4G5JA

Crystal structure of egfr kinase in complex with bibw2992
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
321
structure length
307
Chain Sequence
b'GEAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKEKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Target Binding Properties and Cellular Activity of Afatinib (BIBW 2992), an Irreversible ErbB Family Blocker.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 307
sequence length 321
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g5jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g5jA01
2BAJA 4O1PA 4JBQA 1UKHA 5DGZA 3NUXA 1SYKA 5CU6A 4MXOA 5B2MA 4XHKB 5CENA 3CLYA 4ZK5A 3BPRA 4FKWA 3OHTA 4NU1A 5IG1A 4ORKA 4G9CA 2OU7A 4YPDA 4RPVA 3UQGA 3PG3A 3MY5A 5IEVA 3NZ0A 4IB3A 2DUVA 3EWHA 5KMKA 2JKKA 5D10A 4H05A 4ZS0A 2XK4A 4V05A 3UO4A 3VS6A 3R7EA 5AFVA 3R8UA 3DLSA 4EH9A 5A4QA 3GFWA 2ITNA 1JAMA 3L1SA 2QG5A 3R21A 4IX6A 5EHOA 3B8QA 4E1ZA 4EOKA 3HDMA 4ZTMA 4BCHA 1IEPA 5HZNA 2QNJA 3D7TB 1IA8A 1J1BA 3CBLA 3KF7A 2XF0A 5CVHA 2QU5A 3L8XA 3QU0A 5IF1A 3OUNB 3IG7A 4U41A 4QOXA 2UZUE 4YHTA 1QPDA 1PYEA 3GEQA 4EL9A 4TY1A 5ETIA 5AAFA 5M4CA 5M56A 3LQ3A 4FNYA 4MCVA 3NW6A 1KE9A 2JEDA 5JFWA 5J95A 1H1PA 4IAFA 2IZRA 2VWUA 4P7EA 1OB3A 1OGUA 2HY81 3C4CA 3U9CA 3VULA 3W2SA 5B2LA 2A27A 2B7AA 5JK3A 3U55A 2W96B 4CG9A 3QTXA 3H9OA 4PY1A 5CT0A 2R9SA 4BWXA 1ZYJA 4JL9A 5ANOA 3FEGA 4E20A 2V55A 3GCUA 4BCMA 4OAVB 3QZGA 4R7BA 3EJ1A 1DI8A 2I1MA 4BKYA 4D4RA 3U6IA 2QURA 3V5WA 2QOFA 3PVBA 5HG8A 5A46A 2XKFA 3ORXA 3BEGA 2JKOA 2UZNA 4DH5A 3ZZEA 4ZMFA 3TIZA 1ZWSA 2C5OA 2XZSA 4LV8A 2CJMA 4DA5A 1IAHA 4U97A 4YLJA 3F5GA 5LWMA 4FVQA 3TZMA 4OTWA 4X6QC 3IDBA 2YCQA 1W82A 2YAKA 2XEYA 3F2AA 4GT3A 4N6ZA 4FTQA 3M2WA 3W2QA 1FVVA 5T6KA 2G2HA 2YM4A 3R8VA 4I5HA 4O0TA 3AC3A 3Q9WA 4Z3VA 2WQNA 2E9OA 5A14A 4PMSA 5CI7A 1Q3WA 5E1EA 4EOJA 5CU0A 4EZ5A 3PE1A 1T45A 4JAIA 2G2IA 3AC4A 4GV1A 4GUBA 2C68A 3JPVA 4ZY4A 3TKIA 1NVSA 1WBVA 3QZIA 2IVTA 4UWBA 1NVRA 5HD4A 2JDSA 3ZRKA 1E1VA 3NUPA 4TPTA 4XG7A 3C4FA 2R3PA 4DBXA 4FKRA 4FKPA 2CHLA 4BC6A 4JBPA 2QU6A 3MFUA 3OOMA 4GK3A 4XG2A 4FGRA 4YO6A 4MXCA 2QD9A 3IOPA 3TNIA 2WMAA 3OEZA 3PXZA 1G5SA 4F7JA 1B39A 5G6VA 1AD5A 3I0OA 3ZBXA 4AA0A 4B7TA 3GENA 1DI9A 3DCVA 3HNGA 3OVVA 2OG8A 4KRDA 4FTNA 4MF0A 4ZS4A 3QA0A 5HNGA 1YI6A 3ANQA 3DBEA 3LCDA 1XH9A 3E8EA 3OTVA 4PMMA 2I0YA 5FTOA 3V8TA 1J1CA 4AG8A 4DFYA 3ZLWA 1FMKA 3PVUA 4FIIA 4HPTE 3RAHA 4I92A 5HTIA 3HUCA 2XJ1A 1OIRA 3MPMA 4D1XA 3COKA 2W1IA 1CMKE 1Y6AA 3R9NA 3UBDA 4M7IA 4MXZA 4XCUA 5LARA 4AQCA 2J7TA 2IW6A 3A62A 3O7LD 4CMUA 4ZLZA 4RC2A 1BI8A 4WIHA 4KIPA 4MBIA 5HCYA 2FSTX 3RAKA 5FQDC 1KSWA 3B8RA 3SW4A 5DEYA 5IH4A 3FMDA 4C61A 4MEDA 1PXLA 4BDAA 1WAKA 3I6UA 3QYWA 5CAQA 3QXOA 3W1FA 2PZIA 2BKKA 4RX7A 4RZVA 3P4KA 2QONA 4DITA 4EC8A 4DFNA 4GUEA 1Q8TA 3E7OA 4WG3A 2UZDA 1FMOE 4BWKA 4UALA 4FICA 