4G5JA

Crystal structure of egfr kinase in complex with bibw2992
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
321
structure length
307
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKEKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Target Binding Properties and Cellular Activity of Afatinib (BIBW 2992), an Irreversible ErbB Family Blocker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 307
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g5jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g5jA01
2GTMA 2BKKA 4E93A 4LQMA 4K0YA 4BF2A 4F9YA 3OWLA 4TL0A 3TKUA 5DHJA 5AP2A 3FY2A 1P4OA 3E5AA 1IG1A 4GK2A 4YBKA 4EOJA 1H1RA 4S34A 2QO2A 3EN5A 2XYNA 3QTZA 3EFKA 2JGZA 2PL0A 3FZSA 5BMMA 1LP4A 3KL8A 4RVKA 4Y72A 3ZLXA 4IX5A 3ZC6A 4XHKB 4RJ3A 4U45A 4XBUA 5JSMA 1F3MC 1URCA 1PXNA 3EJ1A 4GH2A 4FSMA 5DWRA 4NM5A 3ZO1A 4XJ0A 2XYUA 4EC9A 3TG1A 5ANIA 3BYUA 4MD9E 5KKRC 2R3QA 1Q97A 2YERA 4QYYA 4MXZA 5FXQA 3VUHA 4RIWA 3QC9A 3SG9A 5DRBA 5BQ0A 2PZYA 1VEBA 4RIYB 4TNDA 4U0IA 1REJA 3QAME 4HYUA 5LCKA 3FXZA 3R8MA 3QXOA 4A06A 3NNWA 2FSOX 4FUXA 3OXTA 3QCYA 4CLJA 1DS5A 1YDRE 1UWJA 2X2LA 4D9UA 4TNBA 2YIYA 4GMYA 4U42A 4YO4A 4RJ7A 4IE9A 1DAYA 2JDVA 2UZUE 4B7TA 3QD3A 4N70A 4XG6A 3RBWA 2IVVA 2QHMA 3QYWA 2W1GA 2HAKA 4O0UA 4UWYA 3QCSA 3OCGA 4IVBA 2PULA 4FZFB 3KVWA 4J71A 3JXWA 3CR0A 3DKGA 3NSZA 4C61A 4MBJA 4X3JA 4OBQA 4X7QA 4FZAB 1H26A 3QFVA 4L52A 4ALWA 5B0XA 1ZY4A 5A4QA 5I9XA 4RFYA 3TUBA 2B9HA 1SNUA 2X39A 3DAKA 3EQCA 4PMMA 5CU0A 4JDHA 4AXAA 1OUKA 3VBQA 1NA7A 4C4EA 1WBVA 1P2AA 4E5AX 3WF7A 4YZDA 3RZBA 1CTPE 3PG3A 3R9DA 3ZO3A 1BMKA 3AXWA 4H3BA 5IEYA 3DLSA 3DA6A 3FYJX 2UZNA 3TCPA 1UVRA 3CLYA 1MP8A 1UU9A 3F5GA 4IIRA 3DCVA 4EC8A 4Z3VA 3QX4A 3PY0A 4J95A 3CTHA 4D2WA 3E93A 2JC6A 3PA5A 3E64A 1ZOEA 4J1RA 4BI2A 4GS6A 3C4EA 4TN6A 1FGKA 2OJJA 2PE0A 2UVXA 2ZVAA 1CKIA 1GZ8A 1WZYA 3EYHA 3MA3A 3OCTA 4ASDA 4DFZE 3AC5A 2VTRA 4CNHA 5JFVA 4ZSEA 2VAGA 1APME 3QTUA 3R30A 4PPAA 3ZUVA 5E8ZA 3HMMA 3FKLA 3EIDA 3RAKA 2UW6A 2F2UA 4L8MA 2OZAB 3DDPA 4JR3A 5M08A 3O2MA 3G51A 3N4TA 2BFYA 2CN8A 3SXFA 1J1BA 1FPUA 1WBOA 2ETKA 3Q53A 3P7AA 2XK4A 5JFSA 1HCLA 4ZLZA 1IAHA 3QRKA 4QD6A 2XJ1A 2XRWA 5EI8A 2KULA 4AW5A 3KEXA 2X9FA 5C26A 5M53A 4TTHB 4F6SA 4O7YA 4QQCA 4FT9A 4FV9A 5KMLA 5FTQA 5HNBA 1E1XA 4I5PA 3KA0A 3CJFA 4QO9A 3CD8A 3BGZA 2P4IA 4AZSA 3PVBA 2ZV8A 4ZS0A 3BLRA 5GZ9A 4RZWA 3RI1A 4WOVA 4HPUE 5L8LA 2GHLA 4IAKA 3AT2A 3VQHA 5LMBA 3W2OA 1XH5A 3F66A 2JDOA 2W96B 2WFYA 3IOKA 2YZAA 3IONA 1G3NA 3EH9A 3EQBA 2ITQA 4BGGA 4NW5A 4EH6A 5K4JA 2QOLA 5IH4A 5AAEA 4MBLA 3CPBA 2J6MA 3SD0A 4HCVA 3RP9A 4LUDA 4QPMA 4BC6A 2YDJA 5J9ZA 5J79A 1Q24A 4P4CA 3OY3A 2WTKC 4DBXA 1JKTA 1OIQA 2E9NA 1AGWA 4S31A 4BN1A 3D94A 2V55A 4CRSA 2GMXA 4UMQA 2B53A 3V5JA 2RG6A 4G34A 2XNPA 3E8NA 5LVNA 1OL1A 2CLXA 4WT6A 4G3GA 3GU6A 3P0MA 4XG4A 2ITZA 3NAYA 4YZ9A 3VBXA 4D2RA 5HQ0A 3A7HA 2PMLX 1P4FA 4GIHA 5BVDA 4IBMA 4WNKA 5HE2A 4L7FA 3VS6A 4RSSA 3VC4A 4FYOA 3ZZWA 1KOBA 5AM7A 4M68A 3D0EA 2VWUA 2Q0BA 1OL5A 1PF8A 3EZRA 3OP5A 3UMXA 2JIUA 3HMIA 4BDDA 2CKPA 4UMTA 4P7EA 4U79A 4M7IA 3WZUA 3D2KA 4IX3A 4RIOA 2W5HA 4B0GA 4QMPA 4FEWA 2YHVA 2RFNA 2O64A 1Y8GA 4XV3A 4DA5A 3PLAE 3BYSA 3GCVA 4GCJA 3L8VA 3PJ2A 3FZPA 4FIIA 5BMSA 2B9JA 5AADA 4F7LA 5JKGA 2OXDA 4BI1A 3UOJA 2XM8A 4BCQA 1B38A 5HEZA 2XNBA 3V5LA 3R8VA 3BV3A 3PWDA 4C7TA 2A19B 3LFNA 4XOZA 4RT7A 4YNOA 2UZVA 4AGCA 1FQ1B 1OUYA 3FL5A 4UWCA 3POOA 5L6WL 4XG9A 4DGNA 3ZSIA 3BQRA 2YIQA 4ASXA 4WRGA 3JVRA 2Y4IC 2BDWA 5FBNC 5B2LA 2UZBA 3TNIA 3EN4A 4O7VA 2BAQA 3ZEWA 3ZZEA 4D4RA 4ERKA 3R71A 5DH3A 4O82A 1Q5KA 5CEPA 1M52A 3PXFA 4UMUA 4QTBA 4FV4A 2RGPA 5AUWA 3ROYA 4Y46A 4EH9A 5IMEA 3ORZA 3KB7A 3L9MA 3MI9A 3NX8A 4GT4A 4X2NA 5IU2A 4ZJIA 3CTJA 3UVQA 3GVUA 2W1ZA 2HW6A 2PZIA 2XK3A 1WAKA 3VW8A 3OOGA 2XK6A 5AEPA 4Y5HA 2YM3A 3A7FA 4LOOA 5K0XA 4CFMA 4ANLA 2C30A 4JBVA 3DJ7A 2KTYA 3Q04A 5IQHA 3NUXA 2PVRA 2BIYA 2VTQA 3SHEA 3B2TA 1JNKA 1H25A 2XK9A 2Y6OA 3H10A 1NT2A 3WZJA 1BX6A 4IANA 3Q4TA 1MUOA 4JT3A 3CGFA 3FLQA 4FK3A 3UNKA 2HK5A 4EZ5A 3LFEA 3TV7A 2QOCA 2Z60A 4D2SA 1G8AA 3KMWA 2W1EA 3KRLA 1WBSA 1MRYA 3WYYA 3QU0A 2V0DA 2VTOA 4CGAA 3I7BA 1XO2B 5J1VA 2PPQA 4BDJA 4EL9A 3G0EA 4FT5A 2XIYA 1YXSA 2PMOX 3JR1A 4G3DA 2FVDA 5JFXA 5EDRA 2CCIA 1WVXA 3QKLA 5D1JA 2PHKA 5IH6A 4FKLA 3F88A 1M2QA 2V5QA 3PPZA 4QMOA 2PVYA 4DEDA 3F9NA 4N6YA 1XH6A 1RJBA 3KVXA 4QTCA 3ZO4A 4DLIA 4GKIA 3HV5A 2C3IB 3R8ZA 3PTGA 2P0CA 4YSJA 4EOOA 4L3LA 3AT4A 2I6LA 4UZHA 4F6UA 2QVSE 3F82A 4YZBA 3NW7A 4TWPA 1RDQE 5L2QA 1H01A 3VUGA 2B1PA 3UOKA 3AD5A 4EJ7A 5DMZA 4M69A 3BWFA 5TO8A 1XR1A 4G1WA 4GG5A 2GU8A 3P23A 3O71A 4YJRA 5C1QB 2PUNA 2PE2A 4HYIA 1M2RA 4O21A 4RWLA 1A9UA 5E8UA 1UA2A 2A2AA 3ID6C 1X8BA 5CSHA 4L45A 4EH3A 4HW7A 4E6CA 2UZDA 5J95A 2RFSA 3Q9WA 3B8RA 5DG5A 2EUFB 3II5A 5JQ5A 4HCUA 4JI9A 2VNWA 4F1TA 2YLFA 3POZA 5ACKA 1H27A 5EI2A 4ZTMA 1HOWA 5TKDA 2JDTA 2XEYA 5CF6A 4EQMA 4ZTHA 5JEBA 4W8EA 4CV9A 3TN8A 3GQIA 4V0GB 2XKCA 3PWYA 2RKUA 4MXCA 2F49A 2OU7A 4ARKA 4IDTA 4QP2A 3KULB 3EL7A 4ZTLA 3PA4A 4CFFA 5E1SA 3TACA 3K2LA 4O81A 4BBFA 1W83A 3QUEA 1TVOA 4GT5A 4FL3A 4OGRA 3Q52A 1UNGA 3TZMA 