A 3V5TA 3LQ3A 2OO8X 3GXLA 2VUWA 3G0EA 2H96A 3MVJA 2UZDA 3P86A 4FTOA 4FZAB 5LWNA 4FZ6A 4QP6A 1BLXA 3QLFA 3AT3A 4ANLA 5DEYA 3VBYA 4H3PA 5AUYA 3TUDA 2BKZA 4EHVA 2X8IA 1KE9A 1Q8UA 2X0GA 2GFCA 4TNBA 5CNOA 1CDKA 3LXNA 5TO8A 4I22A 5FXQA 2JITA 2R3PA 3FKOA 3KMMA 4U42A 4M7IA 4CFVA 3DXNA 5A6NA 3LFCA 4EC8A 4FKUA 5ANOA 4C4IA 3R1NA 4TKSA 2UW4A 2UVYA 3LFAA 1QPJA 2R9SA 3VW8A 2B4SB 5ANJA 3V5QA 4BF2A 3OTUA 2OXXA 5BQ0A 3LMGA 3ALOA 4XOZA 4F0FA 4FGBA 4Q9ZA 2BRGA 4I0RA 3TCPA 4JG7A 5FP6A 3RHKA 2W7XA 3D7ZA 1R0PA 2W1CA 4FG7A 1BL7A 2I40A 2WTKC 5A4LA 4C34A 4OAVB 4FKTA 4TWNA 2W5AA 2YCQA 4QQ5A 5L2SA 3UPZA 4UALA 5LQFA 3P5JC 4M97A 5I9UA 2BFYA 2HXQA 5IUHA 4F9CA 4DLJA 4TTHB 4WHZA 4EK8A 3D5VA 1JOWB 1MUOA 4E26A 3O2MA 1DM2A 2XK9A 5CX9A 2CNVA 2ETMA 3QZFA 3PXQA 1DAYA 2IN6A 1MP8A 2ERKA 2OJJA 3DCVA 4LL0A 3LXLA 1MRVA 4BYIA 2BALA 3JXWA 3HMPA 3CP9A 5EM7A 1VYWA 2UZEA 5KMMA 1G8SA 4D4YA 5EDQA 4AX8A 1S9JA 2YM8A 3Q9ZA 4X6RA 4BDBA 3R1QA 2F7EE 3OG7A 5CAPA 4PTCA 3FY0A 2WKMA 3DA6A 2X2LA 3GI3A 3W18A 3V5JA 4L68A 5IQHA 4IVCA 2F2CB 3RAKA 2CHLA 4OT5A 4ACMA 5IEXA 3DK6A 4HVHA 1JKLA 2PHKA 2XEZA 3DNDA 1E1XA 2J0JA 1ATPE 1H28A 5CU3A 4B8LA 4RX8A 1UU9A 2BDJA 4I93A 2VV9A 3TT0A 2VWBA 4YTFA 1M2QA 4YZ9A 4I92A 4D4VA 4KIKB 4L43A 4AA0A 5CSWA 4EOSA 5HTBA 3Q4TA 3DU8A 3KFAA 4RVMA 4I1ZA 3S3IA 5JZJA 2QKRA 1QCFA 4DFXE 5FXSA 2ONLA 1IAJA 4GYIA 3LMIA 2I0VA 3P0MA 3HUCA 3MH3A 3MW1A 3EQDA 4JDJA 4AW1A 4ZTHA 4RZWA 1QMZA 2IF8A 2UW8A 4HGEA 4AT4A 4IJPA 4M14A 5EDPA 2WAJA 3KK9A 2I7QA 3FV8A 2PUUA 3KY2A 3F69A 1TQPA 4ZSAA 3GU6A 3PXKA 4PWNA 3UNZA 2X7FA 4LV7A 2C6IA 1FQ1B 4ANMA 2XJ2A 3NNWA 4ZLOA 4E5AX 5LMKA 4RWJA 4BHZA 3I5ZA 4AOTA 1ZXEA 3VUGA 1QPEA 3G6GA 3NS9A 5ICPA 2GQRA 3LJ0A 5DYJA 5C8NA 3KULA 2IW8A 3RPRA 