3OBGA 4A9YA 3R9DA 4O0WA 4YJNA 4L8MA 4APCA 4ARKA 5L2IA 1PKDA 1A48A 2GTNA 1BL7A 3OW4A 4TWNA 4IM3A 3RK5A 3IW4A 2ERZE 2GTMA 2UZEA 2IW8A 4I4FA 4RFMA 3VUKA 5LQFA 5BQ0A 4PL5A 4ZEGA 4FEUA 4EOMA 4J1RA 2ITWA 4NUSA 3PIYA 3TZ9A 4G5JA 4MF1A 3EL8A 3RPYA 4Y95A 1JOWB 3BI6A 4HYHA 5FDXA 2P55A 4M0ZA 1KOBA 3EQPA 3LCKA 2XEZA 3CD8A 1FVTA 1DS5A 2XNMA 4D0XA 2XK3A 2B9FA 5KE0A 4FA2A 3RGFA 2QI8A 4DC2A 3OUKA 5HBEA 3KL8A 3EYHA 3FYJX 4GK4A 5FP5A 5LCJA 3Q5ZA 1RJBA 3E87A 3QUPA 4IDVA 2RFEA 3P7CA 4U44A 4TKSA 2CCIA 3MN3A 4WOVA 4I21A 3W55A 4CTCA 2GPHA 3NAYA 1M7NA 5CYIA 5HQ0A 3QLGA 2X81A 2YA9A 3K3JA 3NS9A 1WVYA 4FTMA 4G3EA 3EB0A 4FZ7A 4FV2A 4PUZA 2R3KA 2RFNA 3LM0A 4I6HA 4QYHA 3R7VA 3HV3A 5FGKA 5J1VA 2Q0NA 4FKUA 4FUXA 4FMQA 4NM5A 4DH7A 1G3NA 5F94A 5J7BA 3A61A 1REKA 3PSCA 3MPAA 2VO6A 3A7HA 3R01A 4JDKA 4DEAA 5ANIA 1OKYA 4IM2A 4LOQA 5HCZA 1OIQA 2FYSA 3TL8A 2V5QA 1M7QA 3Q3BA 3NIEA 3QAME 3W2OA 5EYCA 5L6PA 3CTQA 3ZLSA 4MHAA 4IJPA 3EHAA 2AC5A 1CDKA 3LCTA 4XS2A 4YJQA 4L7FA 4U0IA 4CYJA 4YTFA 2PPQA 4DGMA 1PW2A 1YDTE 2QQ7A 2R3IA 3BWJA 3S95A 4AGWA 4IX5A 4BGHA 3SXSA 4C4EA 4TYHA 3UYSA 2HW7A 4AGDA 4JDIA 3TTIA 3WE4A 4AZTA 4BCJA 3GXLA 1M2RA 4B8LA 2FB8A 4ERKA 4ZSGA 3FL5A 3U8WA 5AA8A 4IDTA 4M66A 4HGTA 3Q5IA 3F9NA 4D2RA 5FP6A 2HZ0A 3P7AA 2WOTA 5IUHA 4HVGA 2AC3A 3E7VA 4JS8A 3GC9A 4FYNA 4E73A 3HEGA 4MWIA 5ANGA 2GNGA 2J2IB 2XKCA 3FY0A 5HG7A 3R02A 5CF4A 5IH6A 5L4QA 3M42A 3OP5A 4HVDA 1Y8GA 3R2YA 4L3JA 3VHEA 3F5XA 3EFWA 3KK9A 4GT4A 2JIUA 3VS5A 5HORA 3WYYA 1UNGA 3KRRA 2EXMA 3NMUF 2XNGA 3HV4A 4JQ8A 5M09A 2VWBA 3GB2A 3ZDIA 4O0YA 3BV2A 5FG8A 4QMYA 5L6OA 4RWIA 3UOJA 5GIPE 3H9RA 4BN1A 5CAPA 2QO2A 5LMKC 3QUEA 4TWCA 5GJDA 3ZEWA 1PKGA 3O23A 4U5JA 5C1QB 3F3VA 2C0TA 2C6IA 2UVZA 2XNNA 2YN8A 5F95A 4YP8A 4YTCA 3FLSA 5LVNA 5JKGA 4YGAA 4LL5A 3O2MA 4U9AA 4EWQA 3R1QA 1U46A 4QYEA 4XMOA 3COHA 4EOSA 4RLKA 3Q96A 4FUYA 2W5BA 4XH6A 1O9UA 1Q8WA 3D15A 3HZTA 4HYIA 2UW4A 2RIOA 1H1QA 3QZHA 2FO0A 4GJ3A 1H08A 1IASA 2PVKA 4UXQA 3IS5A 3NSZA 3ZONA 4D4SA 2RFSA 3LFFA 4RG0A 3HMPA 3L9PA 5HHWA 1OKVA 3D5WA 5J9LA 2W05A 4KD1A 4AZFA 2Y0AA 2C69A 3KC3A 3PJ1A 4GW8A 1GZNA 4FKJA 3SV0A 3DKCA 4TWOA 2VWZA 5J79A 3O17A 4CTBA 3U54A 3H0YA 2P4IA 3DNDA 4GVAA 2QLUA 3PVWA 3BHHA 3K2LA 3PY3A 5CSXA 3U87A 3ZO4A 5HLNA 1GIHA 4ITHA 5DMZA 4RGJA 4CEGA 2C6TA 4FEWA 2XBAA 4ANSA 2J51A 3R22A 4FKVA 3FE3A 2PVLA 2Q0BA 4KRCA 5A4EA 3OT3A 2OJ9A 4EK6A 1U5QA 2PVHA 4MH7A 4PQNA 5AUUA 2Q83A 1U59A 5DR9A 4PDYA 1YWRA 3BKBA 2PUNA 2PMOX 4WO5A 1YOJA 3UP7A 1JVPP 3C51A 2X0GA 1I09A 2A19B 3KKVA 3QZFA 1TKIA 3R71A 5CVGA 5JMSA 2YIWA 1JPAA 3NYVA 4NEUA 3ZSHA 4KUJA 3NWWA 3OS3A 4O7ZA 4OLIA 5J9ZA 2Y7JA 2WTJA 4NW5A 5AR7A 5AX9A 2HOGA 5I4NA 1TQIA 2JAMA 4FKOA 4MWHA 4ANOA 4OUCA 4D5HA 4C34A 1RW8A 4JOAA 3WF6A 5GINE 2QCSA 3LE6A 5I9UA 2ZMDA 3TV6A 3A2CA 3FMJA 5IEXA 3L8SA 4FKGA 4KS8A 4KS7A 4AACA 5KMNA 3HAVA 2PL0A 2WMWA 4D4YA 3DBDA 1G8SA 