2YIQA

Structural analysis of checkpoint kinase 2 in complex with inhibitor pv1322
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
280
Chain Sequence
b'VYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title X-Ray Structures of Checkpoint Kinase 2 in Complex with Inhibitors that Target its Gatekeeper-Dependent Hydrophobic Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiqA01
3KRXA 4MF0A 1U59A 2QU5A 1OVEA 4OAVB 3HUBA 3BGQA 3LCDA 3E3BX 3TTIA 4X2KA 2JDVA 4KKHA 4RZVA 1SZMA 3FXXA 4IDTA 1W8CA 1V0PA 2DYLA 3F69A 4QMOA 4OR5A 4XH6A 5TO8A 3VS0A 2CNUA 4F63A 2P55A 2C30A 3A2CA 3ENHA 4ITHA 3OT8A 4XOZA 5E1SA 2QCSA 5G6VA 3NVMB 4FMQA 1QPJA 3GC7A 4S34A 2ZV8A 2CKOA 1GIHA 2VTMA 3G5DA 3PSDA 2OZOA 4NIFA 3KY2A 3L9MA 4MQ1A 3E92A 3Q04A 4PL5A 2WMRA 4M69A 3NNWA 3MS9A 5I9XA 3EJ1A 4JX3A 4DGLC 5IF1A 4X6QC 2FSOX 4GYGA 2X4FA 3DJ5A 4L01A 2B9HA 4OGRA 5CYIA 4BDBA 1XH4A 2VGPA 4AOTA 3PJ3A 1MRYA 2UVXA 3CIKA 1T45A 3FHRA 4LGHA 3ZUVA 3DNEA 4PL3A 4FG8A 3MW1A 2CGWA 2OXYA 3ETAA 3VBTA 2A4LA 3VAPA 2VAGA 3H0YA 4MKCA 3IKAA 3R73A 4RFMA 4I93A 5HIDA 4E1ZA 3MTFA 3E7VA 3QGWA 5HD7A 3VIDA 5AA9A 2X2MA 4DTAA 4TWPA 2R7IA 4GVAA 4YZNA 4FVPA 2Y6OA 3L9LA 3LMGA 2GS7A 2IJMA 3E3PA 5HQ0A 2YWPA 5J5TA 3I5ZA 4EOIA 4ZSAA 1YWNA 3CKWA 4B0GA 3ERKA 5EDQA 3DJ7A 4IJPA 4JOAA 4X6RA 1R1WA 2FSLX 3MYGA 2BPMA 4JR7A 4FF8A 5FUTA 4PMSA 3DLSA 4QNYA 1ZYLA 1OL5A 4U81A 5AR4A 4F6UA 3W18A 4ANSA 3PY0A 4OW8A 4G31A 4S2ZA 3B2WA 4NFMA 1IG1A 2VTOA 5CI6A 3R04A 2VTPA 4JRNA 4RVMA 4FTMA 1MUOA 3BU6A 4IWPA 4L8MA 5J95A 2E9PA 4OTRA 4GUEA 4ANQA 4YBJA 3D5XA 1YOLA 5L2SA 3DLZA 3EQHA 5B2KA 3TJDA 4V01A 1P5EA 3VUMA 4RJ5A 5JT2A 1PYXA 4A4OA 5AUXA 1ZZ2A 4NW5A 4EOJA 3A7GA 4BCHA 3KRLA 2B9JA 3DXNA 5CEIA 4ZXTA 2PVJA 5CF4A 5I5ZA 3W2RA 3ZO3A 1CTPE 2ZB1A 2XRUA 2KULA 2BFYA 3DU8A 4EOSA 2QG7A 5L4QA 3FSKA 3MH3A 1H1RA 4ACGA 5HIEA 5E9EA 2Z7RA 4BCFA 4C3PA 3RK9A 4FKPA 4WBBB 3FQEA 4EK5A 3UZTA 3F3TA 2P2HA 4HPUE 5CASA 3GU7A 5CENA 1G8SA 2VU3A 3FMLA 3NUXA 4FIIA 2R3KA 3IO7A 3IW5A 3NUUA 4O21A 4XNEA 5CEQA 1PXJA 3LLAA 4JQ7A 5EYDA 4XG9A 4ZTSA 3BELA 1G5SA 3ALOA 2X6EA 4U43A 3R8VA 3BHTA 1FMKA 4C4FA 5M53A 3PP0A 4BWKA 1Q3DA 3LJ0A 3BLHA 1AD5A 3PA3A 2O63A 3PVBA 4BI1A 3IGOA 5AP0A 2A1AB 3IG7A 3P9JA 4ACMA 4K1BA 3O7LB 4QMTA 4GU9A 4DG2E 4FT3A 2Y7JA 3FYKX 5HNGA 3TG1A 4XHKB 4CSVA 1R39A 4I0SA 4QQTA 3TZ8A 4D4RA 4AT3A 3V5QA 3RM6A 4O0UA 2W9ZB 4R3CA 3RBWA 1OMWA 5CEMA 2VTHA 2V62A 2YCRA 5AR2A 3TNIA 4AE9A 3F2RA 5C1QB 1U5QA 1ERKA 2YDIA 1JAMA 4USEA 1ZXEA 2X8IA 2QOOA 1R0EA 3AGLA 3UZPA 4O7LA 1YDTE 1XH6A 3BGZA 3PSCA 3M11A 3UG1A 5LARA 4JLCA 2YACA 4GW8A 3RWQA 4BHZA 1CKJA 5L2WA 1J3HA 2GQGA 3QA8A 3I0QA 4FV6A 4JL9A 5ETAA 3SX9A 3R22A 3NLBA 4BICA 4TY1A 2RFSA 4E73A 2PWLA 4G5JA 3R7VA 5EYMA 3R9RA 5FTOA 3WZKA 2OGVA 4RX5A 1GNGA 3VJOA 2J2IB 3G9NA 4WRGA 4IVBA 3F5XA 3FZRA 4ANNA 4WIHA 2BFXA 4KS8A 2XNEA 3SW4A 3R9NA 5FRIA 3TKHA 5AR8A 2JBOA 3LFBA 3R21A 4CVAA 4TWNA 3M1SA 2R3QA 3JPVA 3MJ1A 1TQMA 4NWMA 4MHAA 4FKQA 2WMVA 3FKNA 4C4IA 4IAKA 4J7BA 2O2UA 3FI2A 3DA6A 4RX8A 4YPDA 2ITOA 5AAFA 3PJCA 1SMHA 3D7TB 4O96A 1OECA 1IASA 4GRBA 5FXQA 4J52A 4R7HA 3FI4A 3SRVB 5IH4A 5J9ZA 5LQFA 1J1CA 2G2IA 4CFUA 4O7ZA 2P4IA 2C6TA 2KTYA 2W1EA 4UMQA 1PXIA 2XYNA 3O8TA 3NW5A 3T3UA 4HNIA 3VUIA 4Y85A 1KE9A 4FTOA 4PQNA 4QP8A 4I20A 4TYIA 1GZNA 5EKOA 5IH6A 5AWMA 1RDQE 3DJ6A 1FOTA 3AT4A 3BHYA 1H07A 4H1JA 2GQRA 3WI6A 1QL6A 2ZMCA 3EZRA 3DS6A 2Z7QA 2ZDTA 4MD9E 5TOZA 1ZOGA 2UZVA 4GH2A 3RM7A 3F5UA 3Q6UA 4XG3A 2YAAA 4EHGA 1WBTA 2OO8X 4QP3A 4KUJA 2PK9A 4AX8A 2G9XA 4HYHA 3S0OA 4FG7A 3GBZA 3MVMA 3C5UA 5I9VA 4OTIA 3PIZA 2B53A 5I4NA 2VWBA 2RGPA 2UUEA 3UOHA 3E8NA 3W2OA 4BBFA 4BCKA 5KMOA 3MV5A 1OM1A 4M0YA 5CI7A 2ZV7A 4RZWA 5HCXA 2B52A 1Y6BA 3MBLA 4PNIA 1U4DA 2XKEA 4AA5A 4C2WA 4ZOGA 3CPCA 3HNGA 4JI9A 3O0GA 5DR9A 2QI8A 2CPKE 5IG1A 5TE0A 4RWLA 3W16A 4BB4A 3VBXA 3S00A 1CM8A 4AGUA 1OPKA 4QMVA 4ZTHA 2YFXA 3D4QA 3Q4CA 3GXLA 5FWKK 2GNLA 3DY7A 4BGGA 2YITA 5AX9A 2R3MA 4KA3A 4NUSA 5JSMA 3A7FA 3IW6A 3L8VA 3BE2A 2XF0A 4LRMA 5AM6A 1APME 3PXRA 1NW1A 4FTNA 5E8ZA 3G9LX 3I4BA 4ZJVA 3ZM4A 4F7LA 3DK3A 1PF8A 4RIOA 3G0EA 1JSVA 5K9IA 3NYVA 4I0RA 3BYOA 3LFSA 4O6LA 5HLNA 3PE2A 3KREA 2XUUA 3ACKA 4AFJA 1H25A 4I4FA 3C9WA 3KEXA 3LXPA 3V5LA 4M12A 4B9DA 4G16A 3ZUUA 3KL8A 2Z02A 5E8WA 2W1CA 4E6CA 4AOIA 5KUPA 5HI2A 1PJKA 2YZLA 4YO6A 4L7FA 2Q83A 2NP8A 5J7HA 3RPRA 1UNGA 3RVGA 4KRCA 2QOIA 5EHOA 2C6IA 3F66A 1ZMWA 5T68A 3UMXA 2FSTX 3NSZA 3L8SA 5IA1A 5IQGA 2YZAA 3D0EA 2QKRA 2XNPA 2WTJA 3HV3A 1ZMVA 3PA5A 4C4JA 4FKLA 5K3YA 3T9IA 4BCNA 4YJOA 4CKJA 3TTJA 4BFMA 3C0HA 4D5HA 5JEBA 1PXKA 1J1BA 1DAWA 3WOWA 4BDCA 1W98A 4CFXA 3I0OA 4WOVA 4D1ZA 1H24A 3II5A 2PULA 1KE8A 3EN4A 4S33A 4CCBA 2YDJA 1WMKA 2WTWA 4H3PA 4E6AA 4R3RA 3PXZA 3TJCA 4IB3A 5AR3A 3EQIA 2JBPA 3BU5A 2ACXA 1IA8A 4FZ7A 1JWHA 3KCFA 4YO4A 5KKRC 4IAAA 4BTFA 3E64A 1U54B 4EHEA 4KNBA 3WYXA 4N70A 2UZWE 4FT9A 2R3RA 4V0GA 3V5PA 4EWHA 2GNFA 3EYHA 4Y5QA 4EH5A 5EDPA 1OKWA 1IEPA 2X7OA 3V5TA 1JKKA 4FK6A 4LOPA 1H8FA 1XBCA 4XS2A 1YXVA 4M66A 2IVTA 1Y8YA 2J5FA 2R4BA 3DGKA 2QHMA 4M8TA 2WZJA 3DBFA 4DGNA 2JITA 2YM7A 3UVPA 4AN2A 4BDKA 