4E1ZA 1OI9A 2ZMCA 5IMXA 5CSWA 3UQGA 5A6OA 1SMHA 5HORA 2QHNA 2GNHA 5HG8A 3O0GA 2WAJA 3DBQA 4N4SA 2PMNX 3OEZA 3IPHA 3HKOA 5CSPA 4QP4A 2YIXA 3KXHA 2R3KA 4O7SA 5M09A 5J7BA 2OJGA 5AUTA 3U9NA 4EQUA 3ZLYA 1MRUA 3EKNA 5HESA 1KE9A 5I3RA 4F1MA 4DT9A 4L53A 4QP6A 4A4LA 3K5VA 4DFNA 5A4LA 4CXAA 4LRMA 3EQRA 3NUNA 5DBXA 1UKHA 3KXZA 2VTAA 4BCGA 1CSNA 4JQ8A 3MW1A 1EH4A 4GV1A 1CDKA 2NRUA 3C0GA 1DM2A 1OL2A 3PXKA 4OTGA 5FWKK 5HLNA 4BDFA 3AOXA 2PVMA 4ANBA 4MYGA 4O0RA 4F08A 5HU3A 5CYIA 3RVGA 3OT3A 3ROCA 3UQCA 4CV8A 4Y8DA 2J0JA 4JX7A 1F0QA 3MFTA 5CZIA 3R9HA 4OLIA 3FLWA 3R0TA 4YNEA 3OG7A 1GZKA 2UZLA 4RWJA 4ZZOA 5E9EA 3VS4A 4MF0A 3RPYA 5M55A 4QMYA 3CS9A 3MH3A 2WOUA 4M66A 3CD3A 4FODA 4JG8A 5FRIA 4F4PA 2VRXA 3D4QA 5ICPA 5JZJA 2R3GA 4ZK5A 4CFXA 4PNKA 2J2IB 5KX8A 4WG4A 4X3FC 4C36A 5EYCA 2JEDA 1SNXA 3N9XA 2Z7SA 2G1TA 4FV2A 4I21A 5HO6A 1FVRA 2OKRA 4GL9A 1ZY5A 4PMTA 4YSMA 3QKMA 1R3CA 1WBNA 3HEGA 2YACA 2UW4A 4FVRA 3NNUA 3AD6A 1M7QA 4WUNA 3RPOA 5HG5A 4F70A 5M06A 4BCNA 4UEUA 2V62A 5JGDA 4R7IA 4W4XA 5HBHA 5JH6A 2GHMA 3OF0A 3K54A 5C8NA 5F4NA 1J91A 4BCOA 3DT1A 3NZ0A 5HLWA 4QMVA 3ORTA 4ZZNA 2IZUA 4PNIA 1H0WA 5KMKA 2W06A 4O91A 4NL0A 4Z9LA 4DBNA 2I1MA 2Z8CA 2UW8A 3OFMA 5E8SA 2ITPA 2PVLA 1J7IA 4IX6A 1TQMA 4MNFA 5AP3A 4G3EA 4OTHA 3U54A 1V0BA 2F7EE 2W1IA 4DGLC 4QP1A 4OAVB 4O7ZA 4IB5A 3F5UA 4RA4A 3FMHA 5FTGA 4FNWA 4E4LA 2B54A 2BR1A 2QI8A 2C47A 3NIZA 3OD6X 3OTVA 4WKQA 1S9IA 1UV5A 3SA0A 4M15A 3VUDA 2BZKB 4FKUA 4OR5A 3G90X 3FE3A 4YHTA 4DCEA 4D58A 2J0MB 3U6IA 3QKKA 5HE1A 4YP8A 2WMUA 3HUCA 5IISA 3U6HA 3TIYA 4KRCA 4B6LA 5IH5A 2R3RA 5LJJA 1LPUA 3H30A 3DKFA 5CVGA 3TUDA 3HMNA 3NS9A 3HV7A 3C4CA 1W0XC 3PA3A 3QGWA 4JLCA 5HCZA 4HVIA 3CE3A 5TR6A 3SW7A 4FTKA 2YA9A 5CT0A 4DG2E 1RQQA 4IVDA 4NWMA 3QRTA 4AT3A 4EHZA 3ZDUA 3O8PA 4ONAA 4GEOA 1YWNA 3P78A 4RVLA 4CKJA 1OKWA 2QO9A 2WIPA 5IA2A 2QR8A 4BDBA 1OZ1A 5L4QA 3PXYA 5HVJA 3REPA 5IPJA 2VX1A 1KE7A 4ZTRA 4TW9A 1PYXA 1BL7A 3PVWA 4D2TA 1O6YA 4C4IA 3PP0A 4EHEA 4USEA 2IZRA 5CU6A 3V6RA 1YOJA 3IK3A 4G16A 4EH5A 5EI6A 4N6ZA 5CEKA 2OICA 3A2CA 1GOLA 3BHYA 4E6QA 4F99A 3LCOA 4RQVA 1YWVA 1YXUA 4O7WA 3G2FA 4F0IA 4M14A 4QMWA 5CY3A 4GYIA 4UZDA 3EQPA 3RM6A 3V5PA 2GS2A 1JAMA 2F4JA 2GTNA 4QP7A 4E26A 2P2HA 4KS7A 3PJ1A 1OM1A 3F6XA 4IC8A 2Z2WA 3FMEA 4K1BA 4ZEGA 3ZBXA 4BDIA 2XM9A 1PXPA 3O8UA 2WQMA 3C4ZA 3IS5A 5E8YA 4BTKA 5FM2A 3O7LD 3KMMA 3AD4A 4CTCA 2CGUA 1K3AA 3BHVA 2ITYA 4FG7A 4DTAA 4I6FA 1XBBA 3KU2A 2WQEA 3UO4A 3L9NA 3U51A 5IQCA 4DFYA 1R0EA 3VS2A 4C4GA 2R0UA 1LEWA 3G5DA 3QQGA 3UC4A 3V5QA 3WF5A 5LMKC 2XS0A 4KKGA 4YPSA 4X2GA 3GC7A 3LJ1A 4IZYA 3QTIA 4D1ZA 2XKEA 4HNIA 1OECA 1U5QA 5HGIA 5L2IA 4X21A 5L8KA 3LJ0A 4MXAA 4HGTA 3ZONA 4I41A 1GIJA 1YRPA 2C6KA 2YDKA 5AV4A 2X7OA 3DB8A 4CKRA 5KUPA 3F7WA 4E5WA 5FTOA 3VAPA 4KABA 4MQ1A 4QNAA 1OVEA 4QMSA 4WUAA 3AG9A 4R7BA 3GXLA 4OW8A 5CASA 1XH7A 3KF4A 2Y8OA 3BYVA 1H0VA 3LCDA 4IADA 1YQJA 4RIXA 1NVQA 4HVGA 3FLSA 5EFQA 3CPCA 3RK5A 4AOJA 4S30A 4O83A 3R73A 2NP8A 3EB0A 5L8JA 1YOMA 2I7QA 4FE2A 2ITWA 4HZSA 2C6EA 4TZRA 3EQGA 4O7TA 2GPHA 3LPBA 3ORMA 3VO3A 2CLQA 4AN3A 2C0OA 3QTRA 2BALA 4IAAA 5HNIX 3WE4A 2QG7A 4Z55A 3TZ9A 4C38A 1GIIA 2WPAA 3M1SA 3IECA 4TY1A 3IKAA 4XP0A 3HMOA 1Q61A 4AUAA 1KE8A 3CCNA 3R7OA 5DN3A 4HCTA 3KRRA 4FNXA 4KSPA 4AF3A 3T3VA 3QUDA 1CM8A 4KIPA 2J0IA 3NPCA 4FI1A 4BCPA 3RPSA 2C68A 1FINA 1UKIA 4IH8A 4EI4A 4M0ZA 4QYFA 5AV1A 2Z02A 4A4OA 3OHTA 2ITXA 5G6VA 3MPMA 4KB8A 5KHWA 4AS0A 4Q5EA 4FT0A 1IA8A 4QYGA 3ZFYA 3FC1X 5DOSA 2P33A 3WF8A 1BL6A 5FP5A 4FV8A 5DR9A 3M2WA 2YFXA 4GFOA 3MFSA 4R7HA 4WHZA 5HHWA 3TNWA 1TKIA 4J8NA 2YJSA 4M0YA 3TDWA 3PE2A 5HTBA 3V5TA 4I5CA 3Q2MA 2G9XA 4YPDA 3KN5A 3TNHA 2B9IA 2XZSA 2RSVA 2V7OA 3EL8A 3LM5A 4O0YA 2R4BA 2YCRA 3F2NA 1VR2A 4YUQA 2OXXA 2CSNA 2YLEA 4KINA 3VUMA 4HPTE 4GJ3A 3GP0A 2X7GA 4P5QA 4PF4A 4CG9A 2UW7A 4XNEA 5H2UA 4O27B 1JVPP 2CHLA 3Q2JA 1REKA 2H96A 3VBYA 4DITA 4FKJA 5K5NA 5K0KA 4F7SA 5AAGA 3MB6A 4BKZA 3ZHPC 3KQ7A 4OTWA 2FSMX 4KBCA 4DYMA 5M07A 4UXQA 4D1SA 1S9JA 2XJ2A 4ZTQA 4NU1A 1ZMUA 2C1AA 3NRMA 4ID7A 3JVSA 4CZUA 4WO5A 5J87A 3Q9XA 4DFUA 3SGCA 3WYXA 3S1HA 3FPQA 1IAJA 1TQPA 3QQHA 2C6OA 1ATPE 3E92A 4LV8A 4FICA 3TV4A 5DR6A 3NWWA 5CANA 1GZOA 4DEGA 5EYMA 2YITA 1FVVA 4CMUA 5JK3A 1LUFA 3SOAA 3G9LX 5KE0A 4XLIA 2R64A 5D12A 4FTIA 5ETCA 4H39A 3ATSA 2R3NA 5GJDA 3HRCA 4FTUA 2FB8A 3BGQA 1OKYA 3MY1A 1WVYA 4BRXA 2VTSA 2AYPA 2YM8A 2WHBA 3QZGA 4AA4A 1Q8WA 1PXMA 5AV3A 4G6LA 4MAOA 3PRIA 3RALA 2OJFE 5BVNA 4C4JA 3NCZA 4YTCA 4F0GA 3BBTB 3QALE 4O96A 2PVNA 3OBGA 2WMAA 3P7CA 5BNJA 4ANSA 2QG5A 4IW0A 4KWPA 2IWIA 4XLVA 3TNPC 2YCFA 4RGJA 5KBRA 5ETIA 3F3WA 1GJOA 3R83A 3DZQA 3GOKA 4BCFA 3PG1A 4WBOA 4BY9E 3RAWA 4XS2A 3FMMA 2C69A 5HX8A 5CAUA 4UALA 1PXOA 5F20A 4PMPA 2W5AA 2YWPA 3NYNA 3TTIA 5EG3A 5IUGA 4Y73A 5FXSA 4BHZA 4YTIA 2HZIA 3GCSA 3OY1A 4MD7E 3DK6A 2X4ZA 5DGZA 4H1MA 4K77A 4CQEA 3E62A 4HVDA 3UO5A 1OPLA 1H1QA 4UN0C 1MQBA 3RWQA 2C5OA 4TYHA 5IDPA 5TOZA 4CKIA 2EU9A 3S95A 1O6LA 3DPKA 3BGPA 2C1BA 1E9HA 2A1AB 2XB7A 1W7HA 3LFDA 3R22A 3DTCA 3EFWA 3HVCA 3HECA 4IB3A 3CBLA 2XBAA 3H0ZA 4ITIA 4L67A 4W4VA 4A9RA 2JAMA 4QMNA 3Q3BA 5K9IA 2FSLX 3HV4A 2YAKA 