2HZ4A 1L8TA 2PUIA 4EK5A 1AQ1A 4J95A 4DG0E 3TUCA 4DGLC 1YHWA 3D4QA 3A7JA 1NA7A 2CPKE 3DS6A 3SHEA 4FSNA 1W8CA 4BTKA 3PJ8A 3ENHA 3ORZA 1P4OA 4JI9A 1YWVA 4EH4A 1GNGA 2GDOA 5AR2A 3UZPA 3WZDA 1YI3A 4ZSAA 4YMJA 3VQUA 1OKZA 3C7QA 5IMXA 4F7SA 4K6ZA 4LQMA 2BRMA 3CSVA 1XH5A 2XBJA 4BBFA 2I7QA 2HZIA 4JQ7A 4NT4A 4LFIA 4CGAA 4ID7A 4XV3A 5A4CA 1MUOA 1ZMVA 4AZEA 4FTKA 4YSMA 4EKKA 4TYJA 2OLCA 5EI8A 4KBCA 2XYUA 3VW6A 3V51A 4I94A 3UG1A 4GFMA 4E5WA 3MA6A 2BKZA 5IU2A 2WKMA 3I81A 5EOBA 3H10A 1KOAA 2YEXA 5HKMA 3F2RA 2J0KA 3Q2MA 3FY2A 2BMCA 3GGFA 4HNFA 4QT1A 4CV9A 2WTDA 3UNKA 5M4FA 3Q4UA 2UW0A 3E3BX 3AGLA 4R3CA 3LQ5A 1UNLA 2OF2A 2CNQA 4N6YA 2ZB0A 2C5YA 2HXQA 4RC4A 4WSQA 3LJ0A 3BLHA 5HO8A 3RTPA 4ALWA 4LL0A 4FNZA 4YR8A 1SVHA 1XH7A 3FL4A 4GCJA 3VUHA 3KB7A 2E2BA 5HO6A 3D5XA 3MVMA 4R5SA 3WI6A 5A54A 3FC2A 3G9LX 3VUTA 5AV0A 1XQZA 5CZIA 3AT2A 5FTQA 4DFZE 3L9LA 3R9RA 3NUUA 2YDKA 4D1ZA 5A6OA 3F5UA 5AAGA 4C8BA 4QRCA 4C3PA 2VTRA 5CSVA 4EZ7A 4F9BA 3P5KA 5CWZA 3AMYA 4FSQA 4RJ4A 3SC1A 3UTOA 3VBVA 3LMIA 4CFNA 3BLRA 5AP7A 3QYZA 4II5A 4ZAUA 4XBUA 1O6LA 5IKWA 4NIFB 2BROA 3MB6A 5JGAA 3R1SA 4WRGA 5I9VA 2XK7A 1YQJA 2H9VA 4D9TA 4LGDA 1ZAOA 2YJRA 4QQ5A 4MK0A 3TT0A 3CQEA 4FTAA 3R7UA 3LQ8A 1WZYA 3AD4A 1T46A 3MW1A 2WTKC 3NEWA 4PF4A 3MB7A 5LWNA 4OBQA 1J7IA 3FPMA 4L43A 3TI1A 2HENA 3FXZA 4BFMA 2OO8X 4EK3A 2JIIA 3KXXA 4ENYA 2J0IA 4QD6A 3V04A 5I5ZA 3BE9A 5IH5A 3N4UA 2CGUA 4C38A 4RQVA 3UQCA 1PXNA 4IZ7A 2VTAA 1V0BA 2UW7A 4A9SA 3RCJA 5H8EA 3R8MA 3UNZA 5AAEA 2F49A 1GJOA 3CEKA 3HRBA 3JY0A 3IK3A 3DTCA 2R3FA 4NZWB 4EBWA 2P2IA 3DK7A 2VTTA 3DY7A 1TVOA 4BZDA 1JQHA 4U7ZA 2R3MA 4XP0A 3DJ5A 3LJ2A 4NW6A 1U54B 2ETRA 1JWHA 5M07A 4Z9LA 1WFCA 1H01A 1XBAA 3PP1A 4B0GA 3WYXA 1P14A 4BI1A 5FXSA 4FVPA 3CGFA 5AV2A 5AM7A 3WILA 4F64A 5CF5A 4EOPA 3V6RA 2IN6A 4I24A 3ZC5A 3UOLA 4YPSA 4HJOA 3VWAA 2VTQA 4CRSA 3D5VA 2VTOA 4HOKA 1YHVA 4KAOA 4FNWA 4USDA 3GU8A 4ALVA 2EUFB 2OXDA 1SVEA 4RT7A 5J8IA 3S2PA 4O7WA 5M55A 4DFLA 4RIXB 5CT7A 5DOSA 4EH2A 5LMKA 1H07A 1OL6A 2JIVA 4R7IA 5FBNC 3CGOA 1ERKA 3PRFA 4F0GA 5EW3A 2B55A 2V0DA 2PE0A 3R6XA 3U9NA 4FIFA 2PWLA 3B2TA 3R8ZA 5H8GA 2IVSA 4DEBA 2XK8A 4QMSA 2C4GA 3EN9A 1UVRA 1HCKA 3QD2B 4FV5A 4O0RA 3CTHA 2OI4X 5CLPA 2RGPA 4XG4A 5IA4A 3K5VA 4LUEA 2V7AA 2XKEA 3EL7A 3NUNA 4I6QA 4YZMA 2O0UA 5AWMA 4E3CA 4UZHA 2PVJA 4X6RA 3W2RA 3FAAA 4C58A 3NX8A 2VO7A 4GVJA 4G6NA 1GIIA 1Q4LA 2R7IA 4MXYA 2W7XA 4XYFA 5DA3A 5DT0A 5C01A 5KCVA 1KUTA 1DAWA 5FBOA 4ZSEA 5C4LA 2HZNA 2Z7SA 3DV3A 3VBWA 4E4NA 3TUDA 3QCQA 1BL6A 2J50A 5IA0A 4O0VA 2A4LA 2WU7A 5GHVA 3PTGA 2X2MA 4DFXE 4IM0A 3TZ7A 4XRJA 4KA3A 1H0WA 2HELA 4JG8A 5EI6A 5IA5A 4JG6A 4C4IA 5HOAA 1BUHA 2CGWA 4ZOGA 4WNMA 1KE8A 1JNKA 2PY3A 2R0IA 4FTIA 5C4KA 3SLSA 3TEIA 3GCQA 3IECA 3OMVA 4X3FA 3IDCA 3N51A 3A7FA 4G3CA 4M13A 4QYFA 3TTJA 4D5KA 3SOAA 4ANLA 2JKQA 4UXLA 4C57A 4K0YA 4KSQA 2J0MB 4HYUA 2WFYA 