4C0TA 3BE9A 5A14A 4FEVA 2XIKA 4UEUA 4WKQA 3IW8A 4CKIA 3GFEA 3FZPA 4F9AA 2QC6A 4EK8A 1W82A 4IZ5A 3BWJA 3OHTA 1JVPP 2V5QA 4FVQA 4GS6A 1YRPA 5FTGA 3WYYA 3ANQA 3ORPA 4EJ7A 2X9FA 3F3VA 4JBQA 4G3EA 5M06A 4DH3A 4XRLA 3OY3A 3EFLA 3R0TA 4D0XA 5A4TA 3HV5A 3PIYA 3W10A 3PJ8A 3QRIA 3MFRA 5BQ0A 4I6HA 1IR3A 4G5PA 4NM3A 3VF8A 4L42A 4QYGA 3FZTA 2YLFA 4JBOA 5AP3A 4DLIA 5H9BA 2AC5A 4IMYA 4UXQA 2CKQA 2BRNA 4AA4A 3VO3A 4ZS0A 3RCJA 3VS6A 4LMNA 3HAMA 4CFWA 3TNWA 4PY1A 2LAVA 3E88A 5ETCA 3TEIA 4I5PA 4IVCA 4LRKA 4P7EA 3PY1A 4CMUA 3FL5A 4M69B 4XV1A 3FXZA 3IPHA 1TKIA 4ARKA 2UW9A 3FPMA 3HP2A 3KXNA 2OZAB 4YJPA 4EBVA 2VD5A 3TI1A 5L2TA 3KQ7A 4QYYA 2Z2WA 5D41A 3ZLYA 1J7LA 3FMJA 3MIYA 2BAQA 4XCUA 4KRDA 3HA6A 5IA5A 3GU6A 3KN6A 4JBVA 4UX9A 4BIEA 1R0PA 1H1PA 4YUQA 2GMXA 4N6ZA 3RNYA 2HELA 4H39A 3UQGA 2WGJA 1J91A 4EQMA 3TN8A 1VYZA 4KKGA 4RBLA 2RFNA 5DEWA 1W84A 3ZC6A 4ZJJA 1XO2B 4XP3A 3H9FA 4TYEA 2XA4A 4UBAA 4TNBA 2JLDA 4QYHA 2XEYA 5J79A 4NW6A 4UYNA 2F9GA 4CFMA 5BNJA 3PRFA 2BVAA 5CVGA 4E93A 3KKVA 4FTLA 3MN3A 1H00A 1LUFA 4F99A 2RF9A 2PL0A 3AC8A 3BBTB 2VWXA 3RAKA 3ROYA 3EFWA 5M4UA 5JRSA 4FIJA 4NT4A 4YJSA 3R7GA 3K2LA 3WILA 5CY3A 2NPQA 4FICA 3TV6A 3QZIA 4ACCA 3PUPA 1NVRA 2JDOA 3JXWA 3MJ2A 4ASZA 1PY5A 4FIFA 5LOHA 5CEPA 1DI8A 1E9HA 3RHXA 4U41A 3FZOA 5FM2A 4F65A 4CFNA 3QLFA 4HGSA 1YDRE 2WQEA 4WSQA 5BVFA 3QZGA 2EXEA 2EUFB 2WTIA 4AA0A 5DT0A 4AW1A 1BUHA 4E5BA 1Y57A 1YDSE 2OG8A 3HV4A 2XBAA 5BVKA 3NDMA 5J1VA 3FLSA 4ZS4A 2FYSA 5BYLA 4C62A 5C8MA 4D2TA 3N4VA 3MH1A 4JT3A 4JBPA 1P2AA 2BILB 2I40A 2YIYA 2VTLA 3GC9A 4MAOA 1OBDA 4H05A 5DRDA 3W2QA 4HGLA 3UNJA 4U5JA 2R3LA 2YCSA 5FGKA 1XKKA 1XQZA 3ALNA 4O0YA 4C3RA 5HTIA 2C0IA 4K9YA 2VTTA 3NPCA 4MQ2A 3TM0A 5HO6A 5DNRA 5IQFA 5L8KA 2V7AA 4O91A 4LL0A 3KFAA 3LFQA 4O6EA 5BYYA 5B2LA 3R83A 3EYGA 5ANGA 4JDHA 4AW2A 5EKNA 5EQEA 3EFKA 3A4OX 4Q5HA 1ZOEA 3ACJA 1PMEA 4MNEA 2FVDA 2UVYA 2WD1A 3RTPA 4GKHA 3HEGA 4O0SA 5BVDA 2YM6A 3PZHA 3D5UA 3FC1X 2AC3A 4FKUA 3LMIA 3L9NA 4NCTC 3DXQA 4C61A 3FKLA 4PDYA 2B9FA 2Y4IB 3ZFYA 3GNIB 1Q61A 4PMMA 4JXFA 3VRZA 2IG7A 2QNJA 2QO7A 2YIWA 3AT3A 2VV9A 4R5SA 3Q96A 4DA5A 3UVRA 4QTBA 3MSSA 4NCTA 4QMLA 3R8ZA 4XG7A 5H8EA 4DFZE 1Q8UA 3T9TA 4Y8DA 1W83A 3PSBA 4D9TA 3ORZA 3MB6A 4YZCA 3HMIA 4WUAA 3RNIA 4BDFA 4IW0A 3FLZA 4UY9A 4EH3A 2CN5A 4AZTA 2VTAA 1NVQA 1H0WA 2HOGA 2XMYA 3DTCA 4KWPA 2HY81 4Y5HA 2PVHA 1REKA 3OTUA 1UKIA 3QRKA 4GCJA 5AIRA 2XIXA 2VTQA 1GIJA 1NT2A 5A4CA 5M57A 4XBRA 5A54A 2B7AA 3ATTA 2B9IA 4EHVA 5FEDA 5DIAA 3FE3A 5HZNA 2GHLA 2GSFA 3TV4A 4DEHA 4Z7GA 5KBRA 2XK4A 3IK3A 4NTSA 5FG8A 3ZOSA 5EQPA 5LCKA 3OUKA 4BI0A 4ANOA 1KV1A 3RALA 4PP7A 3DKCA 1FMOE 5IA2A 2V7OA 2EWAA 2UZBA 3UP2A 3D94A 3HRCA 2F7EE 1M17A 4ZLOA 4YTHA 5A9UA 5DFPA 4E6QA 4GFMA 4DG3E 4FX3A 5FD2A 4A9SA 5LVPA 3LCOA 3C4ZA 5CF6A 2PHKA 4OTHA 2EU9A 4YLKA 5HHWA 3GUBA 3MDYA 4EH7A 5AMNA 4QP7A 4GKIA 5CEOA 2UZTA 4Z9LA 3V8SA 2HZ0A 3R71A 4U0IA 4O7NA 4QMWA 3UOJA 3HRBA 4KABA 2R0IA 2P0CA 4FV7A 3CXWA 4FSNA 4CZYB 2H8HA 5BX0A 2XNBA 2VWVA 4DEGA 2PVYA 3ORNA 1K2PA 5GZ8A 1ND4A 1LEZA 4I21A 4BGQA 4RLKA 4F6SA 4M7IA 3RKBA 3KK8A 2BUJA 5K5NA 5KMLA 2PUPA 2FGIA 3F3UA 4HPTE 4DGOA 1KSWA 1YHWA 2GHMA 3KB7A 4O7YA 2Y4PA 3DK6A 4P4CA 4QOXA 1FGIA 4WG5A 4EBWA 3CSVA 5GZ9A 4ZIMA 3NAYA 3Q60A 4C4EA 4D55A 1UKHA 2ITTA 3GCQA 2W5HA 1MQBA 3OWLA 3QTRA 4ANMA 5EW8A 2QR7A 1ZOHA 1KUTA 5IA0A 3TZ9A 4CTCA 1A06A 3IDBA 3ZFXA 3COIA 4ZY5A 3ZH8A 4IACA 2C6DA 3PYYA 4OT6A 2ERZE 4UZDA 3TKUA 1XR1A 2JDTA 3VUGA 4QP1A 4FT7A 3L1SA 4XUFA 5FEQA 3TIZA 3O23A 3LFNA 5HBJA 2G2FA 2J90A 2C69A 4B4LA 4D2SA 3DDPA 4PV0A 1CMKE 4I94A 2CLXA 4BRXA 3Q5IA 2VWYA 4RC3A 3COHA 3DQXA 5JZJA 1OIQA 2CCHA 3NW6A 4PF4A 1Z9XA 2XK9A 4LRJA 4D2RA 3FHIA 4YTCA 4UWCA 2R3HA 4CT2A 2ITXA 2WMQA 4FKVA 4BKYA 3N4UA 4XBUA 4BCQA 3AOXA 1F0QA 4WBOA 3B8QA 1O9UA 1URCA 3HP5A 4JJRA 4F08A 4WNOA 5E8XA 4JAIA 2YJRA 3G2FA 2ZOQA 4IHPA 4I1ZA 4ID7A 2Y8OA 4C7TA 4RT7A 4IX4A 3HV6A 4CV9A 2VTNA 3HMNA 4I3ZA 4ZAUA 2VZ6A 5CXZA 5E8YA 3DAKA 4MF1A 4OTFA 4BF2A 3OCGA 4J95A 2XH5A 3KN5A 3WF8A 5M08A 1JBPE 4R1VA 3ODZX 4F09A 4DF3A 4DFUA 3IDPA 4R7IA 5AV1A 5DYJA 3LHJA 3P5KA 3G51A 4IH8A 1O6YA 2YIRA 3C50A 3KULA 4QMZA 3VS1A 5GJGA 4JX7A 5T6KA 3JY9A 4FTRA 3IW4A 1OPJA 1FVVA 2JGZA 5AP2A 2BZKB 3FSFA 3KU2A 3PWYA 3VRYA 3QD0A 4M67A 1DM2A 3P79A 3P23A 2XYUA 1Z5MA 3AT2A 2Q0BA 5CU6A 5JGBA 3ZRLA 1UVRA 2ITPA 4YJNA 4EH8A 2GFCA 2IZSA 3E87A 2GNIA 4IB5A 3DKGA 2J5EA 4J53A 3VW8A 3TUBA 5IUHA 4L44A 3RPOA 4IM0A 4ZZNA 2W1HA 3HUCA 3P7CA 5IA4A 4QYFA 3LCSA 3N4TA 2IVSA 3QKMA 4LGGA 4M84A 2OICA 4K77A 3A7JA 4UMRA 3I5NA 4WT6A 4HCTA 3L9PA 4L68A 2HWOA 4J71A 5B0XA 4UMTA 5IQDA 3W32A 4QNAA 1H1SA 3Q2JA 3OCTA 4DTBA 4BDIA 3POOA 3BU3A 2EB3A 5EM5A 5JFSA 2E9OA 2UW5A 4WSYA 2W0JA 4RPVA 4LUDA 4YJTA 5J9LA 3O50A 5KHXA 4AN9A 2QD9A 4U97A 2W9FB 3W8QA 1XH7A 3LQ5A 4MWHA 5EK7A 1BI7A 2GTMA 4U6RA 3VS7A 4BCGA 1OZ1A 1Q4LA 3MVJA 3MTLA 3BCEA 3QX2A 3EN9A 4AZEA 3RK5A 1V0OA 2JFLA 4FI1A 3U4WA 1PHKA 1SM2A 1YI6A 4L52A 4RIXA 2OJFE 2E9NA 1Y6AA 3OVVA 4UWYA 4YMJA 4CLJA 5M44A 5CQUA 5AP6A 4IZYA 5DT4A 4L3PA 3ULIA 2X2KA 4A07A 3UBDA 3TNQB 3HZTA 3VWAA 2FO0A 3C1XA 4U42A 1P14A 