1UKHA 3RM6A 2VNYA 5H3QA 2C0TA 3F3UA 3TYKA 3ZSHA 3AD5A 2UW9A 5IUIA 4YURA 2Y0AA 2R0IA 4MEDA 3UQCA 3LLTA 3PPJA 1PXLA 3W10A 2G15A 3GC0A 2CN8A 4QP8A 4FTIA 4FTRA 3R9RA 4IE9A 2FH9A 5CS6A 5AR8A 1OUYA 3WF5A 4L3LA 2BR1A 3DOGA 4QYHA 3PPZA 4FIIA 5EM8A 5C4LA 1KUTA 3R22A 2IZUA 4AZWA 4PL5A 2HXLA 4M15A 4YJPA 3OTVA 4I20A 5CSXA 3H0ZA 4BCPA 3UIXA 2VO0A 3V5WA 4ID7A 4XNEA 2BVAA 3KN6A 4BZDA 1CM8A 5AV0A 3FI8A 3ZS5A 5KMKA 4QMWA 4N6ZA 5M56A 4PP7A 3QYWA 5GJGA 1ZOGA 4E6CA 4LFIA 3ORZA 2WQMA 3RTPA 1TVOA 2HOGA 3TG1A 4ARKA 4EZ7A 4RMZA 4ZP5A 5EYKA 3R8UA 2W4OA 4L7FA 4F9YA 1Q5KA 3ET7A 5DPVA 3MPAA 5AUWA 3ZXZA 4FTCA 4EYJA 3QTSA 5BVOA 3HAMA 4RA5A 3BU3A 3M11A 3EYGA 2E9UA 2WMUA 4LGHA 5KNJA 1CKIA 1OM1A 1W83A 3IW8A 3KXXA 4DBXA 5E8SA 3Q2JA 3FEGA 3MBLA 2YJRA 5JRQA 2WIHA 3O8TA 4BDGA 1OL7A 3DPKA 3BWJA 1S9IA 3AGLA 3DDPA 4C62A 1PKDA 3TTJA 1UNHA 2PZIA 3FZPA 4I6FA 4TWPA 3ORLA 4H05A 3NZ0A 4MNEB 5C8KA 1CTPE 1L3RE 4FF8A 4I41A 4N6YA 1CKJA 5IKWA 3GB2A 4FV8A 4E20A 3HUBA 1DS5A 4ZXTA 3MTLA 5EHLA 3FBVA 2YM4A 3ANQA 4O7TA 3JPVA 4ASEA 3LM5A 4WG4A 5IMXA 4JL9A 4RLLA 2VX1A 4PPAA 3HV6A 5E8WA 4C4GA 4RG0A 5CI7A 3OY1A 2J2IB 3DJ7A 5AX3A 2Y6MA 3AC8A 3S95A 2WU7A 1XO2B 2GMXA 2A4LA 3IO7A 2XIRA 3D7TB 5L8LA 1XBAA 3ZM9A 4X3FA 2A1AB 2BRHA 3L9NA 2NP8A 5JFSA 5E8UA 2F49A 2GCDA 2OH0E 5FEQA 1XR1A 4R1VA 3MH1A 4QP4A 3SVVA 2RIOA 1W82A 3NWWA 2GS2A 2UV2A 3EFLA 3KU2A 4L7SA 4P4CA 3UO6A 4CFWA 2Y7JA 5K0XA 1ZYDA 4AXDA 1J1CA 3AXWA 4BL1A 4OTRA 3K2LA 4FT7A 4I0TA 3RK9A 3MWUA 4I94A 3ZUVA 2J0IA 3DKFA 4QP2A 2PYWA 5TOZA 3VUMA 2WMQA 3QRIA 4ZIMA 1GY3A 1NXKA 3O7LD 4S30A 3DLSA 4GV1A 5A4CA 1RE8A 3OW4A 4BDHA 3ATTA 3FXZA 4FZDB 3U8WA 3FI3A 1ZWSA 3QCXA 2RG6A 2NYAA 4KS7A 2X6EA 3BHUA 5AR7A 2OXDA 2YJSA 1OKVA 2G2FA 5M08A 2BAJA 