2XNOA 3G0FA 5I0BA 4EONA 4AW0A 4YJUA 5AUUA 5LVMA 4NCTC 2O63A 1L3RE 2CCHA 2UVZA 3EQFA 5CEOA 4AX8A 3AGMA 5I9YA 2WU6A 3BLHA 3LFAA 2VNYA 4WNMA 4IX4A 4IWQA 2PTKA 3QHWA 5CENA 4O0XA 3W16A 4XV9A 4IMYA 1Y8YA 3OWJA 5A6NA 2UW3A 4XG8A 3UIUA 2PZPA 2C0TA 2GNGA 1OBGA 5HO8A 4GRBA 4F0FA 4X3FB 3RCJA 2BROA 4YJOA 3KRWA 4Z7HA 4NSTA 5ANEA 5CTPA 4FA2A 4J96A 5BYYA 4FSRA 1RE8A 1L8TA 4CYJA 1JKLA 4HGSA 4F09A 3QX2A 3MPTA 4QMZA 5FLFA 2R7IA 4QQJA 5CU2A 2OG8A 3RZFA 4IWPA 4IDVA 2CPKE 4AU8A 4HVHA 5AIRA 3ZYAA 3C0IA 2C3KA 4DH3A 4D0XA 2WTIA 4Q9SA 2ZV9A 2HXQA 2OFUA 2R3IA 3DB6A 3ERKA 3D5UA 5GINE 2W4JA 1WBPA 4DG3E 2VTNA 3D5XA 2BVAA 4A9UA 4MNEB 5L6PA 3ZCLA 1K9AA 2X9EA 3Q9ZA 4LGDA 3A7GA 4JBQA 2PY3A 5HG7A 3PVUA 3HLLA 3A8XA 1Z5MA 3GC8A 4JIAA 4MWIA 4K33A 4QMXA 3FC2A 4TYGA 2V7AA 2ZV2A 1ZYCA 4FSUA 4EH4A 3GU4A 1WBTA 2HWPA 4NZWB 4HYHA 4CTBA 4FV6A 2EVAA 1KUTA 2PVFA 4FGRA 2WGJA 3F5XA 3FMKA 1JSTA 4G3CA 3BRBA 3HX4A 3WARA 5HD7A 4USDA 4C4HA 2P55A 5FDXA 2R5TA 2H34A 3WF9A 3MN3A 3UBDA 5IUIA 4GU9A 5JGBA 2F2CB 5L3AA 4PTEA 1PMNA 1W82A 3MB7A 4YU2A 4XYFA 2A27A 4MXOA 3MH0A 5AUYA 4EEVA 1FVTA 4FTAA 5AR7A 2UW0A 4RWKA 4FV1A 4F7NA 2WMWA 3C9WA 4ERWA 1MQ4A 3HGKA 4L6QA 4RIYA 4Y95A 5BUIA 1YW2A 4BWPA 3UG2A 3R9RA 1ZMVA 3L8PA 3GU8A 3PY1A 4RX8A 5IA0A 3PY3A 5IF1A 4H05A 4OT6A 4NM0A 4ASZA 3PSCA 2REIA 3W2PA 3LXKA 5C4KA 2QKRA 4M13A 4I6BA 4E4NA 4AA0A 5HCXA 4PP7A 4QPAA 4M8TA 5AUZA 2P3GX 3UQFA 2BZHB 1B6CB 5CLPA 1CKPA 5EM5A 3VBWA 5AA9A 3WF6A 3VIDA 3ODZX 4Z16A 2ERZE 3C50A 4PMSA 1H8FA 4AG8A 4ZJJA 5M4UA 5IQGA 1YXTA 1XKKA 4JDIA 3IQ7A 4QMUA 3ZXTA 2BRNA 2UUEA 5G1XA 4EYMA 1UWHA 2C6MA 3VS3A 2BHHA 3UIBA 3LQ5A 3LCKA 3C5IA 3LM0A 3ET7A 4E20A 2QR7A 4MF1A 1KWPA 2Y4PA 2O5KA 4KA3A 5DVRA 5HBJA 3PDTA 4CD0A 3R2YA 5I4NA 3MBLA 5AIKA 1VYWA 4TRLA 1XQZA 1ZXEA 3SRVB 3R1QA 3V04A 3F61A 1MRVA 3HDMA 3MJ2A 3QTXA 5KMOA 4RQKA 5CAVA 1OIYA 1WFCA 3AC2A 3FL4A 1QPCA 3I6WA 2JLDA 4GIIA 4LV5A 4IFCA 5AR5A 3IGOA 2J7TA 4JVGA 2C6LA 3MVJA 4PDOA 3OS3A 4TWNA 3SLSA 5I9ZA 4OAUC 4YLKA 5EKNA 1Q8UA 3RM7A 4CRLA 4NIFB 1UU8A 3LW0A 4R1VA 5FUTA 2WMXA 3BHHA 5ETFA 3T9TA 3TI1A 4O38A 4RMZA 3T9IA 4JQ7A 3RINA 4BYJA 5CXZA 1QMZA 2WEIA 5C8KA 4D4VA 3BE2A 4EK8A 5HE3A 4O7RA 2OZAA 1OKZA 5C4LA 4I23A 3RKBA 2E2BA 2GSFA 1B39A 4BBMA 2PE1A 3UZRA 4IAFA 4C0TA 2RL5A 3WILA 5IG1A 5LQFA 4YJQA 2DYLA 5CEIA 3DQXA 3SQQA 1M7NA 4J52A 2XJ0A 3FZRA 4J8MA 4O2ZA 5IDNA 2C5NA 2V22A 1OBDA 3R8PA 3I1AA 1KV2A 4FV3A 5D41A 3H9OA 4RX5A 3KRJA 4R3RA 1ZZ2A 2J5FA 4XEYA 4IB0A 2IZTA 4IXPA 1ZYJA 2W4OA 5AR4A 3ZS5A 1R39A 4FIGA 3EZVA 3C4XA 2JKOA 3K5UA 3RCDA 3UOLA 2BHEA 4FKSA 4OTRA 5ANJA 3HZTA 5EM8A 1PXKA 2C6IA 1JBPE 5DNRA 2HW7A 4DEBA 4BB4A 4FEXA 1R0PA 2C5XA 3VW6A 3NDMA 3I5NA 5EOLA 3OUKA 2VO6A 3UDBA 4E6DA 2O0UA 4M84A 2CGVA 4DT8A 2YCSA 4YGAA 1ZOGA 4H3QA 2GS6A 2RF9A 1AD5A 3Q6UA 3R7UA 4G6OA 5CS6A 2HYYA 5A54A 3F3TA 3QF9A 1GZNA 3GBZA 5FGKA 3KC3A 3SX9A 2A0CX 3F3UA 5KHXA 5E7RA 5DFPA 3L9PA 3I6UA 4JBOA 4KIKB 3S4QA 4IHPA 1FOTA 3GGFA 3EQDA 4L9IA 4RC4A 3U9CA 4ZY4A 3C4WA 5LXMA 2X2KA 4IACA 3CQUA 3R8LA 3PPKA 3R9NA 4FTMA 4IM2A 3D9VA 3R7YA 2RFEA 4HNFA 4XX9A 3DJ6A 4F65A 4DEAA 4RFZA 4ZIMA 4BCJA 5AP5A 1W98A 2G2FA 1T45A 2X2MA 3R8UA 3RHXA 2HENA 4I3ZA 3IW6A 3P79A 4FTTA 3V8TA 4IEBA 2OW3A 4F9AA 4XP3A 3C4FA 3QUPA 4U8ZA 1IASA 4ANQA 4L68A 1Q62A 5AR8A 1DI9A 4YTFA 3DNEA 5ETAA 2ZJWA 1JQHA 1IA9A 4QPSA 5LCJA 5M4IA 3NAXA 2GNFA 3WBLA 4CVAA 3OW3A 3F5PA 4O84A 4LOQA 4NKSA 4C8BA 4FUYA 3DOGA 4GYGA 3HRFA 2IPXA 1JWHA 2PK9A 2DUVA 5DEWA 3IDPA 4BCIA 2XIXA 5E4HA 5EW3A 2W5BA 4LG4A 4RJ6A 3TUCA 2P2IA 5A14A 2F9GA 4AT5A 4ZS4A 1YKRA 2E9PA 4C4FA 5L2TA 3ORLA 3K3IA 4I5HA 2UVYA 3F69A 3DXQA 4WG3A 2QNJA 3KCKA 4U3YA 3ZU7A 4QRCA 3GB2A 4U7ZA 3ORXA 4C02A 4FOBA 4Q2AA 4PV0A 4S33A 3FEGA 3BI6A 3ZUUA 4ASEA 4JAJA 4E8AA 5B2KA 2XIKA 1SZMA 4U6RA 3FXXA 3S00A 3EKKA 2W0JA 1K2PA 4U43A 5CU4A 5E8WA 3Q5ZA 5KZIA 4ZAUA 4Y5QA 3GC9A 3G15A 4EOKA 3R1YA 2C3LA 2G2IA 5CNOA 1U54B 2VV9A 1KE5A 3BYOA 2A4LA 3I79A 3NUPA 3PZHA 4QTDA 4R1YA 4PPCA 4FKIA 4PX6A 3G6GA 2ITUA 2BKZA 3WIGA 3IDBA 3ZRKA 4N57A 5DE2A 2GQSA 3LAUA 3MPAA 3RAHA 3UPXA 2W1CA 2WOTA 3OMVA 4IVAA 5EYDA 3LQ3A 4EQCA 4PPBA 5J7HA 4CG8A 2XK8A 3NNXA 2IW9A 2WTWA 3VQUA 3ZBFA 3ZRMA 2FUMA 2Z7QA 3C0HA 3GU7A 4IWOA 4FSQA 4WNPA 3N4UA 3FLZA 3A62A 2QOHA 1OIUA 2J0LA 4JG6A 1T46A 3HNGA 2WZJA 2YM5A 5A9UA 4BZOA 4HYSA 3ZO2A 1H08A 1VJYA 4BIEA 5FG8A 3LMHA 5J5TA 1E1VA 4ACDA 1W8CA 3OCBA 3SKCA 1IR3A 1PJKA 2R3FA 4DTKA 2R3LA 3R7IA 3SAYA 1V0PA 4FKQA 5ACBC 5HI2A 2W9FB 1PYEA 2XIRA 5EOBA 2O2UA 2R7BA 4AFJA 4EOPA 4EKLA 4QMLA 5EHOA 4PL4A 3JUHA 2HZ0A 3KMUA 2UZWE 3KFAA 2FH9A 4L46A 4XOYA 2WO6A 3FBVA 4UYAA 3WZDA 1ZRZA 3SDJA 3R7EA 1OGUA 2PSQA 3D7TB 2W9ZB 5AV2A 3MDYA 3S2PA 4H58A 1FGIA 2ZMDA 3VBVA 3FKNA 4A7CA 3NVKI 2VTMA 3V01A 3HRBA 3Q32A 3NMUF 4FSZA 4NM7A 3GCQA 3GU5A 3DFCB 3RGFA 5EKOA 3DNDA 3I60A 4G17A 3O23A 4FGBA 3RMFA 1YWRA 3AC3A 3Q60A 4FTRA 4C57A 3SG8A 2X7FA 3FQHA 4D4SA 5M4CA 1PXJA 3SXRA 4O7LA 3VS5A 3LZBA 5ANKA 2QOIA 4FSNA 3W10A 2W05A 3Q4ZA 4FVQA 3W2CA 4XMOA 4DGMA 2E9UA 1Q8YA 3FJQE 3JYAA 4V0GA 3V6SA 4FIEA 3TT0A 4WNOA 4PDSA 5J8IA 3KULA 4ZLYA 1YHVA 2JFLA 3JPVA 3ITZA 2CMWA 2H9VA 2JBPA 1PMVA 4AGWA 4USFA 