4EOPA 4PL4A 4CXAA 4FSTA 2PPQA 4YLLA 4JAJA 2GHGA 4HZRA 4IAFA 4WG4A 4L67A 4DCAA 4DFYA 2PZRA 4H1MA 4TN6A 1GY3A 2E2BA 5LMBA 2J51A 4AW5A 5E8TA 5EFQA 5JFVA 3DFCB 4FODA 1TVOA 3H4JA 4KIKA 4YHTA 4IM3A 2PVFA 3DB6A 5L8JA 4DT9A 4O86A 5AA8A 3KK9A 2QLQA 4FYNA 3FY0A 3PY3A 4NL0A 1OPLA 1TQIA 2BCJA 3HLLA 4IC8A 2CNQA 4C02A 4YTFA 4OTWA 3S95A 5AAEA 2VO3A 4RLLA 4C34A 3TDVA 2XK3A 3RWPA 4G3CA 2C0OA 1NA7A 5HE1A 5M09A 3FI3A 1GZ8A 4F6WA 3NNXA 3ZM9A 4GUBA 1GJOA 1SVGA 5AV0A 3SC1A 2J0MB 3QBNA 1BKXA 4EK4A 4O7VA 3OBGA 3UP7A 4QMUA 1Q41A 2WTDA 4IJ9A 4C58A 2QOLA 3MIAA 4UALA 4FKSA 3HECA 1OIRA 4JDJA 4X3FC 3LXNA 2UW3A 1OITA 3FLWA 3NUSA 1HCKA 2O3PA 4MXYA 2VWZA 2W99B 3BPRA 4IAIA 4YNEA 2XKCA 2XK7A 4RIYA 4X3FA 3OZ6A 2XEZA 2J0IA 2ITZA 4L53A 4LOOA 4IEBA 2BDFA 5IUGA 3NAXA 2B0QA 3AMAA 5HNIX 1QPCA 1LPUA 2QO9A 1YWRA 3EN6A 5ICPA 3D9VA 4TYHA 1KOBA 2HAKA 3QRJA 5KCVA 5DH3A 4WD5A 4GG5A 4E20A 4Y72A 4ZSEA 5I9ZA 2EVAA 3QGYA 3D14A 5HKMA 4EONA 2C0TA 3EKNA 4LV5A 5F20A 5A4EA 1Q62A 4YHFA 4DEEA 3O71A 4TYJA 4RJ3A 3FBVA 3MFTA 2WFYA 1OKVA 4RC2A 5IUIA 4HVHA 4UXLA 3RCDA 4D4SA 1OBGA 3GU4A 4WNKA 4NEUA 1PKGA 2GTNA 2PVNA 3E93A 4RC4A 3U9CA 3UIMA 3ZSGA 4DITA 4PMPA 5JKGA 5BMSA 3D15A 3OY1A 5HX8A 2J9MA 1GZOA 4IZ7A 3MA3A 5E1EA 3H30A 3OT3A 1ZY5A 1L3RE 5AEPA 3QKKA 3UO4A 2OJJA 4IM2A 2YDKA 4LG4A 3V04A 4TW9A 1BL7A 2W17A 2XZSA 3G90X 4G6OA 4FV3A 4ONAA 1X8BA 4FKTA 5FDPA 4PRJA 4OTPA 3PPKA 4OBQA 1H26A 5E8VA 5AUTA 3LKMA 3LIJA 4WNPA 3NR9A 4ZEGA 2W4KA 4D2WA 4AGCA 3EH9A 5BVEA 5BMMA 3HKOA 1WFCA 3PE1A 3Q9YA 4XG4A 5CSVA 4PDPA 4YJQA 2OSCA 3T8OA 4D1XA 3Q9WA 2G1TA 3PFQA 2PVMA 4W9WA 2PMOX 3GI3A 4I5MA 4AN3A 4O83A 4XV2A 3FV8A 5FQDC 4D28A 4MNEB 4QT1A 3ZDUA 3JY0A 2PZYA 2QURA 4J8NA 2B54A 5CALA 4QP6A 3NUNA 1T46A 3OBJA 4V04A 3NIEA 3GCUA 1AQ1A 5DR6A 5A3XA 4EQUA 4NK9A 2F7XE 2CKEA 2ITYA 3UO6A 5IQCA 2OXDA 3GC0A 3KVXA 4AXAA 1Q99A 2IZRA 4II5A 1NXKA 2OK1A 3QTZA 4IVAA 4C35A 4GL9A 2W1DA 3R00A 4GT3A 3VQHA 5M55A 5L2IA 3FAAA 2QVSE 2PMLX 2XJ1A 2UZOA 2R3GA 3E8DA 1CKIA 4IAYA 4A06A 4AU8A 3Q6WA 2X2LA 1FQ1B 2HK5A 5CVHA 4EUTA 1B6CB 3QHRA 4G9RA 2UW8A 4JQ8A 5I9UA 1YVJA 3ZLXA 4XLIA 4O38A 4DH7A 4Q9ZA 3RHKA 4ALVA 4CKRA 1YHSA 4Y83A 5ACKA 2XKFA 2C5XA 2WMWA 1Q24A 4AZFA 5A6NA 2YM8A 3S2PA 4CNHA 3CQUA 4AZVA 3CGFA 5FEEA 4YLJA 4YNOA 4GIIA 2C47A 3O8UA 3PVWA 4IADA 4D2VA 3ZO2A 4L3JA 4I92A 2WTKB 3FLQA 2X6DA 2R64A 3QC4A 1RJBA 4LV8A 1F5QA 4ENXA 4L46A 3RI1A 5JGDA 4R6VA 3ENMA 2BZJA 4O0RA 3SHEA 5CNNA 3R6XA 4Q9SA 3IECA 4TT7A 4MWIA 5CWZA 3KRRA 4FIEA 1PRYA 3GOPA 4AWIA 4AUAA 2BALA 3KF4A 2RG6A 4HVIA 5BPYA 4KIOA 2WTVA 3AD4A 3ZSIA 2JDSA 3DZOA 3NZ0A 1UU7A 4FGRA 4O22A 2DS1A 4KIQA 1B39A 2WB8A 3QFVA 1H28A 4O82A 3I6WA 4RVKA 4OAUC 3PP1A 4AOJA 5F4NA 2V55A 4RQVA 3C0IA 1FPUA 3DKOA 3VJNA 5TR6A 4ITIA 3VUHA 2QOKA 4C3FA 5DEYA 3G0FA 3OCBA 3C0GA 3I81A 4WNMA 3UVQA 3EMGA 1WBNA 5HO7A 4ZTLA 4MH7A 1PMUA 2JAMA 4IC7A 4GV1A 2VO0A 1V1KA 2JC6A 4FV0A 2DUVA 3QF9A 3NUAA 2PVLA 5DVRA 4DBNA 3O2MA 3E7OA 3KMUA 1UA2A 5L2QA 4DYMA 3CTJA 4K8AA 1OIYA 2A27A 2ITNA 4G2FA 3BQRA 3CE3A 1BX6A 4G1WA 2YERA 4P2KA 5EW3A 3AC3A 1R3CA 4TTHB 4BVUA 1LP4A 1WCCA 3U9NA 3TZMA 4DEIA 4E4MA 3UOKA 4QMPA 3U87A 3QQFA 3QRTA 4I6BA 4QPAA 2DWBA 3EQCA 3GEQA 3A62A 5FTQA 3H3CA 4CV8A 1REJA 2HCKA 3OP5A 3UIXA 4K11A 3I79A 4U40A 2OJ9A 2R2PA 3ZSHA 2XM9A 1YXXA 4IXPA 4TRLA 2OF4A 5DI1A 4I23A 2XK6A 3CR0A 2HZ4A 3KXZA 2E9UA 3O51A 4TWCA 5AAGA 1Q8WA 3BX5A 3EHAA 2BRMA 5BUJA 2VNWA 5G1XA 3OWKA 5GNKA 1MRVA 2WQBA 3IOPA 3DKFA 4DGMA 4ORKA 2HZIA 4RIWA 3DOGA 3LM0A 3ZLWA 4YC3A 5EYCA 4RJ4A 5LXMA 4USFA 2IVUA 5CSXA 1H1QA 3BYVA 1VR2A 4FR4A 5K4JA 5DRBA 3QA0A 3CD8A 3SXFA 3Q4ZA 4FKJA 4FKOA 3O17A 2W96B 4DG0E 4P5ZA 4KBKA 4NYEA 3P4KA 1H1WA 2JKQA 3TCPA 4YSJA 1R78A 3LLTA 5AIKA 4F9WA 4IVDA 5CF8A 3FLYA 2O64A 4ZP5A 4O7RA 2YM4A 3U55A 2R3PA 1FVRA 2VTRA 3QUPA 5C03A 4GJ3A 5IDPA 3RJCA 5DT3A 2WAJA 4RVTA 4A9TA 5AR5A 4BYIA 5KBQA 3KXGA 4EUUA 2PZIA 1YQJA 3UQCA 3OS3A 2EB2A 1SVEA 3L8PA 3AC1A 4RA4A 5BYZA 5M56A 3OEFX 3T3VA 4RWJA 2WQNA 3VS5A 3GFWA 4LQMA 4YJRA 3MGYA 3A7IA 4IIRA 4UB7A 5L6WL 3G33A 4FKRA 5FP6A 4YU2A 5HU9A 5E4HA 1V0BA 1UWHA 4DFXE 4BGHA 5DN3A 2BRGA 4A9UA 2HXLA 1OL7A 3UMWA 4P90A 5ETIA 4B99A 3FQSA 2W1GA 4MK0A 3VNTA 2F4JA 4IBMA 4NIFB 3NS9A 2BTRA 2Y9QA 4CRSA 3PPJA 3RP9A 4BCIA 1YOJA 4BIDA 1A48A 1XJDA 2NO3A 4FG9A 2WKMA 5DOSA 5F94A 1CKPA 3D83A 3DAEA 4NJ3A 4HYIA 4O1OA 1XBBA 3JYAA 3VS3A 2UW7A 4XX9A 3WF9A 3UDBA 4J96A 1H4LA 5HE3A 1G8AA 3WZEA 3OUNB 4S30A 4BCPA 2J7TA 3GB2A 2PMNX 3BQCA 4Z7HA 4Y95A 5B7VA 5IZFA 5ANEA 4WA9A 4X2NA 3CJFA 3QUDA 5E91A 5C9CA 1PXNA 3QC9A 4RIXB 2RIOA 4O2ZA 3ITZA 2WXVA 3UG2A 5CZHA 2C6MA 4NZWB 1Q8ZA 1O6LA 2BIYA 2OIQA 2XP2A 2WIHA 1YHVA 1ZZLA 3GQIA 4PDSA 3O8PA 4FYOA 2ITUA 3DFAA 3AXWA 3MFSA 5D12A 4F1TA 2CDZA 4DFBA 1Q8YA 4C37A 2C1BA 3H0ZA 3RAHA 3VW6A 5C8KA 5JRQA 3QCSA 3ZONA 5HG7A 3AG9A 2W5BA 3ZYAA 4D0WA 5LVMA 2YIXA 2FUMA 5LCJA 4O0XA 4FUYA 3P1AA 5FBNC 5HG8A 1WVWA 4PTGA 4EC8A 5I9WA 5ANKA 3AQVA 3NCGA 3C4EA 1IA9A 1QPDA 2BHEA 2W05A 3ZBFA 5JFXA 3RPSA 3R28A 2OKRA 1OL2A 3OROA 5C4KA 4LFIA 3R7OA 2WHBA 1UU8A 5KMMA 4BDHA 2X7GA 4RFZA 4WO5A 4GK3A 3E63A 3HDNA 4LUEA 1VZOA 2VWUA 