2CLXA 3P0MA 4FE2A 3TNHA 5E8VA 4JXFA 2Y9QA 4BCOA 4I1ZA 1H1WA 3F7WA 4F63A 5EM5A 4FSZA 4PPAA 3DT1A 5CZHA 3DA6A 5KMLA 3G15A 3ACKA 3EQDA 3PJ2A 3FQEA 2W1ZA 2Y4PA 3DNEA 4K11A 4AT4A 4EH7A 1OPKA 4DTAA 4PDSA 4F0IA 3MIAA 4MBJA 4K1BA 1OUKA 5A9UA 5JEBA 4OAUC 3H4JA 3VHKA 2C6MA 1H24A 5CF6A 4AE9A 1ZLTA 1R39A 2OFVA 3SXFA 1OIYA 3UG2A 4CT2A 3UVQA 4DGGA 5IQBA 2GFSA 4L7SA 4M97A 3RPVA 3FI2A 3SQQA 2JFLA 4QNAA 3S3IA 4ACCA 4N0SA 3MY1A 4YC6A 4M12A 5LVOA 4KNBA 3I0QA 2FSOX 3EQCA 4AF3A 3BQRA 3UQFA 2EVAA 2UZVA 2AUHA 3MFTA 4FEQA 3OWJA 2O63A 2LAVA 5EFQA 2BHHA 3VQHA 4C2VA 3DK3A 3QQKA 3HUBA 4BTFA 2JBOA 4H39A 2R3NA 2BZJA 5IQAA 1V0OA 4DN5A 4E5AX 4FT5A 2FSMX 4F7NA 3FMKA 5EDRA 1KE7A 1H00A 4IFGA 3PJCA 2NRUA 3W2CA 4FSUA 4XJ0A 4B9DA 4UMRA 2BDFA 3LFSA 2YCRA 4ZSLA 5AMNA 1OMWA 4DGNA 5KHXA 3PXQA 3BHVA 5JGDA 2BAKA 3S4QA 2CGXA 2QC6A 3C4WA 3PY0A 2F7XE 4I3ZA 2ZM3A 4UYAA 4JX7A 3ZDUA 5EG3A 3EN5A 3IKAA 4D0WA 1OITA 2I0VA 2QOCA 4BDFA 4D2VA 4DT8A 4XG8A 5M57A 1TQPA 5E8TA 3I7CA 2YIYA 2CN8A 2C5NA 4L00A 2F4JA 2QOKA 2I6LA 4IBMA 3RHKA 3RM7A 4FKLA 2R3GA 4FR4A 1IR3A 3R7OA 3N4TA 4Q2AA 2Y4IC 5LOHA 4IC8A 3ZH8A 4E8AA 3AMAA 5E1SA 5FM3A 1LR4A 4JIAA 3UMXA 3WIKA 4YJRA 3OCTA 4YJUA 5HTCA 4A9RA 4GIIA 3FHIA 3E62A 3ZSIA 2V7OA 2WTCA 1B6CB 4WNOA 3P1AA 3DLZA 3KEXA 4ANMA 3PUPA 2HWPA 3EQGA 2ZM1A 5BVNA 3PA5A 1GIJA 4Z16A 4IJ9A 1Q61A 5HE2A 5DR6A 5DN3A 2NNWB 5EYKA 4DAWA 4EH5A 5K4JA 1PXJA 3UYTA 3H3CA 3Q04A 2ZV2A 1LEZA 4FOCA 4FV0A 4BDGA 1XH4A 5CNNA 4WT6A 2C3LA 5HX8A 5IUGA 3GU6A 2IVVA 2ITXA 5F20A 2EB2A 5HI2A 3CQWA 4X7QA 2VO3A 4ONAA 3EKNA 5DBXA 3T3VA 3ZO2A 4LRJA 5KMMA 1ATPE 4XP3A 3MVHA 5JZNA 3DPKA 3UC3A 5BVEA 5L6WL 2XK6A 3R2BA 3TNPC 1CKJA 4QMMA 3PXFA 5EH0A 3VJNA 2C6DA 2R3RA 2WTVA 3F3WA 4O91A 4UWYA 4HZSA 4YLLA 2UZLA 3T8OA 3EMGA 4H1MA 5L2TA 4EHVA 4G1WA 3MPTA 3VO3A 4QTEA 4XG3A 5C26A 1BYGA 4KIQA 3KULB 1E1XA 2CDZA 4YC3A 2QHMA 4DG3E 4Y73A 1Y8YA 4O22A 4D55A 3HL7A 2NP8A 2PE1A 5CVFA 4LV5A 4OT6A 1FQ1B 1JSUA 5GZ9A 4OTIA 3RPRA 4RQKA 3HDNA 1OZ1A 2XNEA 3UO5A 3HP2A 3WF9A 4ZJVA 4ZTLA 2PVNA 1JKTA 3MVJA 2VTHA 4FV4A 4GJ2A 4TL0A 4FT3A 2CKEA 4DG2E 4FX3A 2XRUA 3FPQA 5CALA 1PXIA 2W99B 4BYJA 4BHZA 1AGWA 4IAZA 4AT3A 4A9UA 3WZJA 2NO3A 2VWWA 3WZKA 3S0OA 4Z7HA 3DK6A 4G31A 3PLSA 4ACMA 4BKJA 3KREA 3KN6A 2X7GA 4BIDA 5H9BA 5TKDA 1LPUA 3FZPA 1M52A 4R1VA 3LLTA 3DXPA 2ONLC 3SRVB 1BLXA 3MYGA 3NCZA 4FK6A 3MGYA 4D4VA 4EH3A 3BE2A 3KCFA 4S2ZA 3PE2A 4PTEA 4X2FA 3R9HA 3ZRLA 3ZU7A 4EYJA 3A7IA 3ET7A 4V0GA 4HW7A 3VN9A 4XX9A 1OL1A 3OWKA 2ITOA 2YM3A 4EOOA 2XCKA 2B9JA 3LFNA 4RA4A 3K54A 1W0XC 4FV6A 5TOZA 5DT4A 4YHJA 4DHFA 1YRPA 4C4FA 2YM5A 1PMEA 3UNJA 3DB6A 3QD4A 3DTWA 5JSMA 1XBCA 4NCTC 3C5IA 4C35A 2RG6A 3VS7A 1REJA 4WA9A 2HIWA 1H25A 4PL3A 4M15A 3DJ7A 4IWQA 4GL9A 4L3PA 3ROCA 4G3FA 3KY2A 3IONA 3DDPA 4J8MA 2R0UA 4EUTA 2AYPA 4CYIA 2G1TA 3I5NA 3Q9YA 1LEWA 3FJQE 4NTSA 4EK8A 5A4TA 3DXQA 4G2FA 1STCE 