2YIQA

Structural analysis of checkpoint kinase 2 in complex with inhibitor pv1322
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
280
Chain Sequence
VYPKALRDEYIMSKTLGGEVKLAFERKTCKKVAIKIISKVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Checkpoint Kinase 2 in Complex with Inhibitors that Target its Gatekeeper-Dependent Hydrophobic Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 89
structure length 280
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiqA01
3ZC5A 2XBJA 4IB0A 4JDKA 4F0FA 1H4LA 3A8WA 3HRCA 4FTLA 3TJDA 3IOPA 4R6VA 3WBLA 4B4LA 5CF4A 5L6PA 3HDMA 3W8LA 5IQGA 3RK9A 4QPAA 2VX1A 1IG1A 4GL9A 2WQOA 3Q2MA 4F7LA 4YMJA 1IRKA 1J1CA 5I9YA 3PSBA 2RF9A 3PE1A 4L42A 2XRUA 4GJ3A 3JUHA 5CXHA 3UO6A 2PMNX 3MV5A 4YPSA 4N0SA 1F5QA 4BCQA 3D2KA 2UZOA 4IW0A 2VTPA 5A3XA 1PKDA 2XKCA 3GU4A 4Q2AA 4F6UA 5IA2A 4IADA 4R78A 2OFUA 5DT0A 2OJIA 3B2TA 4ZS4A 2CSNA 3H30A 2YDKA 4PDSA 4CZTA 4YTCA 2OGVA 2OICA 3ALNA 4FKUA 3RBWA 3FI8A 3OROA 3KF7A 3QA8A 4KSPA 4C3RA 4C4IA 3QTIA 4GK2A 4FV6A 4BDDA 3TUBA 3EFKA 4MXOA 3L9NA 2HENA 1ZZ2A 3VUMA 4E6AA 5EQEA 3C4CA 3ZMMA 1P4OA 5JMSA 2ONLC 4II5A 4FG8A 3OEZA 3UOKA 5CSPA 4AFEA 4ZTRA 2BDJA 4NJ3A 4EH3A 3QGWA 1G5SA 2X7OA 4AN3A 4C8BA 3AD4A 1XQZA 4PNKA 2Y6MA 1YOLA 5JFVA 3ZEPA 1BMKA 2BFXA 5I9VA 3O17A 5DYJA 1FMKA 4OTFA 1XBBA 3K5VA 4DEIA 3UMXA 2RG5A 3FLYA 2QG7A 3MFRA 3A7FA 2QOHA 4DGGA 2E9UA 3GU6A 4Y8DA 4YTFA 4WUNA 4D55A 4EHEA 1PJKA 2ITQA 5KE0A 2HW6A 3R1SA 1CKIA 2X9FA 3BQCA 4M12A 2BCJA 1S9JA 4HNFA 1CMKE 2HZ0A 5DEYA 2F9GA 4G6OA 2BAJA 2C0TA 3PPKA 3KXGA 2CNVA 4ALVA 3LAUA 2XYNA 3A7GA 3MH3A 3VUGA 1PXOA 3TKHA 5CAUA 3FMEA 3LFFA 1ZXEA 3NSZA 4DCEA 4FT3A 3F66A 3LW0A 2QNJA 3G6HA 4RT7A 4ANOA 4BCMA 5KO1A 3QQGA 3NIZA 2OJ9A 3P78A 3UIXA 5CAVA 3R1NA 2IVTA 4HNIA 3T9IA 2BDFA 4QMXA 2O64A 1YHWA 5EOLA 2GQRA 5DNRA 2R0IA 4Z7GA 2O65A 3IOKA 3LM0A 4MX9A 3DCVA 3P7AA 1ZARA 4L00A 5LXMA 3MVHA 3ZM9A 4QQJA 5AMNA 4IANA 2VWYA 2UW9A 4ZLYA 1V0OA 4JXFA 3UIMA 4F0IA 3DBDA 3M11A 4W4XA 3OC1A 5HD7A 3VBWA 2HXQA 4AGCA 4CD0A 5M51A 4QRCA 4ZZMA 4C62A 2ITPA 2ACXA 4YZMA 2CGVA 1WZYA 4UYNA 2WGJA 1Q5KA 2ZDUA 3TWJA 2Y0AA 4KRCA 4JX7A 2ZJWA 4XX9A 5DRDA 5F94A 4B8LA 3PRIA 4XG4A 5EH0A 4F99A 5CU2A 2VWXA 5D7AA 4AW1A 4FTOA 3JY9A 3N51A 4RIWA 4XP0A 4BDKA 2BMCA 5EQYA 4EC8A 3F88A 4DEGA 3E62A 3V8TA 3PLAE 3ZTXA 4AW0A 2YM8A 4R77A 3AGLA 4RIXA 4FT0A 4FKWA 2ZMDA 4EHZA 2GFSA 4GKHA 4FSTA 1VZOA 2YACA 4MXYA 2PWLA 3PVWA 5KNJA 1R78A 4LGDA 3RCJA 4QTCA 3E8NA 4S30A 5C26A 4YLKA 4C59A 3OT8A 4EKKA 2J6MA 4O7SA 3SOCA 3KY2A 3P5KA 3TZ9A 4B8MA 2NNWB 4BI2A 3UVPA 5LMKA 1KWPA 4I4FA 1M17A 2ETKA 4JAIA 3VUTA 4XH6A 3ATSA 4J98A 4QMTA 3MIYA 5ETAA 4BCFA 4ZK5A 3DTWA 4BDGA 4QP1A 2R3OA 4X0MA 4LYNA 2BUJA 2AYPA 3DLSA 4MNEB 4RGJA 5FM2A 5TF9A 3C50A 3MTFA 1F3MC 5IEYA 3BWFA 2GNGA 2ITVA 4U79A 1RW8A 4GS6A 4XBRA 2YZLA 1O6YA 4F7SA 1OKVA 3FKNA 4C33A 4FA2A 3RCDA 5HBHA 5AIKA 2UZEA 1PMVA 4QYYA 2R3PA 5KKRB 3AG9A 3D7TB 4FSRA 4E3CA 3NDMA 4FK6A 3I5ZA 4AS0A 2V22A 3DLZA 3GCUA 4YC8A 3HUCA 2ITUA 4ZTLA 2ZB0A 5J1WA 4DH5A 5CF5A 4I5MA 4MF1A 4IC8A 3M42A 1WVWA 2QOCA 2VRXA 2BRNA 4FTQA 3QC9A 2BRHA 4JIKA 4DN5A 3BE2A 3HL7A 4E73A 5JFXA 2AC5A 3TDVA 1Z9XA 2RFNA 4JBPA 5CF6A 4X2KA 2C6MA 5F9EA 5LVLA 4JJRA 3QYWA 3SGCA 3VW8A 4U0IA 3FMKA 5HIEA 4CMUA 2X39A 2PVHA 5EKOA 4DT8A 2PVNA 4ASZA 5CSXA 4G3DA 3R04A 3TZ8A 1OL6A 5ANJA 3KRLA 1HCLA 3R1YA 1OBDA 4K18A 4EOSA 3P08A 5LWNA 3TNHA 1Q8YA 2OJGA 5EQPA 3UNKA 3QQUA 4QTAA 3O51A 4A9YA 5B2MA 4ZTMA 4UALA 2YAAA 3IG7A 1B38A 3K54A 4TTHB 5HX8A 3F3TA 2V55A 3WIKA 4BFMA 2W9FB 4CKIA 3LXLA 2VTTA 3HV7A 4NM5A 2E9NA 4JRVA 3S3IA 4O81A 3COKA 4MXCA 3ELJA 4L3JA 5IZFA 4FV5A 1AQ1A 3TT0A 3LPBA 4GK3A 2QG5A 4BCHA 2BAKA 2VTHA 3F5UA 3MVMA 4H3PA 3CBLA 5K0XA 2WNTA 3KVXA 3N4TA 2XM8A 3D7ZA 2VTQA 3CE3A 3FI4A 2UZVA 2OIBA 4UWCA 3UO5A 3CTHA 3DBCA 5IQAA 4FV9A 4IAFA 4IX5A 3AOXA 3AD5A 4F4PA 3RNIA 2WEIA 1I44A 4CKJA 5LCKA 2Z02A 2EXMA 4FYNA 4O0WA 2ZAZA 5FXRA 4EWQA 4NCTC 2ZV2A 4MF0A 4HYIA 3TTJA 3ZZEA 4JVGA 2PTKA 4RX8A 1BI8A 4BCPA 2VNYA 3COMA 4FIFA 3W18A 3KEXA 3OBGA 4OTIA 4WKQA 2OLCA 4I6FA 1MP8A 4PNIA 4AF3A 1LP4A 3V5LA 4DG3E 2BIKB 3LCDA 3V5JA 1DI9A 1GOLA 4B6LA 3FI2A 3UVQA 4CCBA 2YCSA 4RMZA 2X8EA 2DYLA 3DFAA 3Q9WA 4FKQA 4GU6A 3MI9A 2G2IA 2BZHB 2EWAA 3EQGA 1Y8GA 4J96A 3LFNA 4PPCA 5CALA 5E8XA 2VWVA 2XBAA 4PDPA 2FGIA 3O23A 3DB8A 3OCTA 4HGSA 4DLIA 3PUPA 2BKZA 4JG8A 3U55A 2WU7A 3E93A 3Q5IA 3ODYX 4N4SA 3R8LA 2IG7A 2OWBA 2X81A 3MBLA 5CZIA 4AN9A 2GNHA 2QODA 4GCJA 3U9CA 5JQ8A 4JQ7A 2XK7A 1MQBA 2XKDA 4KS8A 3UOJA 1W7HA 1XH4A 3LJ1A 4JBQA 5AAFA 4AA0A 3NUPA 1YOMA 3COHA 1JKLA 3AQVA 3A4PA 1CSNA 3PXYA 3VHKA 3G0FA 4WG3A 4XS2A 3C0GA 2WMUA 3R2YA 1OVEA 2YFXA 5IKWA 2C0OA 3RHKA 4AWIA 4QMNA 1BL7A 4KIKB 4RLLA 4HCTA 3IGOA 4YZNA 5D11A 4EZ3A 3PJCA 2ZMCA 4LL0A 4EC9A 2R3NA 3Q53A 5HCXA 3MY0A 4H1JA 5L8JA 4Z7HA 4NZWB 4RQVA 3TIZA 4AZTA 3FZPA 4NFMA 4EUUA 3K2LA 4ZSLA 4ALWA 3TCPA 2I40A 1Z57A 3C0IA 4K11A 3FC2A 5CNNA 4U44A 3HX4A 3GVUA 4YTHA 4HGEA 5E1SA 4RIWB 2P2HA 4BCJA 3QZFA 3PPJA 1PMUA 3W2RA 4L9IA 4LUEA 2C6DA 3QD0A 5LJJA 4NW6A 5EYMA 5I9ZA 2CKPA 3FMNA 3O8TA 1XBAA 3T3UA 1H0VA 4GG7A 2X2LA 