3KGAA 3P7BA 5CNOA 4APPA 1M2RA 3BBWA 1DI9A 2WU7A 4BCOA 1JSTA 4DLJA 2C5OA 4OT5A 3V5WA 4G3GA 3ZRMA 3BZ3A 1UU3A 4G6LA 4BDAA 4ZTMA 1OL1A 4ZY6A 4W4YA 5K5XA 1IAJA 2VWIA 3QTXA 4H3QA 2YWVA 5AV2A 2Y6MA 5KMKA 3GT8A 5ETFA 5A6OA 3V01A 4AT5A 4J97A 2XNNA 1SNUA 2ZAZA 4ZSLA 3F9NA 2VO6A 5DGZA 4RIYB 5KMJA 3A8WA 2RG5A 4YP8A 4IQ6A 4GYIA 3EWHA 4IAZA 2PVRA 3R7EA 2GDOA 1I44A 3KCKA 4IWOA 4X2FA 5GJFA 2WO6A 4GU6A 4FTTA 3K5UA 1KOAA 5IMEA 3NYXA 5JZNA 3DBQA 3UC3A 3MY1A 1ZLTA 5FXSA 3HRFA 3ZMMA 4DN5A 3CTHA 3G6HA 2JD5A 3F82A 3G15A 5H3QA 5HEZA 2ZYBA 2B55A 4NKSA 1KWPA 2Z7LA 3ODYX 4F7SA 1H01A 3E5AA 4EOMA 4FL2A 5C27A 2F2UA 2CGVA 3COKA 1WBPA 5GHVA 1KE7A 3TNHA 3ROCA 4I4EA 3SA0A 5M4FA 2IWIA 3ZUTA 2C6OA 5HE2A 1MRUA 4QQCA 5J9YA 3LFCA 3HA8A 4EKKA 3PPZA 4ASDA 2PUNA 5HCZA 1BYGA 1ZRZA 1M7NA 4BIBA 2ZJWA 3N9XA 4HJOA 2RFDA 4IANA 4DH8A 1E1XA 5KHWA 2CKPA 3QRUA 1JNKA 4KAOA 4RFYA 4AACA 4PPAA 3LMHA 5AJQA 4F9BA 1ZMUA 4F70A 2HWPA 2HYYA 3LFFA 3QQGA 3I60A 4EH4A 4F0GA 1QCFA 4GT5A 1PMVA 4E4XA 5DHJA 3A8XA 4L00A 4MXOA 3D7TA 2C68A 2XJ2A 2YIQA 3HYHA 4YJUA 5EYKA 4AT4A 4D4VA 1IAHA 5IQBA 3SRVA 2WMAA 3GENA 5DMZA 3FMDA 4CG9A 3NYNA 3MFUA 2EXCX 3VULA 4N57A 3TDWA 3Q53A 4QYEA 4CEGA 3GU8A 4YURA 5IQHA 1JOWB 3QYZA 2JKOA 4H3BA 4X0MA 1ZARA 1JPAA 3LPBA 4QTAA 3W2PA 1GZKA 4FV2A 5CZIA 1WBSA 4QP9A 4YBKA 3SOAA 4O84A 4N6YA 5EHYA 1ZAOA 4OTGA 4YC6A 1ZY4A 1VYWA 2ZDUA 2VUWA 2GPHA 5J87A 2BKKA 2BRHA 2PZ5A 5JH6A 2VN9A 4EK3A 3Q4TA 4CG8A 5CT7A 3LXKA 4FBXA 3I7BA 3CQEA 4G3DA 2VX0A 4BBEA 4CMOA 2CGXA 4GIHA 2FA2A 3QCYA 3JUHA 4CTBA 5CAUA 4FEWA 3UQFA 5M07A 3Q9XA 4MBIA 4XG2A 4E6DA 2I1MA 1ATPE 4FSYA 2H96A 2HXQA 2R3OA 4ZY4A 4AAAA 3GCVA 1EH4A 2Z8CA 2YM5A 3LVPA 3CLYA 4N4SA 4RG0A 2RKUA 3ELJA 4XJ0A 2HZNA 5J1WA 3UNKA 2HW7A 5M4IA 3WZJA 3FWQA 3R1NA 3ZFMA 1XH5A 2VNYA 4M15A 4L9IA 3OOMA 4NH1A 1KV2A 2B1PA 3P0MA 3V3VA 1JQHA 5CLPA 4YPSA 3W55A 4AZSA 1WVXA 2UW0A 3ZU7A 4DEBA 1S9JA 4O7SA 4JQEA 1YXTA 3U54A 1LEWA 4OTDA 3U6JA 4PTEA 2C3KA 5D7AA 4UN0C 2IW6A 2O0UA 3ZS5A 3W1FA 3C5IA 4XYFA 3FC2A 3ZO1A 4IWDA 3ZHPC 2ETMA 3VUTA 2W1ZA 3R9HA 5D11A 3UJGA 4EOOA 4DGGA 1YWVA 2YISA 4R77A 3P86A 5DPVA 4RJ8A 5CS6A 4D2PA 3P08A 4U9AA 4W4WA 1QPEA 3A60A 1U5RA 2QODA 2JKKA 3N51A 4EJNA 4QTCA 4IFGA 3KC3A 4FOBA 5DE2A 4RWKA 3QQHA 3OF0A 2ETRA 5CX9A 5FP5A 2XNOA 5IKWA 4PNKA 3CBLA 4FNYA 4JVGA 4K6ZA 5HCYA 2W4OA 3ATSA 3LJ2A 3F88A 5F1ZA 3NX8A 3VVHA 2ZMDA 4MEDA 5L8LA 3LJ1A 4PMTA 4L7SA 3VUKA 5BUIA 4XRJA 2YM3A 2R3NA 4C33A 2FSMX 2J0JA 4FVRA 5K4IA 4B6LA 4MD8E 4AP7A 3KXHA 3VHEA 2UZEA 2XKDA 4DT8A 4J8MA 4CT1A 4NJDA 2ZM4A 4JG8A 3BHVA 4FEUA 2BTSA 3Q4UA 5CTPA 4FA2A 3O7LD 4TXCA 3ORTA 3F5GA 5BVNA 2VTIA 5AM7A 2ERKA 3FKOA 4I6FA 3UPXA 3ZZWA 3K54A 4EOKA 1U54A 5IEYA 3L8XA 3QU0A 4JNWA 4HYSA 5IISA 3CD3A 1FVTA 4FTUA 4I5CA 4BR3A 3WARA 3EL7A 4MBLA 2J0LA 3QZHA 3NMUF 4E5AX 5LVLA 1S9IA 5AUUA 3Q3BA 4F0IA 3QZFA 2JFMA 1FINA 2IO6A 4MYGA 5HICA 3RINA 3VN9A 3H9RA 3PDTA 1A9UA 2GS6A 4FEQA 5TKDA 4UMPA 3Q9ZA 4FV8A 3F5PA 2ITVA 3M42A 3QLGA 4BHNA 3MPTA 4BDDA 4GK4A 1M7QA 4OLIA 4A4LA 4O0VA 4FV9A 4IB0A 1LR4A 2C4GA 3DPKA 4V0GB 4QQJA 3R1YA 2OIBA 3QTSA 2QOBA 5KKRB 3EN7A 3TACA 2QOFA 5CSPA 2GNHA 4UV0A 2JIVA 3DCVA 4G17A 5LMKC 3KA0A 4DEAA 4NM7A 2XVDA 3QKLA 4K33A 3PZEA 4LI5A 4OBOA 4PP9A 3RAIA 5DBXA 4NM5A 3JR1A 4F9YA 1JKTA 4CZUA 3H9OA 3NUPA 2X9EA 3DTWA 2I7QA 4QMNA 5LMKA 5GINE 5HOAA 3K3IA 3FPQA 4TPTA 2XIZA 2EXMA 3DBDA 1WBWA 2ZV2A 5JFWA 5H8BA 4W8EA 1DS5A 4I0TA 1RE8A 3GVUA 4O0TA 3ZRKA 3PXYA 3PA4A 5CXHA 1YXSA 4C57A 3QTUA 2QOHA 4O27B 4FE2A 2OH4A 2OZAA 3PVGA 3MVHA 5GJDA 3ZZEA 2JIIA 3RZBA 3THBA 2PTKA 3CEKA 5HIBA 4BBMA 1JLUE 1H08A 3TKIA 4GK2A 2UV2A 3OMVA 4GJ2A 1ZYDA 2X7FA 3FQHA 4EWQA 2BZIB 3MPMA 3OTVA 4ITJA 5BVWA 3FUPA 2X1NA 2XBJA 5HVJA 3BRBA 4MVFA 4BKJA 1Q5KA 4M3QA 4IWQA 5A4LA 2ONLC 1HOWA 5AUWA 4DEDA 4EOQA 4AZWA 2OBJA 4X2GA 1Y91A 4CD0A 5DA3A 2ONLA 3BYSA 2YCFA 3TNPC 3NNVA 4Y73A 4RRVA 4BWPA 3LQ3A 4I5HA 5E8UA 2YHVA 2HENA 3FMKA 3PIXA 5HGIA 5HE0A 3TUDA 3LE6A 1VEBA 2OJGA 2A0CX 3QWKA 2R3FA 4B7TA 3UIUA 4FK3A 4USDA 2WMXA 2PUIA 3AMYA 3SXSA 3QWJA 3OC1A 4J98A 4BDGA 5GZAA 4BZDA 2WQMA 2WU6A 3GQLA 2WIPA 3VF9A 5HVYA 5A46A 4HZSA 4LL5A 4AGDA 3OXZA 3VHKA 4H58A 5M4CA 3UOLA 4F0FA 3NNUA 1GIIA 3UYSA 2NNWB 4QMSA 4A9RA 2OFVA 3RGFA 3CC6A 4YZ9A 4BN1A 5KO1A 2ITWA 1NVSA 1PKDA 4N0SA 3R9DA 2WELA 3HVCA 5CSWA 2OU7A 2XCKA 4EZ5A 4ASEA 3C13A 3P7AA 3U51A 3TT0A 3HMPA 4FSRA 3EZVA 5D1JA 2DQ7X 1SVHA 4AF3A 3FZ1A 3TXOA 3V5JA 2PE0A 2I6LA 3FDNA 2OFUA 2ZM1A 3LZBA 4JIAA 2Z60A 4EYJA 4MNFA 1UWJA 4FC0A 3QQUA 2ZM3A 1OUYA 3EFJA 4G9CA 1O6KA 2J0KA 5HBEA 4Q2AA 5IH5A 1OUKA 4Q5EA 2XCHA 2YABA 5AX3A 5EOLA 2ZB0A 2CSNA 3QXOA 4U3ZA 2WEVA 2W5AA 4UYAA 3FY2A 3B2TA 4KB8A 3PG1A 2Y4IC 2H34A 3R7UA 3POZA 4YGAA 3I6UA 4EOLA 3PXFA 2R9SA 1JKLA 5E8SA 4GT4A 3UZRA 2HY0A 5C26A 2UZNA 5E90A 5M51A 2PE1A 4YZMA 1G3NA 4UWBA 5EI2A 3UIBA 4J1RA 3WBLA 3EL8A 1GOLA 4F1OA 3ORKA 2IVVA 2CHLA 3SOCA 2WPAA 4KBCA 3EKKA 4BWXA 4FZDB 4EI4A 3WZDA 3CY2A 3LFAA 2YEXA 3ZTXA 5EM8A 4PPBA 4RMZA 3V8TA 4QMQA 3BI6A 4XMOA 4EC9A 1XHAA 2QOQA 5DG5A 3BV2A 4ALUA 4XEYA 1UNLA 5H8GA 4M13A 2QU6A 2P2IA 2G2HA 4KIPA 2BAKA 5IMXA 2H9VA 3ZDIA 5T3QA 