4D28A 5EQPA 4NTTA 4PTGA 2B0QA 3EFJA 2VD5A 1YXXA 4FC0A 3UTOA 5LWMA 3LMIA 1O9UA 3ZC5A 4V04A 2W7XA 4JX3A 4KUJA 1YI4A 1H00A 2EXCX 4NJDA 3VWAA 3DKCA 2HY81 5BUJA 3QA0A 3FY0A 2VN9A 5CWZA 2OJ9A 5JMSA 2R3HA 3FPMA 4LYNA 4UMRA 5HIEA 3GCUA 4IQ6A 4BGHA 4KIOA 2YM7A 3FI2A 4TYJA 3SOCA 4AW2A 4B8MA 1Q99A 4CYIA 1LR4A 4FK6A 4U40A 5JN2A 4IVCA 3HV3A 3HP2A 5T68A 5CEMA 2VO3A 3MTLA 2FYSA 5CI6A 4E73A 4RJ8A 4NJ3A 4YO6A 3A8WA 4MWHA 5EYKA 2IW8A 4FNYA 4HOKA 4C35A 3CEKA 4PQNA 1JSVA 3V51A 2ZDUA 4IZAA 2UW5A 3DY7A 4EH2A 2PWLA 4WBBB 4XP2A 3UNJA 3DTWA 1OB3A 2EXMA 1H24A 3NR9A 4O0VA 3KF7A 3FWQA 4OTQA 4EUTA 3OW4A 1YDSE 4NKAA 3P5KA 4S2ZA 4I20A 4RVTA 4BZNA 4QQTA 4FL1A 5H9BA 3VUTA 5LOHA 4FV0A 1J1CA 3OWKA 4D1XA 4BWXA 3QQLA 5L2SA 3ACJA 5A4CA 2XF0A 1Z57A 2X4FA 3NUYA 4LOPA 4NW6A 2OH0E 3W18A 3WZKA 5HO7A 2VWXA 3EN7A 4F6WA 1PHKA 5GHVA 3COKA 3DXPA 3ZLSA 4HJOA 2PUPA 3UIMA 2WIHA 3DBDA 3PXZA 4FEVA 3DV3A 4FEQA 2OSCA 4XCUA 2BAKA 5A4EA 5CF4A 2WMQA 3CIKA 3FI8A 1H1PA 3VS1A 5GIOE 2QOKA 4U5JA 2BILB 4ACCA 3AGLA 3B8QA 3E8DA 5BX0A 2WMBA 2QKWB 3I81A 4FG9A 3AT3A 5C9CA 1G8SA 2IW6A 4BBEA 4XG7A 3OXZA 4DLJA 3THBA 4B8LA 4H1JA 3UVRA 2CNQA 3D7ZA 5D9HA 3EQHA 4X6RA 4J97A 1YHWA 1ZAOA 4FX3A 2WKMA 3BLQA 4X2JA 3CKXA 5CU3A 4NCTA 3VVHA 5DA3A 4BDKA 4E3CA 4FT3A 3UC3A 2CNUA 2BTRA 2W1HA 1GY3A 4C3RA 3JY0A 4EH8A 2WTVA 1CMKE 2OH4A 2ACXA 3MIAA 4MH7A 4PY1A 3TIZA 3U4WA 4DC2A 4NFMA 4B9DA 2XCKA 2ZB0A 4APPA 3VJNA 4UWBA 2ZV7A 3BHUA 3L1SA 1O6KA 3QTQA 4AFEA 3MGYA 4FEUA 3OC1A 4I4EA 1UNLA 1Z9XA 2WMVA 3BQCA 4JDJA 5IEXA 3QXPA 3VN9A 2EWAA 3BZ3A 1YXVA 2ONLC 3E88A 3NW6A 3O50A 4U80A 3TWJA 3VS7A 3L8SA 4WSQA 2W99B 2WQBA 2YIRA 4W4YA 3KRXA 4DHFA 5KMJA 4EK3A 4PWNA 4ZSLA 3QZIA 4B4LA 4C2VA 5AP4A 1BI8A 1V1KA 5M44A 4QQ5A 3GFWA 2OFVA 5F1ZA 2BTSA 4DH8A 3IW5A 3LFSA 4WRSA 3PP1A 4FKGA 3R1SA 4GK3A 4F64A 3IW8A 4CFVA 4PTCA 3LFBA 5FD2A 1Y6AA 2NNWB 2RG5A 2YWVA 3NW5A 2BIKB 5HTIA 4MX9A 2WTJA 4I92A 3FXWA 5J5SA 4MD8E 2J9MA 3AC1A 4UV0A 5LVPA 5GJGA 3TKIA 4DG0E 1Q8TA 4I6HA 1SVHA 4KD1A 4I0TA 1PKDA 2GCDA 4G2FA 3HMPA 2OGVA 2YM6A 5CVFA 4YURA 5HX6A 4GUEA 4X2FA 2PZ5A 5ITAA 4FKPA 4RIWB 4QYHA 1OKVA 1H4LA 3C5UA 4K18A 3LJ2A 3QZFA 2ZDTA 3EFLA 3UNZA 3VF9A 4RC3A 3FZ1A 4YLJA 1OL7A 2R9SA 2I0HA 2OBJA 4ITJA 3DAJA 5KCVA 3HP5A 4F63A 5DT0A 5HOAA 4FIFA 2IN6A 3UE4A 4BIBA 2J90A 3FI3A 2F7XE 3FMJA 2B52A 5GZ8A 2EB3A 2CN5A 3UZTA 3ULIA 4I4FA 2VTTA 2IVTA 3UG1A 3H0YA 4O1PA 4EOSA 2VUWA 5AP0A 3EYGA 1U4DA 1Q41A 4IB1A 2WNTA 3QYZA 5IA1A 2ESMA 3R1NA 5HZNA 5ANOA 3I4BA 4E4XA 2CNVA 2PVKA 3SXSA 5BYLA 2WMRA 2X8EA 5KNJA 3A99A 2J4ZA 3BU5A 3H9FA 1PW2A 1GAGA 3C1XA 3ZUTA 5KMMA 3NUAA 3TXOA 2GHGA 1PMUA 2VO0A 1NVSA 3LQ8A 4JXFA 4BL1A 4YC3A 2Z7LA 3ANRA 3Q96A 2X0GA 2UZEA 3P1AA 4PDPA 5IQIA 4TT7A 4V01A 3NUSA 4ANOA 5CAQA 3I7CA 3ZDIA 1WCCA 1YHSA 4EK5A 4M67A 4N0SA 3MH2A 3W33A 3UP2A 4AZEA 3WI6A 1QCFA 4L43A 5HNGA 4GVJA 3W8LA 2IG7A 5TF9A 3E3PA 5AP6A 2XKFA 3E8CA 1R1WA 3LVPA 3ORKA 3GFEA 4S32A 3H3CA 2NPQA 1U5RA 3ZFMA 2GQRA 2G2HA 3G33A 3BV2A 3LLTA 4FKWA 3ZMMA 3R02A 5DT3A 4IM0A 4R77A 1TQIA 4K2RA 3BU6A 4FT7A 4KSQA 5HBEA 4FBXA 3BE9A 5HICA 2EXEA 2VWZA 3CP9A 2VWWA 1YI3A 2W4KA 3E87A 4MBIA 2PVHA 1W84A 2CKOA 3N4VA 2CJMA 1P14A 5EW8A 4O0WA 4MTAA 4RZVA 4ZJVA 2CGWA 4W9XA 4JDKA 3FAAA 4ZSGA 5I3OA 3ATTA 3DKOA 2YIWA 3NYOA 3DDQA 5BVWA 5K4IA 2XEZA 4BI0A 3BKBA 1PMEA 5IA3A 3GCPA 4EK6A 2EB2A 4R6VA 4XV2A 1XBAA 2BCJA 4AAAA 4F9BA 4AZVA 4DFBA 1VZOA 4BKJA 2GNJA 2XCHA 3A61A 3PJ3A 4FZ6A 2QLUA 5EM6A 2G01A 5C01A 2JDSA 3I5ZA 5AP7A 4AACA 1M14A 2ITTA 3FMNA 4L44A 4DGGA 5KMIA 1A48A 3TNQB 2VWIA 4KKHA 4IAYA 4ANNA 2HY0A 3OROA 3P7BA 4EOQA 3MSSA 2ITNA 3MYGA 3FHRA 3OUNB 2OXYA 3R7VA 3Q6WA 1QPJA 5LMAA 3CY3A 2J0KA 2BUJA 3KXNA 4ORKA 4NK9A 1KSWA 4UX9A 3ORIA 3PSDA 3CGOA 1M2PA 4A4XA 3ZXZA 5E8XA 5E90A 4IZ7A 5A4TA 5DYJA 4KIQA 3FZOA 3LOKA 4LL5A 3CJGA 4DF3A 3WZEA 4UY9A 2W1DA 1J3HA 2C3JA 2X6DA 3MVLA 3PRFA 5AX3A 4C59A 5EQYA 2B4SB 2WU7A 4EZ3A 4EKKA 1KE6A 4ACHA 3JY9A 2GQGA 2H8HA 4DN5A 2QOQA 1H28A 3QWKA 1Y6BA 1ZLTA 4FZ7A 3D5VA 4IAZA 4KBAA 4WA9A 3N51A 3VRYA 3PIXA 1XH8A 1JKSA 1VYZA 2BRMA 4C34A 5HU9A 4O86A 1PKGA 4EORA 3S0OA 4AZTA 3NGAA 4D9TA 5HE0A 4OTPA 4DGOA 4JBPA 2OLCA 1HCKA 3PIYA 4TYEA 3IGGA 4QTAA 4RLLA 4R78A 3E7OA 1OPKA 4CEGA 3UPZA 3QQJA 3TZ7A 4O6LA 3F7ZA 4JR7A 4D2VA 4O0SA 4OTFA 2LAVA 5CF5A 4ALUA 4FMQA 3OVVA 4E7WA 5J9LA 4FKTA 4FG8A 5DEYA 5EH0A 3GNIB 5KBQA 4PUZA 3P86A 5T6KA 4EWHA 4U44A 5F94A 3UO6A 4QMQA 5L2WA 2HZ4A 2R3JA 4I93A 3VHEA 3QLFA 4GFGA 2IVUA 5CALA 1STCE 2PZRA 2ZYBA 3KREA 2AC3A 3QWJA 3MY5A 2PYWA 3BX5A 4JS8A 4RRVA 5EDPA 3FQSA 3DJ5A 3PXRA 3QL8A 4GVAA 1XH9A 4X2KA 3E7VA 2C5VA 4LRKA 3WIKA 1BUHA 1PY5A 3M11A 3GENA 2XKDA 3PYYA 2X1NA 5BVEA 2ETRA 4P2KA 4LRJA 3DK7A 4A9TA 3COIA 1NVRA 2JDRA 4JIKA 3C7QA 5EM7A 4FIHA 4RBLA 5TE0A 2WEVA 3W55A 4BTFA 2GNIA 2VGPA 4UXLA 4ACGA 3TM0A 4LMUA 4ZXTA 1SYKA 5JGAA 1ZOHA 3BIZA 3LFFA 4FOCA 5C03A 3ZH8A 3RK9A 2VWBA 4DFXE 2VX0A 2JKMA 4CFUA 5KMNA 3CY2A 3FMLA 5CZHA 4WG5A 4CFNA 4FSTA 3GOPA 1UU3A 4ZOGA 4KRDA 4QNYA 1Q3WA 3QHRA 2UZTA 4UBAA 4J98A 3CSVA 4C3FA 2QU6A 4X6QC 4QMTA 4BDHA 4NYEA 4ITHA 3MY0A 4O22A 5DLSA 3SV0A 2BRHA 3C51A 5I9UA 3AMAA 2I0EA 2QLQA 1Y91A 3PSBA 