4QYGA 2NO3A 2WTCA 1KE6A 4MNEA 3A60A 2R7IA 4BHZA 5CEMA 1YXSA 4O7NA 4GUEA 3DV3A 4RSSA 4UMTA 5IEVA 4TT7A 5C8KA 4EOJA 3U6JA 5GIOE 4XLIA 4KIOA 4MTAA 3I4BA 4O0SA 1ZMWA 3ZFXA 4HYUA 3RK5A 3LQ8A 3KU2A 5H8EA 3HMPA 3OUNB 1E1VA 3QLFA 4HGLA 4IACA 3QRKA 2FO0A 3SXSA 3FWQA 4XP2A 4NIFB 4XOYA 1ZWSA 4FKLA 3D0EA 2Q0BA 2PUIA 2IWIA 2PPQA 3QZHA 3RZFA 3VBTA 2HELA 3AD6A 3NUSA 1GZOA 3ERKA 4HCUA 3NLBA 2VTJA 4F9WA 2O63A 5E90A 4BDHA 4E5BA 2NRYA 2GHLA 1YHVA 1TQPA 3DA6A 4L52A 2QLUA 3QYZA 5AM7A 3BHVA 4QNAA 5K0KA 3KF4A 3V6RA 5IPJA 5DLSA 5IUIA 3HA6A 5CSWA 2ITYA 2R9SA 2UVXA 1UNGA 4ZAUA 3HP2A 3U8WA 4QNYA 4YHFA 2QR7A 4O7TA 3QKLA 4RIXB 3QFVA 1CDKA 4GIIA 5C4KA 3ORKA 4OAVB 3U51A 2VGOA 3FZ1A 3QHRA 4FICA 4RFZA 3TACA 1KE7A 3DGKA 1K3AA 1L8TA 4KKGA 3CCNA 2C69A 5KX8A 3CEKA 4Y83A 2VU3A 2W1EA 3ZCLA 1PHKA 4YPDA 2JD5A 4FIGA 2XK4A 2JKQA 4FT5A 1NW1A 3MH2A 4QQCA 4FL1A 5DE2A 1MQ4A 3NVKI 3IONA 4GT4A 5DOSA 2CKOA 3IGGA 4F9CA 2XNPA 4IM2A 3R83A 4C4EA 5C9CA 2FVDA 3SKCA 4RWJA 3IKAA 3R30A 5CEOA 2I0EA 5HBEA 3PE2A 2W1CA 5DA3A 3OW3A 3ZUVA 2E9OA 5J9YA 2H34A 3MTLA 4FGBA 3QTQA 4MXAA 1H07A 2JIUA 3QL8A 3V6SA 3DJ6A 1OKYA 3ZHPC 4EORA 3L9PA 4MD7E 2UUEA 3KN6A 2W4KA 4YJTA 5C03A 4DEBA 5JRSA 5LQFA 5CYIA 4AA4A 1IA9A 2WTIA 4RC3A 5ANEA 4D1XA 3R8ZA 2UW3A 3PP0A 2IW8A 3OCGA 1RJBA 2OIQA 3FV8A 4FV4A 5FP6A 3VJOA 2VZ6A 3QAME 4DAWA 4FIHA 4WBBB 5K4JA 2ITNA 4Y5QA 5J95A 5C8MA 5A14A 2I1MA 4OTWA 5LOHA 2ITTA 2C5YA 4ITHA 4I23A 3NS9A 2KTYA 4M3QA 4NM0A 4O1PA 4C4FA 1KUTA 5TT7A 1GAGA 4TW9A 3VULA 4XHKB 3BV2A 2YCFA 4F63A 5I9XA 4NEUA 2B4SB 4O7RA 4I20A 1Q4LA 3Q6UA 4K9YA 3CR0A 1OIYA 2WTDA 1W8CA 3N9XA 5JN2A 2BROA 1YQJA 2VO7A 4YURA 5HNBA 3ORZA 5EW3A 3GQIA 3OWPA 3POOA 4QMQA 2HXLA 5JQ5A 2XM9A 4OTHA 4XG8A 1JLUE 4ARKA 3QCQA 2W5AA 4QT1A 1LEZA 3R1QA 1H28A 3A8XA 4AP7A 4G5JA 4BRXA 3UZTA 4L3PA 3UOLA 3V51A 3KXXA 3NW6A 5FUTA 3D4QA 3D5WA 2HW7A 4FV2A 3H9FA 2VWIA 4OLIA 4MH7A 3II5A 3NYNA 3DKGA 3IS5A 2EVAA 3OXTA 1DS5A 4U5JA 4BCIA 3HV5A 3S2PA 1CKJA 2UZWE 3QD2B 3L1SA 4IZ5A 3OD6X 4R1YA 4RPVA 5BYYA 1Q99A 4CLJA 3FZTA 2W1HA 4C61A 1Q61A 2C30A 3WI6A 1UV5A 4W9WA 4ALUA 4AUAA 2C0IA 4I0RA 4BTFA 4CTBA 1LEWA 3E7OA 4NM7A 3QXOA 2IW9A 2BHEA 3BLRA 4QO9A 1AD5A 1XH6A 2WQNA 3ZRKA 3D14A 4W4WA 2QU6A 4YNOA 3EN6A 1XBCA 2OZOA 3BCEA 2OXDA 5JEBA 3SW4A 3DAEA 3G2FA 2ERKA 3FQEA 3UNJA 4D2RA 3ROCA 4KIPA 4HPTE 2UZLA 4IDTA 4O22A 4KRDA 1Q8WA 4RWIA 4TYIA 1FOTA 4IAKA 4CFXA 5EW8A 4NL0A 2YHVA 4L46A 4MK0A 4CMOA 4UMRA 4PY1A 3DJ5A 4CEGA 3PIXA 5CI6A 4YJUA 3FMDA 1KV2A 3HA8A 4N6YA 3I0QA 4G2FA 1YWNA 4WUAA 3GGFA 3DZQA 3FZOA 4C2WA 4E4LA 2J51A 2UW7A 4Q5HA 4BL1A 3QQFA 1OL5A 1XJDA 3GT8A 4KBAA 2R3IA 2IJMA 4E20A 4CSVA 3R9NA 4F09A 3CTQA 4U80A 4FEUA 4D4RA 4X21A 3L9MA 4QMWA 5DT4A 5CU6A 5M4UA 3LJ2A 3RHXA 4ZLOA 1O6KA 1Q8UA 3VF9A 1J7LA 1OPKA 2PMOX 3SHEA 5E1EA 4M14A 4KKHA 4WOVA 2YIXA 2WO6A 4M0ZA 2VTNA 4I22A 5JFSA 4CFUA 4IHPA 3E7VA 5M09A 3ZLXA 2XEYA 4FKTA 4PL3A 4UZDA 3M1SA 2IO6A 4IVBA 3VC4A 2JKOA 3MB7A 2QOIA 2JAVA 2G01A 2P55A 1URCA 1ZYJA 2Z7QA 5FTQA 1SNXA 2Z7LA 4V0GB 1KOAA 1PYEA 3VNTA 2YCQA 3PJ1A 2J90A 3NUNA 4MQ1A 5KKRC 3GQLA 3CQEA 3FDNA 3BU6A 3NMUF 1E1XA 2OZAA 3SLSA 2YAKA 5CY3A 2HZNA 4O2PA 1WBPA 2NP8A 3PYYA 2EB3A 4W8EA 4CNHA 5AV3A 4CFMA 2XS0A 3DY7A 5HEZA 2W0JA 4S34A 2GQSA 2H8HA 3UC3A 2XRWA 1H24A 4WNOA 4IE9A 1WBTA 3HMIA 5GNKA 4ASEA 3CY3A 4QYFA 3SA0A 2H9VA 3KULA 3W2SA 4OW8A 5C01A 4CV9A 3LCSA 3DKFA 5KHXA 5HVJA 3OVVA 1CTPE 1JSTA 1WBVA 1H8FA 2VO3A 3ENMA 3Q9ZA 1ZZLA 4O0VA 4U42A 3LXKA 5D1JA 5BVOA 1G3NA 4EOPA 2X8IA 3FYJX 5BPYA 1PYXA 4NCTA 2GU8A 4GW8A 4Z55A 5LVNA 3ID6C 1OIRA 2ETMA 4DTAA 2AUHA 2XK6A 1H26A 4RVKA 3MYGA 5CASA 3OWLA 3DOGA 2WTKC 3UTOA 4Y72A 4BCGA 4MHAA 3KMUA 3MY1A 4U8ZA 3KK8A 4Y85A 2XJ2A 4D1ZA 4M69B 5FQDC 4C3FA 5GJGA 4WSYA 3A62A 3KC3A 2GCDA 3ZSGA 4XEYA 3C4ZA 3OY1A 3LFBA 4O86A 4O7ZA 3G90X 3IO7A 2VX0A 4JBOA 5E8WA 2CMWA 4X3FA 1NVQA 3TNPC 4GU9A 4OTPA 1Z5MA 3MSSA 2YM5A 3C13A 5G6VA 5KZ0A 2B52A 4C3PA 2C6OA 5EM6A 4I0TA 4FL3A 3BYMA 2ITZA 2VTRA 2VTOA 2B54A 2HOGA 1XR1A 2Y9QA 5DEWA 5E8VA 1A48A 4DFBA 3EFJA 2FSTX 4YZBA 4CYJA 4IVDA 3HKOA 4JR3A 4QQTA 4FNWA 3RAHA 3JY0A 4DH8A 4D2TA 4ZXTA 1PXKA 2CCHA 3V5QA 1E9HA 3LE6A 2IPXA 3A7JA 3K5UA 5EW9A 2BHHA 5FRIA 4ANSA 4MNFA 3ZM4A 3IW7A 4E1ZA 1MRUA 4PRJA 5BQ0A 3QXPA 4YZ9A 2R3HA 1Q3DA 2G2FA 2UZBA 4YC6A 1XH9A 1ZYCA 2EUFB 3DXPA 3G5DA 3FAAA 3ODZX 4OT6A 2WAJA 4YJSA 5J5SA 3ATTA 2XA4A 4GT5A 4G16A 1Q97A 3RMFA 4ACHA 4C57A 3W33A 4KBCA 4XCUA 2C5OA 2RGPA 4Y46A 5IMEA 5AP1A 3HMNA 3RTPA 1OIUA 4XG6A 1R1WA 3MDYA 4QMMA 5AV4A 4LV5A 5CVGA 1CKPA 2PHKA 4I92A 1OL2A 2XNOA 4H1MA 5EKNA 1NT2A 5E8SA 3SOAA 1UVRA 3V8WA 4HVIA 3GU7A 5FTOA 3UIBA 2ZVAA 2BRBA 5DRBA 2DWBA 5HTBA 1FGIA 2REIA 2W1FA 4EK6A 2GSFA 2CLQA 5CI7A 3RKBA 2YISA 1IR3A 3REPA 5CEPA 2YERA 1OUKA 4I1ZA 4AX8A 5EHYA 1M7QA 2R3JA 3FY0A 3PJ8A 3WIGA 1NVSA 4CXAA 2X0GA 3IW5A 3SX9A 1GNGA 1ZOHA 2XNGA 4IWDA 2BIYA 3JVRA 5F95A 3TNQB 5BUIA 3PSCA 1PXPA 3WOWA 2VTMA 4XYFA 2PVFA 3VQHA 4J7BA 4FI1A 4G5PA 4E6CA 5IH5A 2GHGA 4QMLA 3R2BA 4FSNA 4WT6A 3OTVA 4K33A 3HZTA 2G15A 4FZ7A 3QTRA 1XH7A 2ZM4A 4JQ8A 4CG8A 1Q41A 2QKWB 3D94A 3FQHA 3Q4UA 3EQPA 3PXRA 4CFNA 2JKKA 5HESA 