1GAGA 4DH1A 3V51A 1QMZA 1MQ4A 2PMIA 3ZO4A 5CAPA 4LOQA 4BZNA 3VBQA 4QPMA 5FM3A 3NVKI 4JDIA 2C6KA 5DWRA 4HNFA 5J8IA 4W8DA 1M2PA 2C1AA 2UZUE 4RA5A 5HORA 4YJVA 1OI9A 3OCSA 3SXRA 5CU4A 2BHHA 3MPAA 5F95A 5HBHA 3BEGA 5I3OA 2FH9A 5LJJA 5HESA 5KZ0A 4QP2A 4JRVA 3UNZA 2C3IB 4ZK5A 4FTKA 3SAYA 3HDMA 5ANDA 2XS0A 5KZIA 3UE4A 1YI4A 5CANA 2OIDA 4XV3A 4TWOA 4APCA 3D7ZA 5EQYA 1YKRA 2C3LA 4FNXA 2W06A 3DAJA 3F61A 3FL4A 4IFCA 2YJSA 4O1PA 3F2NA 3KMMA 4KKEA 4G3FA 4CRLA 3EN5A 4ZZMA 3MA6A 4ZTNA 1SNXA 3QD2B 3RK7A 4E4LA 2R5TA 3AD6A 4DFLA 5A4QA 4EH2A 3R01A 4IE9A 1KE5A 3QHWA 4FNWA 4RSSA 5LMAA 3R02A 2UW6A 3LXLA 1FBNA 4TKSA 3R8MA 4RJ7A 4CYIA 2G15A 2AUHA 3BV3A 4KD1A 4HCUA 3ZEWA 5F9EA 5AFVA 5GIPE 5KMIA 3NIZA 2BMCA 5AP5A 4DC2A 3QD4A 4ZMFA 5JGAA 3EB0A 3A4PA 4KBAA 4H36A 2QOCA 4O7WA 4NKAA 2PYWA 4EH9A 3WZUA 3AGMA 1WVYA 2F2CB 4JG6A 4MXCA 4U8ZA 4L3LA 1Q97A 3QXPA 3R9OA 3BLRA 3AMBA 1P4FA 3PVUA 4ZTRA 3QQJA 4X2JA 5B2MA 3DBCA 4P5QA 3KRJA 2PVKA 2BZHB 2SRCA 3KF7A 4FL3A 4GEOA 4FTIA 1YW2A 3SG9A 3CGOA 3PLSA 4O2PA 1ZYSA 4QTDA 4KINA 4D4YA 3QX4A 4X21A 4AGWA 3M2WA 3QTIA 4E4NA 2A19B 1OKZA 1PXMA 3OW4A 2GFSA 1JKSA 3EQBA 3F6XA 4FSMA 4FZAB 4I41A 2WMSA 4MXZA 2F7ZE 2UZLA 3QQLA 3QALE 5E92A 2PSQA 5AUVA 5HO8A 2O5KA 4E3CA 5K0XA 5HLWA 3LFDA 3KXMA 3BHUA 4TNDA 4TL0A 1UV5A 2C5NA 4A4XA 3PTGA 2CCIA 3ZCLA 4CMTA 4AG8A 3BIZA 4FSUA 4M97A 2J4ZA 4BTJA 4O7TA 2WTCA 4ERWA 2JKMA 3COMA 3QTWA 3MESA 3NYOA 4QMMA 4AFEA 5AP1A 1UNHA 5CF5A 4JG7A 3ZEPA 4DCEA 5ITAA 2GU8A 4C4HA 4NTTA 2O8YA 3MH2A 5CAVA 3NEWA 4FTJA 5EM7A 2O65A 2HW6A 3ORIA 3PJ1A 2XRWA 4E8AA 5IEVA 5J5SA 4AE6A 3F2AA 2WMUA 4F7NA 2BR1A 4G6NA 4KS7A 4U44A 5BUEA 3SW7A 3DXPA 3FYJX 4BCMA 4JS8A 4EYMA 3QD3A 5JK3A 4XG6A 5C01A 2GQSA 3ZBXA 4D1SA 4DINA 3DBEA 1W7HA 4F64A 4E5WA 4FT5A 4OUCA 3R7YA 4FKGA 3KRWA 2C5YA 2I0HA 3PXKA 4DAWA 2ZV9A 4AW0A 3VS4A 4DFNA 3AD5A 2J6MA 3CS9A 4FZFB 4EKLA 3DZQA 4BZOA 4FV4A 3E62A 2OWBA 4I22A 3UO5A 3CCNA 4JR3A 2WQOA 4D58A 1J7IA 4FNZA 5D7VA 1CDKA 1MP8A 5CU2A 2OI4X 4FZ6A 5EHLA 4MBJA 5HD4A 3OXTA 3ZXTA 1OB3A 3TUCA 5CT0A 3KULB 2VX3A 3C4FA 3WF6A 5I0BA 1UU9A 3H10A 4CGAA 3HAVA 1OGUA 2RSVA 4PWNA 3U4UA 3R2BA 2JAVA 3VBVA 2RFEA 2X81A 4GFOA 3EQDA 3EOCA 4HVGA 4IX6A 3QUEA 4F9CA 4IDVA 5AR7A 4EZ7A 3DK7A 4Z16A 1OKYA 5CU0A 3D2IA 4ACHA 2PY3A 3V8WA 3GGFA 4GG7A 2ETKA 2GS2A 4ANLA 3DNDA 5LVNA 2UVZA 3KVWA 1PXOA 3G6GA 5AUYA 3TZ7A 4ENYA 2YN8A 4F7JA 4Z55A 2QONA 3FEGA 1J7UA 4M0ZA 2C6EA 3R63A 4JIKA 4BYJA 4HVDA 2RL5A 3R30A 3GU5A 1ZYJA 2HIWA 4YTIA 4ALWA 5J7BA 1BL6A 3A7HA 3BKBA 2GCDA 3HL7A 3Q52A 2CJMA 3GCPA 4D9UA 3OFMA 4TYGA 3CKXA 3NGAA 1I09A 3ULZA 2I0YA 4ZLZA 2GNGA 3HGKA 3BEAA 2C3JA 1OL6A 4HCVA 4F4PA 5CEKA 4DBXA 3VQUA 5IPJA 4I6QA 2VX1A 3IW7A 5AV4A 3ORXA 3OG7A 3FLNC 5CQWA 4HGEA 3GC8A 3SKCA 3PG3A 2F49A 4PPCA 2H6DA 1AGWA 2PU8A 1Y8GA 2ITQA 3VUDA 2G01A 2X39A 4FIGA 4J99A 5D9HA 3SQQA 5HU3A 1K9AA 1WBVA 4O0WA 4HW7A 3IGGA 4X7QA 1E1VA 2C6LA 5AP7A 3CJGA 3U6IA 5CAQA 3K5VA 3DQWA 5FDXA 5KE0A 4FV5A 4ZMEA 5TT7A 3EQRA 4V05A 2BIKB 4R1YA 2YLEA 4ZZOA 3R1QA 5D10A 2OW3A 1PW2A 4EEVA 5BVOA 4W4VA 4YC8A 4WUNA 5KMNA 2IZUA 3BHHA 4KIKB 2I0VA 3HX4A 3PRIA 3ANRA 4FKWA 4GVJA 3K3JA 4FSQA 4MCVA 4GSBA 5EM6A 3CTQA 5EW9A 4UMUA 1XH8A 4ZJIA 4QO9A 2Y0AA 4L6QA 2QR8A 3IDCA 4BTMA 1URWA 3AC5A 1PXPA 2W4JA 3FMMA 4U3YA 3KXXA 3CQWA 3MH0A 4RVLA 2OJIA 3FMEA 4HGTA 3LQ8A 2V22A 4D5KA 1F3MC 3OD6X 4K18A 1NY3A 5E7RA 2VRXA 2OXXA 4BTKA 1RW8A 2Q0NA 2B4SB 3QQKA 4FGBA 4L45A 2WEIA 5JQ8A 3ZLSA 3PLAE 4FSWA 3EQPA 4PDOA 3WE8A 3E8EA 3F3WA 3UTOA 4BY9E 4FT0A 2BKZA 1L8TA 2XNGA 3QL8A 4PTCA 3WE4A 5HNBA 3MY5A 5HG5A 3F3ZA 1W0XC 5HLPA 1BMKA 3VBYA 2F57A 2REIA 5DLSA 1H0VA 3S1HA 3C7QA 4DE4A 3WF5A 5IQEA 5FLFA 3UC4A 5GIOE 4X3FB 2JIUA 3P78A 4CFVA 5IQAA 3DB8A 2VO7A 4L43A 4EK6A 4LMUA 4ASXA 1WAKA 5C4LA 4KSQA 4RX7A 4TYHB 3LOKA 2X4ZA 3OEZA 5AUZA 3V6SA 2AYPA 2QKWB 2J50A 3MWUA 3R7IA 4KSPA 5EI8A 3RAWA 5EI6A 1PXLA 3FXWA 2JEDA 3IOKA 3TWJA 4R78A 3UODA 1YOMA 4LM5A 3U8WA 1Z57A 3FI8A 3ZC5A 4PX6A 4YHJA 4AQCA 3C4CA 4Z3VA 5CAOA 4QQ5A 5AV3A 2BDJA 3W2CA 3REPA 3W33A 3AC2A 2CNVA 1SYKA 3Q32A 3WIKA 1H27A 5K0KA 2IW8A 3GOKA 4LYNA 2QQ7A 2WOUA 1WZYA 4PUZA 3E8CA 4QTEA 1ZWSA 2R3IA 3SDJA 5LWMA 3S4QA 4R7BA 2ESMA 3NUYA 4I24A 5HVKA 4G34A 3WF7A 4B8MA 1U46A 5L6OA 3HMMA 2YCQA 3MVLA 4ACDA 4C36A 3SVVA 5CVFA 2FB8A 3MB7A 4MD7E 1Q8TA 3ET7A 5H2UA 4C38A 2XK8A 4BDJA 2W1FA 2NRUA 4HVSA 2BAJA 2QHNA 2X0GA 2W7XA 2VGOA 4XLVA 1HCLA 4XP2A 3EQGA 4W4XA 4EH6A 2VTJA 2WMBA 4RGJA 3FJQE 3D5WA 3FMNA 3DT1A 4GMYA 4A7CA 3Q5ZA 4WHZA 5IU2A 3U6HA 1VJYA 4XV9A 2W1IA 4YZDA 4BC6A 3QCXA 3NRMA 3BYUA 2R0UA 4EHZA 5EOBA 3LAUA 2E9VA 1XWSA 3R1SA 2QO2A 4RQKA 5LWNA 3QCQA 4NFNA 4BKZA 1K3AA 4C2VA 3WIGA 4EQCA 4MTAA 2IZTA 4ZSJA 4XG8A 5AP4A 5JN2A 3NCZA 2R7BA 2WTKC 3KMWA 4FTAA 4IB1A 2CN8A 3RMFA 3HV7A 3LFEA 4HYUA 4S32A 1WBOA 5TF9A 3RPYA 4A9YA 4BI2A 3Q2MA 3QAME 4CCUA 2XIYA 3MY0A 3NWWA 1B38A 2GNJA 3PJ2A 4FL1A 4LGDA 3RPVA 3SD0A 5LVOA 1M14A 3S3IA 3GCSA 5CSHA 2XM8A 3CP9A 3IQ7A 3R2YA 4FIHA 1FGKA 5EDRA 4CZTA 4BL1A 2OF2A 4ZSGA 5FBOA 3D2KA 3ORLA 3TL8A 4YSMA 4QPSA 4C4GA 2Z7SA 2IW9A 3DDQA 4EORA 4R5YA 5HTBA 1ZYCA 1CSNA 2A2AA 4IX5A 