4L46A 3V5JA 3TV4A 1J3HA 4OTFA 5AUXA 3C50A 1Z5MA 4NJDA 5AP2A 3Q6UA 3QQJA 3ZZWA 4RX9A 1WBSA 3FLYA 4DE4A 2Y8OA 3FXWA 3L9NA 2PYWA 4FI1A 4RC3A 4YJVA 4W8DA 4C59A 4RJ6A 1YXTA 5EW8A 3QTIA 4HCUA 5HU9A 2O8YA 3HRFA 3VBQA 3NUSA 3QRUA 1K3AA 2C5VA 5GJGA 1YHSA 2H8HA 3HVCA 4LOPA 3RINA 2RL5A 4EQMA 3OY1A 2W4KA 3GQLA 4FT0A 3VS3A 4F9YA 2BILB 3DAJA 3UP2A 3LHJA 4O7YA 2Y6OA 4F08A 2BZIB 2PVMA 2XS0A 3F69A 4IX3A 2JDVA 5T68A 4DINA 2B1PA 5M44A 3PDTA 1SZMA 5AA9A 1JBPE 5HO7A 3L9MA 3RI1A 3ZO1A 3I5ZA 1FGKA 2ITZA 3LFDA 3UVRA 3PPKA 5HIEA 3RALA 5CF8A 5BVOA 4GRBA 2XM9A 4K77A 5ITAA 2WELA 5CTPA 4F65A 5HGIA 3GOKA 4IB1A 4QMXA 2QO7A 4KIKB 4O6LA 5HX6A 3NDMA 5A6NA 4QMNA 1X8BA 4ASDA 2YWVA 3QTUA 1KE6A 3LFAA 3UO6A 4BCGA 1UWJA 4ZZMA 4FV3A 2WEIA 4YTHA 3FZSA 4LYNA 4CCBA 4MNEB 3QUDA 4D2SA 4EYMA 3UODA 2QKWB 3W18A 4W4WA 5ACBC 3WF5A 3FZRA 4AUAA 2ZB1A 3KXNA 5FLFA 4RIWA 4F9WA 3V6SA 2GS7A 3OT8A 4C3RA 1YXXA 4FV7A 2W1GA 4CFUA 5BYLA 5GIOE 2CGVA 4F4PA 2W0JA 4GFGA 3ZMMA 4JJRA 3RJCA 3T3UA 4YUQA 2UW3A 4H36A 4MNFA 2XVDA 3GU5A 4G5PA 4U8ZA 1PMUA 1NY3A 2W5AA 4JRVA 3KQ7A 5AP5A 3VS2A 4HVSA 5J87A 3U4WA 2JDOA 1VZOA 4NYEA 2YISA 3JR1A 3PA3A 1YOMA 2BZKB 4AE6A 4UWCA 4BGQA 2O3PA 2VWXA 4MAOA 2BTRA 4H3QA 5E9EA 4QP4A 3EQRA 1KE5A 4YJOA 2UVXA 3FLQA 3E64A 2QVSE 3E92A 3RP9A 1VJYA 2W1FA 2ZV9A 3QRJA 4IE9A 4N57A 4E5BA 1CTPE 3FQSA 3PA4A 1TQMA 1YW2A 3D5UA 4YO4A 2V62A 2Y6MA 3CY2A 1VR2A 3H30A 1CSNA 2WZJA 4PPCA 3I79A 3CPCA 3QTZA 4IC7A 4DCEA 1URCA 3RAWA 4F70A 3JUHA 4GKIA 4RRVA 4FV8A 4I93A 4ZTQA 5LVLA 2ZV8A 3GU7A 3O96A 4Y72A 3V5LA 1E9HA 2SRCA 2W1DA 1H0VA 3AC1A 3SOCA 4DFBA 3ORKA 4AP7A 4BCPA 4FSYA 3NYOA 3A8WA 4U45A 1HCLA 5J9YA 4WG5A 4M14A 4XLIA 4LGHA 1IRKA 3AT3A 3LOKA 4K9YA 4S34A 4PNKA 5ICPA 3ZXZA 3RK9A 3ZBFA 4RIYB 4DEHA 2WNTA 2C47A 4OTQA 3GNIB 3KRJA 1PMNA 3DKOA 1KWPA 4G6LA 1CKPA 2VGPA 4NM7A 4R7HA 1BI7A 4E6AA 1JSVA 4D2WA 4ASXA 5CEMA 3UOHA 1ZRZA 2B0QA 5CS6A 5DT3A 2VAGA 3CR0A 3TJDA 5L2WA 3GC8A 2YZAA 4E4LA 2WGJA 2C6LA 3UOKA 2QOBA 3C4ZA 4E6DA 3MTFA 3OC1A 3MIYA 4ZY5A 1ZYSA 4GYGA 3DZOA 4Y5HA 4ITJA 4ERWA 3QHRA 3WIGA 1J7LA 4FZDB 4FTTA 4C02A 3UE4A 5HNBA 3D2KA 3AOXA 5D9HA 3ACJA 1OL2A 1OKWA 2ZVAA 3LLAA 2OZAB 3TN8A 2OWBA 4UMQA 4BYIA 4AOTA 4ZSJA 4E7WA 3D7TA 4JAJA 1ZY4A 4BHNA 2DYLA 2VO0A 4FIEA 3ZOSA 3CY3A 4FODA 4O6EA 2RSVA 2YIQA 1H26A 1P4FA 4QP7A 3W32A 5HVJA 3I60A 4ZIMA 4P4CA 4QMLA 1RDQE 3F7ZA 4J7BA 4S30A 5CEPA 1U4DA 5I9XA 4BR3A 3LMGA 4QTAA 3VF8A 1ZXEA 3RNIA 3QTWA 4CD0A 4R3PA 3A8XA 3BHUA 3ODYX 4FIGA 4M8TA 2W1HA 4AT5A 4C4HA 5E4HA 1Q24A 4O7LA 2P3GX 1XR1A 2QG7A 3ATSA 3MV5A 1GOLA 3TKHA 1GZ8A 5BNJA 4KBKA 2J4ZA 3IW6A 3HECA 3VRZA 5LMAA 2XP2A 2F2CB 5T3QA 3KA0A 3Q9XA 5F4NA 5HLWA 5B0XA 2PSQA 4D58A 5C8MA 4L44A 4X2KA 4I5CA 5C8NA 1SNXA 3PWYA 3L8PA 1Y57A 3LFBA 4IZYA 4U80A 2PMLX 4QTCA 4XP2A 4WNPA 2OZOA 4PNIA 4W4VA 3QQGA 5JRQA 4LMNA 4F1OA 4AFEA 3GCPA 2J5FA 3GP0A 4RIOA 5ANJA 4FZAB 4KB8A 