2YIQA

Structural analysis of checkpoint kinase 2 in complex with inhibitor pv1322
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
280
Chain Sequence
VYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Checkpoint Kinase 2 in Complex with Inhibitors that Target its Gatekeeper-Dependent Hydrophobic Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 89
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiqA01
5T6KA 3V6RA 5L2IA 3U8WA 2VTRA 3D5WA 4IB1A 3PWYA 3JPVA 3UNKA 3DB6A 3QAME 3SA0A 5GZAA 3ALNA 3DT1A 4FG7A 4EC9A 1H01A 3IGOA 4O0WA 1J91A 2X4FA 5GHVA 4ANNA 2GMXA 3DAKA 3NNVA 4AZWA 4NIFB 4B0GA 4O81A 1YWRA 2G01A 2OJGA 3UVQA 2UZOA 3N9XA 4BL1A 3C9WA 4YJVA 2WTVA 2YCFA 3FMJA 2H9VA 5E8WA 4WUAA 1WBSA 4GUBA 3NX8A 4FNXA 4QMLA 2KTYA 1Q8UA 3GU7A 3Q04A 3ZHPC 4L3PA 3PJ1A 1ZZLA 4WD5A 5HE2A 3WF8A 5M44A 3I1AA 2IJMA 2NRUA 4F63A 4O7ZA 4NL0A 4RX9A 3UC3A 3W55A 2QOOA 1SZMA 3MGYA 2CGVA 4AN3A 3MH0A 4RJ7A 4LQMA 3E87A 3EZVA 4EYMA 3ZUTA 4DN5A 4XHKB 3UJGA 2YM3A 4JBOA 2GDOA 3IKAA 5FWKK 1E9HA 3HNGA 3MH2A 4DEIA 3GC8A 1SMHA 4R5SA 4O6LA 3RAIA 5J87A 3WE4A 4GIIA 5IKWA 1JWHA 4L45A 2PHKA 4D1ZA 5D1JA 5AV2A 3VUHA 4ITJA 2OZOA 4PX6A 5FBOA 2QOIA 5JFSA 1WVYA 2OXXA 2XP2A 3FSKA 4QD6A 4A9UA 5CAVA 3NNXA 1SVGA 4V05A 2IW9A 4BCIA 2NRYA 3KF4A 1Q8TA 4GKHA 2X9EA 4L01A 4A9SA 3C4ZA 1ND4A 4X2GA 5JT2A 2VTAA 4FVQA 5CNOA 2BUJA 2CCHA 4RIXB 5DT0A 3WBLA 3U51A 1KE6A 3V8TA 2HYYA 3T3UA 3C51A 4S33A 1P2AA 4E73A 2BAKA 4RA4A 4EHVA 3KMMA 1O6YA 2C3IB 5EM6A 2OZAA 2P3GX 3HP5A 3O8UA 4O86A 3IS5A 3O96A 2PMLX 4L43A 2GSFA 5DE2A 4C7TA 5HVJA 3MH1A 3VJNA 4EHEA 2HY81 4RJ5A 4I1ZA 1K2PA 3ORZA 3QD3A 5EHYA 2OJ9A 2VD5A 3ACJA 4GYIA 3FWQA 3PIXA 1H24A 4L67A 3KXZA 2J0MB 4PL3A 2JD5A 3L9NA 5AJQA 2V7OA 1UU7A 4G3GA 2P2IA 3R7UA 2CKOA 4KSPA 1XH9A 1UU8A 3LFSA 5L8JA 4XX9A 4YO6A 2CKPA 3QUPA 2QOKA 2UVYA 5CYIA 4WG4A 3HEGA 5E91A 2OLCA 4ACDA 1PY5A 3DJ5A 1FINA 4CT1A 3GVUA 4RFYA 3F61A 5E9EA 3HECA 3MFTA 4L7SA 2PVKA 3LM5A 3NNWA 4EK3A 2C0OA 2JAMA 5EI6A 3CKWA 3GFWA 3TZ9A 4X3FC 3FC1X 5HNBA 5LVMA 5H8GA 4E5BA 3LFQA 2R3NA 4ITHA 3FEGA 1GJOA 2BTRA 1APME 1G3NA 5M51A 2C1BA 4KIOA 3D0EA 4P2KA 4RLLA 5HU9A 5KUPA 2YA9A 4YZDA 3TZ8A 3E7VA 1VZOA 4P5ZA 1R3CA 1XBBA 1GY3A 3NVKI 3PSCA 2XIYA 3LXPA 3PXRA 4FG8A 3AC3A 2IZRA 4IX3A 4V0GA 4ZTHA 4I92A 4AS0A 3PJ3A 5C8MA 4FIJA 4I93A 3CY3A 2J4ZA 3NIZA 3PWDA 4AZFA 5C26A 5HI2A 4CGAA 2JIUA 3RWQA 2OW3A 5EW3A 4BZNA 2PUUA 1GZKA 4FT0A 4RIWA 4AUAA 4FKWA 2XBAA 1BUHA 3PUPA 4YSJA 2X8EA 1PMNA 2W0JA 3EL8A 4E5AX 4EQCA 2WMVA 3R2YA 2BRNA 4QTCA 5CZHA 1OPLA 3LCOA 4HGSA 4WNOA 5ANOA 4CZTA 5K5XA 3BYUA 3PE1A 1REKA 1YHWA 4ZTSA 3VHKA 4ZSAA 5K4JA 4FKGA 1JSUA 3BCEA 4L3LA 4QMTA 4C61A 3LMHA 2OFVA 4LYNA 5E1EA 4BGGA 4IVBA 2X7OA 4AZEA 4EORA 2GNLA 3GOPA 4QRCA 4AP7A 4YHFA 5KMKA 3CR0A 2CJMA 3GENA 4YJRA 5EKOA 5L3AA 4BYJA 4YR8A 2I0VA 4NK9A 4FL2A 2UZUE 3QXPA 4ALVA 3KL8A 2WTDA 2C30A 5IDNA 4AF3A 1H1RA 3QTQA 4IB0A 1KE9A 5AA8A 3BU3A 2YM4A 2O8YA 5K0XA 2CNUA 4O0UA 1OI9A 4NCTA 5HGIA 5BQ0A 5CF8A 3O8PA 2ZV8A 3GCQA 3EH9A 4YPDA 5EDRA 3GCVA 2H6DA 3ZZEA 3ANQA 4A4XA 1URWA 2OF4A 2YM8A 2UW0A 3EL7A 4ACCA 3EKNA 3MYGA 4WHZA 4RJ8A 1P4OA 2B4SB 1ZARA 1JNKA 4S2ZA 5DG5A 5A9UA 4KA3A 3P4KA 1MRYA 4DEDA 3W2OA 4QP6A 2X7FA 3Q53A 2B55A 4IACA 5AUTA 3GCPA 4CEGA 4Z16A 2A0CX 3ETAA 4FV7A 5J9ZA 4JR7A 2G1TA 3MPTA 5HNGA 3BRBA 4FT9A 3NAXA 4K6ZA 3F5XA 2DYLA 4JS8A 4YC8A 3PPZA 5C4LA 5H3QA 5IPJA 3LAUA 2BPMA 4NSTA 4U7ZA 1V0PA 2ZAZA 4RGJA 1YDSE 4EUUA 4FIFA 3V5PA 2ITNA 4J95A 4M13A 2ITTA 2XH5A 3SOCA 4AN2A 2C3LA 4FL1A 3Q9YA 3SD0A 3QTWA 5A4QA 2BRGA 5TO8A 1M52A 1YKRA 4DGMA 4YNEA 1IRKA 2C6IA 3V04A 3DDPA 5DBXA 2R4BA 2W1EA 3KRRA 5BVWA 4O7LA 4TYEA 3KY2A 4C0TA 2PVFA 1Y6AA 5TOZA 3F3VA 4IWPA 3FMKA 2JDOA 3KC3A 2Z7RA 3OT3A 4BC6A 1OB3A 4AGWA 4G3CA 5DOSA 3DZQA 2JDSA 3MY5A 4E4LA 5AP4A 4F9YA 3BWJA 4A4OA 3L1SA 5JGAA 5C8KA 2UZDA 4BB4A 3H9OA 3MS9A 4LI5A 5BYLA 3QQKA 4C4FA 1YVJA 4C35A 3LXLA 2WQEA 3LMIA 3OWLA 3NWWA 3KMUA 3R8MA 3ZTXA 4D9UA 4USEA 4EZ5A 5DHJA 3VUMA 1U5RA 3BKBA 1NT2A 1QPCA 4OGRA 2X39A 1FOTA 3AC8A 2YDIA 3S2PA 5E4HA 1A48A 4ANSA 2EXEA 4UY9A 4H1JA 3F5GA 4C3RA 3IQ7A 1OIUA 3MFUA 3AGLA 2WD1A 3ZEWA 2ZDTA 2LGCA 3GEQA 4F70A 2PE2A 3O7LD 4MHAA 4TYHB 3ZDUA 3BBTB 5BVFA 4ANMA 3LLTA 3Q32A 2H8HA 5IQHA 1H00A 4L52A 4PDSA 4RQVA 3FL4A 1NY3A 4GU6A 5DT3A 3I0QA 3MSSA 4IFGA 5EOLA 4MBIA 3R9RA 3OVVA 3OF0A 1S9IA 1FMKA 1OGUA 2R3HA 2YDKA 4QMNA 1UA2A 4CFXA 4I6FA 1XBCA 2R2PA 4GEOA 5JFVA 5HCZA 4WRSA 4ZAUA 2R3JA 5A14A 4KIKB 1FVVA 4S30A 2IVVA 4O7SA 4L68A 4ORKA 3BIZA 3ZU7A 4HGLA 3FXZA 2HWPA 4K9YA 2QCSA 4BDDA 4MBJA 4A07A 4FE2A 3PZEA 5HNIX 3RINA 1PW2A 3R8PA 3W2PA 4FZDB 5A4EA 3RPRA 5FDPA 4O7YA 5HE1A 3W8QA 4MXOA 3VHEA 2HZ4A 4I20A 4WUNA 4GVJA 3UOJA 2NO3A 5KBRA 3QKLA 5DA3A 2EVAA 3AXWA 4ZS4A 4GS6A 4EK8A 4L9IA 4F7NA 3RPSA 3MESA 4I41A 5AV4A 5AMNA 2C5OA 2WTKC 2XJ0A 3K5UA 4EK4A 4FGRA 1Z5MA 3U4WA 3TIZA 3DKGA 4O7VA 1W7HA 3C13A 2CLXA 3DK3A 5ANDA 2HIWA 4F09A 2WMXA 3VS0A 5K0KA 4JX3A 3FMDA 3RI1A 4YTIA 1OECA 3P5KA 4H3PA 4FVRA 3RGFA 4BCKA 4KRCA 4QPSA 4ZP5A 4L46A 1R0PA 4GIHA 2RFDA 4RSSA 3NVMB 2G2FA 5EDPA 3BGPA 4GU9A 2QURA 3PXKA 3BGQA 4JQEA 