3EN9A 1Q8ZA 4YJTA 4JAIA 1SM2A 3PJ8A 3U87A 3V3VA 3NLBA 5J1WA 4YHJA 4M12A 3FLYA 5CF8A 4FTQA 4G5PA 3V8WA 4Z7GA 2R3MA 3GEQA 2JKQA 3P4KA 3R21A 4D2PA 2OIDA 3NEWA 5F95A 4C3PA 3U6JA 4W9WA 4AGUA 4LM5A 4GFMA 4M69B 2YISA 3RAIA 4BKYA 4X3FA 4AZWA 5CXHA 3QD4A 4LI5A 4APCA 2Y7JA 3PFQA 2X8IA 1ERKA 3MVHA 4R3CA 3WE8A 4I22A 3QZHA 3WOWA 4YZCA 4FIJA 1M17A 1ZWSA 2FGIA 1G5SA 4KKEA 2VO7A 3G6HA 3OT8A 5B2MA 4G6NA 2QU5A 5EHYA 4E6AA 5E1EA 3OTUA 3D83A 5AR2A 4DH1A 5AJQA 2RFDA 5LVOA 3W2QA 3FKOA 2JITA 2XBJA 3IO7A 4FKRA 5T3QA 4HVSA 4I24A 4QTEA 5AUXA 3UJGA 4K11A 3TZ8A 3P08A 4BFMA 4UMPA 1XHAA 4MNEA 5C8MA 5M57A 4X0MA 5D10A 2Q0NA 2ITOA 3A60A 4Q5HA 3UP7A 2R3PA 5A3XA 5M4FA 4FKVA 4R3PA 1RW8A 4BYIA 3NYVA 5I9WA 4BWKA 2W1FA 1Y57A 4FNZA 5CSXA 5HIBA 2DQ7X 5IQEA 3SVVA 3VULA 3L9LA 5AAFA 4E5BA 2B9FA 3TDVA 5I9VA 3Q5IA 4I1ZA 4RA5A 4GW8A 2OO8X 4FVPA 2QCSA 5HCYA 1QL6A 3O51A 2OI4X 4FYNA 4OUCA 4BIDA 4C2WA 4YZNA 3IW7A 1U46A 2ZM3A 4I5MA 5D11A 5CSVA 3QC4A 5AMNA 4JJRA 3ALNA 4MXYA 3I0QA 5J9YA 3EN6A 4QP9A 3PUPA 4R8QA 4UB7A 1JOWB 4G3FA 4IZ5A 4BTJA 4LFIA 3SW4A 4GUBA 4TPTA 4CZYB 4JOAA 4XUFA 5CEQA 5HTCA 2GS7A 4BZDA 4JNWA 1ZZLA 3KCFA 1P5EA 3QD2B 3IW4A 1JPAA 2XP2A 4QYEA 1LEZA 5D7AA 3ZLWA 2YJRA 3CC6A 4IJPA 2ETMA 2VTHA 3W32A 5H3QA 3F2RA 3VS0A 3BEAA 2XNMA 4FTOA 3R9OA 4W4WA 4RJ4A 4YJSA 4YTHA 5FBOA 4XRLA 2CGXA 4K8AA 2YM4A 3G9NA 2HOGA 4LMNA 4ZY5A 4NT4A 5IQBA 3LFQA 3ZM9A 3BWJA 5JZNA 3GQLA 4GG7A 5IKWA 4MHAA 3UODA 1OIRA 2XUUA 3ZOSA 3U4UA 2QURA 5A46A 4D4YA 2F7ZE 4ALVA 4WIHA 5HVYA 3KXGA 3GT8A 3KXMA 3PPJA 2NRYA 3AC8A 4D5HA 3RK7A 5AP1A 3HV6A 4ZZMA 2XRUA 2FSTX 3NIEA 4F7JA 3BEGA 3SRVA 4ENXA 2Q83A 2WQOA 3UYSA 4CCUA 1JKKA 5GIPE 4U41A 5CNNA 4AW1A 3RPRA 1OPJA 3DQWA 3ETAA 3RHKA 3ZTXA 5F9EA 2OWBA 3VUIA 2FA2A 3QTWA 5AV0A 4D0WA 4YR8A 2PUIA 3MFRA 2JKKA 4O7NA 2IVSA 3BELA 4NIFA 5DRDA 5LMKA 3BU3A 4DTBA 3FHIA 5AR3A 4BHNA 5GZAA 2Z7RA 3RNYA 2BPMA 3RWPA 4XG3A 4YC6A 2ZOQA 1CKJA 2XNGA 4IJ9A 3UVPA 4MK0A 4EOIA 1JLUE 4CMTA 4QP3A 2VWVA 4IAIA 2CDZA 5FQDC 3LIJA 4ZMFA 3MH1A 5DR2A 2OJIA 3S3IA 4EH7A 1H1SA 2O3PA 2HELA 3FQEA 3MIYA 4ENYA 2DWBA 4AGDA 3KK8A 1XWSA 2X8DA 2JD5A 3ANQA 2VTLA 4FZDB 3UIXA 2QOBA 5M51A 2YABA 3CTQA 2C6DA 3Q4CA 1OL6A 3UZPA 3OCSA 4AA5A 4YBJA 2HIWA 3TEIA 3R63A 4IC7A 2BDFA 3KY2A 5JQ8A 2ZM4A 4O2PA 2ZM1A 2VTJA 3V5WA 4I0RA 4A9YA 2AUHA 3QRJA 1YI6A 5IQDA 1FMOE 2AC5A 5AFVA 3PJCA 1QPEA 4BTMA 4YC8A 4LUEA 3B2WA 4BDEA 2YEXA 2BFXA 2ONLA 2XVDA 4GU6A 4C58A 3HAMA 2I0VA 1GIHA 2OF4A 2UW9A 3LFCA 2BMCA 3R00A 4EWQA 2B7AA 3CXWA 2R3OA 2XIZA 3EMGA 4TKSA 2DS1A 5IQAA 1Q4LA 2HZNA 1DI8A 1V0OA 4EUUA 1PXIA 5FEDA 3T8OA 3GUBA 3R6XA 5IEVA 4FV7A 4FSYA 3A7IA 3LCSA 4J53A 2WTCA 4ZP5A 3FI4A 3R7GA 4YJPA 5IA5A 2X81A 5GJFA 3JS2A 4GJ2A 5AWMA 3H4JA 4CCBA 3ZSHA 4F9CA 2HWOA 3NNVA 3OBJA 4KIKA 3TJCA 3BCEA 4AWIA 3DBCA 1ZYSA 1AQ1A 4UYNA 1ZMWA 4ANMA 3D5WA 5HG9A 4BICA 3IOPA 4D55A 5H8GA 1WBWA 5AX9A 3FMDA 4NTSA 3CQEA 3AMYA 4FTJA 4RPVA 4L3PA 4FKOA 4DEEA 2YDIA 4AOTA 2QC6A 4FL2A 5KKRB 4R5YA 3F3ZA 2CKEA 4YJNA 5HIDA 5JRSA 5AM6A 3SC1A 1SVGA 3FSKA 5E8VA 2WB8A 3W2SA 5HD4A 2J5EA 3CKWA 2VTIA 4FTNA 3U55A 4CLIA 1WMKA 1YVJA 3VBTA 4KNBA 3ODYX 4HZRA 1FMKA 3HYHA 4R5SA 4U97A 2W17A 4DEIA 3LLAA 4AP7A 3OOMA 4CT2A 3QRIA 3MV5A 4OBPA 4AOIA 4BGQA 3AC4A 4PP9A 3ZFXA 5B7VA 3QQUA 3NUUA 2QOFA 4FR4A 5H8BA 3RPVA 2BAJA 4CZTA 4DINA 4I94A 3UMWA 4PL5A 2LGCA 3FDNA 4LGGA 5EW9A 2RIOA 2R0IA 4AE9A 3FZTA 4F1OA 3O96A 3NVMB 2OIQA 5IZFA 3OEFX 1GNGA 3HA6A 1FBNA 4C37A 4XV1A 3BYMA 3AMBA 4ZSAA 4B99A 2HCKA 4M3QA 4I0SA 4BVUA 1I09A 4CFWA 5HKMA 4H3PA 2XA4A 5I5ZA 5CVHA 3PLSA 1ND4A 4RIXB 4KAOA 2QOOA 1H1WA 2VX3A 3C13A 3OXIA 4YJVA 5IUHA 5CAOA 3MJ1A 4IFGA 4K9YA 1R78A 4JG7A 4DCAA 2F57A 4RWIA 5CI7A 4GSBA 4ZY6A 4FSWA 4U3ZA 3O8TA 3MA6A 3BHTA 3KKVA 4NM3A 5K3YA 1PXLA 1SVEA 5CAPA 1U54A 5EHLA 5LWNA 5CX9A 3E8EA 3ENMA 3FLNC 1H07A 4ZTSA 5FEEA 4QMMA 2PMIA 5E91A 5BVOA 3MVMA 4BCKA 4YZMA 4F9WA 3KN6A 4G9RA 4L00A 2PVJA 4J99A 3PIZA 3LXNA 4GK4A 5K5XA 3VHKA 3R01A 2VGOA 3RJCA 5BPYA 4II5A 2OK1A 2XH5A 1F5QA 2FO0A 3L8XA 3OWPA 4O0TA 4RVMA 4WSYA 3QCQA 3COMA 1U59A 2SRCA 4HGEA 2Y6MA 3KGAA 4KS8A 2O8YA 3MS9A 4RX7A 4V05A 4BCHA 4DH7A 1QPDA 2YN8A 3P9JA 3TV6A 4HGLA 1J7UA 3F3VA 2QO7A 2PU8A 1BI7A 3R28A 5DPVA 4P90A 3QLGA 1URWA 3COHA 3D14A 4CSVA 3A4OX 4AN2A 2VZ6A 3KK9A 2VWYA 1YDTE 2BZIB 2GFCA 2XNNA 4H36A 4YLLA 3VUKA 2VU3A 2BDJA 4CT1A 4NEUA 3PVGA 2WXVA 3K3JA 3QA8A 4FV5A 3MESA 3FV8A 4AT4A 2GNLA 4DAWA 2GFSA 4EBWA 3TJDA 4ACMA 4EHGA 4BCMA 4MKCA 4OBOA 5ANDA 4L01A 4DEHA 1ZYLA 3DGKA 4G5JA 3ZM4A 3D7TA 2WELA 4OTDA 5E8TA 3FSFA 4KBKA 5FEQA 2WTKB 3DLZA 3PZEA 3Q9YA 2JBOA 5BVFA 5KZ0A 3ACKA 2JFMA 5D7VA 4YHFA 3LKMA 2BRGA 4JRNA 3HUBA 4MCVA 4U81A 2J51A 1J7LA 1YOLA 3DBFA 5CQUA 4RC2A 3ORNA 1OMWA 1ZARA 4BDGA 1IEPA 3CQWA 2ZAZA 3DK3A 5DIAA 4J7BA 4M97A 2QODA 3DZOA 4YMJA 5CT7A 2UZOA 3Q4UA 1I44A 1PRYA 1JSUA 1KV1A 4QT1A 4TXCA 3BPRA 1BKXA 4E4MA 3BBWA 3W2RA 1XJDA 2IZSA 2QONA 1XH4A 1BLXA 3RNIA 2HXLA 2YAAA 5FM3A 5DI1A 1WVWA 2C6TA 2JAVA 4FTLA 2G15A 3LCTA 4D5KA 3VJOA 4XG2A 3NCGA 3UOHA 1Q3DA 4G31A 1BYGA 5GNKA 2XNEA 4QP8A 5KO1A 2YCQA 3QQKA 3MFUA 4JQEA 4L42A 4MVFA 2PUUA 3FYKX 3TTJA 3O7LB 3QRUA 4RX9A 2CKQA 