3PWDA 3LCKA 4FTQA 3VC4A 4ZLYA 5I3RA 4FEXA 4S31A 2ZVAA 3IS5A 5L3AA 4TZRA 3QYWA 4FOCA 4U7ZA 3PXQA 2PUUA 4BDEA 4DH5A 4R3PA 2XIRA 4QMXA 5JMSA 3EQFA 4ZTQA 1TQPA 3UPZA 2C5VA 4DHFA 4M14A 3C51A 2I0EA 3CY3A 4UZHA 3OXIA 4DTKA 5ANOA 3BWFA 2LGCA 5ACBC 4NU1A 3JVSA 4CQEA 2BRBA 4X3JA 3R8PA 4QP4A 4MXAA 3HMOA 4QRCA 2YA9A 4IX3A 3UYTA 4MX9A 5L6PA 3IONA 2P33A 4NSTA 3C4XA 1P4OA 4U79A 1XH9A 3BLQA 4E26A 4IZAA 1M2QA 5IA3A 1KE6A 5DR2A 1DAYA 3W8LA 3LCTA 4CLIA 3AC4A 3MI9A 3F7ZA 2QG5A 5C8NA 4FUXA 4CQGA 2XJ0A 3O96A 3EIDA 5EH0A 3JVRA 4C59A 4WG3A 3BGPA 4HOKA 3C4WA 3A61A 4OTQA 3DV3A 4RX9A 4RWIA 4FKIA 4ANBA 3ID6C 3D5VA 2QLUA 3OWJA 4M68A 3VS2A 2X8EA 3B8RA 5IDNA 2UW4A 5IQIA 3UGCA 4B8LA 3NW7A 3JS2A 4BCJA 4XOYA 3OOGA 4FSZA 1RQQA 1YI3A 4Y46A 4CYJA 4E7WA 4QMYA 2BDWA 4WRSA 3ZXZA 3LM5A 2WNTA 2JDRA 1Q3WA 2P3GX 1YXUA 2VWWA 4K2RA 4ERKA 5IEXA 3SGCA 1BLXA 1JSUA 2NRYA 4R8QA 3TV7A 2OH0E 2CGUA 2X8DA 3CPBA 5FXRA 5HX6A 5ANIA 3A99A 4O81A 1M52A 2CLQA 2XB7A 4XP0A 5HTCA 4W9XA 3SG8A 2WMTA 5JQ5A 2IPXA 3I7CA 3SV0A 4U80A 2WOTA 2PZPA 5CU3A 4EL9A 3I1AA 3LW0A 2PE2A 5ANJA 3R8UA 1BI8A 3F7WA 3FZSA 5HG9A 3RZFA 4MXXA 4YZBA 1OIUA 3OW3A 3V6RA 4QD6A 4EZ3A 3FMHA 4YR8A 5KX8A 3OWPA 4CFFA 3BYMA 3R8LA 4K0YA 2UZDA 5KNJA 4RIWB 4RJ6A 2CMWA 4OBPA 1IRKA 3TIYA 4JDKA 2XNMA 2OLCA 2YAKA 3GP0A 2V0DA 4F1MA 1STCE 1XBAA 1PMNA 3VBWA 2BROA 4GFGA 5EG3A 3SLSA 3W2SA 1PYEA 2VTSA 4C8BA 4U45A 2IN6A 3ORMA 4FTCA 5I9YA 4AS0A 5AADA 3QTQA 4FV1A 4NM0A 2R3JA
chains in the Genus database with same CATH superfamily
3KRXA 4MF0A 1U59A 2QU5A 1OVEA 4OAVB 3HUBA 3BGQA 3LCDA 3E3BX 3TTIA 4X2KA 2JDVA 4KKHA 4RZVA 1SZMA 3FXXA 4IDTA 1W8CA 1V0PA 4I6LA 2DYLA 3F69A 4QMOA 4OR5A 4XH6A 5TO8A 3VS0A 2CNUA 4F63A 2P55A 2C30A 3A2CA 3ENHA 4ITHA 3OT8A 4XOZA 5E1SA 2QCSA 5G6VA 3NVMB 4FMQA 1QPJA 3GC7A 4S34A 3TMOA 2ZV8A 2CKOA 1GIHA 2VTMA 3G5DA 3PSDA 2OZOA 4NIFA 3KY2A 3L9MA 4MQ1A 3E92A 3Q04A 4PL5A 2WMRA 4M69A 3NNWA 3MS9A 5I9XA 3EJ1A 4JX3A 4DGLC 5IF1A 4X6QC 2FSOX 4GYGA 2X4FA 3DJ5A 4L01A 2B9HA 4OGRA 5CYIA 4BDBA 1XH4A 2VGPA 4AOTA 3PJ3A 1MRYA 2UVXA 3CIKA 1T45A 3FHRA 4LGHA 3ZUVA 3DNEA 4PL3A 4FG8A 3MW1A 2CGWA 2OXYA 3ETAA 3VBTA 2A4LA 3VAPA 2VAGA 3H0YA 4MKCA 3IKAA 3R73A 4RFMA 4I93A 5HIDA 4E1ZA 3MTFA 3E7VA 3QGWA 5HD7A 3VIDA 5AA9A 2X2MA 4DTAA 4TWPA 2R7IA 4GVAA 4YZNA 4FVPA 2Y6OA 3L9LA 3LMGA 2GS7A 2IJMA 3E3PA 5HQ0A 2YWPA 5J5TA 3I5ZA 4EOIA 4ZSAA 1YWNA 3CKWA 4B0GA 3ERKA 5EDQA 3DJ7A 4IJPA 4JOAA 4X6RA 1R1WA 2FSLX 3MYGA 2BPMA 4JR7A 4FF8A 5FUTA 4PMSA 3DLSA 4QNYA 1ZYLA 1OL5A 4U81A 5AR4A 4F6UA 3W18A 4ANSA 3PY0A 4OW8A 4G31A 4S2ZA 3B2WA 4NFMA 1IG1A 2VTOA 5CI6A 3R04A 2VTPA 4JRNA 4RVMA 4FTMA 1MUOA 3BU6A 4IWPA 4L8MA 5J95A 2E9PA 4OTRA 4GUEA 4ANQA 4YBJA 3D5XA 1YOLA 5L2SA 3DLZA 3EQHA 5B2KA 3TJDA 4V01A 3W0QA 1P5EA 3VUMA 4RJ5A 5JT2A 1PYXA 4A4OA 5AUXA 1ZZ2A 4NW5A 4EOJA 3A7GA 4BCHA 3KRLA 2B9JA 3DXNA 5CEIA 4ZXTA 2PVJA 5CF4A 5I5ZA 3W2RA 3ZO3A 1CTPE 2ZB1A 2XRUA 2KULA 2BFYA 3DU8A 4EOSA 2QG7A 5L4QA 3FSKA 3MH3A 1H1RA 4ACGA 5HIEA 5E9EA 2Z7RA 4BCFA 4C3PA 3RK9A 4FKPA 4WBBB 3FQEA 4EK5A 3UZTA 3F3TA 2P2HA 4HPUE 5CASA 3GU7A 5CENA 1G8SA 2VU3A 3FMLA 3NUXA 4FIIA 2R3KA 3IO7A 3IW5A 3NUUA 4O21A 4XNEA 5CEQA 1PXJA 3LLAA 4JQ7A 5EYDA 4XG9A 4ZTSA 3BELA 1G5SA 3ALOA 2X6EA 4U43A 3R8VA 3BHTA 1FMKA 4C4FA 5M53A 3PP0A 4BWKA 1Q3DA 3LJ0A 3BLHA 1AD5A 3PA3A 2O63A 3PVBA 4BI1A 3IGOA 5AP0A 2A1AB 2IEWA 3IG7A 3P9JA 4ACMA 4K1BA 3O7LB 4QMTA 4GU9A 4DG2E 4FT3A 2Y7JA 3FYKX 5HNGA 3TG1A 4XHKB 4CSVA 1R39A 4I0SA 4QQTA 3TZ8A 4D4RA 4AT3A 3V5QA 3RM6A 4O0UA 2W9ZB 4R3CA 3RBWA 1OMWA 5CEMA 2VTHA 2V62A 2YCRA 4AQKA 5AR2A 3TNIA 4AE9A 3F2RA 5C1QB 1U5QA 1ERKA 2YDIA 1JAMA 4USEA 1ZXEA 2X8IA 2QOOA 1R0EA 3AGLA 3UZPA 4O7LA 1YDTE 1XH6A 3BGZA 3PSCA 3M11A 3UG1A 5LARA 4JLCA 2YACA 4GW8A 3RWQA 4BHZA 1CKJA 5L2WA 1J3HA 2GQGA 3QA8A 3I0QA 4FV6A 4JL9A 5ETAA 3SX9A 3R22A 3NLBA 4BICA 4TY1A 2RFSA 4E73A 2PWLA 4G5JA 3R7VA 5EYMA 3R9RA 5FTOA 3WZKA 2OGVA 4RX5A 1GNGA 3VJOA 2J2IB 3G9NA 4WRGA 4IVBA 3F5XA 3FZRA 4ANNA 4WIHA 2BFXA 4KS8A 2XNEA 3SW4A 3R9NA 5FRIA 3TKHA 5AR8A 2JBOA 3LFBA 3R21A 4CVAA 4TWNA 3M1SA 2R3QA 3JPVA 3MJ1A 1TQMA 4NWMA 4MHAA 4FKQA 2WMVA 3FKNA 4C4IA 4IAKA 4J7BA 2O2UA 3FI2A 3DA6A 4RX8A 4YPDA 2ITOA 5AAFA 3PJCA 1SMHA 3D7TB 4O96A 1OECA 1IASA 4GRBA 5FXQA 4J52A 4R7HA 3FI4A 3SRVB 5IH4A 5J9ZA 5LQFA 1J1CA 2G2IA 4CFUA 4O7ZA 2P4IA 2C6TA 2KTYA 2W1EA 4UMQA 1PXIA 2XYNA 3O8TA 3NW5A 3T3UA 4HNIA 3VUIA 4Y85A 1KE9A 4FTOA 4PQNA 4QP8A 4I20A 4TYIA 1GZNA 5EKOA 5IH6A 5AWMA 1RDQE 3DJ6A 1FOTA 3AT4A 3BHYA 1H07A 4H1JA 2GQRA 3WI6A 4BJJA 1QL6A 2ZMCA 3EZRA 3DS6A 2Z7QA 2ZDTA 4MD9E 5TOZA 1ZOGA 2UZVA 4GH2A 3RM7A 3F5UA 3Q6UA 4XG3A 2YAAA 4EHGA 1WBTA 2OO8X 4QP3A 4KUJA 2PK9A 4AX8A 2G9XA 4HYHA 3S0OA 3VONA 4FG7A 3GBZA 3MVMA 3C5UA 5I9VA 4OTIA 3PIZA 2B53A 5I4NA 2VWBA 2RGPA 2UUEA 3UOHA 3E8NA 3W2OA 4BBFA 4BCKA 5KMOA 3MV5A 1OM1A 4M0YA 5CI7A 2ZV7A 4RZWA 5HCXA 2B52A 1Y6BA 3MBLA 4PNIA 1U4DA 2XKEA 4AA5A 4C2WA 4ZOGA 2XANA 4QDVA 3UDZA 3CPCA 3HNGA 4JI9A 3O0GA 5DR9A 2QI8A 2CPKE 5IG1A 5TE0A 4RWLA 3W16A 4BB4A 3VBXA 3S00A 1CM8A 4AGUA 1OPKA 4QMVA 4ZTHA 2YFXA 3D4QA 3Q4CA 3GXLA 5FWKK 2GNLA 3DY7A 4BGGA 