1MUOA 4MYGA 5IQIA 1UKIA 1W98A 2Z8CA 5J8IA 4O7NA 1YOJA 3QA0A 3QX2A 5M53A 4HJOA 4MD8E 3FZSA 4G34A 4HZRA 5JFWA 3LLAA 4FEUA 4HPUE 5CT7A 4HYHA 4XG2A 5AIKA 1FPUA 1I09A 2X4ZA 4AN9A 4UEUA 3VF8A 3LW0A 3CD3A 4QP2A 3G90X 4A9TA 2Y9QA 5A3XA 3COKA 3O7LB 1WBPA 2OJJA 2WMQA 4IM2A 4EQMA 2W9FB 3ZBXA 4XEYA 5E1SA 2XNBA 1MRVA 2YITA 3WYXA 2JEDA 3MI9A 4P90A 3KEXA 2UVXA 4D28A 4DEAA 2VZ6A 3D2IA 4ZSEA 2J0LA 2R3GA 3UPZA 3GGFA 4Y73A 3ENHA 2XK4A 2HK5A 2R9SA 2YWPA 3LM0A 5D10A 4BDFA 1CKJA 1OIQA 4FZ7A 3CCNA 3OEFX 2BDJA 4CKIA 5FP5A 2W1DA 4ZS0A 4AX8A 1XQZA 2YM6A 3PVWA 3EOCA 4O83A 3JYAA 3LQ5A 4RQKA 3H0YA 4BVUA 2BDWA 3POZA 3PVBA 5HVYA 2WU7A 1Q62A 2C5VA 3FE3A 3V8WA 2F7EE 4ZSLA 4ZY6A 5CALA 3FKLA 4TYIA 3LFDA 2GCDA 4HNIA 3F88A 4QYEA 3TTIA 4FTQA 4IC8A 3CE3A 4G3EA 1H0VA 1T45A 3GU8A 4JRVA 5HTIA 3TKHA 2YJRA 3AQVA 4FKSA 5FGKA 4C4EA 4E6CA 4EOPA 1PXKA 4QMWA 1PMEA 3C50A 4FEWA 4PMMA 3LPBA 1KV2A 3G9NA 4PL4A 1BYGA 4UB7A 5CSXA 1U5QA 1G8AA 4FSTA 4FZAB 3S4QA 3VS7A 2I7QA 5CI7A 5IQBA 4CG8A 4DH3A 2C68A 3CBLA 5DLSA 4QTBA 4HOKA 4GJ3A 4FEQA 3PXFA 4UZHA 3MIYA 1WVWA 1M7NA 2HZNA 3ROCA 3U9NA 3I0OA 1OMWA 2WELA 1YHSA 1AGWA 2YDJA 4B6LA 4ZJJA 4FTUA 1B39A 3HMIA 1B38A 3O50A 5G6VA 4LL0A 3OHTA 4W4XA 1OM1A 2X8IA 5AP7A 3Q9WA 4PDYA 3IOPA 2VTNA 2AYPA 1W84A 5L8LA 4E4XA 5CSVA 4LGHA 4F9WA 3FKNA 2R3FA 4O0SA 3GUBA 4HYSA 3O23A 4XV1A 2V62A 4I4FA 2CNVA 4Q5HA 3RPYA 4BCPA 4I24A 4W9XA 4YHJA 4H3BA 4WBOA 1W83A 1QPDA 3NSZA 1OKWA 4FOCA 4MAOA 2C6LA 2W4OA 5CF6A 1KWPA 5IEXA 1YWNA 2JDVA 2ZJWA 3NS9A 4FTNA 2XCHA 5AM6A 4PRJA 3UMWA 2WTWA 4BDEA 5BVOA 5D7AA 4MXCA 2ITVA 5JZNA 2PVNA 4NTSA 4PF4A 3G33A 4X0MA 3KQ7A 5CXHA 5DPVA 5HESA 4USDA 4JX7A 4UXQA 2W9ZB 1ZYSA 2Y6MA 4F0FA 2IWIA 5E8UA 3R28A 3VBQA 4NFMA 5B0XA 3G2FA 3IDCA 3ZO3A 3P86A 1PHKA 2GS7A 3EZRA 4ANQA 1KOAA 3NUUA 4PY1A 4F6SA 2C47A 3MA3A 3NYOA 3C0IA 2ONLA 3HKOA 3Q9ZA 4M7IA 1CSNA 4I5HA 3CS9A 4E4NA 4G6NA 1Q41A 3GU5A 4NEUA 4OTQA 1MQ4A 4JL9A 3UO4A 1YI3A 1PMVA 1KV1A 1WZYA 4FC0A 3NGAA 4M84A 3NIEA 1JKLA 2ZB1A 3A7IA 5M06A 4NKSA 3RPVA 3ELJA 4G2FA 1J7LA 4QPAA 4ZEGA 5GIOE 3D2KA 5KZ0A 3CY2A 3QTRA 1A06A 4X3FA 4FTTA 3SOAA 1SVEA 4F7SA 4FSRA 2IVTA 4V04A 3MJ2A 5HD7A 5BYYA 4MBLA 3E93A 4CVAA 4X3JA 4EH5A 1IA8A 1BKXA 1PXMA 5GINE 2RG6A 4UMQA 5I3RA 3B2TA 3DAJA 1H1SA 3LFNA 4AA5A 4GT5A 5AUXA 3TTJA 4FNYA 3CKXA 3R1QA 4R3CA 4U44A 2EUFB 4XJ0A 3VBWA 2VWXA 4HVIA 4Z3VA 3V6SA 2B9FA 2WPAA 5EW9A 2ESMA 3U4UA 2A2AA 3NUSA 4YBJA 4DFXE 3R21A 3OD6X 4FMQA 4WSQA 3IECA 3SLSA 4YJPA 4QTEA 4O21A 2BKKA 3NRMA 2J7TA 3R73A 3ET7A 3DNDA 3SDJA 3EMGA 4YURA 2WO6A 5AP1A 4BN1A 3CD8A 3OW4A 4FG9A 3D5UA 3ULZA 4IAKA 2GTMA 2PMIA 4LL5A 2VO6A 3MDYA 5EHOA 2C1AA 4YZBA 1PYXA 4LV8A 5JKGA 3ZONA 3UC4A 1Y91A 2W5BA 4QMUA 2YERA 3HV7A 3DK7A 3L9LA 4GV1A 3MB6A 3FV8A 1YW2A 2OICA 3HUBA 3KXGA 3PA4A 4QPMA 4BRXA 4O82A 4DCAA 1TQMA 5DH3A 2WFYA 2FSMX 4I5MA 4IIRA 4RZWA 5E8SA 3BZ3A 4TNBA 1Y8YA 2CN8A 4WSYA 2XS0A 3FL5A 3TIYA 1JSTA 4RC4A 3COIA 3PJ8A 4RJ6A 2V22A 2W7XA 3S1HA 2GTNA 3W2CA 2XIZA 5C03A 4FOBA 4QQTA 2XNMA 3WF9A 4NIFA 4FKTA 2WOUA 4LRJA 1WAKA 3RHXA 4MNEA 2VWZA 3QUEA 3HMOA 3Q3BA 4DGNA 3REPA 4ZTQA 3RTPA 5AP2A 3HV5A 3BWFA 3OCBA 4EH4A 4BCJA 3RJCA 2FSLX 2IW6A 4LGDA 4J53A 3WZDA 5J5SA 1KUTA 2VO3A 3F5PA 2OWBA 5HIDA 2QG7A 1JBPE 3RALA 1M17A 3O17A 4FKVA 3NR9A 2QKRA 1REJA 4PDPA 5AP5A 4OTFA 1VJYA 3ODZX 3ORTA 2PE1A 3EQHA 4IAAA 2X6DA 3EN4A 3IDPA 4FSQA 2BZKB 3ANRA 4PPAA 5FG8A 4CQGA 4FT5A 5F9EA 2PZRA 4G3FA 2PVRA 2X81A 4EH8A 5FDXA 1QMZA 5IA5A 1ERKA 4NYEA 3PLSA 5M55A 5HBEA 5FP6A 2YEXA 4FBXA 3PP1A 4KWPA 3D83A 3UOHA 2IO6A 4BBFA 3BYOA 4R3PA 3HAMA 3C0GA 4RG0A 4UV0A 4F0GA 2WMAA 1XH4A 3E3BX 1J3HA 2VN9A 1PF8A 4WNKA 3EFWA 4Y8DA 4YP8A 3GFEA 2Q83A 2PE0A 3FMMA 3UZTA 1IR3A 3O71A 4BTMA 3M11A 2AUHA 3CEKA 2ITUA 4FSZA 3FQHA 5BNJA 5CEQA 2P33A 3R00A 4FKIA 3BHUA 3AD4A 3FSFA 4LUEA 3LXKA 3UQGA 3UO5A 4DG2E 2GHGA 3ZH8A 4DEGA 1IASA 2YM7A 5CZIA 3W33A 1FGKA 3MVMA 2YAAA 3VAPA 4ZTLA 2UZVA 3M42A 5AUVA 4L00A 3LQ8A 4QTAA 4WNMA 4YBKA 4QMMA 4BDBA 2PUIA 3BHVA 3ZYAA 3VRYA 4O7WA 3TDWA 4WKQA 4NZWB 4XV3A 5CU4A 2R3PA 2UW3A 4AGDA 3Q5ZA 4IDTA 2UZTA 4MF0A 4O0TA 4U5JA 4FEVA 5JMSA 4MXXA 2C5XA 3QHRA 1O6KA 3HRFA 4KINA 3R9NA 3IDBA 3E8DA 3K5VA 1U54A 4DGOA 1Q3DA 5A6NA 2BR1A 3FZRA 4K1BA 4GK2A 5EQPA 3QWJA 4G5JA 4WIHA 4F7JA 4LRMA 1QCFA 2QI8A 2Y6OA 3QZHA 5F1ZA 4M68A 4NU1A 4YJTA 4IM0A 2EXMA 4NH1A 5EOBA 2VTHA 5AX9A 3T8OA 4QYYA 3FPQA 4AGCA 1YDRE 5LVLA 4O0YA 4IDVA 3VUIA 4BDIA 4C4GA 4YUQA 3QQJA 5HLNA 4IWQA 1MP8A 4M14A 4X21A 3KU2A 3BEGA 4P5QA 3C4FA 3FLSA 1SYKA 3KXMA 5FM2A 3SXFA 3SV0A 5CANA 5FUTA 2CSNA 2ERZE 4H39A 3D14A 2HXQA 3DDQA 4FICA 2PPQA 4G3DA 2VTPA 2AC5A 3C4EA 4XOZA 2UW4A 1CMKE 5TKDA 1VR2A 3HRCA 1BI8A 5CU0A 1KE8A 4UX9A 4NTTA 2GQRA 2QO2A 3BHYA 5AR5A 5IISA 3TKIA 4EKLA 3LKMA 4X2JA 2XEZA 4CFVA 1UNGA 4K2RA 2CMWA 2Z60A 4JXFA 1FBNA 3GU6A 5J7BA 3VF9A 5BUJA 3QLFA 4KRDA 3NAYA 3QRIA 3LFAA 4LRKA 3F6XA 5CSHA 5KMNA 5IA4A 5E92A 2X6EA 5CXZA 3TV6A 4CTCA 4G6OA 4J99A 4F6UA 3HUCA 3GT8A 1ZMUA 1XO2B 2RG5A 3V5QA 4CFWA 1I44A 1UVRA 2ITZA 3MFRA 1YXTA 3PY3A 4JBVA 5LWMA 3ZC5A 1A9UA 4M97A 4A4LA 5IA2A 5FEQA 3EN6A 2CNQA 3Q6WA 2UW8A 4FSNA 4DLIA 