3I0OA 3VNTA 4L3JA 2OZOA 5LARA 4CQGA 3OZ6A 4RLKA 5HVKA 4EOLA 4XRJA 2JIIA 4QOXA 4MQ2A 3EQIA 4LGHA 3DBEA 2H6DA 4TWCA 2WMSA 3F2AA 4U9AA 4AE6A 3HA8A 3QTSA 2ZB1A 3LE6A 2E9VA 1NY3A 3TL8A 3DU8A 3DS6A 2Y4IB 2C0IA 4GKHA 2NO3A 3MTFA 2QD9A 1NXKA 4XH6A 4XBRA 5FDPA 3U8WA 2I40A 5FXRA 4Y85A 3EHAA 3ZSGA 4JL9A 3QGYA 4O6EA 3D2IA 3IG7A 4G9CA 4O1OA 4BDAA 4PRJA 5EK7A 1IRKA 4PL3A 4NUSA 2IO6A 4OT5A 3VRZA 4RFMA 2WMTA 2QQ7A 3UGCA 4CMOA 5IA4A 2E9OA 5IQFA 2ERKA 3ELJA 5BYZA 4LL0A 4EK4A 4ZMEA 3LXLA 3ULZA 4C62A 4EJNA 5BVKA 4MEDA 3VF8A 2VTPA 4P5ZA 3HAVA 4TYHB 2WTDA 3TKHA 5JRQA 3A7JA 4A9SA 3FUPA 4OTIA 3QCXA 4MXXA 3UYTA 3M42A 3NYXA 4AQCA 5JFWA 2UV2A 3O17A 3QBNA 4RG0A 2J50A 2I0YA 2XMYA 4Y83A 5M56A 2B55A 3LHJA 2Y0AA 4ZLOA 4FF8A 3PXQA 1KOAA 3W8QA 5ANGA 3KXXA 5L6OA 2BRBA 3MWUA 4BDCA 2OF2A 2OIBA 3GC0A 3AQVA 3PE1A 4EZ7A 4AZFA 4DH5A 4JRVA 4Q9ZA 2BZJA 4DE4A 1UU7A 4FTCA 3R04A 5AA8A 5EQEA 4NFNA 4NH1A 4I6QA 2WQNA 3GI3A 3EOCA 3IDCA 3H9RA 3LXPA 5LVLA 5BUEA 3QD0A 4EYJA 1A06A 3A4PA 5DT4A 3DXNA 4PDYA 2O65A 5AUVA 3DFAA 3T3UA 1DAWA 3ORPA 4WD5A 4EHVA 4DFLA 4L7SA 5EDQA 5HLPA 4W8DA 3ALOA 3E63A 3HDNA 4BR3A 4EBVA 1UNHA 2ITVA 5E92A 4K6ZA 5TT7A 4AN9A 1ZYDA 3DAEA 1NW1A 3ENHA 4EOMA 3QQFA 4IM3A 3RTPA 4A07A 4TWOA 3ZEPA 2X6EA 5H8EA 4IWDA 3V8SA 2GDOA 3E3BX 2C5YA 3D15A 5FP6A 4RJ5A 4C33A 5C27A 3EWHA 3LMGA 1XBCA 2R2PA 2WD1A 2XK7A 5CQWA 1OITA 3HL7A 3ZRLA 2JIVA 2Y9QA 3W1FA 2IJMA 4ZTNA 5JT2A 4TYIA 3R2BA 4ZSJA 4GT3A 2C4GA 2YZLA
chains in the Genus database with same CATH superfamily
2GTMA 2BKKA 4E93A 4LQMA 4K0YA 4BF2A 4F9YA 3OWLA 4TL0A 3TKUA 5DHJA 5AP2A 3FY2A 1P4OA 3E5AA 1IG1A 4GK2A 4YBKA 4EOJA 1H1RA 4S34A 2QO2A 3EN5A 2XYNA 3QTZA 3EFKA 2JGZA 2PL0A 3FZSA 5BMMA 1LP4A 3KL8A 4RVKA 4Y72A 3ZLXA 4IX5A 3ZC6A 4XHKB 4RJ3A 4U45A 4XBUA 5JSMA 1F3MC 1URCA 1PXNA 3EJ1A 4GH2A 4FSMA 5DWRA 4NM5A 3ZO1A 4XJ0A 2XYUA 4EC9A 3TG1A 5ANIA 3BYUA 4MD9E 5KKRC 2R3QA 1Q97A 2YERA 4QYYA 4MXZA 5FXQA 3VUHA 4RIWA 3QC9A 3SG9A 5DRBA 5BQ0A 2PZYA 1VEBA 4RIYB 4TNDA 4U0IA 1REJA 3QAME 4HYUA 5LCKA 3FXZA 3R8MA 3QXOA 4A06A 4O4DA 3NNWA 2FSOX 4FUXA 3OXTA 3QCYA 4CLJA 1DS5A 1YDRE 1UWJA 2X2LA 4D9UA 4TNBA 2YIYA 4GMYA 4U42A 4YO4A 4RJ7A 4IE9A 1DAYA 2JDVA 2UZUE 4B7TA 3QD3A 4N70A 4XG6A 3RBWA 2IVVA 2QHMA 3QYWA 2W1GA 2HAKA 4O0UA 4UWYA 3QCSA 3OCGA 4IVBA 2PULA 4FZFB 3KVWA 4J71A 3JXWA 3CR0A 3DKGA 3NSZA 4C61A 4MBJA 4X3JA 4OBQA 4X7QA 4FZAB 1H26A 3QFVA 4L52A 4ALWA 5B0XA 1ZY4A 5A4QA 5I9XA 4RFYA 3TUBA 2B9HA 1SNUA 2X39A 3DAKA 3EQCA 4PMMA 5CU0A 4JDHA 4AXAA 1OUKA 3VBQA 1NA7A 4C4EA 1WBVA 1P2AA 4E5AX 3WF7A 4YZDA 3RZBA 1CTPE 3PG3A 3R9DA 3ZO3A 1BMKA 3AXWA 4H3BA 5IEYA 3DLSA 3DA6A 3FYJX 2UZNA 3TCPA 1UVRA 3CLYA 1MP8A 1UU9A 3F5GA 4IIRA 2IF8A 3DCVA 4EC8A 4Z3VA 3QX4A 3PY0A 4J95A 3CTHA 4D2WA 3E93A 2JC6A 3PA5A 3E64A 1ZOEA 4J1RA 4BI2A 4GS6A 3C4EA 4TN6A 1FGKA 2OJJA 2PE0A 2UVXA 2ZVAA 1CKIA 1GZ8A 1WZYA 3EYHA 3MA3A 3OCTA 4ASDA 4DFZE 3AC5A 2VTRA 4CNHA 5JFVA 4ZSEA 2VAGA 1APME 3QTUA 3R30A 4PPAA 3ZUVA 5E8ZA 3HMMA 3FKLA 3EIDA 3RAKA 2UW6A 2F2UA 4L8MA 2OZAB 3DDPA 4JR3A 5M08A 3O2MA 3G51A 3N4TA 2BFYA 2CN8A 3SXFA 1J1BA 1FPUA 1WBOA 2ETKA 3Q53A 3P7AA 2XK4A 5JFSA 1HCLA 4ZLZA 1IAHA 3QRKA 4QD6A 2XJ1A 2XRWA 5EI8A 2KULA 4AW5A 3KEXA 2X9FA 5C26A 5M53A 4TTHB 4F6SA 4O7YA 4QQCA 4FT9A 4FV9A 5KMLA 5FTQA 5HNBA 1E1XA 4I5PA 3VONA 3KA0A 3CJFA 4QO9A 3CD8A 3BGZA 2P4IA 4AZSA 3PVBA 2ZV8A 4ZS0A 3BLRA 5GZ9A 4RZWA 3RI1A 4WOVA 4HPUE 5L8LA 2GHLA 4IAKA 3AT2A 3VQHA 5LMBA 3W2OA 1XH5A 3F66A 2JDOA 2W96B 2WFYA 3IOKA 2YZAA 3IONA 1G3NA 3EH9A 3EQBA 2ITQA 4BGGA 4NW5A 4EH6A 5K4JA 2QOLA 5IH4A 5AAEA 4MBLA 3CPBA 2J6MA 3SD0A 4HCVA 3RP9A 4LUDA 4QPMA 4BC6A 2YDJA 5J9ZA 5J79A 1Q24A 4P4CA 3OY3A 2WTKC 4DBXA 1JKTA 1OIQA 2E9NA 1AGWA 4S31A 4BN1A 3D94A 2V55A 4CRSA 2GMXA 4UMQA 2B53A 3V5JA 2RG6A 4G34A 2XNPA 3E8NA 5LVNA 1OL1A 2CLXA 4WT6A 4G3GA 3GU6A 3P0MA 4XG4A 2ITZA 3NAYA 4YZ9A 3VBXA 4D2RA 5HQ0A 3A7HA 2PMLX 1P4FA 4GIHA 5BVDA 3AKJA 4IBMA 4WNKA 5HE2A 4L7FA 3VS6A 4RSSA 3VC4A 4FYOA 3ZZWA 1KOBA 5AM7A 4M68A 3D0EA 2VWUA 2Q0BA 1OL5A 1PF8A 3EZRA 3OP5A 3UMXA 2JIUA 3HMIA 4BDDA 2CKPA 4UMTA 4QEBA 4P7EA 4U79A 4M7IA 3WZUA 3D2KA 4IX3A 4RIOA 2W5HA 4B0GA 4QMPA 4FEWA 2YHVA 2RFNA 4JMQA 2O64A 1Y8GA 4XV3A 4DA5A 3PLAE 3BYSA 3GCVA 4GCJA 3L8VA 3PJ2A 3FZPA 4FIIA 5BMSA 2B9JA 5AADA 4F7LA 5JKGA 2OXDA 4BI1A 3UOJA 2XM8A 4BCQA 1B38A 5HEZA 2XNBA 3V5LA 3R8VA 3BV3A 3PWDA 4C7TA 2A19B 3LFNA 4XOZA 4RT7A 4YNOA 3W0QA 2UZVA 4AGCA 3O5AA 1FQ1B 1OUYA 3FL5A 4UWCA 3POOA 5L6WL 4XG9A 4DGNA 3ZSIA 3BQRA 2YIQA 4ASXA 4WRGA 3JVRA 2Y4IC 2BDWA 5FBNC 5B2LA 2UZBA 3TNIA 3EN4A 4O7VA 2BAQA 3ZEWA 3ZZEA 4D4RA 4ERKA 3R71A 5DH3A 4O82A 1Q5KA 5CEPA 1M52A 3PXFA 4UMUA 4QTBA 4FV4A 2RGPA 5AUWA 3ROYA 4Y46A 4EH9A 5IMEA 3ORZA 3KB7A 3L9MA 3MI9A 3NX8A 4GT4A 4X2NA 5IU2A 4ZJIA 3CTJA 3UVQA 3GVUA 2W1ZA 1G8KA 2HW6A 2PZIA 2XK3A 1WAKA 3VW8A 3OOGA 2XK6A 5AEPA 4Y5HA 2YM3A 3A7FA 4LOOA 5K0XA 4CFMA 4ANLA 4BJJB 2C30A 4JBVA 3DJ7A 2KTYA 3Q04A 5IQHA 3NUXA 2PVRA 2BIYA 2VTQA 3SHEA 3B2TA 1JNKA 1H25A 2XK9A 2Y6OA 3H10A 1NT2A 3WZJA 1BX6A 4IANA 3Q4TA 1MUOA 4JT3A 3CGFA 3FLQA 4FK3A 3UNKA 2HK5A 4EZ5A 3LFEA 3TV7A 2QOCA 2Z60A 4D2SA 1G8AA 3KMWA 2W1EA 3KRLA 