2YITA 5AX9A 2R3MA 4KA3A 4NUSA 5JSMA 3A7FA 3IW6A 3L8VA 3BE2A 2XF0A 4LRMA 5AM6A 1APME 3PXRA 1NW1A 4FTNA 5E8ZA 3G9LX 3I4BA 4ZJVA 3ZM4A 4F7LA 3DK3A 1PF8A 4RIOA 3G0EA 1JSVA 5K9IA 3NYVA 4I0RA 3BYOA 4F78A 3LFSA 4O6LA 5HLNA 3PE2A 3KREA 3NFFB 2XUUA 3ACKA 4AFJA 1H25A 4I4FA 3C9WA 3KEXA 3LXPA 3V5LA 4M12A 4B9DA 4G16A 3ZUUA 3KL8A 2Z02A 5E8WA 2W1CA 4E6CA 4AOIA 5KUPA 5HI2A 1PJKA 2YZLA 4YO6A 4L7FA 2Q83A 2NP8A 5J7HA 3RPRA 1UNGA 3RVGA 4KRCA 2QOIA 5EHOA 2C6IA 3F66A 1ZMWA 5T68A 3UMXA 2FSTX 3NSZA 3L8SA 5IA1A 5IQGA 2YZAA 3D0EA 2QKRA 2XNPA 2WTJA 3HV3A 1ZMVA 3PA5A 4C4JA 4FKLA 5K3YA 3T9IA 4BCNA 4YJOA 4CKJA 3TTJA 4BFMA 3C0HA 4D5HA 5JEBA 1PXKA 1J1BA 1DAWA 3WOWA 2XALA 4BDCA 1W98A 4CFXA 3I0OA 4WOVA 4D1ZA 1H24A 3II5A 2PULA 1KE8A 3EN4A 4S33A 4CCBA 2YDJA 1WMKA 2WTWA 4H3PA 4E6AA 4R3RA 3PXZA 3TJCA 4IB3A 5AR3A 3EQIA 2JBPA 3BU5A 2ACXA 1IA8A 4FZ7A 1JWHA 3KCFA 4YO4A 5KKRC 4IAAA 4BTFA 3E64A 1U54B 4EHEA 4KNBA 3WYXA 4N70A 2UZWE 4FT9A 2R3RA 4V0GA 3V5PA 4EWHA 2GNFA 3EYHA 4Y5QA 4EH5A 5EDPA 1OKWA 1IEPA 2X7OA 3V5TA 1JKKA 4FK6A 4LOPA 1H8FA 1XBCA 4XS2A 4AXEA 1YXVA 4M66A 2IVTA 1Y8YA 2J5FA 2R4BA 3DGKA 2QHMA 4M8TA 2WZJA 3DBFA 4DGNA 2JITA 2YM7A 3UVPA 4AN2A 4BDKA 4C0TA 3BE9A 5A14A 4FEVA 2XIKA 4UEUA 4WKQA 3IW8A 4CKIA 3GFEA 3FZPA 4F9AA 2QC6A 4EK8A 1W82A 4IZ5A 3W0RA 3BWJA 3OHTA 1JVPP 2V5QA 4FVQA 4GS6A 1YRPA 5FTGA 3WYYA 3ANQA 3ORPA 4EJ7A 2X9FA 3F3VA 4JBQA 4G3EA 5M06A 4DH3A 4XRLA 3OY3A 3EFLA 3R0TA 4D0XA 5A4TA 3HV5A 3PIYA 3W10A 3PJ8A 3QRIA 3MFRA 5BQ0A 4I6HA 1IR3A 4G5PA 4NM3A 3VF8A 4L42A 4QYGA 3FZTA 2YLFA 4JBOA 5AP3A 4DLIA 5H9BA 2AC5A 4IMYA 4UXQA 2CKQA 2BRNA 4AA4A 3VO3A 4ZS0A 3RCJA 3VS6A 4LMNA 3HAMA 4CFWA 3TNWA 4PY1A 2LAVA 3E88A 5ETCA 3TEIA 4I5PA 4IVCA 4LRKA 4P7EA 2X0OA 3PY1A 4CMUA 3FL5A 4M69B 4XV1A 3FXZA 3IPHA 1TKIA 4ARKA 2UW9A 3FPMA 3HP2A 3KXNA 2OZAB 4YJPA 4EBVA 2VD5A 3TI1A 5L2TA 3KQ7A 4QYYA 2Z2WA 5D41A 3ZLYA 1J7LA 3FMJA 3MIYA 2BAQA 4XCUA 4KRDA 3HA6A 5IA5A 3GU6A 3KN6A 4JBVA 4UX9A 4BIEA 1R0PA 1H1PA 4YUQA 2GMXA 4N6ZA 3RNYA 2HELA 4H39A 3UQGA 2WGJA 1J91A 4EQMA 3TN8A 1VYZA 4KKGA 4RBLA 2RFNA 5DEWA 1W84A 3ZC6A 4ZJJA 1XO2B 4XP3A 3H9FA 4TYEA 2XA4A 4UBAA 4TNBA 2JLDA 4QYHA 2XEYA 5J79A 4NW6A 4UYNA 2F9GA 4CFMA 5BNJA 3PRFA 2BVAA 5CVGA 4E93A 3KKVA 4FTLA 3MN3A 1H00A 1LUFA 4F99A 2RF9A 2PL0A 3AC8A 3BBTB 2VWXA 3RAKA 3ROYA 3EFWA 5M4UA 5JRSA 4FIJA 4NT4A 4YJSA 3R7GA 3K2LA 3WILA 5CY3A 2NPQA 4FICA 3TV6A 3QZIA 4ACCA 3PUPA 1NVRA 2JDOA 3JXWA 3MJ2A 4ASZA 1PY5A 4FIFA 5LOHA 5CEPA 1DI8A 1E9HA 3RHXA 4U41A 3FZOA 5FM2A 4F65A 4CFNA 3QLFA 4HGSA 1YDRE 2WQEA 4WSQA 5BVFA 3QZGA 3AKKA 2EXEA 2EUFB 2WTIA 4AA0A 5DT0A 4AW1A 1BUHA 4E5BA 1Y57A 1YDSE 2OG8A 3HV4A 2XBAA 5BVKA 3NDMA 5J1VA 3FLSA 4ZS4A 2FYSA 5BYLA 4C62A 5C8MA 4D2TA 3N4VA 3MH1A 4JT3A 4JBPA 1P2AA 2BILB 2I40A 2YIYA 2VTLA 3GC9A 4MAOA 1OBDA 4H05A 5DRDA 3TYKA 3W2QA 4HGLA 3UNJA 4U5JA 2R3LA 2YCSA 5FGKA 1XKKA 1XQZA 3ALNA 4O0YA 4C3RA 5HTIA 2C0IA 4K9YA 2VTTA 3NPCA 4MQ2A 3TM0A 5HO6A 5DNRA 5IQFA 5L8KA 2V7AA 4O91A 4LL0A 3KFAA 3LFQA 4O6EA 5BYYA 5B2LA 3R83A 3EYGA 5ANGA 4JDHA 4AW2A 5EKNA 5EQEA 3EFKA 3A4OX 4Q5HA 1ZOEA 3ACJA 1PMEA 4MNEA 2FVDA 2UVYA 2WD1A 3RTPA 4GKHA 3HEGA 4O0SA 5BVDA 2YM6A 3PZHA 3D5UA 3FC1X 2AC3A 4FKUA 3LMIA 3L9NA 4NCTC 3DXQA 4C61A 3FKLA 4PDYA 2B9FA 2Y4IB 3ZFYA 3GNIB 1Q61A 4PMMA 4JXFA 3VRZA 2IG7A 2QNJA 2QO7A 2YIWA 3AT3A 2VV9A 4R5SA 3Q96A 4DA5A 3UVRA 4QTBA 3MSSA 4NCTA 4QMLA 3R8ZA 4XG7A 5H8EA 4DFZE 1Q8UA 3T9TA 4Y8DA 1W83A 3PSBA 4D9TA 3ORZA 3AKJA 3MB6A 4YZCA 3HMIA 4WUAA 3RNIA 4BDFA 4IW0A 3FLZA 4UY9A 4EH3A 2CN5A 4AZTA 2VTAA 1NVQA 1H0WA 2HOGA 2XMYA 3DTCA 4KWPA 2HY81 4Y5HA 2PVHA 1REKA 3OTUA 1UKIA 3QRKA 4GCJA 5AIRA 2XIXA 2VTQA 1GIJA 1NT2A 5A4CA 5M57A 4XBRA 4DHJA 5A54A 2B7AA 3ATTA 2B9IA 4EHVA 5FEDA 5DIAA 3FE3A 5HZNA 2GHLA 2GSFA 3TV4A 4DEHA 4Z7GA 5KBRA 2XK4A 3IK3A 4NTSA 5FG8A 3ZOSA 5EQPA 5LCKA 3OUKA 4BI0A 4ANOA 1KV1A 3RALA 4PP7A 3DKCA 1FMOE 5IA2A 2V7OA 2EWAA 2UZBA 3UP2A 2XAMA 3D94A 3HRCA 2F7EE 1M17A 4ZLOA 4YTHA 5A9UA 5DFPA 4E6QA 4GFMA 4DG3E 4FX3A 5FD2A 4A9SA 5LVPA 3LCOA 3C4ZA 5CF6A 2PHKA 4OTHA 2EU9A 4YLKA 5HHWA 3GUBA 3MDYA 4EH7A 5AMNA 4QP7A 4GKIA 5CEOA 2UZTA 4Z9LA 3V8SA 2HZ0A 3R71A 4U0IA 4O7NA 4QMWA 3UOJA 3HRBA 4KABA 2R0IA 2P0CA 4FV7A 3CXWA 4FSNA 4CZYB 2H8HA 5BX0A 2XNBA 2VWVA 4DEGA 2PVYA 3ORNA 1K2PA 5GZ8A 1ND4A 1LEZA 4I21A 4BGQA 4RLKA 4F6SA 4DDGA 4M7IA 3RKBA 3KK8A 2BUJA 5K5NA 5KMLA 2PUPA 2FGIA 3F3UA 4HPTE 4DGOA 1KSWA 1YHWA 2GHMA 3KB7A 4O7YA 2Y4PA 3DK6A 4P4CA 4QOXA 1FGIA 4WG5A 4EBWA 3CSVA 5GZ9A 4ZIMA 3NAYA 3Q60A 4C4EA 4D55A 1UKHA 2ITTA 3GCQA 2W5HA 1MQBA 3OWLA 3QTRA 4ANMA 4DHIB 5EW8A 2QR7A 1ZOHA 1KUTA 5IA0A 3TZ9A 4CTCA 1A06A 3IDBA 3ZFXA 3COIA 4ZY5A 3ZH8A 4IACA 2C6DA 3PYYA 4OT6A 2ERZE 4UZDA 3TKUA 1XR1A 2JDTA 3VUGA 4QP1A 4FT7A 3L1SA 4XUFA 5FEQA 3TIZA 3O23A 3LFNA 5HBJA 2G2FA 2J90A 2C69A 4B4LA 4D2SA 3DDPA 4PV0A 1CMKE 4I94A 2CLXA 4BRXA 3Q5IA 2VWYA 4RC3A 3COHA 3DQXA 5JZJA 1OIQA 2CCHA 3NW6A 4PF4A 1Z9XA 2XK9A 4LRJA 4D2RA 3FHIA 4YTCA 4UWCA 2R3HA 4CT2A 2ITXA 2WMQA 4FKVA 4BKYA 3N4UA 4QDEA 4XBUA 4BCQA 3AOXA 1F0QA 4WBOA 3B8QA 1O9UA 1URCA 3HP5A 4JJRA 4F08A 4WNOA 5E8XA 4JAIA 