4MXZA 2VTJA 1OITA 5HTBA 3H9RA 4CMOA 2YM5A 4NM3A 4V0GB 3IO7A 3CSVA 4AT5A 2VGOA 1J1BA 3FLWA 3KMWA 4C57A 2XM8A 2QLQA 5AR2A 3HMNA 4BDKA 3DB8A 2PZYA 2W17A 2IZSA 4FTAA 4GH2A 2W1CA 3NYVA 4UALA 5AAFA 5IEYA 2X2KA 4E20A 4L44A 4X3FB 3TV4A 2F7ZE 3QQLA 3IG7A 4HZSA 4C37A 2WAJA 1OKZA 4RVTA 3HMMA 5HHWA 5GIPE 4R6VA 1Q3WA 4ZIMA 2WMUA 2DWBA 3F3TA 3TNPC 3QWKA 4IVDA 4XP2A 3K3JA 1XBAA 3R9DA 4EUTA 4QMVA 5FQDC 2OBJA 1Y8GA 2O3PA 2W99B 4OR5A 4WO5A 3DFAA 1ZY4A 4FL3A 5HIEA 5HKMA 4BR3A 4OAUC 2HAKA 4QNYA 1VYZA 3UG2A 4RC3A 3E3PA 3KF7A 4RPVA 3SKCA 3OBGA 4FK6A 3E7OA 4GK4A 4FV5A 4Q9ZA 1GZNA 3NEWA 3IGGA 3LMGA 3PJ2A 3RZBA 3R04A 4QMZA 3EQPA 4FTCA 3O8TA 3VS2A 1ZYDA 3EFLA 4OBOA 4QYGA 3EQFA 3FZPA 5K3YA 3R7YA 1YXUA 3PA3A 4X2NA 4YJNA 4HW7A 4EOKA 3LCDA 2ETMA 2QOHA 1VEBA 1S9JA 2QVSE 3Q4CA 4M69A 4TL0A 1R1WA 2PMNX 2JIVA 4J52A 3WF7A 4BIBA 3HAVA 3ENMA 4OTDA 3ZM9A 3NNUA 2YWVA 4PUZA 4YTCA 5HEZA 3EYGA 4L6QA 5L2SA 2DUVA 3EKKA 5FXQA 3OOGA 4FF8A 3DBQA 3I60A 5TT7A 1SVHA 2PK9A 5JSMA 3KA0A 4C34A 3C5IA 4Y5HA 5BVDA 5KZIA 4U79A 4AT3A 4ZSGA 3BQRA 3W16A 3RBWA 2BZIB 2ZYBA 4K0YA 5B2KA 3VRZA 3H3CA 1H1PA 5FTQA 2ZV7A 5F95A 3DKCA 4DFBA 2B52A 1ZOGA 4FTLA 3QGYA 1LP4A 1PKGA 5JRQA 2UUEA 5HO7A 2VAGA 3KXXA 3MBLA 3PTGA 5FTOA 3KK8A 1OKVA 3DK6A 3JY9A 3SXRA 3TDVA 3DQWA 4LMUA 4EH3A 4IZ5A 2X8DA 1SNXA 4G1WA 3OT8A 4FZFB 2NP8A 4ERKA 5AV0A 1P4FA 5JEBA 4Z7HA 1K3AA 2XKCA 4AACA 2WZJA 4C02A 1YDTE 5DGZA 1OIRA 4PP7A 5E7RA 2FGIA 2AC3A 3JY0A 2VWYA 3FDNA 4C4JA 4RX5A 4W4VA 5AP6A 5ETCA 3WZUA 5KKRC 3F69A 3TUDA 5L2WA 3VS1A 4G17A 5IA3A 3UOLA 3PXYA 4BHZA 3ZZWA 5AUWA 3KKVA 3OUNB 4O84A 1JAMA 3QD0A 4BCMA 3FQSA 5BVEA 3CJGA 3CQEA 3ZUUA 4JIKA 2C0IA 2VTTA 2W5AA 3ZM4A 3SX9A 5KCVA 5CT0A 3EQIA 3M1SA 3S00A 2Z02A 2J0JA 1NW1A 2WEVA 5DFPA 4W4WA 3BU5A 3RVGA 3WYYA 3F66A 4LG4A 4CLJA 1UWJA 4ASEA 2I1MA 4HVDA 2VU3A 3DFCB 4CT2A 1WFCA 4DGLC 4JBQA 5D9HA 4BBMA 1BL6A 5B2LA 5AV3A 1JQHA 3I81A 3I6WA 4KBAA 4CFMA 3ZS5A 5H8EA 1H07A 4FTOA 3I4BA 3L8VA 4S31A 3RHKA 5CAQA 4S34A 4IAIA 2GS2A 3U6IA 5CF4A 3NDMA 1F0QA 3CTQA 2XRUA 4G31A 4R8QA 1M14A 3V5WA 4BY9E 4YU2A 3TUCA 1NVSA 4BTFA 2PY3A 2IG7A 5HG9A 4KUJA 5AUUA 4FX3A 2CGUA 4BCFA 4O7RA 4CQEA 3O51A 4FV0A 3TKUA 3IOKA 5TR6A 3D5VA 2YISA 4ZZOA 3Q60A 4EHZA 3ALOA 4JNWA 5CWZA 3F2RA 4DT8A 1Z57A 3NUNA 2PMOX 4XV9A 3UYTA 3ZLXA 2I40A 3BU6A 4DFUA 1RDQE 4NFNA 4D4RA 3ZXTA 4BDCA 2C6MA 4IVCA 4QTDA 2HCKA 3OC1A 5I9XA 5AEPA 2HXLA 5E8YA 3SG9A 4TYJA 3BYVA 3MH3A 5LVPA 1FVRA 4DBNA 3F2NA 4YHTA 3FLZA 3MJ1A 3CGOA 3OW3A 2IVSA 5DR2A 4IAYA 2UZLA 5H2UA 5E8TA 4XP3A 4J7BA 4U42A 5I9UA 5HORA 2Y4IB 4GUEA 1YI4A 4DFLA 2R5TA 5K9IA 2YACA 5I3OA 5AUZA 4BCHA 4FTMA 3HLLA 4M3QA 3L8SA 2OH4A 3ZRKA 4CG9A 2ETRA 3OOMA 5CLPA 3OY1A 3BHTA 4EOQA 4O0RA 5DT4A 3MWUA 3WF6A 3GXLA 3E88A 4OUCA 4X2KA 4FZ6A 4JIAA 4ASDA 4CFUA 4IJPA 4YNOA 4RJ3A 2Y7JA 4JR3A 3KXHA 4E3CA 1YOMA 2WMWA 2WTJA 4O6EA 4FV4A 2JFMA 5IZFA 3FI2A 4GT4A 4GG7A 1HCLA 1TQPA 3WZEA 1ZWSA 4BTJA 4OTRA 3W10A 3R6XA 4QMPA 3RK9A 4EOJA 2QO7A 4YGAA 2R3RA 3FKOA 3L9PA 2R3LA 3U6HA 4Z55A 1HOWA 4OTHA 5CU6A 4ACGA 2QO9A 2F49A 1CKPA 4FR4A 4O1PA 5IEVA 2C6OA 4AT4A 2ETKA 4FA2A 3OXZA 2GHLA 2KULA 3Q2MA 5HX6A 1QPJA 5CY3A 4XG9A 3UIBA 3TG1A 3HV6A 5BUIA 4L42A 2C6EA 4U81A 3KULB 4ZMEA 2C6DA 2B9HA 3KVWA 3LJ2A 3NUPA 3QQHA 4L7FA 3PZHA 5I0BA 2J0IA 4TZRA 5AFVA 4AW0A 4LOOA 1RQQA 4ZTNA 4GFMA 4YPSA 5KMLA 4O38A 4IXPA 4WNPA 5DIAA 3R7VA 2RFNA 2XIXA 5AR4A 3D7TA 5IDPA 4U0IA 3NPCA 4ZXTA 3AD6A 4V01A 3CP9A 3FJQE 3EB0A 3V51A 3FY0A 2SRCA 4IAZA 5IQGA 2EB3A 4RVKA 3QCXA 2YCQA 1ZLTA 4RA5A 3RMFA 4GYGA 3EYHA 3TZ7A 4F9AA 1UWHA 4PMPA 5BPYA 3DPKA 4QP4A 4FTJA 5HG5A 3MW1A 4IZYA 2VV9A 4E26A 4F7LA 5C27A 3HVCA 4UMTA 2QC6A 3DJ6A 5FEEA 4C8BA 2C4GA 4NCTC 4FKPA 4QP7A 2JC6A 2QG5A 4Q5EA 4R77A 3PXZA 3D15A 4FSYA 4PV0A 2WMTA 1XH5A 4FSMA 5CVFA 2GNJA 4IQ6A 1WBOA 4MKCA 3SW4A 4USFA 1F5QA 5EM8A 4KIPA 1CTPE 2HY0A 3SHEA 4D1SA 2ITPA 2ITXA 3EIDA 1GIHA 3PP0A 4MH7A 3W2SA 4TWCA 5I9WA 3TCPA 1BI7A 1UV5A 3HX4A 2PVHA 3P1AA 3RK5A 3SW7A 4IAFA 3E8EA 2FVDA 3V5TA 4QMXA 2UW6A 4NW5A 4WG5A 5DVRA 5AUYA 2JITA 5JQ8A 5JGBA 1ZYJA 2BVAA 3QCYA 3TNWA 1SNUA 4UMUA 4IWDA 3W2RA 5CEMA 5KO1A 1WBNA 1UU3A 5M4CA 2QOBA 4OBPA 4C3PA 5IQAA 3R63A 1LEZA 3F7ZA 3IW8A 4MX9A 1CM8A 4CTBA 3GP0A 3DBDA 3OWPA 4C59A 3UOKA 4GW8A 2PL0A 4RIWB 3UNJA 4DCEA 5E8XA 2QOCA 4U43A 1BX6A 3PRFA 4D4YA 5EQEA 2IVUA 4AQCA 2DQ7X 3HL7A 4RT7A 5HX8A 2FB8A 4M12A 4IZAA 3I79A 5ANEA 4XBRA 3H30A 5EDQA 5E8VA 1PXLA 3E64A 3P23A 5FTGA 4XNEA 4APPA 4IMYA 1OVEA 4UMPA 4JBPA 1XWSA 1ZAOA 3ZDIA 5EFQA 3B2WA 5ETIA 4NT4A 3F7WA 4BIDA 2R3QA 4FGBA 4Q9SA 3RNIA 3PJCA 5CS6A 3EFJA 5J9LA 3FHIA 3LCKA 1H28A 4IANA 3QRUA 3R8LA 3OG7A 2WIHA 4WT6A 3CGFA 3ODYX 4IX5A 4EH7A 4QQ5A 5F20A 1WMKA 3P79A 4ASXA 5KHWA 4R7IA 2A1AB 2V0DA 5HD4A 2VGPA 4OAVB 2FSTX 3GC0A 4EI4A 4C3FA 4EOIA 1IEPA 4MEDA 3PYYA 2PYWA 3FZOA 4PTGA 4ZSJA 3U6JA 3QRTA 3QU0A 4WG3A 5AWMA 2E9PA 3R2BA 4JJRA 3PSBA 1PRYA 5FLFA 1GNGA 3AOXA 3VN9A 2XZSA 4EH2A 3BYSA 4BZOA 3G0FA 3AC4A 3R02A 2R3OA 3HGKA 3QKMA 3R71A 4JDIA 5EYDA 5L6WL 3CIKA 4XV2A 1NVRA 3KGAA 3QC9A 4ASZA 4ZTMA 2JKOA 3VBVA 1Y57A 3C1XA 5DRDA 5HO6A 4CXAA 2JKQA 2XYNA 3ZFMA 