1B38A 3I0QA 4CRSA 3VS4A 2W5HA 2ONLC 1SYKA 4GT3A 4OTHA 4F09A 3NYNA 4XHKB 2YDKA 4W4YA 3FUPA 4FV0A 4IB0A 4R5YA 2C6DA 1SM2A 5IQIA 3E3PA 4MKCA 4QQCA 4RC4A 5B0XA 4DHJA 2HWOA 2X9FA 3ACJA 5HESA 2B1PA 2QR7A 2R3LA 2XVDA 1UU7A 5JQ8A 4YBKA 5CASA 2FSLX 3ZRMA 1H1QA 3CQEA 5K4IA 5KO1A 4D4RA 3HRFA 3HMMA 4KKGA 5C01A 3PA5A 3QHRA 3LXPA 1M2RA 4JG8A 4OTQA 3LHJA 3FQEA 1OKWA 3KF7A 4OBQA 4XCUA 3DKGA 3W2RA 5L2TA 5KKRC 5H8GA 2YDJA 2QLQA 2XM9A 2WMBA 4XBUA 5FEEA 4KBKA 4XG8A 3FXWA 4J8MA 2C3IB 2OICA 2R3GA 5KUPA 4QMNA 2JC6A 4G5PA 5TR6A 1YWNA 5LCJA 4J7BA 5F1ZA 4FMQA 2JKOA 1JAMA 2IVVA 4AXFA 3ZC5A 2G2IA 5EFQA 4O7YA 4IJ9A 4RIWA 2VO3A 3FPMA 2NNWB 2Q83A 3OROA 3CQUA 4O21A 4YPDA 3COMA 5KMNA 4QTBA 4YGAA 3EN7A 3VBVA 4U6RA 3HRBA 3OXTA 4TYIA 4IB5A 1W2DA 4NJDA 2UW0A 2GNLA 2V7OA 3G51A 3ORMA 3O5AA 3GP0A 3RNIA 3VUKA 3WE4A 3KRXA 4HVGA 2YFXA 4IZ7A 1Y91A 2P4IA 5AR2A 4ACCA 2YIYA 3D5WA 2GFSA 5I9YA 3EH9A 4U3YA 3DK7A 3TUCA 4OT6A 4FSZA 2QD9A 3VQHA 3AC5A 4QOXA 2X0OA 4NM5A 1GZOA 3LVPA 4ZK5A 4AE6A 3N51A 4IEBA 4LYNA 4AQCA 3NGAA 1APME 3FZOA 4DE4A 3A7GA 2O64A 4WKQA 3HNGA 2BHHA 2Y6OA 4QMMA 2OKRA 1NY3A 1G8AA 3DAKA 4WNMA 4X6QC 1VLRA 4I6LA 1UNLA 2FA2A 5HD4A 5CEMA 4JIAA 3WILA 4O6LA 1PYEA 4LRJA 1MQBA 2QVSE 4I5PA 3DFCB 4QQTA 4YZCA 4JRVA 3ZZEA 4M8TA 1XBBA 3OEFX 1K3AA 2B0QA 2P3GX 3LIJA 2P0CA 4GVAA 4YC8A 5DRBA 1KE6A 3DXPA 2WMVA 5C03A 2FYSA 3IW5A 4DG3E 4ZY4A 3PYYA 5ANDA 4NFMA 3FZTA 4F4PA 1F5QA 2BTSA 3EOCA 5T6KA 3BL7A 4NCTC 4W9WA 3RVGA 4EH5A 3SDJA 3QGWA 4F1TA 4G3FA 2J0MB 1ST0A 2UZWE 5IEVA 4FIFA 4RIYA 4IX6A 4RJ5A 5AUVA 3ATSA 5GZ9A 4O27B 4IVAA 4BRXA 1ZYJA 4FBXA 4YTCA 2VTSA 5M07A 2P2HA 5J7BA 3GOPA 4II5A 4LI5A 4EK6A 3PXFA 3II5A 4X3FC 2OU7A 4UYAA 4DDIA 4E5WA 3CLYA 4FV9A 4U0IA 2OIBA 4BWXA 4C58A 