3QKKA 3FL4A 4NM3A 5EDRA 4QMVA 4CYIA 3S4QA 2C4GA 2XIZA 4E6QA 3A7IA 4YLLA 4YP8A 2PZ5A 4N57A 5EI8A 2RL5A 4ERWA 1ZYLA 2RKUA 5AP2A 3QC4A 2QOOA 2IVSA 2VUWA 5HLNA 4JS8A 4Q9SA 3KXZA 4FL2A 3Q4ZA 2GDOA 1J7UA 1DAYA 2HZIA 5DGZA 5IF1A 5H8BA 5TO8A 1H00A 4FEQA 3BBWA 3RM7A 1IA8A 4IAAA 4DFYA 5M4FA 2BRGA 2C1AA 2PVKA 2O3PA 5AP3A 3E63A 1FPUA 3ULIA 3E3PA 4U40A 2W17A 2J7TA 3OG7A 5FEDA 2OFVA 4BDIA 2QOKA 4D58A 3LFAA 3EMGA 4IX4A 4U81A 5AA8A 2CGWA 1YDRE 4DH1A 2BPMA 4FSYA 3HAMA 4CGAA 4XV1A 3GI3A 3ZRMA 4ZSAA 2WD1A 2VWWA 5AP4A 3F3UA 3Q3BA 4NUSA 4DINA 5K5NA 5E4HA 5AUZA 5CEKA 2XKEA 4LL5A 5A4EA 4KB8A 3LFCA 3RI1A 4EONA 2F49A 2X2KA 3EL8A 3ORMA 4PMPA 4IVCA 4FZFB 3B2WA 5FDPA 5IH4A 3PY0A 3R21A 3E5AA 1L3RE 3AC1A 5J79A 4EKLA 3N4UA 4S2ZA 4JT3A 4FG9A 3BHHA 1GY3A 4KD1A 4GUBA 4D1SA 1R3CA 3BLHA 3CKXA 3L8SA 3PY3A 4FIIA 4FV3A 4IDVA 5TR6A 2JIIA 3VWAA 4FTMA 5AUVA 3OWJA 4O7VA 3DS6A 4FSZA 2A0CX 3SQQA 5EK7A 4FTTA 4DFLA 1JNKA 3GU5A 2X4ZA 3DPKA 3A7HA 3ORIA 4UYAA 5HO6A 4KIQA 1ZYDA 4EH6A 4IXPA 3VS4A 4BDCA 1SVEA 4KS7A 3Q2JA 4TKSA 3MFTA 3ZFMA 3AC5A 1NVRA 1KV1A 4U7ZA 2CDZA 3AT2A 3FXXA 3DNEA 3RJCA 3R7VA 4MBLA 4O96A 3BU3A 4I5HA 4LRKA 4O0UA 3VUDA 3RGFA 2C6LA 3F2AA 2RSVA 3HV3A 4FV8A 4NFNA 2WMTA 3QCSA 4LM5A 1JSVA 1SNUA 3VS6A 1B39A 5KBQA 2R5TA 3W2OA 5HOAA 3GB2A 1G8SA 2VTAA 3U4WA 4DF3A 2PK9A 1ATPE 4PX6A 4I4EA 4CQGA 2BTSA 1WVYA 4IWQA 2YLFA 4BWKA 4ZLZA 4CRLA 1HOWA 2ETRA 4IAIA 3ZO2A 3D5VA 4MQ2A 1WBSA 4QPSA 2IVUA 3V5TA 4IAZA 4ANBA 3WILA 4BI0A 2R2PA 3V5PA 3CJGA 4LG4A 2C1BA 1UU3A 3K3IA 5M08A 3C51A 4RC4A 5HBJA 4BIBA 2JDSA 2PE2A 3EN5A 4AGDA 4ORKA 4BR3A 4FC0A 4PMMA 4YO4A 2CPKE 2HYYA 4M8TA 3FQSA 5AUYA 3A4OX 4EJ7A 1OI9A 3H9OA 3R7GA 4JDHA 4DTKA 1H27A 4G6NA 3SXFA 4NKAA 2PE0A 3PG3A 4L8MA 3CJFA 5CEIA 3C4EA 2IZRA 4LGGA 3FEGA 2SRCA 2XKFA 3QRIA 3EKNA 4Q5EA 2I0VA 3ZLWA 4D2SA 4KINA 4BTJA 3MVJA 3RPYA 4AGWA 2I0HA 3MH0A 3Q5ZA 4U45A 3IDPA 4W4YA 1R0PA 4FTKA 5F20A 5AV0A 2OIDA 5BMMA 3UG1A 1XWSA 3KN5A 3OP5A 4IJPA 4AOTA 5AX3A 3WF8A 5JT2A 2YM7A 5J1VA 5ICPA 4RVMA 1WMKA 3BRBA 4M13A 4ITJA 3OOGA 3OHTA 3WYYA 3ORTA 4AOJA 4AZSA 3V3VA 5M4CA 4JBVA 4B99A 4U3ZA 1OIQA 3Q4CA 4DGOA 3ULZA 4GG5A 3R01A 2YN8A 3RAIA 3LQ3A 1BI7A 3R8UA 2C68A 5B2LA 4IQ6A 5GJFA 5L8KA 3EOCA 2HY81 3UMWA 1IASA 4F1OA 5LMBA 3UZRA 4BY9E 4K77A 2UW4A 3BHTA 1SZMA 4GK4A 5A4TA 5L6OA 4EQMA 5EHLA 4X2FA 4G9CA 4QQ5A 3R7OA 3DFCB 4XV2A 5HE1A 1VEBA 2UV2A 4Y5HA 4M67A 5AFVA 4EYMA 2UVYA 4UWYA 4NYEA 3EZVA 3PG1A 3W8QA 3SW7A 3ZFYA 1PXNA 1U5RA 3TDWA 3LMHA 3FHIA 4FMQA 3FMMA 5BYZA 2Z2WA 5IA1A 3GC9A 5AR3A 5KUPA 3W1FA 1ZMVA 4O6EA 3RM6A 3CPBA 5A9UA 3G9LX 3V5WA 4B0GA 4USEA 3S00A 4ONAA 5CNOA 3KA0A 3KRRA 4M68A 2OSCA 3S1HA 2P0CA 4USFA 5JSMA 3EFLA 4PL5A 2JEDA 5DBXA 1UKIA 4CT1A 5L4QA 4C4HA 5M57A 3FLQA 5EYKA 2W9ZB 4RX7A 2P33A 2WMQA 2ITWA 2Y4IB 3FBVA 4ZP5A 4ENXA 4WG4A 5C4LA 1S9IA 4ACMA 3UIUA 3NUUA 3WF6A 2JITA 2OK1A 3PJ3A 2Z7SA 3LLTA 4MEDA 4BDBA 5E9EA 4EBVA 3O2MA 4WIHA 4E5WA 3RALA 4XJ0A 3V01A 1GIJA 1H1WA 1X8BA 4U41A 2XH5A 5ETFA 2QO2A 4APCA 1EH4A 2FSLX 1YDTE 4A7CA 4ZMEA 1ZRZA 2WELA 4GMYA 4HYHA 3RVGA 3UYTA 4NWMA 4ZJVA 3DBEA 5BUEA 2R4BA 4AU8A 4XRJA 1QMZA 3QF9A 4I6BA 4MAOA 4UN0C 4G3CA 4BTMA 2DUVA 2CGUA 2J2IB 2V0DA 3D5XA 3GFEA 3PVGA 3MJ1A 3O50A 4FTJA 3V8SA 3VUHA 2QR8A 2XF0A 1W98A 2X8DA 4WBOA 4O91A 3TTIA 4BYIA 2H96A 4EZ7A 4GKIA 3MJ2A 4ZSGA 4O7YA 4NT4A 2A19B 4JLCA 4ZS0A 3VBXA 4U3YA 5AP5A 4RIOA 4EJNA 3MVLA 5FXQA 4I93A 1QPDA 3DXQA 4ZTSA 4KAOA 2OG8A 4XMOA 3I60A 1FQ1B 1IEPA 2BFYA 2PVLA 3BX5A 4QP9A 4E8AA 5IQBA 1MUOA 5CT0A 3PTGA 5HG7A 5M4IA 1UU8A 2QHMA 2QOQA 4EK3A 3P79A 3D9VA 4JDJA 3IW6A 4EOIA 4FVPA 4WO5A 2ZYBA 4G17A 4BTKA 3MPAA 2BKKA 4GFMA 2XMYA 4O0RA 3B8RA 3G9NA 5CXZA 3I5NA 3U6HA 3WZUA 5FBNC 1U54A 5KBRA 3T8OA 2B0QA 1P4FA 3HV6A 4NIFA 2ERZE 3BWJA 1WBNA 4F08A 3D2IA 5ETIA 3ORNA 1V1KA 3KB7A 4M97A 4R3CA 4RZVA 4EOLA 1H01A 2XNMA 1ZYSA 3QGYA 5DR2A 3EQDA 4K6ZA 4EH7A 3NAYA 4DE4A 4HOKA 3F3WA 1OKZA 2FA2A 3NEWA 4A06A 2UZTA 2PU8A 3ET7A 3CGOA 5BVFA 2PL0A 1DI8A 3PZEA 4QD6A 4UV0A 3AC8A 4X3JA 5EOBA 3UYSA 1OECA 3NUYA 3U9NA 4UXQA 5DHJA 2JDOA 5D12A 2JFMA 3DU8A 3UOHA 2WMWA 3O7LB 3UDBA 3PVUA 4R8QA 5AR4A 3AXWA 2UW6A 4HPUE 4GRBA 1Q8TA 2WTJA 3Q9XA 4IJ9A 4BGQA 4WSQA 4FKIA 5KMIA 3RK7A 3IQ7A 2CHLA 3PWYA 4AT4A 1F0QA 3S95A 4BF2A 3UJGA 5AAGA 4FKGA 3MY5A 5E8TA 4TNDA 1I09A 3OMVA 4ITIA 5L6WL 4R5SA 4YHTA 3RP9A 5J8IA 3KK9A 4IAYA 5FXSA 3A99A 3B8QA 4BCKA 1YI3A 4E6DA 5AR8A 3GCSA 4M69A 4F0GA 4DG0E 5BVKA 2J0LA 3FLZA 4FVRA 5HCYA 3UQCA 2W99B 4L3LA 2W5HA 3OWKA 3HECA 3ZO4A 3PXKA 1OPLA 2EU9A 2Y6OA 4YSMA 3BZ3A 1OITA 2CCIA 1NA7A 3UE4A 4DITA 4HJOA 5CANA 4X2GA 3BPRA 2OKRA 2WIPA 2XK3A 5EI2A 2IVVA 5FGKA 5ACKA 4AE6A 2A2AA 3CGFA 4QOXA 4LV8A 4QMSA 3OZ6A 3KFAA 3C4XA 3NNWA 3VW6A 4A4XA 5TE0A 4KUJA 4F7NA 5KMKA 3D83A 3SG9A 5IEXA 4NJDA 3TEIA 2HZ4A 5IMXA 4G9RA 1PXMA 4YC3A 3KXHA 2RG6A 1SVGA 5AR5A 3THBA 5LVPA 4F6WA 4F6SA 5J87A 4CFFA 4EH2A 1WAKA 4LI5A 3E88A 4GJ2A 4IEBA 2Y4IC 3PXQA 2W1ZA 3GENA 4LQMA 5HE0A 3VUKA 2W06A 2PMIA 3QQJA 1GIIA 4ZEGA 4BCNA 3EKKA 1M7NA 3MGYA 3QRTA 3QUPA 2O5KA 4PQNA 2I0YA 1KOBA 3FL5A 1OZ1A 5LMAA 3ZONA 5ANKA 1H25A 1K2PA 3ITZA 5CF8A 4TYHB 3N4VA 2YDIA 