3MTFA 2WEIA 5HZNA 4CYIA 3MPMA 2ZDUA 2YAKA 1W82A 3OCTA 4BDAA 4EOLA 4ZZNA 4IC7A 4BBEA 1JVPP 4RIYA 1OPJA 1KSWA 4H58A 4R1YA 2J5EA 3ERKA 4NM5A 4F9BA 2RGPA 3UZRA 4W8DA 1PXNA 2G15A 3R83A 4EK6A 3HV3A 4IW0A 5BX0A 3G15A 2XBJA 4GK3A 4KBCA 4D5KA 3FI8A 1JPAA 2IPXA 1M7QA 4FIEA 5CVGA 4DE4A 1Q8YA 5CEKA 5JK3A 1XR1A 4E7WA 2HZIA 1GIIA 2X1NA 2PSQA 4JQ8A 4YLJA 3TNIA 4GL9A 2C6KA 4LUDA 4D55A 4EWHA 4HCUA 4RBLA 4ACHA 4ERWA 3BLHA 1JOWB 5KE0A 4I6HA 1YQJA 3LQ3A 4UN0C 3VUGA 1OBGA 3T9TA 5L2QA 5K4IA 3Q96A 2JKMA 2XNPA 4G5PA 4JAIA 3W32A 3WIGA 3VW8A 1PXPA 3ORXA 4E6DA 4NUSA 3EFKA 4FT3A 2YZLA 4QMSA 2W4KA 2QR8A 4KS7A 1H4LA 5CSWA 5DI1A 3BI6A 2PZ5A 1OIYA 3IK3A 2Z7SA 5L2TA 4H1MA 4YJSA 3ZFXA 2GQGA 1ZXEA 3VBXA 5IH6A 3Q9XA 3DAEA 3ZSHA 2VTQA 4KS8A 3VO3A 2OGVA 2R3IA 2QONA 4I94A 2VO0A 3DXQA 4PMSA 1PXJA 4XRJA 4AW1A 3KRLA 3QCSA 2GQSA 1OUYA 3GCSA 3PFQA 2WMBA 4I6QA 4UWCA 4CSVA 4D1XA 3H10A 1H27A 4D9TA 1TQIA 3FBVA 4DTBA 1J7IA 3COMA 2YIYA 3MVLA 4FIIA 5KMOA 3Q4ZA 1PMUA 1H1QA 5M4UA 3HYHA 1IAHA 3E92A 3PG1A 1O6LA 5IQEA 2VX3A 3BX5A 5IUIA 4Y46A 3SGCA 5AR7A 4N70A 2Z2WA 2UW7A 2HELA 4EZ3A 4OTWA 5I5ZA 3LXNA 2EXCX 3FPMA 4ANOA 2XK8A 4RJ4A 3VW6A 4N0SA 4H36A 4MVFA 4PMTA 3D7TB 4O0VA 3C4WA 3BV3A 5LJJA 3CXWA 1OL1A 4MXYA 4IHPA 3O2MA 3S0OA 3P08A 1WBVA 2Z7QA 3BGZA 4F1MA 3AT4A 3PY0A 4ZOGA 1KOBA 2JKKA 2XA4A 3OUKA 5LMAA 2R7IA 4EONA 3ORMA 3I7BA 4YJQA 4KKHA 2PULA 3CTJA 4I21A 2PTKA 2G9XA 3L8XA 5HO8A 3BYMA 3ITZA 3JUHA 3R7GA 4RVLA 4U40A 4X6RA 3RNYA 4ZTRA 3VUDA 2GNHA 5GJFA 5AAEA 4F08A 2VWWA 3FQEA 5C4KA 4BDGA 3E8CA 4RIOA 3DTWA 4IWOA 3ZSIA 3ZO1A 3MVJA 4F1TA 2R3MA 2W5HA 2WQOA 3PG3A 5BMSA 3DTCA 2PVLA 2UZWE 2J5FA 2FSOX 1OL7A 1R0EA 3EJ1A 4F4PA 1NVQA 2RKUA 3OY3A 4HCVA 3HA8A 4ALUA 4ZLYA 4RIXA 2PWLA 3PY1A 4TRLA 3R7OA 4ACMA 3PDTA 5DR9A 3V3VA 4I23A 2E9NA 2OF2A 5DEYA 4UYNA 3TL8A 4AG8A 2JIIA 4FUXA 2A19B 4D58A 3QUDA 4AAAA 4AW5A 2CPKE 2OG8A 5KX8A 5LMBA 4J8NA 5IMXA 4CV8A 3PIYA 1WVXA 3EWHA 3GC7A 4AFJA 3DXPA 4XCUA 2VWUA 3KN5A 3VC4A 4FV6A 4GG5A 2WMRA 3LJ0A 4Z9LA 5DWRA 4WRGA 4IB3A 4QOXA 3WI6A 3R9OA 5A4CA 2J50A 2ZB0A 1ZOEA 3TXOA 4KABA 3IPHA 4TPTA 3ZLWA 2PZPA 3DNEA 4M15A 4OTIA 4Y72A 3W2QA 5FM3A 3SVVA 4XYFA 2X7GA 2V5QA 5ANJA 1YRPA 4MTAA 1RE8A 4UWBA 2XKFA 2R64A 3R1NA 4TWPA 1EH4A 2P2HA 2GNFA 5CNNA 5GZ9A 2UZNA 5CU2A 2EB2A 4ANBA 5ITAA 5KMJA 1F3MC 4O96A 3RKBA 1OL2A 1H0WA 4G16A 2F9GA 4DEBA 4FSWA 5CX9A 3KRWA 3VS3A 3WF5A 3GC9A 5I4NA 2J51A 2ZM1A 4PWNA 4YZNA 4CRSA 2E9OA 5HCYA 1DAWA 3TI1A 5G1XA 3TNQB 3ZBFA 3E63A 3UIMA 2O63A 4FKQA 3F3UA 4I22A 3DXNA 3QRKA 3K2LA 4IEBA 3LFBA 3LFCA 4E5WA 3D5XA 5EYKA 2ZM4A 4QQCA 4BKZA 3GQIA 3P9JA 3VBYA 4EHGA 1YXVA 3UQFA 5BVNA 3D7ZA 1DI9A 2OJIA 4HNFA 4BYIA 2JFLA 1OPKA 1Q97A 4MWIA 4EEVA 2OXYA 4C58A 4J8MA 3A7JA 1P5EA 5EM5A 5TF9A 4APCA 3G9LX 4TYHA 2R7BA 5EYMA 2YCRA 3JXWA 3C4CA 4ZY5A 2OZAB 3R7EA 2VNWA 3EN9A 3PPKA 3A7FA 2OI4X 5LVOA 2FO0A 4IFCA 3P78A 2OSCA 3QYWA 4L8MA 4OTPA 4XG6A 2JDTA 2PVMA 3ULIA 3F3ZA 2XJ2A 2F57A 3KFAA 4JVGA 3FAAA 2XKDA 1W0XC 4U8ZA 2VO7A 4DTAA 3OFMA 2YIRA 2OKRA 4W4YA 4ZY4A 1R78A 3PXQA 3Q4UA 4GMYA 1BL7A 4F1OA 3BLQA 2QKWB 3MB7A 4BICA 1K9AA 3RCJA 2FH9A 2VWIA 4PPCA 2B9IA 1WBTA 2RL5A 4XRLA 4ALWA 5BUEA 5FEDA 1UKHA 2GHMA 4UZDA 3VS5A 1Q24A 3D94A 3O0GA 5BYZA 4RIYB 2QNJA 4C33A 5HE3A 1LEWA 2JBOA 3L8PA 1E1VA 4TWOA 1KE7A 2W1ZA 4AZTA 3Q2JA 2I0EA 4YTFA 2IZUA 4IB5A 3QTXA 2OJFE 5FBNC 5B2MA 5M08A 3JVSA 1H8FA 2XNGA 4ZJIA 3R8VA 3S95A 3S3IA 1E1XA 1M2RA 2I0YA 2VTLA 2W1FA 3PVGA 1W8CA 4BDHA 1FMOE 3H0ZA 4PDOA 4X7QA 3DY7A 4M66A 2PUPA 4N57A 1PKDA 3FMEA 3G6HA 4DF3A 2BIKB 4K33A 4C62A 3UYSA 3AG9A 3D4QA 4R78A 3G51A 2QODA 3KCFA 2OO8X 4NM0A 4O22A 3BPRA 4YJOA 2XUUA 3RPOA 4M69B 1GZ8A 4AA4A 2BHHA 3NCZA 4CNHA 4LM5A 3NYXA 4M67A 3R9HA 3A60A 3LZBA 4MD9E 3W1FA 4B4LA 4QP1A 3BLRA 4FV9A 3OEZA 4JT3A 4X2FA 4TXCA 1QPEA 3Q5IA 5LVNA 3FMLA 3F3WA 5AP3A 3R1YA 2FA2A 5LCKA 1V0OA 1U59A 3ZO4A 3DLSA 4EBVA 2XEYA 3UP7A 2C69A 3ORKA 2VX0A 5EH0A 3HZTA 2IZTA 1XHAA 3QBNA 2J90A 4ARKA 2BRMA 5DNRA 4D2TA 4H05A 1YOLA 5KBQA 3CJFA 5IA0A 3ACKA 5B7VA 2WGJA 4LGGA 5IU2A 5HU3A 2BTSA 3GB2A 4MQ2A 2W1GA 2QHNA 2UZBA 5CEPA 3G6GA 4IJ9A 5HIBA 2EWAA 3FXXA 3DOGA 4GKIA 1GAGA 3NCGA 5ETFA 5BVKA 4HCTA 5DR6A 5HBJA 2XIRA 1DM2A 3QTIA 4JG8A 4XLIA 2BIYA 3UTOA 4BWPA 2Y8OA 3BHHA 3FUPA 4K11A 3SXSA 2WHBA 4O0XA 5CAUA 2GU8A 2WTIA 4E1ZA 5H8BA 2YCSA 5AV1A 3LJ1A 2ERKA 1XH6A 3MY0A 5IH4A 2GFCA 4DGGA 2ITOA 1TVOA 2C6TA 4QP9A 3QA8A 5HCXA 3UDBA 3LVPA 3OZ6A 2WMSA 4D5HA 4JDHA 3ZC6A 5JN2A 3ZXZA 4QYFA 2ITYA 2BAJA 3OWKA 4FYOA 4FTKA 3ZRLA 4D0WA 4CYJA 3QTZA 4OW8A 2WOTA 3E5AA 2QLUA 3QD2B 3PLAE 4R7BA 2BALA 3F9NA 3ZFYA 3KK9A 4EZ7A 4CMTA 4KIKA 4NM7A 1JSVA 3A7GA 4DH8A 4XG4A 5M09A 5IMEA 2GFSA 2BAQA 3UIXA 4D2RA 5EKNA 5ACBC 4CCUA 2VTOA 4AW2A 3HRBA 4DT9A 1Q5KA 2HZ0A 1FQ1B 1DI8A 5LXMA 4JRNA 3DGKA 3N4VA 4Z7GA 3QXOA 5I9VA 5K5NA 1G8SA 2RF9A 3VNTA 2WIPA 3Q6UA 4DEHA 5JH6A 5L4QA 5IQDA 4CZUA 1LR4A 4I0TA 4FT7A 5TE0A 3LE6A 5EHLA 4KBKA 5DYJA 4EC8A 2FYSA 3IW6A 4EOSA 3DZOA 3IW5A 4PNKA 4CKJA 4BDJA 5A4LA 3DA6A 4FK3A 2XK7A 5AA9A 3TJCA 4B7TA 2YN8A 5C1QB 1DS5A 4MNEB 4QO9A 3JR1A 3PVUA 2B53A 3ATSA 5GJDA 3UGCA 3OP5A 4FKOA 3RAHA 