4Y85A 2W1EA 4XV1A 1SMHA 3CIKA 4F09A 2W1CA 1DAYA 3KVXA 1J91A 2ITVA 2X39A 3NRMA 2WTIA 3II5A 4U81A 2DQ7X 4CNHA 3COMA 2GHMA 3QGYA 2IG7A 5EHLA 4FT9A 2C3IB 4C62A 4DEDA 3LKMA 5AP3A 4MD9E 3D83A 4HZRA 5AUZA 5CXZA 4CKIA 4JR7A 4DH8A 5LVMA 4YSJA 4TT7A 4NTTA 2ITUA 2W4OA 3E8NA 3PZHA 4JNWA 4QNYA 2OBJA 4QPAA 5CEQA 5A4LA 5EM8A 5DYJA 4JDHA 4YZNA 4OW8A 3VS4A 4GIHA 4AW5A 2F7ZE 4EWHA 1PYXA 2FH9A 2X7OA 4FK3A 3BYVA 4IH8A 4QQJA 3BWFA 2KULA 2EXCX 4L53A 3R8LA 4EUUA 3NYXA 5I9WA 4FL3A 4O7NA 2JDRA 3ZUUA 3U6HA 4TWPA 1VYWA 2IPXA 4O7VA 3TDVA 3KXZA 3PFQA 5ANKA 4V01A 3WBLA 4F7LA 3A99A 3HA6A 4KWPA 4ZTRA 3QX4A 3LFCA 1ZYCA 3VIDA 2VTPA 3ALNA 2UZTA 5TF9A 3UIBA 5IQEA 3ZLYA 4CLJA 3SGCA 4G3DA 1OI9A 3QL8A 1P2AA 4I6BA 4L42A 3W8QA 5B7VA 4G9RA 4A7CA 3FMEA 1Q41A 3EN4A 3G5DA 2GS2A 3G6HA 4LG4A 2IZTA 5F9EA 2LGCA 3ORNA 1NXKA 3GT8A 3WE8A 3BX5A 3BYOA 3FLZA 4QMWA 4XBRA 3DQWA 4GU6A 5F1ZA 5AUTA 3W10A 4U3ZA 4QMPA 3RBWA 3MFRA 3UC4A 4R3RA 4UN0C 4BY9E 1LUFA 4S33A 1YWNA 4W4YA 4ZTSA 3G6GA 1YKRA 3Q60A 5CAOA 4IVBA 3E63A 1GY3A 2F9GA 4BDIA 3KMMA 5HE0A 4AW2A 4PV0A 3JXWA 2XYNA 2R3QA 2BPMA 4QP8A 3COIA 2BDJA 2X8IA 3KF4A 1IG1A 2QO9A 3ORIA 4ZY6A 3QD3A 1XBBA 2BVAA 1MQ4A 5D7AA 2C0IA 3FQHA 4W8EA 4FT7A 3EFJA 4GS6A 3QCSA 3FSKA 1NW1A 3DFCB 1H27A 5CU3A 5ANEA 5HLPA 1WBTA 1PXPA 2FGIA 3BU6A 3NW5A 4FF8A 1OVEA 5BMMA 4EOIA 4F9CA 2YACA 5CAVA 4U79A 4E4XA 4FYOA 2Z02A 2YIXA 3M1SA 3UIUA 4JRNA 3C4XA 3MA3A 4EEVA 5HG5A 3WF8A 2BIYA 5IA3A 4B99A 4EJNA 3ZTXA 3T9IA 3MFSA 1OECA 4N4SA 3A4PA 5HD7A 3MDYA 3A7GA 3ELJA 4L01A 5KKRB 3GQIA 2E9NA 3JVRA 1F0QA 5DG5A 2CCHA 3BGQA 3E8CA 3FMNA 2R3LA 4YJSA 3HV5A 1JKSA 1R0PA 4LRMA 1LP4A 2PTKA 3FDNA 5LJJA 5G1XA 4YJTA 4OGRA 4O7TA 2OKRA 3DAEA 3DQXA 4PPBA 4A06A 3QX2A 4QQTA 2O64A 2CKQA 4EOQA 1OPJA 4X21A 4ZLOA 3FWQA 3V5PA 5CX9A 3PIZA 4OTDA 3HMMA 1FPUA 3ZLXA 4AS0A 4CRLA 4Y83A 3D2IA 2JDTA 5CU4A 5CASA 4NK9A 2R3HA 2YLFA 3FKNA 3CCNA 3UIMA 5HNIX 4AOIA 4OTHA 3TACA 1NVQA 5EYMA 3Q52A 3QC4A 2X9EA 3LJ1A 4RWJA 2VRXA 5D41A 4RA5A 1QMZA 3FZTA 2OH4A 5AUWA 2OSCA 2R3OA 4AZSA 3DBFA 2ZM4A 4F6UA 2XM8A 3NNWA 3QTSA 3VUGA 4O7RA 2OK1A 2IO6A 3DXNA 2OJJA 2FUMA 2YDJA 3QFVA 3LXNA 5DH3A 4AFJA 3EOCA 2XNBA 4D9UA 2X2LA 2B52A 3D94A 3VC4A 3ZRMA 5BVFA 3BQCA 4ZZOA 3FBVA 4I4EA 5GNKA 2OFUA 5IQGA 5M06A 4AN2A 4BDHA 3EFKA 1H1RA 3QQLA 3DBQA 4GK2A 4F1MA 3NGAA 2XJ2A 4FKIA 4BGGA 3Q6WA 5J5TA 2PHKA 3DJ6A 4G16A 4BF2A 2WU6A 4I0TA 1Q3DA 2XIKA 4QMZA 3ROYA 4MVFA 4IVCA 3BELA 5AR8A 5AV3A 4HCTA 4C33A 1M17A 2VNYA 2YM8A 3E93A 4I23A 4BDBA 4GG7A 2J5EA 4GMYA 5HTBA 4UMUA 2WPAA 2IVUA 3IQ7A 3FC1X 4WBOA 4QYYA 5K0XA 3EQFA 2UZOA 4M69B 4RX8A 5ANDA 4BDDA 3PWDA 5KX8A 3C5UA 4GU9A 5IEYA 2OIBA 3CQUA 4O81A 5EK7A 4USEA 3AD5A 1DM2A 4W9XA 5AX3A 5DRDA 3SVVA 2ZAZA 2VX3A 3H9FA 5KUPA 5BVWA 1A06A 1JSTA 2VTJA 2WQMA 2BRBA 3CPBA 5E8YA 2YFXA 5IUIA 3O8UA 4FG8A 4MKCA 2VTSA 4FTUA 4ZZNA 4YNOA 2VX1A 2WOUA 5BYZA 2OF4A 