1WBSA 1MRYA 3WYYA 3QU0A 2V0DA 2VTOA 4CGAA 3I7BA 1XO2B 5J1VA 2PPQA 4BDJA 4EL9A 3G0EA 4FT5A 2XIYA 1YXSA 2PMOX 3JR1A 4G3DA 2FVDA 5JFXA 5EDRA 2CCIA 1WVXA 3QKLA 5D1JA 2PHKA 5IH6A 4FKLA 3F88A 1M2QA 2V5QA 3PPZA 3PUFC 4QMOA 3UDSA 2PVYA 4DEDA 3F9NA 4N6YA 1XH6A 1RJBA 3KVXA 4QTCA 3ZO4A 4DLIA 4GKIA 3HV5A 2C3IB 3R8ZA 3PTGA 2P0CA 4YSJA 4EOOA 4L3LA 3AT4A 2I6LA 4UZHA 4F6UA 2QVSE 3F82A 4YZBA 3NW7A 4TWPA 1RDQE 5L2QA 1H01A 3VUGA 2B1PA 3UOKA 3AD5A 4EJ7A 5DMZA 4M69A 3BWFA 5TO8A 1XR1A 4G1WA 4GG5A 2GU8A 3P23A 3O71A 4YJRA 5C1QB 2PUNA 2PE2A 4HYIA 1M2RA 4O21A 4RWLA 1A9UA 5E8UA 1UA2A 2A2AA 3ID6C 1X8BA 5CSHA 4L45A 4EH3A 4HW7A 4E6CA 2UZDA 5J95A 2RFSA 3Q9WA 3B8RA 5DG5A 2EUFB 3II5A 5JQ5A 4HCUA 4JI9A 2VNWA 4F1TA 2YLFA 3POZA 5ACKA 1H27A 5EI2A 4ZTMA 1HOWA 5TKDA 2JDTA 2XEYA 5CF6A 4EQMA 4ZTHA 5JEBA 4W8EA 4CV9A 3TN8A 3GQIA 4V0GB 2XKCA 3PWYA 2RKUA 4MXCA 3UDTA 2F49A 2OU7A 4ARKA 4IDTA 4QP2A 3KULB 3EL7A 4ZTLA 3PA4A 4CFFA 5E1SA 3TACA 3K2LA 4O81A 4BBFA 1W83A 3QUEA 1TVOA 4GT5A 4FL3A 4OGRA 3Q52A 1UNGA 3TZMA 4E1ZA 1OI9A 2ZMCA 5IMXA 3KIOC 5CSWA 3UQGA 5A6OA 1SMHA 5HORA 2QHNA 2GNHA 5HG8A 3O0GA 2WAJA 3DBQA 4N4SA 2PMNX 3OEZA 3IPHA 3HKOA 5CSPA 4QP4A 2YIXA 3KXHA 2R3KA 4O7SA 5M09A 5J7BA 2OJGA 5AUTA 3U9NA 4EQUA 3ZLYA 1MRUA 3EKNA 5HESA 1KE9A 5I3RA 4F1MA 4DT9A 4L53A 4QP6A 4A4LA 1ST0A 3K5VA 4DFNA 5A4LA 4CXAA 4LRMA 4I6LA 3EQRA 3NUNA 5DBXA 1UKHA 3KXZA 2VTAA 4BCGA 1CSNA 4JQ8A 3MW1A 1EH4A 4GV1A 1CDKA 2NRUA 3C0GA 1DM2A 1OL2A 3PXKA 4OTGA 5FWKK 5HLNA 4BDFA 3AOXA 2PVMA 4ANBA 4MYGA 4O0RA 4F08A 5HU3A 5CYIA 3RVGA 3OT3A 3ROCA 3UQCA 4CV8A 4Y8DA 2J0JA 4JX7A 1F0QA 3MFTA 5CZIA 3R9HA 4OLIA 3FLWA 3R0TA 3NFFB 4YNEA 3OG7A 1GZKA 2UZLA 4RWJA 4ZZOA 5E9EA 3VS4A 4MF0A 3RPYA 5M55A 4QMYA 3CS9A 3MH3A 2WOUA 4M66A 3CD3A 4FODA 4JG8A 5FRIA 4F4PA 2VRXA 3D4QA 5ICPA 5JZJA 2R3GA 4ZK5A 4CFXA 4PNKA 2J2IB 5KX8A 4WG4A 4X3FC 4C36A 5EYCA 2JEDA 1SNXA 3N9XA 2Z7SA 2G1TA 1XMMA 4FV2A 4I21A 5HO6A 1FVRA 2OKRA 3W0PA 4GL9A 1ZY5A 4PMTA 4YSMA 3QKMA 1R3CA 1WBNA 3HEGA 2YACA 2UW4A 4FVRA 3NNUA 3AD6A 1M7QA 4WUNA 3RPOA 5HG5A 4F70A 5M06A 4BCNA 4UEUA 2V62A 5JGDA 4R7IA 4W4XA 5HBHA 5JH6A 2GHMA 3OF0A 3K54A 5C8NA 5F4NA 1J91A 4BCOA 3DT1A 3NZ0A 5HLWA 4QMVA 3ORTA 4ZZNA 2IZUA 4PNIA 1H0WA 5KMKA 2W06A 4O91A 4NL0A 4Z9LA 4DBNA 2I1MA 2Z8CA 2UW8A 3OFMA 5E8SA 2ITPA 2PVLA 1J7IA 4IX6A 1TQMA 4MNFA 5AP3A 4G3EA 4OTHA 3U54A 1V0BA 2F7EE 2W1IA 4DGLC 4QP1A 4OAVB 4O7ZA 4IB5A 3F5UA 2X0PA 4RA4A 3FMHA 5FTGA 4FNWA 4E4LA 2B54A 2BR1A 2QI8A 2C47A 3NIZA 3OD6X 3OTVA 4WKQA 1S9IA 1UV5A 3SA0A 4M15A 3VUDA 2BZKB 4FKUA 4OR5A 3G90X 3FE3A 4YHTA 4DCEA 4D58A 2J0MB 3U6IA 3QKKA 5HE1A 4YP8A 2WMUA 3HUCA 5IISA 3U6HA 3TIYA 4KRCA 4B6LA 5IH5A 2R3RA 5LJJA 1LPUA 3H30A 3DKFA 5CVGA 3TUDA 3HMNA 3NS9A 3HV7A 3C4CA 1W0XC 3PA3A 3QGWA 4JLCA 5HCZA 4HVIA 3CE3A 4O4BB 5TR6A 4FTKA 3SW7A 2YA9A 5CT0A 4DG2E 1RQQA 4IVDA 4NWMA 3QRTA 4AT3A 4EHZA 3ZDUA 3O8PA 4ONAA 4GEOA 1YWNA 3P78A 4RVLA 4CKJA 1OKWA 2QO9A 2WIPA 5IA2A 2QR8A 4BDBA 1OZ1A 5L4QA 3PXYA 5HVJA 3REPA 5IPJA 2VX1A 1KE7A 4ZTRA 4TW9A 1PYXA 1BL7A 3PVWA 4D2TA 1O6YA 4C4IA 3PP0A 4EHEA 4USEA 2IZRA 5CU6A 3V6RA 1YOJA 3IK3A 4G16A 4EH5A 5EI6A 4N6ZA 5CEKA 2OICA 3A2CA 1GOLA 3BHYA 4E6QA 4F99A 3LCOA 4RQVA 4AXFA 1YWVA 1YXUA 4O7WA 3G2FA 4F0IA 4M14A 4QMWA 5CY3A 4GYIA 4UZDA 3EQPA 3RM6A 3V5PA 2GS2A 1JAMA 2F4JA 2GTNA 4QP7A 4E26A 2P2HA 4KS7A 3PJ1A 1OM1A 3F6XA 4IC8A 2Z2WA 3FMEA 4K1BA 4ZEGA 3ZBXA 4BDIA 2XM9A 1PXPA 3O8UA 2WQMA 3C4ZA 3IS5A 5E8YA 4BTKA 3AKKA 4O4CA 5FM2A 3O7LD 3KMMA 3AD4A 4CTCA 2CGUA 1K3AA 3BHVA 2ITYA 4FG7A 4DTAA 4I6FA 1XBBA 3KU2A 2WQEA 3UO4A 3L9NA 3U51A 5IQCA 4DFYA 1R0EA 3VS2A 4C4GA 2R0UA 1LEWA 3G5DA 3QQGA 3UC4A 3V5QA 3WF5A 5LMKC 2XS0A 4KKGA 4YPSA 4X2GA 3GC7A 3LJ1A 4IZYA 3QTIA 4D1ZA 2XKEA 4HNIA 1OECA 1U5QA 5HGIA 5L2IA 4X21A 5L8KA 3LJ0A 4MXAA 4HGTA 3ZONA 4I41A 1GIJA 1YRPA 2YDKA 2C6KA 5AV4A 2X7OA 3DB8A 4CKRA 5KUPA 3F7WA 4E5WA 5FTOA 3VAPA 4KABA 4MQ1A 4QNAA 1OVEA 4QMSA 4WUAA 3AG9A 4R7BA 3GXLA 4OW8A 5CASA 1XH7A 3KF4A 2Y8OA 3BYVA 1H0VA 3LCDA 4IADA 1YQJA 4RIXA 1NVQA 4HVGA 3FLSA 5EFQA 3CPCA 3RK5A 4AOJA 4S30A 4O83A 3R73A 2NP8A 3EB0A 5L8JA 1YOMA 2I7QA 4FE2A 2ITWA 4HZSA 2C6EA 4TZRA 3EQGA 4O7TA 2GPHA 3LPBA 3ORMA 3VO3A 2CLQA 4AN3A 2C0OA 3QTRA 2BALA 4IAAA 5HNIX 3WE4A 2QG7A 4Z55A 3TZ9A 4C38A 1GIIA 2WPAA 3M1SA 3IECA 4TY1A 3IKAA 4XP0A 3HMOA 1Q61A 4AUAA 1KE8A 3CCNA 3R7OA 5DN3A 4HCTA 3KRRA 4FNXA 4KSPA 4AF3A 3T3VA 3QUDA 1CM8A 4KIPA 2J0IA 3NPCA 4FI1A 4BCPA 3RPSA 2C68A 1FINA 4AQKA 1UKIA 4IH8A 4EI4A 4M0ZA 4QYFA 5AV1A 2Z02A 4A4OA 3OHTA 2ITXA 5G6VA 3MPMA 4KB8A 5KHWA 4AS0A 4Q5EA 4FT0A 1IA8A 4QYGA 3ZFYA 3FC1X 5DOSA 2P33A 3WF8A 1BL6A 5FP5A 4FV8A 5DR9A 3M2WA 2YFXA 4GFOA 3MFSA 4R7HA 4WHZA 5HHWA 3TNWA 1TKIA 4J8NA 2YJSA 4M0YA 3TDWA 3PE2A 5HTBA 3V5TA 4I5CA 3Q2MA 2G9XA 4YPDA 3KN5A 3TNHA 2B9IA 2XZSA 2RSVA 2V7OA 3EL8A 3LM5A 4O0YA 2R4BA 2YCRA 3F2NA 1VR2A 4YUQA 2OXXA 2CSNA 2YLEA 4KINA 3VUMA 4HPTE 4GJ3A 3GP0A 2X7GA 4P5QA 4PF4A 3AKLA 4CG9A 2UW7A 4XNEA 5H2UA 4O27B 1JVPP 2CHLA 3Q2JA 1REKA 2H96A 3VBYA 4DITA 4FKJA 5K5NA 5K0KA 4F7SA 2ZFYA 5AAGA 3MB6A 4BKZA 3ZHPC 3KQ7A 4OTWA 2FSMX 4KBCA 4DYMA 1TFFA 4UXQA 4D1SA 5M07A 1S9JA 