3SAYA 3HDNA 4RX8A 4UMRA 4PP9A 5ANIA 4DFZE 4W8EA 2CCIA 3DJ7A 5HQ0A 2CKQA 3TT0A 2HWOA 4EJ7A 5ANGA 5FD2A 4ZK5A 3QALE 2BKZA 4FNWA 4G9RA 1Y6BA 4GFOA 5T68A 1AD5A 2UW5A 3MIAA 2RIOA 4IX6A 5L8KA 3VIDA 4G9CA 4YTHA 4FIGA 5FRIA 4IADA 5AAGA 3GCUA 4C2WA 4GVAA 2YLFA 2ZMDA 5DMZA 2UVZA 5GJGA 3II5A 5LMKA 4FYNA 5HVKA 5IQFA 3VQUA 3BE9A 2YHVA 4DFNA 2ZV9A 2OIQA 2P0CA 3SC1A 3LCTA 5CSPA 3KULA 5M57A 2HW7A 5EK7A 3A4PA 1M2PA 2OIBA 2XRWA 4MQ1A 2W1IA 4PNIA 4KAOA 4DH1A 4E8AA 4F0IA 3QZFA 1OBDA 4Y95A 2XKEA 2F7XE 2YZAA 4ONAA 4PTCA 5EQYA 4GFGA 5AP0A 4F9CA 4U3ZA 4M8TA 3DKFA 2B7AA 3AC2A 3HMPA 2IW8A 1PJKA 4TY1A 3DU8A 3LFFA 4LFIA 3KRJA 4U9AA 3B8RA 5HLPA 4TKSA 1NXKA 3BBWA 3SRVB 5EI8A 4D0XA 3AGMA 4BCQA 3DKOA 4WOVA 3WILA 2YJSA 3JS2A 4HYUA 4BWKA 5J1VA 3TZMA 1G5SA 2O65A 5IA1A 2BROA 3HDMA 1H25A 2WNTA 4YO4A 4R7HA 4J98A 4Y83A 3EN5A 5CEOA 5IH5A 3HV4A 4NW6A 3M2WA 4HYIA 1JKKA 2Q0BA 4PPBA 4U3YA 3WOWA 4EOMA 5J9YA 5JQ5A 2F2UA 3UZPA 4XLVA 4HGEA 4JLCA 4QMYA 3I6UA 3CPBA 3TJDA 1R39A 3C5UA 3KB7A 2R3KA 4CMUA 4D4SA 2P55A 4RWIA 5LQFA 3MVHA 2BCJA 3NW7A 3TEIA 4B8MA 4CKRA 5KHXA 2CLQA 2VX1A 4BZDA 4L53A 1H08A 1LPUA 1YWVA 4ZLOA 2WQBA 5I9ZA 3A99A 5C01A 4BI1A 3R8ZA 3QKKA 1RW8A 2OIDA 4OLIA 4QYHA 5AX3A 4FKLA 3QQFA 5CF5A 1X8BA 2DS1A 2VTSA 1LUFA 4OTGA 3UPXA 4UYAA 4EKKA 2NNWB 3A62A 3A2CA 4I4EA 4X6QC 4RVMA 4BGHA 4FIHA 3NW5A 4CLIA 2BHEA 2NPQA 4KKEA 2Y4IC 4F64A 2O2UA 4EH9A 1BMKA 4JG7A 2HW6A 2ZOQA 3UVRA 3ZRMA 2VNYA 4O2ZA 5A54A 5LOHA 1URCA 2XYUA 3ZEPA 1U4DA 4JAJA 2J9MA 3FHRA 4XP0A 4GJ2A 2V55A 3FI3A 3ZMMA 3N4TA 3LFEA 4BKJA 3QFVA 4FV8A 1NA7A 4RMZA 4DINA 3EN7A 4O1OA 2R0IA 4I3ZA 3NZ0A 5M07A 2X9FA 2W96B 4E93A 1Q8WA 2VTMA 4F99A 3NUAA 3LOKA 1J1CA 3F5UA 2BRHA 2OK1A 2UV2A 4YLKA 4AZSA 5CQWA 3GI3A 2QD9A 3TUBA 2QOQA 3ID6C 4DFYA 1XJDA 3COHA 3QTSA 2IN6A 2V7AA 5EW8A 3ZUVA 4TNDA 3TNHA 4AOJA 2XNEA 3IW7A 3OWJA 4MF1A 4R1VA 4TN6A 2XB7A 2WQMA 5CU3A 3R22A 4KIQA 4TT7A 4BCGA 3FZTA 4D2SA 1J7UA 4PQNA 1ATPE 2Z7LA 4BIEA 2O0UA 3NUYA 1XH7A 4HGTA 5LWNA 2JLDA 4FEXA 2QOLA 2W1HA 4YZCA 3ZCLA 4EYJA 4O27B 4AA0A 1AQ1A 1YI6A 2XM9A 4YLLA 4EJNA 3NW6A 2OU7A 3KRXA 3OTUA 3AT2A 3PPJA 3QX4A 4IM3A 4YC6A 2J0KA 1OL5A 1UNHA 4HVSA 4I5CA 5FXSA 2W05A 3MFSA 1UU9A 2FUMA 3DLZA 2JGZA 4U45A 3EHAA 3FLNC 4BI2A 2PZIA 4BCNA 3NLBA 1L3RE 4AWIA 2J6MA 1T46A 2W4JA 4JDKA 3Q52A 4Y85A 1FGIA 4PL5A 5F4NA 3TV7A 3ZOSA 3ATTA 2I6LA 4F65A 4LOPA 1OKYA 4NKAA 3U54A 2XCKA 3P7CA 4A7CA 5IG1A 5M4FA 5J1WA 1ZZ2A 2GNIA 4QP8A 4GSBA 3HA6A 5F94A 3VS6A 4BFMA 3R01A 4DBXA 4BF2A 2J2IB 5C9CA 4DHFA 4XS2A 2PU8A 4RWJA 4ZZMA 2YFXA 5KKRB 4AZVA 5IUHA 3RCDA 4B9DA 4EOOA 3UVPA 4EQUA 5M56A 4ZMFA 2HENA 4D2WA 5LCJA 5BMMA 2Q0NA 3MA6A 1MQBA 5J5TA 1ZMWA 1ZYCA 2XNOA 3DBEA 2C0TA 3UIUA 3AMAA 5T3QA 2VTIA 3R0TA 4DAWA 4A9YA 3OBJA 3V5JA 3DBCA 4OT6A 3KCKA 3CTHA 1U46A 2O64A 1V0BA 3V8SA 3SRVA 5JGDA 2Y4PA 2JBPA 2QHMA 5GNKA 1O9UA 2BMCA 5KNJA 3H4JA 1IA9A 1Z9XA 3GU4A 2WQNA 4II5A 1WBWA 4PTEA 3U55A 4C4HA 2WTKB 3QL8A 4P4CA 2CGWA 5IUGA 3UODA 3QRJA 2REIA 4RFZA 4CD0A 4DC2A 3R8UA 3FMNA 1PXOA 3AC1A 2YLEA 2EU9A 3PRIA 3QTUA 4KD1A 4N6ZA 2ZM3A 2LAVA 4AE9A 3THBA 4E4MA 2C3JA 1PXIA 4U41A 2XVDA 3R1SA 4XBUA 3QZIA 4RLKA 5FXRA 2P4IA 3DQXA 1MRUA 4H3QA 2WB8A 3AMYA 4IX4A 3BEAA 3OXIA 4YSMA 4KB8A 4ANLA 4MCVA 5D12A 2YIQA 3P7BA 3POOA 3FLQA 2ZV2A 4QMOA 3G5DA 4QT1A 3UNZA 3RWPA 1V1KA 3VULA 4A9RA 1QL6A 2CHLA 3L9MA 4IVAA 5ANKA 5EYCA 2E9VA 4C4IA 4D4VA 2PVYA 2OXDA 4MXAA 4NJ3A 5M4IA 4OBQA 4GRBA 2ZMCA 2YIWA 2B54A 4QP3A 5CENA 4RC2A 3EQGA 1IG1A 1P14A 1ZRZA 3QQGA 4K8AA 4NJDA 1Q4LA 3ORIA 4G6LA 4WA9A 4A06A 4AE6A 4ENXA 3SG8A 1M2QA 1OUKA 3E62A 2ITQA 4U97A 3VVHA 3ZO2A 3VQHA 2HOGA 3EQBA 3NUXA 4R3RA 2VWVA 3DCVA 4KKGA 4KNBA 1DAYA 3C4XA 5A46A 3NYNA 5HTCA 2VRXA 4OT5A 3KXNA 3R30A 2XIKA 4EK5A 1XKKA 1GIJA 1BLXA 4FV2A 2X0GA 4MD7E 1YXSA 3A4OX 3N51A 5CAOA 4C2VA 3F2AA 4XG8A 4DH7A 4ITIA 3FXWA 2QQ7A 4DG3E 4C36A 4UXLA 3BV2A 4QMQA 1JKTA 3QC4A 4YC3A 4QNAA 3C0HA 4JG6A 4CZYB 3EQCA 4EBWA 2YABA 4FV3A 5ETAA 4DLJA 5CAPA 4RX7A 4HVHA 4CFFA 4FVPA 1Q61A 3A7HA 4J96A 2JDRA 3ROYA 1Q99A 2XNNA 1HCKA 5CI6A 3T3VA 3RP9A 2RFEA 2PVJA 4GT3A 5A6OA 3AD5A 4N4SA 4Q2AA 4N6YA 3TN8A 4BI0A 5IF1A 3UO6A 1XH8A 4FKUA 3V01A 4BTKA 1H26A 5EM7A 3UBDA 4D2VA 3LCSA 3OMVA 3JVRA 3KREA 1YXXA 2X2MA 3OXTA 1ZMVA 4U80A 3ORLA 3P7AA 3UE4A 3SQQA 2I0HA 3F82A 1VYWA 4LMNA 4XUFA 3FZ1A 1UNLA 4B99A 5CTPA 3ZSGA 3K3IA 3PSDA 4BCOA 2WU6A 5J95A 3WARA 4BKYA 1H1WA 4BWXA 3ORPA 2C3KA 5LARA 2C5YA 1OZ1A 5IQCA 4K18A 3U87A 5KMIA 4W9WA 2XF0A 3D9VA 3CQWA 4L3JA 4I5PA 4FKJA 4LOQA 1STCE 5AR8A 5L6PA 5L6OA 1JKSA 4TTHB 3V5LA 5J7HA 3GQLA 3LIJA 2R0UA 2X2LA 2BZHB 3A8XA 3DBFA 3WIKA 3PIZA 2F4JA 5HG8A 2BDFA 1WCCA 3HP2A 3UG1A 4C38A 3A8WA 2G2HA 2VWBA 3KVXA 4FTIA 4I6BA 4AOTA 2QR7A 2PUNA 4FI1A 4I0RA 3WE8A 3TM0A 3AT3A 1TKIA 5HG7A 4YMJA 5J79A 3IONA 4M0ZA 5AADA 4DG0E 1U54B 4GCJA 3IW4A 3ORNA 4BHNA 5EG3A 1RJBA 3RAKA 4IE9A 3OTVA 4FUYA 3QCQA 3EQRA 4XG7A 3W18A 3WZKA 2WXVA 2XK3A 3FMHA 3TWJA 4EWQA 4DTKA 4CCBA 4ZLZA 4CV9A 3B8QA 2XK6A 3FYJX 5HLWA 2CKEA 4ENYA 4NWMA 3QZGA 3VUTA 5GZ8A 4TW9A 3QF9A 2OFUA 2XMYA 3W8LA 3MV5A 4D2PA 3RK7A 5CQUA 4JQ7A 2YIXA 4TWNA 4JDJA 4B8LA 