1SVHA 5L2TA 3Q52A 4PTGA 4F1TA 1TVOA 3F7ZA 3PXFA 2W4JA 4PWNA 1JKKA 4OTQA 4ZY6A 2WTWA 3HNGA 4WD5A 5E91A 4BKZA 5HD4A 2ZOQA 3CTJA 3LOKA 3MH1A 4O21A 4A4LA 4AXAA 4BB4A 4BBMA 5ANDA 2QLQA 2YIRA 3G0EA 3FMJA 4AQCA 4DFUA 5GINE 2Z7RA 4QP8A 2VAGA 4XNEA 5FWKK 3CIKA 4E4NA 2QD9A 4GEOA 4RQKA 3VS2A 5D9HA 4PP7A 4BKJA 1U59A 4EYJA 3U6IA 2JDRA 1U4DA 3AC4A 3KGAA 3UODA 3BGQA 2VGPA 3QD3A 4IFGA 4P2KA 4XP3A 4RIYA 1O9UA 3R7IA 3ZBFA 1OMWA 4R3PA 3BU5A 3ZUTA 4PV0A 5E8YA 4FR4A 5CU3A 5A4LA 3GCPA 3UGCA 4G1WA 4I5CA 3RPSA 3ZO1A 4PPBA 4ZY4A 4RG0A 3T3VA 4DGLC 5EDQA 3NCZA 3F7WA 2YDJA 4IB1A 3SXRA 3VS1A 5HTCA 5ACBC 3PDTA 3OBJA 4O84A 4IZ7A 4BZDA 3JYAA 5D10A 5ANIA 3I1AA 4L7SA 3GCVA 4L45A 4R5YA 3GOKA 3R6XA 4BKYA 4H3QA 3MESA 4F65A 3G6GA 4X3FC 5CAPA 3UC4A 4EK8A 2OJJA 3R02A 4FK3A 3TUDA 4PMSA 4RA5A 4TWOA 3FZRA 5E8UA 3DK7A 2B9JA 3PFQA 4QMPA 2VWUA 3KMWA 2J5FA 4R7BA 3ACJA 4EZ5A 1HCKA 2XJ0A 3NNUA 4MD8E 5AADA 2YLEA 5BYLA 3VBQA 4KNBA 2WTVA 4FVQA 2BAQA 4WRSA 3WZEA 3TJCA 3R71A 4OTDA 4HVGA 2W5BA 5HIBA 4LMNA 4V04A 2JAMA 3A61A 5LARA 3SRVA 2FH9A 1FMOE 4N6ZA 4O82A 1T45A 2GS7A 4GH2A 5GJDA 3ZS5A 3EQHA 4G6LA 5ETCA 1O6LA 5JRQA 4DA5A 4S31A 4OGRA 4LUDA 3QX4A 4QMUA 1A9UA 4BHNA 4AG8A 4IZAA 4FBXA 1PMEA 4MD9E 4JG7A 3TNWA 3E92A 2WU6A 4FSUA 4J52A 1PMNA 4HGTA 4JOAA 4OBOA 2QHNA 4EH4A 3DJ7A 5K4IA 1IAJA 4TWPA 5HLPA 1LPUA 4C0TA 3CSVA 3NVMB 1JOWB 4JX3A 3DAJA 4A07A 2YEXA 3NW5A 2BALA 2J0IA 3U4UA 2C5VA 3TIYA 1J91A 2YIWA 3QUDA 4EUTA 3QRUA 4E7WA 4USDA 4LRJA 4U6RA 4EQUA 5DN3A 4CLIA 4KKEA 5JFWA 4JQEA 1U46A 3EIDA 3VHEA 3WARA 5AAEA 5CEQA 1WBWA 5AUXA 1WFCA 2J4ZA 5H9BA 2I7QA 1YXTA 5CU0A 4K0YA 4DBNA 1P2AA 3QHWA 3ZDIA 4NKSA 3EYGA 3QQHA 4N70A 1UNLA 4M66A 2YITA 1W0XC 3RPVA 2VO6A 3C4FA 3RAWA 2G2HA 2UVZA 4JAJA 3ZDUA 3ZXTA 3RNYA 4YUQA 5FM3A 4FX3A 4KBKA 4TYEA 4BVUA 2VTIA 5AUTA 4A4OA 2R3GA 2C5XA 4O1OA 4NSTA 1JKTA 2ONLA 3PP1A 3UPXA 5ITAA 2WB8A 4EOKA 5HNIX 3QZIA 1YXUA 4TXCA 1GZNA 1YI4A 3BELA 4YJRA 3LHJA 2G1TA 3F9NA 4M15A 5C8NA 5BVWA 5HTIA 4MBJA 2WMVA 2ZV9A 2FYSA 3BKBA 3OXZA 2BZJA 2P3GX 3E87A 4YBJA 5FEQA 2OH4A 4EH9A 5KMJA 5HX6A 2X7FA 5CENA 5IQHA 5GIPE 3PA4A 4ASDA 4FODA 3IW4A 3PRFA 5IA0A 4OTRA 3BGPA 3Q9YA 1YOJA 1YW2A 4L7FA 4OBPA 4XRLA 1Y57A 2F2CB 4GSBA 3ZZWA 4BIDA 2F7ZE 2YZAA 4FTUA 4QP3A 5I9WA 2B9IA 5A46A 2RFSA 5CT7A 5HI2A 5GHVA 1MRYA 5DVRA 3QTUA 2XIYA 4MXXA 4RJ7A 4FEVA 3QWKA 4YJQA 2RFDA 5CSHA 4F9BA 2UZDA 4QMOA 2OBJA 5DR6A 1M2RA 4RZWA 1WCCA 5C27A 3NCGA 3SD0A 5J7HA 4J53A 4X2NA 4DC2A 4U97A 1QL6A 1B6CB 3QQKA 5E92A 3TXOA 3VBYA 5BUJA 3NUXA 4XLVA 5TOZA 5JGAA 3OCBA 2G9XA 4BDJA 5EYDA 4YNEA 1SMHA 3FJQE 2UZNA 2W7XA 2GNIA 4AGUA 4ZIMA 3KRJA 5IUHA 1R39A 3EB0A 4D4SA 5GZ8A 4G3EA 4FKSA 4XG9A 1H1SA 2X2MA 2Y4PA 3I0OA 3IECA 4IC7A 2QURA 2V62A 4GVJA 4R3RA 4AT3A 2W96B 4YJVA 4QPMA 4RBLA 4UEUA 3NWWA 4H58A 4O38A 4F9YA 4V01A 3BYSA 5IQIA 4K2RA 5J9ZA 3WF5A 5LWMA 2BVAA 2GNJA 3CD3A 4TRLA 4CCUA 2IZTA 3GC8A 4FT7A 4UWBA 5T6KA 3ZYAA 4FNXA 4B9DA 5AR7A 1XH8A 5EM7A 5IISA 3KREA 2V7OA 2W1DA 3HGKA 5DI1A 3QA0A 5FLFA 3RZBA 2IZUA 4ZSJA 3I6UA 3D15A 4A9SA 2GPHA 4O27B 4D2VA 1ND4A 4A9UA 4APPA 4WNMA 2X7GA 5BVDA 5AUUA 1JAMA 1OKWA 4IBMA 3TKIA 2OXXA 4D5HA 3ZXZA 4ASXA 4RJ6A 3FMLA 4MYGA 2XNNA 3PA3A 3A2CA 5KMOA 1Q8ZA 3CLYA 3PZHA 4QTDA 1UNHA 2VNWA 1SYKA 3P23A 3O8UA 4PDOA 4R1VA 2QVSE 3IPHA 4H39A 2PULA 4NU1A 3P1AA 3UQGA 1V0BA 3QZGA 4FNYA 3PXZA 3ORLA 3EN4A 3P7BA 5H2UA 4XV9A 3LM5A 4TYJA 1APME 4NH1A 1JKSA 4CRSA 2GS6A 4ENYA 1JPAA 2QI8A 4BC6A 4KA3A 1STCE 2W1GA 1NY3A 2Z8CA 3MA3A 2W4OA 4C02A 2ZDTA 3VIDA 4H3BA 3I6WA 5CTPA 4M84A 3H4JA 2E9PA 3VRZA 4FF8A 4IX3A 4LMUA 3JXWA 3IDCA 4IVAA 1UU7A 3E3BX 3TN8A 3FLWA 4QP6A 5AA9A 3PIYA 5AJQA 1ZY4A 1NXKA 2PE1A 3GNIB 4BIEA 5IUGA 5M56A 5M44A 1Y6AA 3QCYA 4OUCA 5L2IA 2Z60A 3IK3A 2HK5A 3NPCA 3MIAA 5T3QA 4D4VA 2C3KA 1FVRA 3ZUUA 4L53A 3H0YA 3FUPA 3I7CA 4P90A 4PMTA 2XB7A 3GU8A 2C3LA 3L8XA 4PTEA 3EYHA 3CPCA 4GYGA 3OY3A 5DT3A 3DQXA 4UB7A 3SAYA 5JGBA 2UW0A 3W2PA 4EWHA 4BI1A 2WZJA 3SRVB 3DKOA 4LOPA 3Q04A 2J0KA 3OFMA 4XOZA 3VQUA 4DEDA 1RE8A 3E8CA 1TKIA 4XG3A 2XIXA 4GT3A 4FKPA 5A4CA 3EZRA 3F5XA 3UBDA 4CV8A 4QMYA 4FIJA 3HLLA 4DGMA 3KCKA 4MKCA 4FUXA 4HVHA 4OR5A 2CNUA 3DXNA 4L44A 3F2RA 5A4QA 5A54A 3Q4TA 4MWIA 2WMSA 3LCKA 5BX0A 5F4NA 3KXNA 3DKCA 3HYHA 4DT9A 3P9JA 2O0UA 3HVCA 4D0WA 5IDNA 3UPZA 4IX6A 4TYHA 4FEXA 2IN6A 3W2CA 4BBEA 5HGIA 2A4LA 3WZDA 5AP7A 3O71A 4WNPA 4H05A 4KABA 1PXIA 3EQCA 4RC2A 2AC3A 3LCOA 3TV6A 1M2QA 4WRGA 2J5EA 3QUEA 2VD5A 1W83A 3F3VA 4P7EA 5EM5A 4OTGA 3OCSA 4UBAA 3FPQA 1JVPP 4UXLA 2XEZA 3RINA 1XH5A 1Y8YA 3BEGA 4I6QA 5BMSA 4FUYA 3NW7A 1QPEA 3HMMA 2CKEA 1CM8A 5IH6A 3F61A 4FG7A 4I94A 3DBFA 4QMZA 4RFMA 4BGGA 4YJOA 2A1AB 4UMUA 4AZVA 4RJ8A 2NRUA 1YXVA 4YO6A 4O7LA 4RWKA 4ZZNA 3EQIA 2HY0A 5H8GA 5K9IA 2C5NA 4P5ZA 2PMLX 4EOOA 2HIWA 1U5QA 4K1BA 4PDYA 4FZDB 4IFCA 3QWJA 4E4MA 4BDEA 4GVAA 2DS1A 4XBUA 3JS2A 1GJOA 3AMBA 5G1XA 4O2ZA 4FGRA 1UWJA 3ANQA 1ZOEA 3DK6A 4Q9ZA 2YWVA 2C3IB 1JBPE 4YZDA 5B2KA 5AWMA 4DEAA 4J1RA 4IM0A 3FC1X 2BTRA 3ZSHA 4WA9A 3FYKX 3F5PA 3F6XA 5CLPA 5CWZA 4CT2A 3M2WA 3TI1A 5HVYA 3CD8A 1YI6A 4LOOA 3ZLYA 5LVOA 1BUHA 4EH5A 2XCHA 1H1RA 2YABA 1DM2A 