2XJ2A 4ZTQA 4NU1A 1ZMUA 2C1AA 3NRMA 4ID7A 1OGYA 3JVSA 4CZUA 4WO5A 5J87A 3Q9XA 4DFUA 3SGCA 3WYXA 3S1HA 3FPQA 1IAJA 1TQPA 3QQHA 2C6OA 1ATPE 3E92A 4LV8A 4FICA 3TV4A 5DR6A 3NWWA 5CANA 1GZOA 4DEGA 5EYMA 2YITA 1FVVA 4CMUA 5JK3A 1LUFA 3SOAA 3G9LX 5KE0A 4XLIA 2R64A 5D12A 3NFGB 4FTIA 5ETCA 4H39A 3ATSA 2R3NA 5GJDA 3HRCA 4FTUA 2FB8A 3BGQA 1OKYA 3MY1A 1WVYA 4BRXA 2VTSA 2AYPA 2YM8A 2WHBA 3QZGA 4AA4A 1Q8WA 1PXMA 5AV3A 4G6LA 4MAOA 3PRIA 3RALA 2OJFE 5BVNA 4C4JA 3NCZA 4YTCA 4F0GA 3BBTB 2A98A 3QALE 4O96A 2XANA 2PVNA 3OBGA 2WMAA 3P7CA 5BNJA 4ANSA 2QG5A 4IW0A 4KWPA 2IWIA 4XLVA 3TNPC 2YCFA 4RGJA 5KBRA 5ETIA 3F3WA 1GJOA 3R83A 3DZQA 3GOKA 4BCFA 3PG1A 4WBOA 4BY9E 3RAWA 4XS2A 3FMMA 2C69A 5HX8A 5CAUA 4UALA 1PXOA 5F20A 4PMPA 2W5AA 2YWPA 3NYNA 3TTIA 5EG3A 5IUGA 4Y73A 5FXSA 4BHZA 4YTIA 2HZIA 3GCSA 3OY1A 4MD7E 3DK6A 2X4ZA 5DGZA 4H1MA 4K77A 4CQEA 3E62A 4HVDA 3UO5A 1OPLA 1H1QA 4UN0C 1MQBA 3RWQA 2C5OA 4TYHA 5IDPA 5TOZA 4CKIA 2EU9A 3S95A 1O6LA 4DDGA 3DPKA 3BGPA 2C1BA 1E9HA 2A1AB 2XB7A 1W7HA 3LFDA 3R22A 3DTCA 3EFWA 3HVCA 3HECA 4IB3A 3CBLA 2XBAA 3H0ZA 4ITIA 4L67A 4W4VA 4A9RA 2JAMA 4QMNA 3Q3BA 5K9IA 2FSLX 3HV4A 2YAKA 2XNOA 3G0FA 5I0BA 4EONA 4AW0A 4YJUA 5AUUA 5LVMA 4NCTC 2O63A 1L3RE 2CCHA 2UVZA 3EQFA 5CEOA 4AX8A 3AGMA 5I9YA 2WU6A 3BLHA 3LFAA 2VNYA 4WNMA 4IX4A 4IWQA 2PTKA 3QHWA 5CENA 4O0XA 3W16A 4XV9A 4IMYA 1Y8YA 3OWJA 5A6NA 2UW3A 4XG8A 3UIUA 2PZPA 2C0TA 2GNGA 1OBGA 5HO8A 4GRBA 4F0FA 4X3FB 3RCJA 2BROA 4YJOA 3KRWA 4Z7HA 4NSTA 5ANEA 5CTPA 4FA2A 4J96A 5BYYA 4FSRA 1RE8A 1L8TA 4CYJA 1JKLA 4HGSA 4F09A 3QX2A 3MPTA 4QMZA 5FLFA 2R7IA 4QQJA 5CU2A 2OG8A 3RZFA 4IWPA 4IDVA 2CPKE 4AU8A 4HVHA 5AIRA 3ZYAA 3C0IA 2C3KA 4DH3A 4D0XA 2WTIA 4Q9SA 2ZV9A 2HXQA 2OFUA 2R3IA 3DB6A 3ERKA 3D5UA 5GINE 2W4JA 1WBPA 4DG3E 2VTNA 3D5XA 2BVAA 4A9UA 4MNEB 5L6PA 3ZCLA 3UDZA 1K9AA 2X9EA 3Q9ZA 4LGDA 3A7GA 4JBQA 2PY3A 5HG7A 3PVUA 3HLLA 3A8XA 1Z5MA 3GC8A 4JIAA 4MWIA 4K33A 4QMXA 3FC2A 4TYGA 2V7AA 2ZV2A 1ZYCA 4FSUA 4EH4A 3GU4A 1WBTA 2HWPA 4NZWB 4HYHA 4CTBA 4FV6A 2EVAA 1KUTA 2PVFA 4FGRA 2WGJA 3F5XA 3FMKA 1JSTA 4G3CA 3BRBA 3HX4A 3WARA 5HD7A 4USDA 4C4HA 2P55A 5FDXA 2R5TA 2H34A 3WF9A 3MN3A 3UBDA 5IUIA 4GU9A 5JGBA 1ST4A 2F2CB 5L3AA 4PTEA 1PMNA 1W82A 3MB7A 4YU2A 4XYFA 2A27A 4MXOA 3MH0A 5AUYA 4EEVA 1FVTA 4FTAA 5AR7A 2UW0A 4RWKA 4FV1A 4F7NA 2WMWA 3C9WA 4ERWA 1MQ4A 3HGKA 4L6QA 4RIYA 4Y95A 5BUIA 1YW2A 4BWPA 3UG2A 3R9RA 1ZMVA 3L8PA 3GU8A 3PY1A 4RX8A 5IA0A 3PY3A 5IF1A 4H05A 4OT6A 4NM0A 4ASZA 3PSCA 2REIA 3W2PA 3LXKA 5C4KA 2QKRA 4M13A 4I6BA 4E4NA 4AA0A 5HCXA 4PP7A 4QPAA 4M8TA 5AUZA 2P3GX 3UQFA 2BZHB 1B6CB 5CLPA 1CKPA 5EM5A 3VBWA 5AA9A 3WF6A 3TYKA 3VIDA 3ODZX 4Z16A 2ERZE 3C50A 4PMSA 1H8FA 4AG8A 4ZJJA 5M4UA 5IQGA 1YXTA 1XKKA 4JDIA 3IQ7A 4QMUA 3ZXTA 2BRNA 2UUEA 5G1XA 4EYMA 1UWHA 2C6MA 3VS3A 2BHHA 3UIBA 3LQ5A 3LCKA 3C5IA 3LM0A 3ET7A 4E20A 2QR7A 4MF1A 1KWPA 2Y4PA 2O5KA 4KA3A 5DVRA 5HBJA 3PDTA 4CD0A 3R2YA 5I4NA 3MBLA 5AIKA 1VYWA 4TRLA 1XQZA 1ZXEA 3SRVB 3R1QA 3V04A 3F61A 1MRVA 3HDMA 3MJ2A 3QTXA 5KMOA 3TMOA 4RQKA 5CAVA 1OIYA 1WFCA 3AC2A 3FL4A 1QPCA 3I6WA 2JLDA 4GIIA 4LV5A 4IFCA 5AR5A 3IGOA 2J7TA 4JVGA 2C6LA 3MVJA 4PDOA 3OS3A 4TWNA 3SLSA 5I9ZA 4OAUC 4YLKA 5EKNA 1Q8UA 3RM7A 4CRLA 4NIFB 1UU8A 3LW0A 4R1VA 5FUTA 2WMXA 3BHHA 5ETFA 3T9TA 3TI1A 4O38A 4RMZA 3T9IA 4JQ7A 3RINA 4BYJA 5CXZA 1QMZA 2WEIA 5C8KA 4D4VA 3BE2A 4EK8A 5HE3A 4O7RA 2OZAA 1OKZA 5C4LA 4I23A 3RKBA 2E2BA 2GSFA 1B39A 4BBMA 2PE1A 3UZRA 4IAFA 4C0TA 2RL5A 3WILA 5IG1A 5LQFA 4YJQA 2DYLA 5CEIA 3DQXA 3SQQA 1M7NA 4J52A 2XJ0A 3FZRA 4J8MA 4O2ZA 5IDNA 2C5NA 2V22A 1OBDA 3R8PA 3I1AA 1KV2A 4FV3A 5D41A 3H9OA 4RX5A 3KRJA 3W0MA 3W0OA 4R3RA 1ZZ2A 2J5FA 4XEYA 4IB0A 2IZTA 4IXPA 1ZYJA 2W4OA 5AR4A 3ZS5A 1R39A 4FIGA 3EZVA 3C4XA 2JKOA 3K5UA 3RCDA 3UOLA 2BHEA 4FKSA 4OTRA 5ANJA 3HZTA 5EM8A 1PXKA 2C6IA 1JBPE 5DNRA 2HW7A 4DEBA 4BB4A 4FEXA 1R0PA 2C5XA 3VW6A 3NDMA 3I5NA 5EOLA 3OUKA 2VO6A 3UDBA 4E6DA 2O0UA 4M84A 2CGVA 4DT8A 2YCSA 4YGAA 1ZOGA 4H3QA 2GS6A 2RF9A 1AD5A 3Q6UA 3R7UA 4G6OA 5CS6A 2HYYA 5A54A 3F3TA 3QF9A 1GZNA 3GBZA 5FGKA 3KC3A 3SX9A 2A0CX 3F3UA 5KHXA 4FJVA 5E7RA 5DFPA 3L9PA 3I6UA 4JBOA 4KIKB 3S4QA 4IHPA 1FOTA 3GGFA 3EQDA 4L9IA 4RC4A 3U9CA 4ZY4A 3C4WA 5LXMA 2X2KA 4IACA 3CQUA 3R8LA 3PPKA 3R9NA 4FTMA 4IM2A 3D9VA 3R7YA 2RFEA 4HNFA 4XX9A 3DJ6A 4F65A 4DEAA 4LV7A 4RFZA 4ZIMA 4BCJA 5AP5A 1W98A 2G2FA 1T45A 2X2MA 3R8UA 3RHXA 2HENA 4I3ZA 3IW6A 3P79A 4FTTA 3V8TA 4IEBA 2OW3A 4F9AA 4XP3A 3C4FA 3QUPA 4U8ZA 1IASA 4ANQA 4L68A 1Q62A 5AR8A 1DI9A 4YTFA 3DNEA 5ETAA 2ZJWA 1JQHA 1IA9A 4QPSA 5LCJA 5M4IA 3NAXA 2GNFA 3WBLA 4CVAA 3OW3A 3F5PA 4O84A 4LOQA 4NKSA 4C8BA 4FUYA 4DHIB 3DOGA 4GYGA 3HRFA 2IPXA 1JWHA 2PK9A 2DUVA 5DEWA 3IDPA 4BCIA 2XIXA 5E4HA 5EW3A 2W5BA 4LG4A 4RJ6A 3TUCA 2P2IA 5A14A 2F9GA 4AT5A 4ZS4A 1YKRA 2E9PA 4C4FA 4DDIA 5L2TA 3ORLA 3K3IA 4I5HA 2UVYA 3F69A 3DXQA 4WG3A 2QNJA 3KCKA 4U3YA 3ZU7A 4QRCA 3GB2A 1G8JA 5BV3A 4U7ZA 3ORXA 4C02A 4FOBA 4Q2AA 4PV0A 4S33A 3FEGA 1TZDA 3BI6A 3ZUUA 4JAJA 4ASEA 4E8AA 5B2KA 2XIKA 1SZMA 4U6RA 3FXXA 3S00A 3EKKA 2W0JA 1K2PA 4U43A 5CU4A 5E8WA 3Q5ZA 5KZIA 4ZAUA 4Y5QA 3GC9A 3G15A 4EOKA 3R1YA 2C3LA