2A4LA 3PA5A 3PE2A 3OCGA 4MK0A 5AM7A 3TACA 2B0QA 3CLYA 3BE2A 4XG3A 3AC5A 2O5KA 5AIRA 3ZLYA 1L8TA 3OS3A 3RAWA 4IBMA 4UWYA 1ZYLA 4BGQA 5I9YA 5E90A 1CDKA 2ACXA 1ZOHA 3Q4TA 4FSUA 3KN6A 3I7CA 4FODA 5CVHA 4TYGA 4XMOA 2UZEA 3RZFA 3FC2A 5HICA 2CDZA 4U6RA 2QOFA 4XH6A 4HVGA 4YJUA 1Q8ZA 2H34A 1JLUE 3UQCA 3WZJA 4DYMA 3BQCA 3FLYA 3VJOA 1CKIA 2GPHA 2BILB 3C7QA 3MY1A 4DITA 3UP2A 4YZ9A 2BFYA 5ACKA 2CGXA 5JRSA 3MPAA 4IZ7A 4MWHA 4DH5A 4AXAA 1GOLA 4ZJVA 3I5ZA 3GNIB 5H9BA 1PYEA 2BZJA 4AOIA 4CRLA 4RWLA 5C8NA 5KMMA 3G0EA 4JOAA 4R5YA 4YZMA 3T9IA 3VS4A 4E6AA 4KSQA 3R7IA 3K54A 4RZVA 2QU5A 3CC6A 4DA5A 5CEIA 5JFXA 4O7TA 3P0MA 4LV5A 1ZY5A 5HE0A 4K77A 3DV3A 3RM7A 4I0SA 1OL6A 1B6CB 2GNGA 4P7EA 5D41A 5AR3A 4JI9A 4O2PA 5LMKC 3H9FA 3QD4A 4FKRA 5A4TA 2B1PA 5DEWA 4RWKA 3RM6A 2OH0E 2BFXA 4E6QA 3CPCA 3EQDA 5D11A 2GS6A 3U9CA 2BRBA 4RRVA 4FV1A 3UMXA 4ID7A 3QGWA 3VWAA 4AU8A 2CN5A 2H96A 3MTLA 4IH8A 2QU6A 4RFMA 2RSVA 3N4UA 3FYKX 2ZVAA 3MN3A 2B9JA 3OROA 4HPTE 2A27A 3GOKA 4EL9A 4J71A 2VUWA 4MNFA 1YHVA 3E8NA 1SM2A 5D7VA 4QQJA 2ITWA 2Y0AA 4DEEA 3FI4A 5HOAA 4XOYA 1GZOA 1KE5A 2F2CB 2E2BA 3DS6A 3OCSA 4Y5QA 4J1RA 5HBHA 5DRBA 4M0YA 3VUKA 2JAVA 2XK9A 5JZJA 3QLGA 2XJ1A 2W06A 4J97A 2WTCA 4O91A 5E8ZA 4S32A 3NMUF 3FY2A 2RFSA 2UW9A 3AMBA 5DN3A 4AGUA 4EH6A 3LHJA 4UBAA 4FTRA 1FVTA 4WBBB 2E9UA 3GBZA 4AFEA 2G2IA 3QYZA 2ONLC 2C5NA 3ZLSA 3I5NA 4CFNA 5EI2A 5CASA 3QHWA 4FNZA 1IAJA 3A61A 3VBTA 4F6WA 3QQUA 5ICPA 2WKMA 3BELA 3CQUA
chains in the Genus database with same CATH superfamily
5T6KA 3V6RA 5L2IA 3U8WA 2VTRA 3D5WA 4IB1A 3PWYA 3JPVA 3UNKA 3DB6A 3QAME 3SA0A 4AAYA 5GZAA 3ALNA 3DT1A 4FG7A 4EC9A 1H01A 3IGOA 4O0WA 1J91A 2X4FA 5GHVA 4ANNA 2GMXA 3DAKA 3NNVA 4AZWA 4NIFB 4B0GA 1VLRA 4O81A 1YWRA 2G01A 2OJGA 3UVQA 2UZOA 3N9XA 4BL1A 3C9WA 4YJVA 2WTVA 2YCFA 3FMJA 2H9VA 5E8WA 4WUAA 1WBSA 4GUBA 3NX8A 4FNXA 4QMLA 2KTYA 1Q8UA 3GU7A 3Q04A 3ZHPC 4L3PA 3PJ1A 1ZZLA 4WD5A 5HE2A 3WF8A 5M44A 3I1AA 2IJMA 2NRUA 4F63A 4O7ZA 4NL0A 4RX9A 3UC3A 3W55A 2QOOA 1SZMA 3MGYA 3O5AA 2CGVA 4AN3A 3MH0A 4RJ7A 4LQMA 3E87A 3EZVA 4EYMA 3ZUTA 4DN5A 4XHKB 3UJGA 2YM3A 3NFFB 4JBOA 2GDOA 3IKAA 5FWKK 1E9HA 3HNGA 3MH2A 4DEIA 3GC8A 1SMHA 4R5SA 4O6LA 3RAIA 5J87A 3WE4A 4GIIA 5IKWA 1JWHA 4L45A 2PHKA 4D1ZA 5D1JA 5AV2A 3VUHA 4ITJA 3P5JC 2OZOA 4PX6A 1W2FA 5FBOA 2QOIA 5JFSA 1WVYA 2OXXA 2XP2A 3FSKA 4QD6A 4A9UA 5CAVA 3NNXA 1SVGA 4V05A 2IW9A 4BCIA 2NRYA 3KF4A 1Q8TA 4GKHA 2X0QA 2X9EA 4L01A 2A98A 3C4ZA 4A9SA 1ND4A 4X2GA 5JT2A 2VTAA 4FVQA 5CNOA 2BUJA 2CCHA 4RIXB 5DT0A 3WBLA 3U51A 1KE6A 3V8TA 2HYYA 3T3UA 3C51A 4S33A 1P2AA 4E73A 2BAKA 4RA4A 4EHVA 3KMMA 1O6YA 2C3IB 5EM6A 2OZAA 2P3GX 3HP5A 3O8UA 4O86A 3IS5A 3O96A 2PMLX 4L43A 2GSFA 5DE2A 4C7TA 5HVJA 3MH1A 3VJNA 4EHEA 2HY81 4RJ5A 4I1ZA 1K2PA 3ORZA 3QD3A 5EHYA 2OJ9A 2VD5A 3ACJA 4GYIA 3FWQA 3PIXA 1H24A 4L67A 1W2CA 3KXZA 2J0MB 4PL3A 2JD5A 3L9NA 5AJQA 2V7OA 1UU7A 4G3GA 2P2IA 3R7UA 2CKOA 2ZFYA 4KSPA 1XH9A 1UU8A 3LFSA 5L8JA 4XX9A 4YO6A 2CKPA 3QUPA 2QOKA 2UVYA 5CYIA 4WG4A 3HEGA 5E91A 4O4FA 2OLCA 4ACDA 1PY5A 3DJ5A 1FINA 4CT1A 3GVUA 4RFYA 3F61A 5E9EA 3HECA 3MFTA 4L7SA 2PVKA 3LM5A 3NNWA 4EK3A 2C0OA 2JAMA 5EI6A 3CKWA 3GFWA 3TZ9A 4X3FC 3FC1X 5HNBA 5LVMA 5H8GA 4E5BA 3LFQA 2R3NA 4ITHA 3FEGA 1GJOA 2BTRA 1APME 1G3NA 5M51A 2C1BA 4KIOA 3D0EA 4P2KA 4RLLA 5HU9A 5KUPA 2YA9A 4YZDA 3TZ8A 3E7VA 1VZOA 4P5ZA 1R3CA 1XBBA 1GY3A 3NVKI 3PSCA 2XIYA 3LXPA 3PXRA 4FG8A 3AC3A 2IZRA 4IX3A 4V0GA 4ZTHA 4I92A 4AS0A 3PJ3A 5C8MA 3VONA 4FIJA 4I93A 3CY3A 2J4ZA 3NIZA 3PWDA 4AZFA 5C26A 5HI2A 3W0RA 2JIUA 3RWQA 4CGAA 2OW3A 5EW3A 4BZNA 2PUUA 1GZKA 4FT0A 4RIWA 4AUAA 4FKWA 2XBAA 1BUHA 3PUPA 4YSJA 2X8EA 1PMNA 2W0JA 3EL8A 4E5AX 4EQCA 2WMVA 3R2YA 2BRNA 4QTCA 5CZHA 1OPLA 3LCOA 4HGSA 4WNOA 5ANOA 4CZTA 5K5XA 3BYUA 3PE1A 1REKA 1YHWA 4ZTSA 3VHKA 4ZSAA 5K4JA 4FKGA 1JSUA 3BCEA 4L3LA 4QMTA 4C61A 3LMHA 2OFVA 4LYNA 5E1EA 4BGGA 4IVBA 2X7OA 4AZEA 4EORA 2GNLA 3GOPA 4QRCA 4AP7A 4YHFA 5KMKA 3W0MA 3CR0A 2CJMA 3GENA 4YJRA 5EKOA 5L3AA 4BYJA 4YR8A 2I0VA 4NK9A 4FL2A 2UZUE 3QXPA 4ALVA 3KL8A 2WTDA 2C30A 5IDNA 4AF3A 1H1RA 3QTQA 4IB0A 1KE9A 5AA8A 3BU3A 2YM4A 2O8YA 5K0XA 2CNUA 4O0UA 1OI9A 4NCTA 5HGIA 5BQ0A 5CF8A 3O8PA 2ZV8A 3GCQA 3EH9A 4YPDA 5EDRA 3GCVA 2H6DA 4BJJA 3ZZEA 3ANQA 4A4XA 1URWA 2OF4A 2YM8A 2UW0A 3EL7A 4ACCA 3EKNA 3MYGA 4WHZA 4RJ8A 1P4OA 2B4SB 1ZARA 1JNKA 4S2ZA 5DG5A 5A9UA 4KA3A 3P4KA 1MRYA 4DEDA 3W2OA 4QP6A 2X7FA 3Q53A 2B55A 4IACA 5AUTA 3GCPA 4CEGA 4Z16A 2A0CX 3ETAA 4FV7A 5J9ZA 4JR7A 2G1TA 3MPTA 5HNGA 3BRBA 4FT9A 3NAXA 4K6ZA 3F5XA 2DYLA 4JS8A 4YC8A 3PPZA 5C4LA 5H3QA 5IPJA 3LAUA 2BPMA 4NSTA 4U7ZA 1V0PA 2ZAZA 4RGJA 1YDSE 4EUUA 4FIFA 3V5PA 2ITNA 4J95A 4M13A 2ITTA 2XH5A 3SOCA 4AN2A 4LDTA 2C3LA 4FL1A 3Q9YA 3SD0A 3QTWA 5A4QA 2BRGA 5TO8A 1M52A 1YKRA 4DGMA 4YNEA 1IRKA 2C6IA 3V04A 3DDPA 5DBXA 2R4BA 2W1EA 3KRRA 5BVWA 4O7LA 2XANA 4TYEA 3KY2A 4C0TA 2PVFA 1Y6AA 5TOZA 3F3VA 4IWPA 3FMKA 2JDOA 3KC3A 2Z7RA 3OT3A 4BC6A 1OB3A 4AGWA 4G3CA 5DOSA 3DZQA 2JDSA 3MY5A 4E4LA 5AP4A 4F9YA 3BWJA 4A4OA 3L1SA 5JGAA 5C8KA 2UZDA 4BB4A 3H9OA 3MS9A 4LI5A 5BYLA 3QQKA 4C4FA 1YVJA 4C35A 3LXLA 2WQEA 