4PY1A 4E93A 5IQFA 1H1WA 3QTZA 4WSYA 3BE2A 4KIQA 5L2QA 5K5XA 4DFLA 4BCHA 3DB6A 3SG9A 2YWVA 4Z3VA 3FKNA 4IAYA 4IZYA 1WFCA 2W1GA 4U44A 5I5ZA 3H3CA 3ZUUA 3OW3A 2JFLA 4FOBA 4Y72A 3POZA 4XRLA 5DWRA 1VYZA 4BZNA 1B39A 3GU5A 5ETIA 5CEOA 4EJNA 4XLIA 4IZAA 3Q5IA 2CKQA 4CGAA 3MB7A 4G3EA 2GNJA 4CNHA 1PXPA 4CYIA 4D1SA 2OI4X 1ZY4A 2PK9A 3T9IA 3BKBA 2GS6A 3QWJA 2GQSA 2YZAA 1YHVA 4FZFB 3UMXA 4NSTA 2RG5A 1FINA 4AN2A 4CTBA 2J5EA 5AP6A 2R3NA 1REKA 3FY2A 5AIKA 4BBEA 1BX6A 4B7TA 4J99A 1M7QA 5EM6A 5AR4A 2VRXA 3OOGA 3DKOA 3F7ZA 4YHTA 5CI6A 4C37A 5M06A 2GNHA 3QXOA 4L46A 4YZNA 2HK5A 4XLVA 1YWRA 3ZZWA 4LG4A 4OTPA 4OBOA 5ACKA 3C4FA 3EMGA 5K3YA 4PPCA 3LFEA 4FKLA 3W8QA 1ZLTA 5H9BA 2F7XE 4ALWA 3EZRA 4QTEA 5BUIA 3OS3A 4N70A 3S4QA 3BBTB 2OJFE 4AUAA 4IX5A 2DWBA 2WMAA 3OOMA 4QD6A 4XV1A 4AXEA 3C0HA 4JDKA 4KRCA 3SW7A 4HYSA 4YR8A 4YTHA 3RCDA 3BLQA 2G2HA 2XCHA 4A9YA 5CANA 1WMKA 3M1SA 4ZJJA 3KMUA 3QU0A 2B52A 5HIBA 1DI8A 5FGKA 4OTGA 3PUPA 4XEYA 4IBMA 4BBFA 4PDPA 4KIPA 4YBJA 2ITUA 2JLDA 5IH5A 3KULB 4JAJA 2OG8A 2VTHA 5JFXA 5HLWA 2GU8A 4NUSA 2REIA 2XNBA 4M84A 5CWZA 4CXAA 4AXAA 2V22A 2VWWA 1KOAA 4WBOA 4CFXA 3FMHA 4K6ZA 4IAAA 3TNIA 5E9EA 3EQHA 4D0WA 5M55A 4P5QA 5M4IA 1J7IA 2J5FA 4IHPA 1SVEA 2GNFA 1M14A 4ZTMA 4QDEA 3QYZA 4YO4A 1SZMA 1PMEA 5K9IA 4O84A 1IEPA 4MWHA 4ZZOA 3JVSA 5L6PA 1YVJA 4BJJB 4FSQA 1Q8ZA 1H08A 2PVHA 4FTTA 5LCKA 3F3TA 1URCA 3OHTA 1JPAA 4IM3A 1H00A 3KRWA 3LW0A 1EH4A 4MWIA 5HIDA 4ZLZA 4XP3A 4UZHA 3QWKA 4BDIA 4NW6A 4AA4A 3Q32A 3UP2A 5HBEA 4PL4A 3PVWA 3HA8A 3SA0A 3G90X 3AC1A 3UVRA 3PIYA 4HZRA 2GPHA 3H10A 3ZDUA 1J7UA 3D9VA 3TV4A 3WYXA 5M57A 1JQHA 1SVHA 1WBWA 5CY3A 1NVRA 3DGKA 5CEKA 5GZ8A 3MVLA 3PSDA 4XP2A 3NRMA 4O0TA 2XIKA 3G33A 3I81A 3TM0A 2YDIA 