1YWRA 3KL8A 3F82A 4IIRA 4AOIA 3I81A 3TZMA 5HORA 5LMKC 1FBNA 3PLSA 3FKOA 1P5EA 2JGZA 3LFEA 2VV9A 4HCVA 2JDTA 4OAUC 4DCAA 1G8AA 2YCRA 4CMTA 3EN9A 3ZEWA 2XK9A 4PUZA 4YJPA 1XKKA 2C6KA 5TKDA 2R3QA 2O2UA 3PJ2A 5HHWA 3PY1A 4BZOA 4ZJIA 4DLJA 1YHSA 1ZY5A 2C6EA 4IWOA 5L2QA 2LGCA 3BLQA 1KE5A 2PY3A 1LR4A 4C35A 5EFQA 3ACKA 5FG8A 4D5KA 4AZFA 3ETAA 2Q83A 1PXJA 5K3YA 3HDNA 2GNLA 3C7QA 5KMLA 3OOMA 1PY5A 2F2UA 3KRXA 4NTTA 5JZNA 3RWQA 5B7VA 2QONA 4IMYA 5M06A 3L8VA 4HW7A 3H3CA 3TZ7A 3JPVA 4ACGA 3R00A 5FP5A 4QTBA 2YA9A 4LRMA 4O0XA 4EL9A 3R73A 4IB3A 5A6NA 4DBXA 2HWPA 3E64A 3U54A 4DH7A 4I3ZA 3NYVA 3RPRA 2NPQA 1GIHA 4TL0A 3OUKA 3VAPA 3F69A 3GUBA 4Z16A 2IZSA 4K8AA 4YZCA 4HVDA 4TN6A 3PVBA 4IH8A 2JDVA 5E7RA 1ERKA 4W4VA 2VWZA 4GFGA 5L8LA 5LCJA 3G33A 5FD2A 1J7IA 2CLXA 4HYSA 4ANNA 3UP7A 5DH3A 3F3ZA 4I21A 2BRMA 4ZTHA 5DR9A 4ZZOA 2BR1A 3DT1A 1H1QA 3NAXA 5AP6A 4C34A 5HVKA 4JDIA 1PRYA 3MB6A 3VS3A 5AP0A 4IB5A 5FEEA 1URWA 2PZPA 3PPZA 4FYOA 2B1PA 3OT3A 2F7EE 2JBPA 2ITXA 3CS9A 4CZYB 1VYWA 3G51A 5HE2A 1PW2A 4ERKA 3ZC6A 4ZOGA 3CP9A 2R3KA 1A06A 5M07A 4FSQA 3WF9A 2WIHA 3QALE 3SDJA 1M14A 3LFDA 4O0TA 4AT5A 3QCXA 5CAOA 3R8MA 3P7CA 2QCSA 4CFVA 3BGZA 2FSMX 4XG7A 5F1ZA 4DFZE 2C6IA 4Z9LA 4TWNA 4GYIA 5FDXA 3PSDA 2WMXA 5JKGA 3S0OA 3FKLA 4FKRA 4RX9A 4D0XA 3NRMA 3QTZA 2WPAA 2I6LA 4DGNA 4BDFA 5DPVA 2OXYA 4DYMA 3QTXA 1OB3A 2XIRA 3C1XA 5HG5A 1REJA 4AE9A 2F7XE 1OUYA 4YTIA 3LXPA 3LJ0A 4W8DA 5HO8A 4IZYA 2BDWA 4FTCA 5HIDA 1ZAOA 1Q3WA 1U54B 4R7HA 1JWHA 4C36A 3HRFA 4FKJA 3CQWA 3NX8A 3VF8A 2XP2A 4EH8A 3VS5A 5AV2A 2VTLA 4DHFA 5KHWA 4I6HA 4TNBA 4ID7A 2QO9A 4F9AA 3NUAA 3QX2A 4NW5A 4BYJA 4FEWA 1IAHA 5J7BA 3R9HA 5EI6A 3NGAA 3MPMA 4R7IA 4JRNA 3DBQA 4UMQA 4ANLA 2XCKA 3U87A 3C5IA 1UKHA 1REKA 5IA4A 4U9AA 1VR2A 3R28A 4HVSA 4AAAA 1WBOA 4YLJA 4XUFA 5CVHA 2XK8A 1UA2A 5GZAA 4BN1A 5AUWA 2E9VA 3BHYA 4V05A 2VTSA 5HE3A 3R9RA 5J9LA 3RPOA 3KVWA 4HZSA 4FV7A 3FLSA 1RDQE 3H0ZA 3HUBA 3FI3A 3C9WA 3DDQA 4FV0A 1PXLA 4TZRA 4X6RA 1WVXA 3F2NA 4Y95A 4S32A 3QTSA 2QOBA 3IW8A 5ANGA 5KMNA 2GTMA 2PYWA 5CQWA 5I4NA 3GFWA 1VYZA 3QTWA 3UP2A 5JH6A 5T68A 3BBTB 4L6QA 5CX9A 2WTKB 4C2VA 3R7EA 2JFLA 2OO8X 5D41A 3NYXA 3W55A 2WQBA 2J9MA 4FE2A 4MXZA 2OZAB 3KMMA 5CVFA 4F7JA 3G15A 5EYCA 4FTNA 3MPTA 3ZLSA 3Q6WA 4D2WA 5J5TA 2OU7A 1AGWA 3UZPA 5DMZA 4ZMFA 4JNWA 3R7UA 3T9TA 2QO7A 2ZV8A 3FXWA 3CXWA 2J0MB 2Y7JA 2X6DA 4MWHA 3R8VA 3QQLA 3COIA 3HMOA 2R64A 3O0GA 5AX9A 3AC3A 1OGUA 2FSOX 3QU0A 4J71A 4EK5A 2PZIA 4EEVA 2ZM3A 2WMBA 4X7QA 3UNZA 5HCZA 2HAKA 5CU4A 3GOPA 4U43A 1KSWA 4M7IA 5H3QA 4FV1A 3TNIA 5BNJA 2W1IA 3FLNC 4LOQA 4MCVA 3FMHA 3ZOSA 4ZJJA 2PVMA 3UO4A 4CG9A 5CQUA 1FINA 1R0EA 4A9TA 3ROYA 1M2PA 4BICA 4O7WA 1YWVA 1XHAA 3I7BA 5HQ0A 2EXCX 3LMIA 1PKGA 3VBVA 1YXXA 2C6TA 1Y6BA 2JLDA 2QOLA 3E8DA 2W05A 4RJ4A 4W9XA 4XV3A 5GZ9A 2J50A 3TV7A 2GNFA 3OW4A 3C0HA 5EDPA 3JR1A 2RIOA 1M52A 4FKVA 3BYUA 4C38A 2WOUA 1H08A 4FT9A 1JQHA 4TYGA 4WNKA 4XG2A 3RAKA 2FUMA 4CZUA 4EHVA 3TUCA 2X4FA 1TQIA 3HEGA 3BV3A 4YBKA 3VJNA 4AZEA 4QYEA 4FSMA 5IU2A 2X9EA 4RX5A 3PIZA 4FTIA 3MWUA 1OBGA 2GMXA 3SG8A 4F70A 3GC7A 2YJSA 3QD4A 4FKOA 3OEFX 4HZRA 4WG5A 4FNZA 3W16A 2EXEA 4FTAA 4AACA 2F57A 3NIEA 3P4KA 3D5UA 3LXNA 5AIRA 5DWRA 3SC1A 3TL8A 3HP5A 4PPAA 4DEHA 4EHGA 3ALOA 4O83A 3AT3A 4D4YA 2B55A 2CNQA 1W84A 3DQWA 3BYOA 3WE4A 4YHJA 5DIAA 1BKXA 1ZLTA 2UW5A 4GV1A 2B53A 3LFQA 5IQCA 2DQ7X 4ZTQA 1QCFA 2CGXA 4ANMA 3KKVA 3AT4A 4J97A 3FSFA 1OL7A 3NYOA 1OPJA 3UVRA 3SV0A 3P86A 3DNDA 4AW5A 3UQFA 3H9RA 3LVPA 5D7VA 2EB2A 2YJRA 2XZSA 4L01A 3AMAA 3R0TA 3NNXA 2BZIB 2ZB1A 5CZHA 4WHZA 3EQBA 3TV4A 3FHRA 1LUFA 4RLKA 4TWCA 5M53A 4KIKA 3EH9A 3BYVA 2ESMA 2QKRA 3TKUA 4S33A 3W32A 3ZRLA 3LCTA 4RFYA 3GEQA 2R3MA 4RJ5A 3DZOA 4GFOA 3TG1A 3EJ1A 2OF4A 3DDPA 2WHBA 3EQRA 3K3JA 2ZM1A 1J1BA 1DAWA 3QBNA 3KRWA 3BE9A 4G31A 4JI9A 4RVTA 4H36A 5HICA 5C1QB 1BX6A 3GC0A 4EQCA 4RIYB 1KE8A 3RWPA 4QP4A 5I9UA 4EBWA 3L8PA 3NNVA 4LGHA 4O6LA 1OM1A 2GFCA 4J8NA 1UWHA 1W82A 3QLGA 4E93A 1VJYA 4GIHA 3VRYA 5KMMA 3R22A 4F1MA 3FPMA 2LAVA 1SM2A 2R7BA 4DH3A 3SVVA 3LIJA 3FXZA 2YM4A 4ZTNA 3C4WA 5M55A 2PVJA 2OJFE 2QC6A 3LMGA 5K5XA 4QYHA 1BLXA 4CQEA 4G34A 2E2BA 4QP2A 2YIQA 4DFNA 3LFSA 2QQ7A 3LQ5A 1P14A 4NK9A 4O0YA 1UU9A 1Q24A 4P4CA 4TY1A 4J95A 3O8PA 2XNEA 4QP7A 1V0PA 1T46A 2J0JA 2ZV7A 3ZBXA 5BVNA 4X6QC 2BZKB 3AMYA 4DFXE 1JSUA 4C58A 2JKMA 2Q0NA 3EHAA 3Q32A 4JIAA 5AR2A 3VO3A 3OXIA 3E8EA 3WE8A 2C3JA 2YM3A 4QTEA 3FZSA 4D28A 4TPTA 2VN9A 4EK4A 1Q62A 4YGAA 5I5ZA 3ORXA 3VS0A 3BI6A 5EM8A 2QU5A 4I0SA 1MRVA 2KULA 4I24A 4YJNA 5HG9A 3W2QA 1PF8A 3MN3A 2ITOA 3WZJA 2R3RA 3VS7A 3NR9A 3Q96A 4YU2A 5CS6A 5BVEA 5AEPA 3VVHA 5IDPA 4AFJA 2P2IA 2V5QA 2QOFA 3Q60A 3C5UA 3IDBA 5JK3A 5B0XA 2CKQA 4CFWA 4G3GA 4IM3A 2C47A 3KXMA 4OT5A 4D9UA 1GZ8A 4C4JA 2CN8A 2JBOA 2OW3A 4I41A 5CAQA 5JGDA 4PL4A 5AV1A 4KSQA 5HKMA 2PVYA 5KZIA 4C4GA 2OF2A 4EOMA 3LKMA 2PVRA 3UG2A 2A27A 4JG6A 5HG8A 4ZSEA 1FVTA 1YKRA 3FSKA 3VN9A 1YRPA 4DEEA 3CQUA 4IWPA 2WMRA 4RJ3A 4UZHA 5IA5A 4F64A 4E5AX 1J3HA 3OS3A 5HNGA 4ACDA 2F4JA 4JR7A 5HU9A 2PZYA 4CVAA 4P5QA 4RVLA 4CTCA 3JVSA 4MBIA 2YWPA 3MS9A 2B7AA 3CC6A 2YIYA 5I3OA 