2YJRA 3G2FA 2ZOQA 4IHPA 4I1ZA 4ID7A 2Y8OA 4C7TA 4RT7A 4IX4A 3HV6A 4CV9A 2VTNA 3HMNA 4I3ZA 4ZAUA 2VZ6A 5CXZA 5E8YA 3DAKA 4MF1A 4OTFA 4BF2A 3OCGA 4J95A 2XH5A 3KN5A 3WF8A 5M08A 1JBPE 4R1VA 3ODZX 4F09A 4DF3A 4DFUA 3IDPA 4R7IA 5AV1A 5DYJA 3LHJA 3P5KA 3G51A 4IH8A 1O6YA 2YIRA 3C50A 3KULA 4QMZA 3VS1A 5GJGA 3P5JC 4JX7A 5T6KA 3JY9A 4FTRA 3IW4A 1OPJA 1FVVA 2JGZA 5AP2A 2BZKB 3FSFA 3KU2A 3PWYA 3VRYA 3QD0A 4M67A 1DM2A 3P79A 4O4CA 3P23A 2XYUA 1Z5MA 3AT2A 2Q0BA 5CU6A 5JGBA 3ZRLA 1UVRA 2ITPA 4YJNA 4EH8A 2GFCA 2IZSA 3E87A 2GNIA 4IB5A 3DKGA 2J5EA 4J53A 3VW8A 3TUBA 5IUHA 4L44A 3RPOA 4IM0A 4ZZNA 2W1HA 3HUCA 3P7CA 5IA4A 4QYFA 3LCSA 3N4TA 2IVSA 3QKMA 4LGGA 4M84A 1G8KA 2OICA 4K77A 3A7JA 4UMRA 3I5NA 4WT6A 4HCTA 3L9PA 4L68A 1XMLA 2HWOA 4J71A 5B0XA 4UMTA 5IQDA 3W32A 4QNAA 1H1SA 3Q2JA 3OCTA 4DTBA 4BDIA 3POOA 3BU3A 2EB3A 5EM5A 5JFSA 2E9OA 2UW5A 4WSYA 2W0JA 4RPVA 4LUDA 4YJTA 5J9LA 3O50A 5KHXA 4AN9A 2QD9A 4U97A 2W9FB 3W8QA 1XH7A 3LQ5A 4MWHA 5EK7A 1BI7A 2GTMA 4U6RA 3VS7A 4BCGA 1OZ1A 1Q4LA 3MVJA 3MTLA 3BCEA 3QX2A 3EN9A 4AZEA 3RK5A 1V0OA 2JFLA 4FI1A 3U4WA 1PHKA 1SM2A 1YI6A 4L52A 4RIXA 2OJFE 2E9NA 1Y6AA 3OVVA 4UWYA 4YMJA 4CLJA 5M44A 5CQUA 5AP6A 4IZYA 5DT4A 4L3PA 3ULIA 2X2KA 4A07A 3UBDA 3TNQB 3HZTA 3VWAA 2FO0A 3C1XA 4U42A 1P14A 4EOPA 4PL4A 4CXAA 4FSTA 2PPQA 4YLLA 4JAJA 2GHGA 4HZRA 4IAFA 4WG4A 4L67A 4DCAA 4DFYA 2PZRA 4H1MA 4TN6A 1GY3A 2E2BA 5LMBA 2J51A 4AW5A 5E8TA 5EFQA 4AXFA 5JFVA 3DFCB 4FODA 1TVOA 3H4JA 4KIKA 4YHTA 4IM3A 2PVFA 3DB6A 5L8JA 4DT9A 4O86A 5AA8A 3KK9A 2QLQA 4FYNA 3FY0A 3PY3A 4NL0A 1OPLA 2IF8A 1TQIA 2BCJA 3HLLA 4IC8A 2CNQA 4C02A 4YTFA 4OTWA 3S95A 5AAEA 2VO3A 4RLLA 4C34A 3TDVA 2XK3A 3RWPA 4G3CA 2C0OA 1NA7A 5HE1A 5M09A 3FI3A 1GZ8A 4F6WA 3NNXA 3ZM9A 4GUBA 1GJOA 1SVGA 5AV0A 3SC1A 2J0MB 3QBNA 1BKXA 4EK4A 4O7VA 3OBGA 3UP7A 4QMUA 1Q41A 2WTDA 4IJ9A 4C58A 2QOLA 3MIAA 4UALA 4FKSA 3HECA 1OIRA 4JDJA 4X3FC 3LXNA 2UW3A 1OITA 3FLWA 3NUSA 1HCKA 2O3PA 4MXYA 2VWZA 2W99B 3BPRA 4IAIA 4YNEA 2XKCA 2XK7A 4RIYA 4X3FA 3OZ6A 2XEZA 2J0IA 2ITZA 4L53A 4LOOA 4IEBA 2BDFA 5IUGA 3NAXA 2B0QA 3AMAA 5HNIX 1QPCA 1LPUA 2QO9A 1YWRA 3EN6A 5ICPA 3D9VA 4TYHA 1KOBA 2HAKA 3QRJA 5KCVA 5DH3A 4WD5A 4GG5A 4E20A 4Y72A 4ZSEA 5I9ZA 2EVAA 3QGYA 3D14A 5HKMA 4EONA 2C0TA 3EKNA 4LV5A 1ST0A 5F20A 5A4EA 1Q62A 4YHFA 4DEEA 3O71A 4TYJA 4RJ3A 3FBVA 3MFTA 2WFYA 1OKVA 4RC2A 5IUIA 4HVHA 4UXLA 3RCDA 4D4SA 1OBGA 3GU4A 4WNKA 4NEUA 1PKGA 2GTNA 2PVNA 3E93A 4RC4A 3U9CA 3UIMA 3ZSGA 4DITA 4PMPA 5JKGA 5BMSA 3D15A 3OY1A 5HX8A 2J9MA 1GZOA 4IZ7A 3MA3A 5E1EA 3H30A 3OT3A 1ZY5A 1L3RE 5AEPA 3QKKA 3UO4A 2OJJA 4IM2A 2YDKA 4LG4A 3V04A 4TW9A 1BL7A 2W17A 2XZSA 3G90X 4G6OA 4FV3A 4ONAA 1X8BA 4FKTA 5FDPA 4PRJA 4OTPA 3PPKA 4OBQA 1H26A 5E8VA 5AUTA 3LKMA 3LIJA 4WNPA 1G8JA 3NR9A 4ZEGA 2W4KA 4D2WA 4AGCA 3EH9A 5BVEA 2AEGA 5BMMA 3HKOA 1WFCA 3PE1A 3Q9YA 4XG4A 5CSVA 4PDPA 4YJQA 2OSCA 3T8OA 4D1XA 3Q9WA 2G1TA 3PFQA 2PVMA 4W9WA 2PMOX 3GI3A 4I5MA 4AN3A 4O83A 4XV2A 3FV8A 5FQDC 3PUFC 4D28A 4MNEB 4QT1A 3ZDUA 3JY0A 2PZYA 2QURA 4J8NA 2B54A 5CALA 4QP6A 3NUNA 1T46A 3OBJA 4V04A 3NIEA 3GCUA 1AQ1A 5DR6A 5A3XA 4EQUA 2X0QA 2F7XE 4NK9A 2CKEA 2ITYA 3UO6A 3ML1A 5IQCA 2OXDA 3GC0A 3KVXA 4AXAA 1Q99A 2IZRA 4II5A 1NXKA 2OK1A 3QTZA 4IVAA 4C35A 4GL9A 2W1DA 3R00A 4GT3A 3VQHA 5M55A 5L2IA 3FAAA 2QVSE 2PMLX 2XJ1A 4FRFA 2UZOA 2R3GA 3E8DA 1CKIA 4IAYA 4A06A 4AU8A 3Q6WA 2X2LA 1FQ1B 2HK5A 5CVHA 4EUTA 1B6CB 3QHRA 4G9RA 2UW8A 4JQ8A 5I9UA 1YVJA 3ZLXA 4XLIA 4O38A 4DH7A 4Q9ZA 3RHKA 4ALVA 4CKRA 1YHSA 4Y83A 5ACKA 2XKFA 2C5XA 2WMWA 1Q24A 4AZFA 5A6NA 2YM8A 3S2PA 4CNHA 3CQUA 4AZVA 3CGFA 5FEEA 4YLJA 4YNOA 4GIIA 2C47A 3O8UA 3PVWA 4IADA 4O4BB 4D2VA 3ZO2A 4L3JA 4I92A 2WTKB 3FLQA 2X6DA 2R64A 3QC4A 1RJBA 4LV8A 1F5QA 4ENXA 4L46A 3RI1A 5JGDA 4R6VA 3ENMA 2BZJA 4O0RA 3SHEA 5CNNA 3R6XA 4Q9SA 3IECA 4TT7A 4MWIA 5CWZA 3KRRA 4FIEA 1PRYA 3GOPA 4AWIA 4LDTA 4AUAA 2BALA 3KF4A 2RG6A 4HVIA 5BPYA 4KIOA 2WTVA 3AD4A 3ZSIA 2JDSA 3DZOA 3NZ0A 1UU7A 4DHZA 4FGRA 4O22A 2DS1A 4KIQA 1B39A 2WB8A 3QFVA 1H28A 4O82A 3I6WA 4RVKA 4OAUC 3PP1A 4AOJA 5F4NA 2V55A 4RQVA 3C0IA 1FPUA 3DKOA 3VJNA 5TR6A 4ITIA 3VUHA 2QOKA 4C3FA 5DEYA 3G0FA 3OCBA 3C0GA 3I81A 4WNMA 3UVQA 3EMGA 1WBNA 5HO7A 4ZTLA 4MH7A 1PMUA 2JAMA 4IC7A 4GV1A 2VO0A 1V1KA 2JC6A 4FV0A 2DUVA 3QF9A 3NUAA 2PVLA 5DVRA 4DBNA 3O2MA 3E7OA 3KMUA 1UA2A 5L2QA 4DYMA 3CTJA 4K8AA 4O4FA 1OIYA 2A27A 2ITNA 4G2FA 3BQRA 3CE3A 1BX6A 4G1WA 2YERA 4P2KA 5EW3A 3AC3A 1R3CA 4TTHB 4BVUA 1LP4A 1WCCA 3U9NA 3TZMA 4DEIA 4E4MA 3UOKA 4QMPA 5BV3A 3U87A 3QQFA 3QRTA 4I6BA 4QPAA 2DWBA 3EQCA 3GEQA 3A62A 5FTQA 3H3CA 4CV8A 1REJA 2HCKA 3OP5A 3UIXA 4K11A 3I79A 4U40A 2OJ9A 2R2PA 3ZSHA 2XM9A 1YXXA 2NYAA 4IXPA 4TRLA 2OF4A 5DI1A 4I23A 2XK6A 3CR0A 2HZ4A 3KXZA 2E9UA 3O51A 4TWCA 5AAGA 1Q8WA 3BX5A 3EHAA 2BRMA 5BUJA 2VNWA 5G1XA 3OWKA 5GNKA 1MRVA 2WQBA 3IOPA 3DKFA 4DGMA 4ORKA 2HZIA 4RIWA 3DOGA 3LM0A 3ZLWA 4YC3A 5EYCA 4RJ4A 5LXMA 4USFA 2IVUA 5CSXA 1H1QA 3BYVA 1VR2A 4FR4A 5K4JA 5DRBA 3QA0A 3CD8A 3SXFA 3Q4ZA 4FKJA 4FKOA 3O17A 2W96B 4DG0E 4P5ZA 4KBKA 4NYEA 3P4KA 1H1WA 2JKQA 3TCPA 4YSJA 1R78A 3LLTA 5AIKA 4F9WA 4IVDA