3BL7A 3LMIA 3OWLA 3NWWA 3KMUA 3R8MA 3ZTXA 4D9UA 4USEA 4EZ5A 5DHJA 3VUMA 1U5RA 3BKBA 1NT2A 1QPCA 4OGRA 2X39A 1FOTA 3AC8A 2YDIA 3S2PA 5E4HA 1A48A 4ANSA 2EXEA 4UY9A 4H1JA 3F5GA 4C3RA 3IQ7A 1OIUA 3MFUA 3AGLA 2WD1A 3ZEWA 2ZDTA 2LGCA 3GEQA 4F70A 2PE2A 3O7LD 4MHAA 4TYHB 3ZDUA 3BBTB 5BVFA 4ANMA 3LLTA 3Q32A 2H8HA 5IQHA 1H00A 4L52A 4PDSA 4RQVA 3TYKA 3FL4A 1NY3A 4GU6A 5DT3A 1G8KA 3I0QA 3MSSA 4IFGA 5EOLA 4MBIA 3R9RA 3OVVA 2X0PA 3OF0A 1S9IA 1FMKA 1OGUA 2R3HA 2YDKA 4QMNA 1UA2A 4CFXA 4I6FA 1XBCA 2R2PA 4GEOA 5JFVA 5HCZA 4WRSA 4ZAUA 2R3JA 5A14A 4KIKB 1FVVA 4S30A 2IVVA 4O7SA 4L68A 4ORKA 3BIZA 3ZU7A 4HGLA 3FXZA 2HWPA 4K9YA 2QCSA 4BDDA 4MBJA 4A07A 4FE2A 3PZEA 5HNIX 3RINA 1PW2A 3R8PA 3W2PA 4FZDB 5A4EA 3RPRA 5FDPA 4O7YA 5HE1A 3W8QA 4MXOA 3VHEA 2HZ4A 4I20A 4WUNA 4GVJA 3UOJA 2NO3A 5KBRA 3QKLA 5DA3A 2EVAA 3AXWA 4ZS4A 4GS6A 4EK8A 4L9IA 4F7NA 3RPSA 3MESA 4I41A 5AV4A 5AMNA 2C5OA 2WTKC 2XJ0A 3K5UA 4EK4A 4FGRA 1Z5MA 3U4WA 3TIZA 3DKGA 4O7VA 1W7HA 3C13A 2CLXA 3DK3A 5ANDA 2HIWA 4F09A 2WMXA 3VS0A 5K0KA 4JX3A 3FMDA 3RI1A 4YTIA 1OECA 3P5KA 4H3PA 4FVRA 3RGFA 4BCKA 4KRCA 4QPSA 4ZP5A 4L46A 1R0PA 4GIHA 2RFDA 4RSSA 3NVMB 2G2FA 5EDPA 3BGPA 4GU9A 2QURA 3PXKA 3BGQA 4JQEA 1MUOA 4MYGA 5IQIA 1UKIA 1W98A 2Z8CA 5J8IA 4O7NA 1YOJA 3QA0A 3QX2A 5M53A 4HJOA 4MD8E 3AKKA 3FZSA 4G34A 4HZRA 5JFWA 3LLAA 4FEUA 4HPUE 5CT7A 4HYHA 4XG2A 5AIKA 1FPUA 1I09A 2X4ZA 4AN9A 4UEUA 3VF8A 3LW0A 3CD3A 4QP2A 3G90X 4A9TA 2Y9QA 5A3XA 3COKA 3W0OA 3O7LB 1WBPA 2OJJA 2WMQA 4IM2A 4EQMA 2W9FB 3ZBXA 4XEYA 5E1SA 2XNBA 1MRVA 5BV3A 2YITA 3WYXA 2JEDA 3MI9A 4P90A 3KEXA 2UVXA 4D28A 4DEAA 2VZ6A 3D2IA 4ZSEA 2J0LA 2R3GA 3UPZA 3GGFA 4Y73A 3ENHA 2XK4A 2HK5A 2R9SA 2YWPA 3LM0A 5D10A 4BDFA 3W0PA 1CKJA 1OIQA 4FZ7A 3CCNA 3OEFX 2BDJA 4CKIA 5FP5A 2W1DA 4ZS0A 4AX8A 1XQZA 2YM6A 3PVWA 3EOCA 4O83A 3JYAA 3LQ5A 4RQKA 3H0YA 4BVUA 2BDWA 3POZA 3PVBA 5HVYA 2WU7A 1Q62A 2C5VA 3FE3A 3V8WA 2F7EE 4ZSLA 4ZY6A 5CALA 3FKLA 1ST4A 4TYIA 3LFDA 2GCDA 4HNIA 3F88A 4QYEA 3TTIA 4FTQA 4IC8A 3CE3A 4G3EA 1H0VA 1T45A 3GU8A 4JRVA 5HTIA 3TKHA 2YJRA 3AQVA 4FKSA 2IF8A 5FGKA 4C4EA 4E6CA 4EOPA 1PXKA 4QMWA 1PMEA 3C50A 4FEWA 4PMMA 2X0OA 3LPBA 1KV2A 3G9NA 4PL4A 1BYGA 4UB7A 5CSXA 1U5QA 1G8AA 4FSTA 4FZAB 3S4QA 3VS7A 2I7QA 5CI7A 5IQBA 4CG8A 4DH3A 2C68A 3CBLA 5DLSA 4QTBA 4HOKA 4GJ3A 4FEQA 3PXFA 4UZHA 3MIYA 1WVWA 1M7NA 2HZNA 3ROCA 3U9NA 3I0OA 1OMWA 2WELA 1YHSA 1AGWA 2YDJA 4B6LA 4ZJJA 4FTUA 1B39A 3HMIA 1B38A 3O50A 5G6VA 4LL0A 3OHTA 4W4XA 1OM1A 2X8IA 5AP7A 3Q9WA 4PDYA 3IOPA 2VTNA 2AYPA 1W84A 5L8LA 4E4XA 5CSVA 4LGHA 4F9WA 3FKNA 2R3FA 4O0SA 3GUBA 4HYSA 3O23A 4XV1A 2V62A 4I4FA 2CNVA 4Q5HA 3RPYA 4BCPA 4I24A 4W9XA 4YHJA 4H3BA 4WBOA 1W83A 1QPDA 3NSZA 1OKWA 4FOCA 4MAOA 2C6LA 2W4OA 5CF6A 1KWPA 5IEXA 1YWNA 2JDVA 2ZJWA 3NS9A 4FTNA 2XCHA 5AM6A 4PRJA 3UMWA 2WTWA 4BDEA 5BVOA 5D7AA 4MXCA 2ITVA 5JZNA 2PVNA 4NTSA 4PF4A 3G33A 4X0MA 3KQ7A 5CXHA 5DPVA 5HESA 4USDA 4JX7A 4UXQA 2W9ZB 1ZYSA 2Y6MA 4F0FA 2IWIA 5E8UA 3R28A 3VBQA 4NFMA 5B0XA 3G2FA 3IDCA 3ZO3A 3P86A 1PHKA 2GS7A 3EZRA 4ANQA 1KOAA 3NUUA 4PY1A 4F6SA 2C47A 3MA3A 3NYOA 3C0IA 2ONLA 3HKOA 3Q9ZA 4M7IA 1CSNA 4I5HA 3CS9A 4E4NA 4G6NA 1Q41A 3GU5A 4NEUA 4OTQA 1MQ4A 4JL9A 3UO4A 1YI3A 1PMVA 1KV1A 1WZYA 4FC0A 3NGAA 4M84A 3NIEA 1JKLA 2ZB1A 3A7IA 5M06A 4NKSA 3RPVA 3ELJA 4G2FA 1J7LA 4QPAA 4ZEGA 5GIOE 3D2KA 5KZ0A 3CY2A 3QTRA 1A06A 4X3FA 4FTTA 3SOAA 1SVEA 4F7SA 4FSRA 2IVTA 4V04A 3MJ2A 5HD7A 5BYYA 4MBLA 3E93A 4CVAA 4X3JA 4EH5A 1IA8A 1BKXA 1PXMA 5GINE 2RG6A 4UMQA 5I3RA 3B2TA 3DAJA 1H1SA 3LFNA 4AA5A 4GT5A 5AUXA 3TTJA 4FNYA 3CKXA 3R1QA 4R3CA 4U44A 2EUFB 4XJ0A 3VBWA 2VWXA 4HVIA 4Z3VA 3V6SA 2B9FA 2WPAA 5EW9A 2ESMA 3U4UA 2A2AA 3NUSA 4YBJA 4DFXE 3R21A 3OD6X 4FMQA 4WSQA 3IECA 4F78A 3SLSA 4YJPA 4QTEA 4O21A 2BKKA 3NRMA 2J7TA 3R73A 3ET7A 3DNDA 3SDJA 3EMGA 4YURA 2WO6A 5AP1A 4BN1A 3CD8A 3OW4A 4FG9A 3D5UA 3ULZA 4IAKA 2GTMA 2PMIA 4LL5A 2VO6A 3MDYA 5EHOA 2C1AA 4YZBA 1PYXA 4LV8A 5JKGA 3ZONA 3UC4A 1Y91A 2W5BA 4QMUA 2YERA 3HV7A 3DK7A 3L9LA 4GV1A 3MB6A 3FV8A 1YW2A 2OICA 3HUBA 3KXGA 3PA4A 4QPMA 4BRXA 4O82A 4DCAA 1TQMA 5DH3A 2WFYA 2FSMX 2XALA 4DDIA 4I5MA 4IIRA 4RZWA 5E8SA 3BZ3A 4TNBA 1Y8YA 2CN8A 4WSYA 2XS0A 3FL5A 3TIYA 1JSTA 4RC4A 3COIA 3PJ8A 4RJ6A 2V22A 2W7XA 3S1HA 2GTNA 3W2CA 2XIZA 5C03A 4FOBA 4QQTA 2XNMA 3WF9A 4NIFA 4FKTA 2WOUA 4LRJA 1WAKA 3RHXA 4MNEA 2VWZA 3QUEA 3HMOA 3Q3BA 4DGNA 3REPA 4ZTQA 3RTPA 5AP2A 3HV5A 3BWFA 3OCBA 4EH4A 4BCJA 3RJCA 2FSLX 2IW6A 4O4EA 4LGDA 4J53A 3WZDA 5J5SA 1KUTA 2VO3A 3F5PA 2OWBA 5HIDA 2QG7A 1JBPE 3RALA 1M17A 3O17A 4FKVA 3NR9A 2QKRA 1REJA 4PDPA 5AP5A 4OTFA 1VJYA 3ODZX 3ORTA 2PE1A 3EQHA 4IAAA 2X6DA 3EN4A 3IDPA 4FSQA 2BZKB 3ANRA 4PPAA 5FG8A 4CQGA 4FT5A 5F9EA 2PZRA 4G3FA 2PVRA 2X81A 4EH8A 5FDXA 1QMZA 5IA5A 1ERKA 4NYEA 3PLSA 5M55A 5HBEA 5FP6A 2YEXA 4FBXA 3PP1A 4KWPA 3D83A 3UOHA 2IO6A 4BBFA 3BYOA 4R3PA 3HAMA 3C0GA 4RG0A 4UV0A 4F0GA 2WMAA 1XH4A 3E3BX 1J3HA 4I6LA 2VN9A 1PF8A 4WNKA 3EFWA 4Y8DA 4YP8A 3GFEA 2Q83A 2PE0A 3FMMA 3UZTA 1IR3A 3O71A 4BTMA 3M11A 2AUHA 3CEKA 2ITUA 4FSZA 3FQHA 5BNJA 5CEQA 2P33A 3R00A 4FKIA 3BHUA 2NYAA 3AD4A 3FSFA 4LUEA 