4ANQA 5IQDA 2OH0E 3P0MA 2HCKA 3R8PA 4AZWA 3D7TA 5ANOA 5IQEA 5L3AA 3O96A 2HWOA 3AGMA 4AN2A 4JL9A 4PF4A 5I0BA 5FTGA 1QPCA 2O8YA 3WZKA 2XNBA 5DFPA 2VWBA 3I79A 4BZNA 3ZO3A 2V7AA 2WMAA 1OL1A 2WQMA 4E4XA 3MFSA 1KE9A 2B9HA 4M0YA 3GCQA 4OBQA 1Y91A 3GBZA 4X3FB 4FTRA 2GTNA 3R9OA 4ACCA 3L9LA 3R7YA 4J8MA 1FGKA 3GP0A 2VX3A 3FE3A 4BGHA 3R9DA 5I3RA 4Z3VA 2B9FA 3KCFA 3NZ0A 2GS2A 4FZAB 2PUNA 2P4IA 2WFYA 4CKRA 2PUPA 3TM0A 2Y8OA 4DG2E 4UY9A 3BQRA 3O7LD 3ANRA 3DTCA 5HU3A 2BILB 5KCVA 3EN7A 3CKWA 3MW1A 3ORPA 4EOQA 4Y73A 4NTSA 3BIZA 3QRJA 2YM6A 3EQFA 3HRBA 4BDAA 1XO2B 5LVMA 2GHMA 3LLAA 4I5PA 2GQGA 5L2SA 3DAKA 2OI4X 4RRVA 2X6EA 3H10A 3EWHA 3VUIA 4AW2A 5L2WA 2WKMA 4EI4A 1H0WA 2JIVA 3KULB 3KQ7A 3POZA 3W10A 3F5GA 2WXVA 4UMPA 3OF0A 4RA4A 5JZJA 2FB8A 2PSQA 2R0UA 3WYXA 5HZNA 4C7TA 2XVDA 4PTCA 3HV4A 4YSJA 1ZOGA 3DK3A 1YVJA 4ZY5A 5A6OA 3BEAA 4L43A 2JC6A 2WQEA 3EFWA 4G3FA 3ZH8A 4FSWA 4AA5A 4D2PA 2IW6A 4BBFA 2XUUA 5CSVA 4X2JA 3FY2A 5EHOA 1BYGA 3GXLA 4J99A 4V0GA 4BWXA 4FOBA 3MA6A 2UZUE 4PP9A 2X1NA 4LFIA 2PZRA 3HAVA 4RWLA 3OTUA 3V04A 4B7TA 4UX9A 2WOTA 4BWPA 2XIKA 3DB6A 5DG5A 5HLWA 3R63A 1H1PA 2CJMA 1GZKA 4L68A 5IQFA 1ZMUA 2RFEA 2PUUA 4L67A 5IA3A 2UW8A 2R3FA 2WEVA 3EL7A 3PWDA 5AM6A 1TQMA 2VO0A 2R3LA 3QKMA 4FIEA 2XYUA 4E26A 4YR8A 3ENHA 4BCOA 5FBOA 1BL6A 4A9RA 4DTBA 5IG1A 3AC2A 1RQQA 1YDSE 4MVFA 3LZBA 1K9AA 4D9TA 3BHUA 4C37A 3PA5A 4FOCA 2XJ1A 3ZU7A 3MFUA 4KWPA 3CY2A 3WF7A 2H6DA 4FZ6A 1FVVA 5E8ZA 5HO7A 2CN5A 1QPJA 3ZSIA 5EG3A
chains in the Genus database with same CATH superfamily
3ZC5A 4BJJB 2XBJA 4IB0A 4JDKA 4F0FA 1H4LA 3A8WA 3HRCA 4FTLA 3TJDA 3IOPA 4R6VA 3WBLA 4B4LA 5CF4A 5L6PA 3HDMA 3W8LA 5IQGA 3RK9A 4QPAA 2VX1A 1IG1A 4GL9A 2WQOA 3Q2MA 4F7LA 4YMJA 1IRKA 1J1CA 5I9YA 3PSBA 2RF9A 3PE1A 4L42A 2XRUA 4GJ3A 3JUHA 5CXHA 3UO6A 2PMNX 3MV5A 2XAOA 4YPSA 4N0SA 1F5QA 4BCQA 3D2KA 2UZOA 4IW0A 2VTPA 5A3XA 1PKDA 2XKCA 3GU4A 4Q2AA 4F6UA 5IA2A 4IADA 4R78A 2OFUA 5DT0A 2OJIA 3B2TA 4ZS4A 2CSNA 3H30A 2YDKA 4PDSA 4CZTA 4YTCA 2OGVA 2OICA 3ALNA 4FKUA 3RBWA 3FI8A 3OROA 3KF7A 3QA8A 4KSPA 4C3RA 4C4IA 1W2FA 3QTIA 4GK2A 4FV6A 4BDDA 3TUBA 3EFKA 4MXOA 3L9NA 2HENA 1ZZ2A 3VUMA 4E6AA 5EQEA 3C4CA 3ZMMA 1P4OA 5JMSA 2ONLC 4II5A 4FG8A 3OEZA 3UOKA 5CSPA 4AFEA 4ZTRA 2BDJA 4O4DA 4NJ3A 4EH3A 3QGWA 1G5SA 2X7OA 4AN3A 4C8BA 3AD4A 1XQZA 4PNKA 2Y6MA 1YOLA 5JFVA 3ZEPA 1BMKA 2BFXA 4AQKA 5I9VA 3O17A 5DYJA 1FMKA 4OTFA 1XBBA 3K5VA 4DEIA 3UMXA 2RG5A 3FLYA 2QG7A 3MFRA 3A7FA 2QOHA 4DGGA 2E9UA 3GU6A 4Y8DA 4YTFA 4WUNA 4D55A 4EHEA 1PJKA 2ITQA 5KE0A 2HW6A 3R1SA 1CKIA 2X9FA 3BQCA 4M12A 2BCJA 1S9JA 4HNFA 1CMKE 2HZ0A 5DEYA 2F9GA 4G6OA 2BAJA 2C0TA 3PPKA 3KXGA 2CNVA 4ALVA 3LAUA 2XYNA 3A7GA 3MH3A 3VUGA 1PXOA 3TKHA 5CAUA 3FMEA 3LFFA 1ZXEA 3NSZA 4DCEA 4FT3A 3F66A 3LW0A 2QNJA 3G6HA 4RT7A 4ANOA 4BCMA 5KO1A 3QQGA 3NIZA 2OJ9A 3P78A 3UIXA 5CAVA 3R1NA 2IVTA 4HNIA 3T9IA 2BDFA 4QMXA 2O64A 1YHWA 5EOLA 2GQRA 5DNRA 3W0SA 2R0IA 4Z7GA 2O65A 3IOKA 3LM0A 4MX9A 3DCVA 3P7AA 1ZARA 4L00A 5LXMA 3MVHA 3ZM9A 4QQJA 5AMNA 4IANA 2VWYA 2UW9A 4ZLYA 1V0OA 4JXFA 3UIMA 4F0IA 3DBDA 3M11A 4W4XA 3OC1A 5HD7A 3VBWA 2HXQA 4AGCA 4CD0A 5M51A 4QRCA 4ZZMA 4C62A 2ITPA 2ACXA 4YZMA 2CGVA 1WZYA 4UYNA 2WGJA 4FRFA 1Q5KA 2ZDUA 3TWJA 2Y0AA 4KRCA 4JX7A 2ZJWA 4XX9A 5DRDA 5F94A 4B8LA 3PRIA 4XG4A 5EH0A 4F99A 5CU2A 2VWXA 5D7AA 4AW1A 4FTOA 3JY9A 3N51A 4RIWA 4XP0A 4BDKA 2BMCA 5EQYA 4EC8A 3F88A 4DEGA 3E62A 3V8TA 3PLAE 3ZTXA 4AW0A 2YM8A 4R77A 3AGLA 4RIXA 4FT0A 4FKWA 2ZMDA 4EHZA 2GFSA 4GKHA 4FSTA 3O5AA 1VZOA 2YACA 4MXYA 2PWLA 3PVWA 5KNJA 1R78A 4LGDA 3RCJA 4QTCA 3E8NA 4S30A 5C26A 4YLKA 4C59A 3OT8A 4EKKA 2J6MA 4O7SA 3SOCA 3KY2A 3P5KA 3TZ9A 4B8MA 2NNWB 4BI2A 3UVPA 5LMKA 1KWPA 4I4FA 1M17A 2ETKA 4JAIA 3VUTA 4XH6A 3ATSA 4J98A 4QMTA 3MIYA 5ETAA 4BCFA 4ZK5A 3DTWA 4BDGA 4QP1A 2R3OA 4X0MA 4LYNA 2BUJA 2AYPA 3DLSA 4MNEB 4RGJA 5FM2A 5TF9A 3C50A 3MTFA 1XMMA 1F3MC 5IEYA 3BWFA 2GNGA 2ITVA 4U79A 1RW8A 4GS6A 4XBRA 2YZLA 1O6YA 4F7SA 1OKVA 3FKNA 4C33A 4FA2A 3RCDA 5HBHA 5AIKA 2UZEA 1PMVA 4QYYA 2R3PA 5KKRB 3AG9A 3D7TB 4FSRA 4E3CA 3NDMA 4FK6A 3I5ZA 4AS0A 2V22A 3DLZA 3GCUA 4YC8A 3HUCA 2ITUA 4ZTLA 2ZB0A 5J1WA 4DH5A 5CF5A 4I5MA 4MUQA 4MF1A 4IC8A 3M42A 1WVWA 2QOCA 2VRXA 2BRNA 4FTQA 3QC9A 2BRHA 4JIKA 4DN5A 3BE2A 3HL7A 4E73A 5JFXA 2AC5A 1XMLA 3TDVA 1Z9XA 2RFNA 4JBPA 5CF6A 4X2KA 2C6MA 5F9EA 5LVLA 4JJRA 3QYWA 3SGCA 3VW8A 4U0IA 3FMKA 5HIEA 4CMUA 2X39A 2PVHA 5EKOA 4DT8A 2PVNA 4ASZA 5CSXA 4G3DA 3R04A 3TZ8A 1OL6A 5ANJA 3KRLA 1HCLA 3R1YA 1OBDA 4K18A 4EOSA 3P08A 5LWNA 3TNHA 1Q8YA 2OJGA 5EQPA 3UNKA 3QQUA 4QTAA 3O51A 4A9YA 5B2MA 4ZTMA 4UALA 2YAAA 3IG7A 1B38A 3K54A 4TTHB 5HX8A 3F3TA 2V55A 3WIKA 4BFMA 2W9FB 4CKIA 3LXLA 2VTTA 3HV7A 4NM5A 2E9NA 4JRVA 3S3IA 4O81A 3COKA 4MXCA 3ELJA 4L3JA 5IZFA 3UDSA 4FV5A 1AQ1A 3TT0A 3LPBA 4GK3A 2QG5A 4BCHA 2BAKA 2VTHA 3F5UA 3MVMA 4H3PA 3CBLA 5K0XA 2WNTA 3KVXA 3N4TA 2XM8A 4JMQA 3D7ZA 2VTQA 3CE3A 3FI4A 2UZVA 2OIBA 4UWCA 3UO5A 3CTHA 3DBCA 5IQAA 4FV9A 4IAFA 4IX5A 3AOXA 3AD5A 4F4PA 3RNIA 2WEIA 1I44A 4CKJA 5LCKA 2Z02A 2EXMA 4FYNA 4O0WA 2ZAZA 5FXRA 4EWQA 4NCTC 2ZV2A 4MF0A 2X0PA 1G8KA 4HYIA 2AEGA 