3UDZA 2ITYA 4MUQA 4L44A 3TJCA 2NO3A 1REJA 3OUKA 3OCTA 3I1AA 3A61A 4ZSGA 2AUHA 3BZ3A 4AU8A 3C5IA 4HGTA 4LV5A 3VUTA 5DT0A 4JBOA 2OIQA 4R5SA 5BVKA 5HBHA 3UOJA 4FV6A 3MFSA 2B55A 2BCJA 4FV2A 4B4LA 3HGKA 5L2IA 3TV6A 3P5KA 4JMQA 2BRMA 2XKDA 3ORIA 4YC6A 3U51A 2YCRA 4BKJA 3HVCA 2J0LA 3BHTA 2VZ6A 4USFA 3GNIB 3VONA 2BHEA 1ZMVA 4NIFB 4M12A 3R1YA 3KXNA 4WT6A 2EXMA 4N0SA 3PLSA 3QUDA 4YLJA 4JDIA 4Z9LA 3EL7A 5JEBA 1R39A 4DG2E 4BCGA 3KXMA 4C33A 4CQGA 5IQEA 5ETFA 1Q3DA 4UMPA 1NW1A 3QRUA 2Y4IC 3O71A 4X0MA 2F57A 1K2PA 2HW6A 2XJ1A 3ODZX 2E9PA 4CKRA 4BWKA 2UW5A 1YHWA 4KB8A 4BDKA 2BFXA 2UZBA 3EQIA 1J3HA 5FM3A 3RMFA 3D0EA 4DEEA 2R64A 4WNOA 4L01A 2JIIA 4E3CA 3UTOA 3LKMA 3HP5A 5D9HA 4EYMA 5I9WA 1ERKA 4AA5A 3P4KA 5AP4A 2F4JA 1Q61A 4BFMA 2I0YA 4ZTSA 2E9NA 1YDSE 4MQ1A 4DC2A 4TL0A 3N4UA 2X4ZA 3DDQA 4L3PA 4ALVA 4ALUA 1W98A 3UYTA 1ND4A 4XBRA 4ZEGA 4RIXA 4TYGA 3OT3A 3PSCA 5DG5A 1YXVA 5DEWA 3UC4A 4C02A 4HCTA 4O0WA 2WELA 4YLLA 4JLCA 2AYPA 2PVYA 4D5HA 3EN4A 5I9VA 2PE2A 4S32A 5M4FA 1P5EA 5HCYA 4GKIA 3KC3A 5DR9A 4EUUA 2XAMA 3NPCA 3IDCA 3EQPA 1UA2A 1ZOHA 3SKCA 5CSPA 4YNOA 3E64A 2QOHA 5HG8A 5LMAA 3VUIA 1TFFA 5B2KA 2EXCX 4CV9A 2PVMA 5I9XA 3VNTA 5L6OA 3QTRA 2UZLA 2EB3A 1OL1A 2UW6A 2X39A 3DQWA 4IVDA 5EOLA 4AOJA 4FVRA 3DS6A 3AT4A 2J4ZA 4JVGA 4MXXA 5H8BA 3W2OA 3W0QA 4WOVA 3C4CA 4GUBA 3W2CA 3L8VA 2ZYBA 3F3WA 3TTIA 4JR7A 4S31A 4EI4A 3MFRA 4C59A 5BX0A 4Y5QA 5ETAA 2YHVA 3O17A 2PE1A 3SLSA 5IISA 4O0SA 3LCOA 4DEIA 3R7EA 3NYOA 3W32A 4QDVA 4AAAA 3E8NA 5BVWA 4KSPA 3FMJA 3NW6A 4IWOA 5JRSA 4ZY5A 2R7BA 3VULA 1HCLA 3NVMB 4DFZE 3S1HA 3WOWA 3K54A 2XB7A 3L9MA 3RBWA 3F9NA 3PXRA 2VAGA 1GZNA 3CQWA 3CY3A 3PJ8A 3O51A 5JT2A 1ZY5A 4AW5A 3WF6A 3VHKA 5DRDA 2I0EA 3COKA 4IQ6A 1ZMWA 3PJ1A