4AN3A 1UU7A 4ASEA 1A9UA 4FVRA 3ZYAA 4M0YA 3FUPA 3KCKA 4H3PA 3QGWA 3QA8A 1PJKA 2J90A 3O71A 4DEEA 2UW8A 3CS9A 1H1SA 5K3YA 3RPSA 2B53A 4FNXA 4RSSA 4J71A 1W83A 1UU9A 3HGKA 3BEAA 4TW9A 2OIQA 3G9NA 4FTLA 4ZXTA 4IVAA 4D2TA 4RX5A 4UYNA 3UZRA 3QF9A 4O27B 1R1WA 2GHLA 2BTSA 1GAGA 3HMOA 4U42A 4U43A 1OIUA 3EH9A 4HYSA 3S1HA 5DPVA 3JY9A 3NR9A 3PP0A 2VNWA 3TUBA 4K33A 4R6VA 4EOLA 4LMUA 1OL7A 5C27A 3KRLA 3OCSA 1V0PA 2XB7A 2PK9A 3QKMA 2F2UA 1GZKA 3IGGA 2XMYA 3EQIA 3R7GA 4CFMA 2PU8A 3QD0A 3KXHA 2CKPA 2JAVA 4IWOA 4EK4A 3MH2A 4UEUA 3ZO3A 4BTMA 4DEGA 2W5HA 4GT5A 4GKHA 2OIDA 4FSRA 4AA5A 4AAAA 4F1TA 3MJ2A 4C36A 4Z55A 1J7UA 5BYYA 2YABA 3PYYA 5CQWA 3R7IA 2BALA 5FEQA 3N9XA 3NNUA 3ZFXA 4EH8A 2ESMA 4UMTA 5CXHA 4IFCA 5TT7A 2EU9A 3TNWA 4QQCA 1XH8A 3BRBA 2B54A 1QCFA 2OJIA 3MSSA 3QRKA 3RPOA 2RG5A 4MQ2A 1YXSA 4UV0A 4EKLA 3EKKA 3FZOA 3RWQA 5K4IA 2XJ0A 4GSBA 5D11A 4TYHB 3LVPA 1ZOHA 4JIKA 5CNOA 5FEEA 5JGBA 3GI3A 5DHJA 2O2UA 1ND4A 4Q5EA 4RZWA 2ACXA 4WUNA 1XWSA 3F82A 5H8BA 1KV2A 4E6CA 4DH3A 5HE1A 4JQEA 2VWIA 2YWPA 5DIAA 3PSBA 4EHZA 3AMBA 1MQBA 2X6EA 3EN7A 2J9MA 3Q4CA 3NNXA 2YLEA 1XHAA 5FM2A 3UMWA 4FIJA 1PHKA 2C30A 5FTGA 1WBNA 3ZM9A 3IW5A 2JC6A 3W16A 3LFQA 4BIEA 3ENMA 3AD6A 2JBPA 2VV9A 1PF8A 3HP5A 2VUWA 3RKBA 2YIRA 3OTUA 4E93A 4O82A 1W7HA 4O2ZA 4W4XA 2UW6A 3VUDA 2OW3A 4E6QA 3RZBA 4J8NA 2R4BA 2C0OA 3ULIA 2XRWA 3HMIA 2HWOA 4DH1A 4O0UA 5AV4A 4C4GA 2PE2A 2C1AA 4F0FA 1M2QA 5IISA 4I41A 2X2KA 4IADA 4MBLA 3HYHA 4ZTNA 4BBEA 3MBLA 2UZWE 2J0LA 4I0RA 4OT5A 5EYDA 5IDPA 3PLAE 3MVLA 4DLJA 4FTJA 4QMQA 2O65A 3ZM4A 4RVTA 5K5NA 2WQBA 3V8SA 4Q5HA 2C6OA 3VF9A 4K2RA 3KVWA 1UV5A 1ZZ2A 5DRBA 5E91A 4FKSA 3FLWA 2PVFA 2CMWA 5AIKA 2B9IA 5GZAA 1ZMWA 2Z7LA 4FEVA 3ITZA 3KN5A 2BIKB 3KFAA 1Z9XA 3O7LB 3ORPA 2X4FA 4YZ9A 3QQFA 4CKRA 1U5RA 4K18A 4NJ3A 4XG6A 4IWDA 2YDIA 4PP7A 3QKKA 3JVSA 4PP9A 5E8WA 3PXYA 3UIXA 3MTLA 3F3UA 4RFYA 2C6EA 5FUTA 2I40A 3U51A 1R0EA 2BFYA 1H8FA 3Q4TA 4MQ1A 5J5SA 2EB3A 4V04A 3ID6C 1RQQA 3KRXA 2H34A 4ACDA 3K5UA 3BGPA 2A2AA 2UV2A 2WMSA 3TM0A 5LVPA 3MWUA 3LIJA 5M53A 2GHGA 4PTCA 2CLQA 4I6FA 5BUIA 4WD5A 4IHPA 2HY0A 3GFEA 4FSTA 4CMTA 3Q53A 4I20A 4NIFA 3B2WA 5AM6A 4BCFA 5I9YA 4QYGA 2WTWA 4EZ3A 4IZ5A 2WMVA 3E8DA 3NAXA 4KABA 4X3JA 5HEZA 2WMUA 4NH1A 4QP2A 3QC9A 3BHTA 3Q32A 1QPEA 4YURA 2X4ZA 5I3RA 3MESA 3BIZA 4G17A 5FXQA 2IWIA 4ITIA 3I6WA 1YDRE 5JFXA 2PZPA 3QLFA 3ANRA 5AR3A 3GUBA 4QPMA 2BRHA 3LXLA 1JKLA 2WMTA 4LUDA 2I0EA 3NPCA 3OXIA 4S31A 5AUVA 4DFUA 4EJ7A 3PPJA 3SDJA 4CFWA 1ZMUA 2HCKA 3DOGA 2IZSA 1SNUA 2GMXA 2QODA 2XIYA 4R8QA 2WIPA 4NKAA 3SXRA 4BCNA 2BDWA 4J96A 2QLQA 1SM2A 3ALOA 2FVDA 3LXKA 4IAIA 3NIZA 2YJSA 4O2PA 5CEIA 3UVPA 1FBNA 5E8SA 2J6MA 4CFFA 5E8UA 3FI4A 4C2WA 1FGIA 4EC9A 3R28A 4FSMA 4AN9A 3GU4A 2QHNA 3LPBA 5KMJA 5AV1A 3G0FA 3CC6A 1CKIA 4PMTA 4BCQA 2GNJA 5FD2A 4CZYB 1QPCA 4IB5A 2Z60A 1APME 1U54A 1MRYA 4BZOA 5CSWA 4C3FA 