3TTJA 3KIOC 3ZZEA 4JVGA 2PTKA 4RX8A 1BI8A 4BCPA 2VNYA 3COMA 4FIFA 3W18A 3KEXA 3OBGA 4OTIA 4WKQA 2OLCA 4I6FA 1MP8A 4PNIA 4AF3A 1LP4A 3V5LA 4DG3E 2BIKB 3LCDA 3V5JA 1DI9A 1GOLA 4B6LA 3FI2A 3UVQA 4CCBA 2YCSA 4RMZA 2X8EA 2DYLA 3DFAA 3Q9WA 4FKQA 4GU6A 3MI9A 2G2IA 2BZHB 2EWAA 3EQGA 1Y8GA 4J96A 3LFNA 4PPCA 5CALA 5E8XA 2VWVA 2XBAA 4PDPA 2FGIA 3O23A 3DB8A 3OCTA 4HGSA 4DLIA 3PUPA 2BKZA 4JG8A 3U55A 2WU7A 3E93A 3Q5IA 3ODYX 4N4SA 3R8LA 2IG7A 2OWBA 2X81A 3MBLA 5CZIA 4AN9A 2GNHA 2QODA 4GCJA 3U9CA 5JQ8A 4JQ7A 2XK7A 1MQBA 2XKDA 4KS8A 3UOJA 1W7HA 1XH4A 3LJ1A 4JBQA 5AAFA 4AA0A 3NUPA 1YOMA 3COHA 1JKLA 3AQVA 3A4PA 1CSNA 3PXYA 3VHKA 3G0FA 4WG3A 4XS2A 3C0GA 2WMUA 3R2YA 1OVEA 2YFXA 5IKWA 2C0OA 3RHKA 4AWIA 4QMNA 1BL7A 4KIKB 4RLLA 4HCTA 3IGOA 4YZNA 5D11A 4EZ3A 3PJCA 2ZMCA 4LL0A 4EC9A 2R3NA 3Q53A 5HCXA 3MY0A 4H1JA 5L8JA 4Z7HA 4NZWB 4RQVA 3TIZA 4AZTA 3FZPA 4NFMA 4EUUA 3K2LA 4ZSLA 4ALWA 3TCPA 2I40A 1Z57A 3C0IA 4K11A 3FC2A 5CNNA 4U44A 3HX4A 3GVUA 4YTHA 4HGEA 5E1SA 4RIWB 2P2HA 4BCJA 3QZFA 3PPJA 1PMUA 3W2RA 4L9IA 4LUEA 2C6DA 3QD0A 5LJJA 4NW6A 5EYMA 5I9ZA 2CKPA 3FMNA 3O8TA 1XBAA 3T3UA 1H0VA 4GG7A 2X2LA 4QYGA 2NO3A 2WTCA 1KE6A 4MNEA 3A60A 2R7IA 4BHZA 5CEMA 1YXSA 4O7NA 4GUEA 3DV3A 4RSSA 4UMTA 5IEVA 4TT7A 5C8KA 4EOJA 3U6JA 5GIOE 4XLIA 4KIOA 4MTAA 3I4BA 4O0SA 1ZMWA 3ZFXA 4HYUA 3RK5A 3LQ8A 3KU2A 5H8EA 3HMPA 3OUNB 1E1VA 3QLFA 4HGLA 4IACA 3QRKA 2FO0A 3SXSA 3FWQA 4XP2A 4NIFB 4XOYA 1ZWSA 4FKLA 3D0EA 2Q0BA 2PUIA 2IWIA 2PPQA 3QZHA 3RZFA 3VBTA 2HELA 3AD6A 3NUSA 1GZOA 3ERKA 4HCUA 3NLBA 2VTJA 4F9WA 2O63A 5E90A 4BDHA 4E5BA 2NRYA 2GHLA 1YHVA 1TQPA 3DA6A 4L52A 2QLUA 3QYZA 5AM7A 3BHVA 4QNAA 5K0KA 3KF4A 3V6RA 5IPJA 5DLSA 5IUIA 3HA6A 5CSWA 2ITYA 2R9SA 2UVXA 1UNGA 4ZAUA 3HP2A 3U8WA 4QNYA 4YHFA 2QR7A 2ZFYA 4O7TA 3QKLA 4RIXB 3QFVA 1CDKA 4GIIA 5C4KA 3ORKA 4OAVB 3U51A 2VGOA 3FZ1A 3QHRA 4FICA 4RFZA 3TACA 1KE7A 3DGKA 1K3AA 1L8TA 4KKGA 3CCNA 2C69A 5KX8A 3CEKA 4Y83A 2VU3A 2W1EA 3ZCLA 1PHKA 4YPDA 2JD5A 4O4FA 4FIGA 2XK4A 2JKQA 4FT5A 1NW1A 3NFGB 3MH2A 3PFYA 4DHJA 4QQCA 4FL1A 5DE2A 1MQ4A 3NVKI 3IONA 4GT4A 5DOSA 2CKOA 3IGGA 4F9CA 2XNPA 4IM2A 3R83A 4C4EA 5C9CA 2FVDA 3SKCA 4RWJA 3IKAA 3R30A 5CEOA 2I0EA 5HBEA 3PE2A 2W1CA 5DA3A 3OW3A 3ZUVA 2E9OA 1ST0A 5J9YA 2H34A 3MTLA 4FGBA 3QTQA 4MXAA 1H07A 2JIUA 3QL8A 3V6SA 3DJ6A 3W0RA 1OKYA 3ZHPC 4EORA 3L9PA 4MD7E 2UUEA 3KN6A 2W4KA 4YJTA 5C03A 4DEBA 5JRSA 5LQFA 5CYIA 4AA4A 1IA9A 2WTIA 4RC3A 5ANEA 4D1XA 3R8ZA 2UW3A 3PP0A 2IW8A 3OCGA 1RJBA 2OIQA 3FV8A 4FV4A 5FP6A 3VJOA 2VZ6A 3QAME 4DAWA 4FIHA 4WBBB 5K4JA 2ITNA 4Y5QA 5J95A 5C8MA 5A14A 2I1MA 4OTWA 5LOHA 2ITTA 2C5YA 4ITHA 4I23A 3NS9A 2KTYA 4M3QA 4NM0A 4O1PA 4C4FA 1KUTA 5TT7A 1GAGA 4TW9A 3VULA 4XHKB 3BV2A 2YCFA 4F63A 5I9XA 4NEUA 2B4SB 4O7RA 4I20A 1Q4LA 3Q6UA 4K9YA 3CR0A 1OIYA 2WTDA 1W8CA 3N9XA 5JN2A 2BROA 1YQJA 2VO7A 4YURA 5HNBA 3ORZA 5EW3A 3GQIA 3OWPA 3POOA 4QMQA 2HXLA 5JQ5A 2XM9A 4OTHA 4XG8A 1JLUE 4ARKA 3QCQA 2W5AA 4QT1A 1LEZA 3R1QA 1H28A 3A8XA 4AP7A 4G5JA 4BRXA 3UZTA 4L3PA 3UOLA 3V51A 3KXXA 3NW6A 5FUTA 3D4QA 3D5WA 2HW7A 4FV2A 3H9FA 2VWIA 4OLIA 4MH7A 3II5A 3NYNA 3DKGA 3IS5A 2EVAA 3OXTA 1DS5A 4U5JA 4BCIA 3HV5A 3S2PA 1CKJA 2UZWE 3QD2B 3L1SA 4IZ5A 3OD6X 4R1YA 4RPVA 5BYYA 1Q99A 4CLJA 3FZTA 2W1HA 4C61A 1Q61A 2C30A 3WI6A 1UV5A 4W9WA 4ALUA 4AUAA 2C0IA 4I0RA 4BTFA 4CTBA 1LEWA 3E7OA 4NM7A 3QXOA 2IW9A 2BHEA 3BLRA 4QO9A 1AD5A 1XH6A 2WQNA 3ZRKA 3D14A 4W4WA 2QU6A 4YNOA 3EN6A 1XBCA 2OZOA 3BCEA 2OXDA 5JEBA 3SW4A 3DAEA 3G2FA 2ERKA 3FQEA 3UNJA 4D2RA 3ROCA 4KIPA 4HPTE 2UZLA 4IDTA 4O22A 4KRDA 1Q8WA 4RWIA 4TYIA 1FOTA 4IAKA 4CFXA 5EW8A 4NL0A 2YHVA 4L46A 4MK0A 4CMOA 4UMRA 4PY1A 3DJ5A 4CEGA 3PIXA 5CI6A 4YJUA 3FMDA 1KV2A 3HA8A 4N6YA 3I0QA 2IEWA 4G2FA 1YWNA 4WUAA 3GGFA 3DZQA 3FZOA 4C2WA 4E4LA 2J51A 4DDGA 2UW7A 4Q5HA 4BL1A 3QQFA 1OL5A 1XJDA 3GT8A 4KBAA 2R3IA 2IJMA 4E20A 4CSVA 3R9NA 4F09A 3CTQA 4U80A 4FEUA 4D4RA 4X21A 3L9MA 4QMWA 3UDZA 5DT4A 5CU6A 5M4UA 3LJ2A 3RHXA 4ZLOA 1O6KA 1Q8UA 3VF9A 1J7LA 1OPKA 2PMOX 3SHEA 5E1EA 4M14A 4KKHA 4WOVA 2YIXA 2WO6A 4M0ZA 2VTNA 4I22A 5JFSA 4CFUA 3W0NA 4IHPA 3E7VA 5M09A 3ZLXA 2XEYA 3ML1A 4FKTA 4PL3A 4UZDA 3M1SA 2IO6A 4IVBA 3VC4A 2JKOA 3MB7A 2QOIA 1TZDA 2JAVA 2G01A 2P55A 1URCA 1W2CA 1ZYJA 2Z7QA 5FTQA 1SNXA 2Z7LA 4V0GB 1KOAA 1PYEA 3VNTA 2YCQA 3PJ1A 2J90A 3NUNA 4MQ1A 5KKRC 3GQLA 3CQEA 3FDNA 3BU6A 3NMUF 1E1XA 2OZAA 3SLSA 2YAKA 5CY3A 2HZNA 4O2PA 1WBPA 2NP8A 3PYYA 2EB3A 4W8EA 4CNHA 5AV3A 4CFMA 2XS0A 3DY7A 5HEZA 2W0JA 4S34A 2GQSA 2H8HA 3W0MA 3UC3A 2XRWA 1H24A 4WNOA 4IE9A 1WBTA 3HMIA 5GNKA 4ASEA 3CY3A 4QYFA 3SA0A 2H9VA 3KULA 3W2SA 4OW8A 5C01A 4CV9A 3LCSA 3DKFA 5KHXA 5HVJA 3OVVA 1CTPE 1JSTA 1WBVA 1H8FA 2VO3A 3ENMA 3Q9ZA 1ZZLA 4O0VA 4U42A 3LXKA 5D1JA 5BVOA 1G3NA 4EOPA 2X8IA 3FYJX 5BPYA 1PYXA 4NCTA 2GU8A 4GW8A 4Z55A 5LVNA 3ID6C 1OIRA 2ETMA 4DTAA 2AUHA 2XK6A 3NFFB 1H26A 4RVKA 3MYGA 5CASA 3OWLA 3DOGA 2WTKC 3UTOA 4Y72A 4BCGA 4MHAA 3KMUA 3MY1A 4U8ZA 3KK8A 4Y85A 2XJ2A 4D1ZA 4M69B 5FQDC 4C3FA 5GJGA 4WSYA 3A62A 3KC3A 2XANA 2GCDA 3ZSGA 4XEYA 3C4ZA 3OY1A 3LFBA 4O86A 4O7ZA 3G90X 3IO7A 2VX0A 4JBOA 5E8WA 2CMWA 4X3FA 1NVQA 3TNPC 