3LXKA 3UQGA 3UO5A 4DG2E 2GHGA 3ZH8A 4DEGA 1IASA 2YM7A 5CZIA 3W33A 1FGKA 3MVMA 2YAAA 3VAPA 4ZTLA 2UZVA 3M42A 5AUVA 4L00A 3LQ8A 4QTAA 4WNMA 4YBKA 4QMMA 4BDBA 2PUIA 3BHVA 3ZYAA 3VRYA 4O7WA 3TDWA 4WKQA 4NZWB 4XV3A 5CU4A 2R3PA 2UW3A 4AGDA 3Q5ZA 4IDTA 2UZTA 4MF0A 4O0TA 4U5JA 4FEVA 5JMSA 4MXXA 2C5XA 3QHRA 1O6KA 3HRFA 4KINA 3R9NA 3IDBA 3E8DA 3K5VA 1U54A 4DGOA 1Q3DA 5A6NA 2BR1A 3FZRA 4K1BA 4GK2A 5EQPA 3QWJA 4G5JA 4WIHA 4F7JA 4LRMA 1QCFA 2QI8A 2Y6OA 3QZHA 5F1ZA 4M68A 4NU1A 4YJTA 4IM0A 2EXMA 4NH1A 5EOBA 2VTHA 5AX9A 3T8OA 4QYYA 3FPQA 4AGCA 1YDRE 5LVLA 4O0YA 4IDVA 3VUIA 4BDIA 4C4GA 4YUQA 3QQJA 5HLNA 4IWQA 1MP8A 4M14A 4X21A 3KU2A 3BEGA 4P5QA 3C4FA 3FLSA 1SYKA 3KXMA 5FM2A 3SXFA 3SV0A 5CANA 5FUTA 2CSNA 2ERZE 4H39A 3D14A 2HXQA 3DDQA 4FICA 2PPQA 4G3DA 2VTPA 2AC5A 3C4EA 4XOZA 2UW4A 1CMKE 5TKDA 1VR2A 3HRCA 1BI8A 5CU0A 1KE8A 4UX9A 4NTTA 2GQRA 2QO2A 3BHYA 5AR5A 5IISA 3TKIA 4EKLA 3LKMA 4X2JA 2XEZA 4CFVA 1UNGA 4K2RA 2CMWA 2Z60A 4JXFA 1FBNA 3GU6A 5J7BA 3VF9A 5BUJA 3QLFA 4KRDA 3NAYA 3QRIA 3LFAA 4LRKA 3F6XA 5CSHA 5KMNA 5IA4A 5E92A 2X6EA 5CXZA 3TV6A 4CTCA 4G6OA 4J99A 4F6UA 3PFYA 3HUCA 3GT8A 1ZMUA 1XO2B 2RG5A 3V5QA 4CFWA 1I44A 1UVRA 2ITZA 3MFRA 1YXTA 3PY3A 4JBVA 5LWMA 3ZC5A 1A9UA 4M97A 4A4LA 5IA2A 1G8JA 5FEQA 3EN6A 2CNQA 3Q6WA 2UW8A 4FSNA 4DLIA 4MXZA 2VTJA 1OITA 5HTBA 3H9RA 4CMOA 2YM5A 4NM3A 4V0GB 3IO7A 3CSVA 4AT5A 2VGOA 1J1BA 3FLWA 3KMWA 4C57A 2XM8A 2QLQA 5AR2A 3HMNA 4BDKA 3DB8A 2PZYA 2W17A 2IZSA 4FTAA 4GH2A 2W1CA 3NYVA 4UALA 5AAFA 5IEYA 2X2KA 4E20A 4L44A 4X3FB 3TV4A 2F7ZE 3QQLA 3IG7A 4HZSA 4C37A 2WAJA 1OKZA 4RVTA 3HMMA 5HHWA 5GIPE 4R6VA 1Q3WA 4ZIMA 2WMUA 2DWBA 3F3TA 3TNPC 3QWKA 4IVDA 4XP2A 3K3JA 1XBAA 3R9DA 4EUTA 4QMVA 5FQDC 2OBJA 1Y8GA 2O3PA 2W99B 4OR5A 4WO5A 3DFAA 1ZY4A 4FL3A 5HIEA 5HKMA 4BR3A 4OAUC 2HAKA 4QNYA 1VYZA 3UG2A 4RC3A 3E3PA 3KF7A 4RPVA 3SKCA 3OBGA 4FK6A 3E7OA 4GK4A 4FV5A 4Q9ZA 1GZNA 3NEWA 3IGGA 3LMGA 3PJ2A 3RZBA 3R04A 4QMZA 2AQXA 3EQPA 4FTCA 3O8TA 3VS2A 1ZYDA 3EFLA 4OBOA 4QYGA 3EQFA 3FZPA 5K3YA 3R7YA 1YXUA 3PA3A 4X2NA 4YJNA 4HW7A 4EOKA 3LCDA 2ETMA 2QOHA 1VEBA 1S9JA 2QVSE 3Q4CA 4M69A 4TL0A 1R1WA 2PMNX 2JIVA 4J52A 3WF7A 4BIBA 3HAVA 3ENMA 4OTDA 3ZM9A 3NNUA 2YWVA 4PUZA 4YTCA 5HEZA 3EYGA 4L6QA 5L2SA 2DUVA 3EKKA 5FXQA 3OOGA 4FF8A 3DBQA 3I60A 5TT7A 1SVHA 2PK9A 5JSMA 3KA0A 4C34A 3C5IA 4Y5HA 5BVDA 5KZIA 4U79A 4AT3A 4ZSGA 3BQRA 3W16A 3RBWA 2BZIB 2ZYBA 4K0YA 5B2KA 3VRZA 3H3CA 1H1PA 5FTQA 2ZV7A 5F95A 3DKCA 4DFBA 2B52A 1ZOGA 4FTLA 3QGYA 1LP4A 1PKGA 5JRQA 2UUEA 5HO7A 2VAGA 3KXXA 3MBLA 3PTGA 5FTOA 3KK8A 1OKVA 3DK6A 3JY9A 3SXRA 3TDVA 3DQWA 4LMUA 4EH3A 4IZ5A 2X8DA 1SNXA 4G1WA 3OT8A 4FZFB 2NP8A 4ERKA 5AV0A 1P4FA 5JEBA 4Z7HA 1K3AA 2XKCA 4AACA 2WZJA 4C02A 1YDTE 5DGZA 1OIRA 4PP7A 5E7RA 2FGIA 2AC3A 3JY0A 2VWYA 3FDNA 4C4JA 4RX5A 4W4VA 5AP6A 5ETCA 3WZUA 5KKRC 3F69A 3TUDA 5L2WA 3VS1A 4G17A 5IA3A 3UOLA 3PXYA 4BHZA 3ZZWA 5AUWA 3KKVA 3OUNB 4O84A 1JAMA 3QD0A 4BCMA 3FQSA 5BVEA 3CJGA 3CQEA 3ZUUA 4JIKA 2C0IA 2VTTA 2W5AA 3ZM4A 3SX9A 5KCVA 5CT0A 3EQIA 3M1SA 3S00A 2Z02A 4AXDA 2J0JA 1NW1A 2WEVA 5DFPA 4BJJB 4W4WA 3BU5A 3RVGA 3WYYA 3F66A 4LG4A 4CLJA 1UWJA 4ASEA 2I1MA 4HVDA 2VU3A 3DFCB 4CT2A 1WFCA 4DGLC 4JBQA 5D9HA 4BBMA 1BL6A 5B2LA 4LV7A 5AV3A 1JQHA 3I81A 3I6WA 4KBAA 4CFMA 3ZS5A 5H8EA 1H07A 4FTOA 3I4BA 3L8VA 4S31A 3RHKA 5CAQA 4S34A 4IAIA 2GS2A 3U6IA 3UDZA 5CF4A 3NDMA 4DHJA 1F0QA 3CTQA 2XRUA 4G31A 4R8QA 1M14A 3V5WA 4BY9E 4YU2A 3TUCA 1NVSA 4BTFA 2PY3A 2IG7A 5HG9A 4KUJA 5AUUA 4FX3A 2CGUA 4BCFA 4O7RA 4CQEA 3O51A 4FV0A 3TKUA 3IOKA 5TR6A 3D5VA 2YISA 4ZZOA 3Q60A 4EHZA 3ALOA 4JNWA 5CWZA 3F2RA 4DT8A 1Z57A 3NUNA 2PMOX 4XV9A 3UYTA 3ZLXA 2I40A 3BU6A 1OGYA 1RDQE 4NFNA 4DFUA 4D4RA 3ZXTA 4BDCA 2C6MA 4IVCA 4QTDA 2HCKA 3OC1A 5I9XA 5AEPA 2HXLA 5E8YA 3SG9A 4TYJA 3BYVA 3MH3A 5LVPA 1FVRA 4DBNA 3F2NA 4YHTA 3FLZA 3MJ1A 3CGOA 3OW3A 2IVSA 5DR2A 4IAYA 2UZLA 5H2UA 5E8TA 4XP3A 4J7BA 4U42A 5I9UA 5HORA 2Y4IB 4GUEA 1YI4A 4DFLA 2R5TA 5K9IA 2YACA 5I3OA 5AUZA 4BCHA 4FTMA 3HLLA 4M3QA 3L8SA 2OH4A 3ZRKA 4CG9A 2ETRA 3OOMA 5CLPA 3OY1A 3BHTA 4EOQA 4O0RA 5DT4A 3MWUA 3WF6A 3GXLA 3E88A 4OUCA 4X2KA 4FZ6A 4JIAA 4ASDA 4CFUA 4IJPA 4YNOA 4RJ3A 2Y7JA 4JR3A 3KXHA 4E3CA 1YOMA 2WMWA 2WTJA 3PUFC 4O6EA 4FV4A 2JFMA 5IZFA 3FI2A 4GT4A 4GG7A 1HCLA 1TQPA 3WZEA 1ZWSA 4BTJA 4OTRA 3W10A 3R6XA 4QMPA 3RK9A 4EOJA 2QO7A 4YGAA 2R3RA 3FKOA 3L9PA 2R3LA 3U6HA 4Z55A 1HOWA 4OTHA 5CU6A 4ACGA 2QO9A 2F49A 1CKPA 4FR4A 4O1PA 5IEVA 2C6OA 4AT4A 2ETKA 4FA2A 3OXZA 2GHLA 2KULA 3Q2MA 5HX6A 1QPJA 5CY3A 4XG9A 3UIBA 3TG1A 3HV6A 5BUIA 4L42A 2C6EA 4U81A 3KULB 4ZMEA 2C6DA 2B9HA 3KVWA 3LJ2A 3NUPA 3QQHA 4L7FA 3PZHA 5I0BA 2J0IA 4TZRA 5AFVA 4AW0A 4LOOA 1RQQA 4ZTNA 4GFMA 4YPSA 5KMLA 4O38A 4IXPA 4WNPA 5DIAA 3R7VA 2RFNA 2XIXA 5AR4A 3D7TA 5IDPA 4U0IA 3NPCA 4ZXTA 3AD6A 4V01A 3CP9A 3FJQE 3EB0A 3V51A 3FY0A 2SRCA 4IAZA 5IQGA 2EB3A 4RVKA 3QCXA 2YCQA 1ZLTA 4RA5A 3RMFA 4GYGA 3EYHA 3TZ7A 4F9AA 1UWHA 4PMPA 5BPYA 3DPKA 4QP4A 4FTJA 5HG5A 3MW1A 4IZYA 2VV9A 4E26A 4F7LA 5C27A 3HVCA 4UMTA 2QC6A 3DJ6A 5FEEA 4C8BA 2C4GA 4NCTC 4FKPA 4QP7A 2JC6A 2QG5A 4Q5EA 4R77A 3PXZA 3D15A