4GU9A 4OTPA 1Z5MA 3MSSA 2YM5A 3C13A 5G6VA 5KZ0A 2B52A 4C3PA 2C6OA 5EM6A 4I0TA 4FL3A 3BYMA 2ITZA 2VTRA 2VTOA 2B54A 2HOGA 1XR1A 2Y9QA 5DEWA 5E8VA 1A48A 4DFBA 3EFJA 2FSTX 4YZBA 4CYJA 4IVDA 3HKOA 4JR3A 4QQTA 4FNWA 3RAHA 3JY0A 4DH8A 4D2TA 4ZXTA 1PXKA 2CCHA 3V5QA 1E9HA 3LE6A 4AXDA 2IPXA 3A7JA 3K5UA 5EW9A 2BHHA 5FRIA 4ANSA 4MNFA 3ZM4A 3IW7A 4E1ZA 1MRUA 4PRJA 5BQ0A 3QXPA 4YZ9A 2R3HA 1Q3DA 2G2FA 2UZBA 4YC6A 3TMOA 1XH9A 1ZYCA 2EUFB 3DXPA 3G5DA 3FAAA 3ODZX 4OT6A 2WAJA 4YJSA 5J5SA 3ATTA 2XA4A 4GT5A 4G16A 1Q97A 3RMFA 4ACHA 4C57A 3W33A 4KBCA 4XCUA 2C5OA 2RGPA 4Y46A 5IMEA 5AP1A 3HMNA 3RTPA 1OIUA 4XG6A 1R1WA 3MDYA 4QMMA 5AV4A 4LV5A 5CVGA 1CKPA 2PHKA 4I92A 1OL2A 2XNOA 4H1MA 5EKNA 1NT2A 5E8SA 3SOAA 1UVRA 3V8WA 4HVIA 3GU7A 5FTOA 3UIBA 2ZVAA 2BRBA 5DRBA 2DWBA 5HTBA 1FGIA 2REIA 1G8JA 2W1FA 4EK6A 2GSFA 2CLQA 5CI7A 3RKBA 2YISA 1IR3A 3REPA 5CEPA 2YERA 1OUKA 4I1ZA 4AX8A 5EHYA 1M7QA 2R3JA 3FY0A 3PJ8A 3WIGA 1NVSA 4CXAA 2X0GA 3IW5A 3SX9A 1GNGA 1ZOHA 2XNGA 4IWDA 2BIYA 3JVRA 2X0QA 5F95A 3TNQB 3PSCA 5BUIA 1PXPA 3WOWA 2VTMA 4XYFA 2PVFA 3VQHA 4J7BA 4FI1A 4G5PA 4E6CA 5IH5A 2GHGA 4QMLA 3R2BA 4FSNA 4WT6A 3OTVA 4K33A 3HZTA 2G15A 4FZ7A 3QTRA 1XH7A 2ZM4A 4JQ8A 4CG8A 1Q41A 2QKWB 3D94A 3FQHA 3Q4UA 3EQPA 3PXRA 4CFNA 2JKKA 5HESA 3QKKA 3FL4A 4NM3A 5EDRA 4QMVA 4CYIA 3S4QA 2C4GA 2XIZA 4E6QA 3A7IA 4YLLA 4YP8A 2PZ5A 4N57A 5EI8A 2RL5A 4ERWA 1ZYLA 2RKUA 5AP2A 3QC4A 2QOOA 2IVSA 2VUWA 5HLNA 4JS8A 4Q9SA 3KXZA 4FL2A 3Q4ZA 2GDOA 1J7UA 1DAYA 2HZIA 5DGZA 5IF1A 5H8BA 5TO8A 1H00A 4FEQA 3BBWA 3RM7A 1IA8A 4IAAA 4DFYA 5M4FA 2BRGA 2C1AA 2PVKA 2O3PA 5AP3A 3E63A 1FPUA 3ULIA 3E3PA 4U40A 2W17A 2J7TA 3OG7A 5FEDA 2OFVA 4BDIA 2QOKA 4D58A 3LFAA 3EMGA 4IX4A 4U81A 5AA8A 2CGWA 1YDRE 4DH1A 2BPMA 4FSYA 3HAMA 4CGAA 4XV1A 3GI3A 3ZRMA 4ZSAA 2WD1A 2VWWA 5AP4A 3F3UA 3Q3BA 4NUSA 4DINA 5K5NA 5E4HA 5AUZA 5CEKA 2XKEA 4LL5A 5A4EA 3W0OA 4KB8A 3BL9A 3LFCA 3RI1A 4EONA 2XARA 2F49A 2X2KA 3EL8A 3ORMA 4PMPA 4IVCA 4FZFB 3B2WA 5FDPA 5IH4A 3PY0A 3R21A 3E5AA 1L3RE 3AC1A 5J79A 4EKLA 3N4UA 4S2ZA 4JT3A 4FG9A 3BHHA 1GY3A 4KD1A 4GUBA 4D1SA 1R3CA 3BLHA 3CKXA 3L8SA 3PY3A 4FIIA 4FV3A 4IDVA 5TR6A 2JIIA 3VWAA 4FTMA 5AUVA 3OWJA 4O7VA 3DS6A 4FSZA 2A0CX 3SQQA 5EK7A 4FTTA 4DFLA 1JNKA 3GU5A 2X4ZA 3DPKA 3A7HA 3ORIA 4UYAA 5HO6A 4KIQA 1ZYDA 4EH6A 4IXPA 3VS4A 4BDCA 1SVEA 4KS7A 3Q2JA 4TKSA 3MFTA 3ZFMA 3AC5A 1NVRA 1KV1A 4U7ZA 2CDZA 3AT2A 3FXXA 3DNEA 3RJCA 3R7VA 4MBLA 4O96A 3BU3A 4I5HA 4LRKA 4O0UA 3VUDA 2AQXA 3RGFA 2C6LA 3F2AA 2RSVA 3HV3A 4FV8A 4NFNA 2WMTA 3QCSA 4LM5A 1JSVA 1SNUA 3VS6A 1B39A 5KBQA 2R5TA 3W2OA 5HOAA 3GB2A 1G8SA 2VTAA 3U4WA 4DF3A 2PK9A 1ATPE 2A98A 4PX6A 4I4EA 4CQGA 2BTSA 1WVYA 4IWQA 2YLFA 4BWKA 4ZLZA 4CRLA 1HOWA 2ETRA 4IAIA 3ZO2A 3D5VA 4MQ2A 1WBSA 4QPSA 2IVUA 3V5TA 4IAZA 4ANBA 3WILA 4BI0A 2R2PA 3V5PA 3CJGA 4LG4A 2C1BA 1UU3A 3K3IA 5M08A 3C51A 4RC4A 5HBJA 4BIBA 2JDSA 2PE2A 3EN5A 4AGDA 4ORKA 4BR3A 4FC0A 4PMMA 4YO4A 2CPKE 2HYYA 4M8TA 3FQSA 5AUYA 3A4OX 4EJ7A 1OI9A 3H9OA 3R7GA 4JDHA 4DTKA 1H27A 4G6NA 3SXFA 4NKAA 2PE0A 3PG3A 4L8MA 3CJFA 5CEIA 3C4EA 2IZRA 4LGGA 3FEGA 2SRCA 2XKFA 3QRIA 3EKNA 4Q5EA 2I0VA 3ZLWA 4D2SA 4KINA 4BTJA 3MVJA 3RPYA 4AGWA 2I0HA 3MH0A 3Q5ZA 4U45A 3IDPA 4W4YA 1R0PA 4FTKA 5F20A 5AV0A 2OIDA 5BMMA 3UG1A 1XWSA 3KN5A 3OP5A 4IJPA 4AOTA 5AX3A 3WF8A 5JT2A 2YM7A 5J1VA 5ICPA 4RVMA 1WMKA 3BRBA 4M13A 4ITJA 3OOGA 3OHTA 3WYYA 3ORTA 2XALA 4AOJA 4AZSA 3V3VA 5M4CA 4JBVA 4B99A 4U3ZA 1OIQA 3Q4CA 4DGOA 3ULZA 4GG5A 3R01A 2YN8A 3RAIA 3LQ3A 1BI7A 3R8UA 2C68A 5B2LA 4IQ6A 5GJFA 5L8KA 3EOCA 2HY81 3UMWA 1IASA 4F1OA 5LMBA 3UZRA 4BY9E 4K77A 2UW4A 3BHTA 1SZMA 4GK4A 5A4TA 5L6OA 4EQMA 5EHLA 4X2FA 4G9CA 4QQ5A 3R7OA 3DFCB 4XV2A 5HE1A 1VEBA 2UV2A 4Y5HA 4M67A 5AFVA 4EYMA 2UVYA 4UWYA 4NYEA 3EZVA 3PG1A 3W8QA 3SW7A 3ZFYA 1PXNA 1U5RA 3TDWA 3LMHA 3FHIA 4FMQA 3FMMA 5BYZA 2Z2WA 5IA1A 3GC9A 5AR3A 5KUPA 3W1FA 1ZMVA 4O6EA 3RM6A 3CPBA 5A9UA 3G9LX 3V5WA 4B0GA 4USEA 3S00A 4ONAA 5CNOA 3KA0A 3KRRA 4M68A 2OSCA 2X0OA 3S1HA 2P0CA 4USFA 5JSMA 3EFLA 4PL5A 2JEDA 5DBXA 1UKIA 4CT1A 5L4QA 3W0PA 4C4HA 5M57A 3FLQA 5EYKA 2W9ZB 4RX7A 2P33A 2WMQA 2ITWA 2Y4IB 3FBVA 4ZP5A 4ENXA 4WG4A 5C4LA 1S9IA 4ACMA 3UIUA 3NUUA 3WF6A 2JITA 2OK1A 3PJ3A 2Z7SA 3LLTA 4MEDA 4BDBA 5E9EA 4EBVA 3O2MA 4WIHA 4E5WA 3RALA 4XJ0A 3V01A 1GIJA 1H1WA 1X8BA 4U41A 2XH5A 5ETFA 2QO2A 4APCA 1EH4A 2FSLX 1YDTE 4A7CA 4ZMEA 1ZRZA 2WELA 4GMYA 4HYHA 3RVGA 3UYTA 4NWMA 4ZJVA 3DBEA 5BUEA 3PUFC 2R4BA 4AU8A 4XRJA 1QMZA 3QF9A 4I6BA 4MAOA 4UN0C 4G3CA 4BTMA 2DUVA 2CGUA 2J2IB 2V0DA 3D5XA 3GFEA 3PVGA 3MJ1A 3O50A 4FTJA 3V8SA 3VUHA 2QR8A 2XF0A 1W98A 2X8DA 4WBOA 4O91A 3TTIA 4BYIA 2H96A 4EZ7A 4GKIA 3MJ2A 4ZSGA 4O7YA 4NT4A 2A19B 4JLCA 4ZS0A 3VBXA 4U3YA 5AP5A 4RIOA 4EJNA 3MVLA 5FXQA 4I93A 1QPDA 3DXQA 4ZTSA 4KAOA 2OG8A 4XMOA 3I60A 1FQ1B 1IEPA 2BFYA 2PVLA 3BX5A 4QP9A 4E8AA 5IQBA 1MUOA 5CT0A 3PTGA 5HG7A 5M4IA 1UU8A 2QHMA 2QOQA 4EK3A 3P79A 3D9VA 4JDJA 3IW6A 4EOIA 4FVPA 4WO5A 2ZYBA 4G17A 4BTKA 3MPAA 2BKKA 4GFMA 2XMYA 4O0RA 3B8RA 3G9NA 5CXZA 3I5NA 3U6HA 3WZUA 5FBNC 1U54A 5KBRA 3T8OA 2B0QA 1P4FA 3HV6A 4NIFA 2ERZE 3BWJA 1WBNA 4F08A 3D2IA