3WZEA 2HK5A 3PY1A 2GQRA 3IPHA 4DLIA 4BDJA 1M14A 5HICA 5C03A 4CV8A 3OF0A 4CQEA 3IW8A 4RJ5A 3MY0A 2BUJA 2GFCA 3CTJA 3VJOA 4EQCA 5EHYA 2VZ6A 2ETKA 3HV7A 4CXAA 4AW1A 5E90A 5IDNA 4AGUA 3W2PA 4RIXA 3JS2A 2XIZA 4L6QA 2V22A 2C3KA 4JG7A 5KMOA 3O51A 2J0JA 3A60A 3FKOA 1WMKA 5AADA 2H96A 3VAPA 3G51A 5CQUA 4L68A 2VD5A 4XRLA 3ULZA 4NL0A 2R7BA 4ZMEA 3PZEA 5ACKA 3BU3A 3KMWA 3DZQA 2Z8CA 3V5TA 4O0SA 3LAUA 2GNIA 4I5PA 3KU2A 2W4JA 1YI4A 3CXWA 3F66A 2C1BA 3C9WA 2X9FA 2VTLA 3WOWA 3QCYA 4I0SA 4QMUA 4CFXA 4O38A 4EORA 4XOYA 3BU5A 2JD5A 2W06A 4NSTA 4M69A 4YBKA 4X2JA 2RFDA 3N4VA 5ETCA 1R3CA 5DFPA 4G6OA 3C0IA 1OPLA 4XNEA 5IZFA 4MXXA 2XNOA 4APPA 4LM5A 2VTMA 4IAAA 4U6RA 4A4LA 2OJFE 2E9VA 3IDPA 4X0MA 4O1OA 5JT2A 2OICA 2RKUA 3AQVA 4FSWA 3F3TA 3F3ZA 4U3YA 3VS0A 5H2UA 4PL4A 2YM6A 3FMMA 4KKHA 1YOLA 4ZLYA 2CN5A 3PG1A 2QOQA 3OD6X 4GH2A 3BHYA 2F7EE 2VTIA 3FZ1A 5JH6A 3ORMA 1ZYLA 3G90X 4C37A 3D0EA 3ORTA 3DU8A 4L9IA 4HGLA 2VU3A 4PDOA 5DE2A 3CKWA 4QMOA 1Q8ZA 2ZMCA 2B9HA 4BRXA 2YZLA 1Q99A 4IX4A 1UA2A 2DS1A 4GFOA 3NLBA 4FKQA 4HCVA 1Q62A 3G33A 1L3RE 4H3BA 4R77A 5HIBA 5GJFA 5K9IA 5HESA 4QO9A 3DDQA 3FYKX 2BZHB 2QOIA 5CY3A 4D28A 3JYAA 4TYGA 5CEOA 4A4OA 3E5AA 4CG8A 4IZAA 4JR3A 1F3MC 5AUYA 3ORLA 4PWNA 5LMBA 3AT4A 3QCXA 3P78A 4AX8A 1XH6A 5JFVA 2GSFA 5B2KA 3POZA 4BI0A 4O21A 2ZOQA 3V01A 2CNUA 1YVJA 2KTYA 2ZYBA 4IVDA 4FG7A 2JLDA 3HV6A 4PTGA 5KBQA 4O83A 4BCIA 2PUUA 1OUYA 5IQCA 4IQ6A 4L45A 4P2KA 2ETMA 4ANNA 5IPJA 5DWRA 2P33A 2WD1A 2UW5A 2XCHA 5CANA 3P23A 4AXAA 4BL1A 4UX9A 5M4UA 3NVKI 5FDPA 1WBWA 4ASZA 3S00A 2ZDTA 3VW8A 4IW0A 5ETFA 2WHBA 4AW0A 3O8PA 4XEYA 2WMRA 2X8EA 4CMOA 4YHFA 4FOBA 2BRGA 2JFMA 4BDKA 5BUJA 3ATTA 4M3QA 4KSPA 3HLLA 2JGZA 4MTAA 3LZBA 1Q8YA 3D7ZA 5CSPA 3ZUVA 5FXRA 1UNHA 3G0EA 3OBJA 3OWLA 4KIOA 4RBLA 5HIDA 4J98A 1ZZLA 4J99A 2A1AB 2Z7QA 4JBOA 4C0TA 3F2NA 3GC0A 2QOHA 2ZV7A 3L8VA 2G15A 3PXRA 4H1JA 3CE3A 4G3GA 3BGZA 2GNLA 4Y46A 1QPJA 4Y8DA 3QQUA 5KZIA 1ZOGA 1PY5A 4FGBA 1WVWA 3DB8A 3AC8A 5KZ0A 3LCSA 3DAKA 5IQHA 2WO6A 5E8ZA 4QP9A 5EQEA 4ZJJA 2ITQA 3R04A 4QMTA 2R3JA 4P90A 3NNVA 3VBTA 4EQUA 3KK8A 5AEPA 4X2NA 5AR5A 5AJQA 5AP0A 1VEBA 3WZUA 2P2HA 1UU8A 4X3FB 2E9PA 3LCOA 5I3OA 3KXGA 3LXPA 3O0GA 4TRLA 1FVRA 3RAIA 3I1AA 4USFA 3CJGA 4KINA 3PSDA 3BCEA 3UZTA 3C0HA 1PRYA 5BPYA 1QL6A 1P5EA 3R0TA 1MRVA 2C6KA 2UUEA 4Q9SA 3EQHA 4PX6A 4AZVA 4O7SA 4FZFB 3PRIA 2I0HA 3RNYA 3R83A 4HVIA 2XIXA 1FOTA 3BYSA 5D7VA 4BKZA 4DT9A 4WNKA 3TG1A 1WVXA 4TNBA 3TXOA 2VX0A 4IB0A 5HE3A 1GZOA 2ONLA 3CD3A 3GC7A 3E3PA 2R64A 2E9UA 2HAKA 3EZVA 1WBOA 1IAJA 3ZHPC 1R78A 5E8XA 3UDBA 1I44A 4BWPA 1UKIA 3OG7A 3FHRA 4AWIA 3UJGA 2VN9A 2WAJA 4NKSA 1RE8A 3DBCA 5DLSA 5AP6A 4FTCA 5I9ZA 3KULA 3RWPA 3FV8A 3R8PA 2XH5A 4X3FC 4YZBA 2NPQA 2G9XA 2BRNA 4YJPA 4OTGA 5EOLA 5TE0A 4Q9ZA 5IA1A 5FEDA 1YDSE 3C4EA 4NCTA 2PZRA 3QTRA 5IQDA 4JLCA 4QP3A 3BZ3A 2X6DA 4F9AA 3KRWA 1YXVA 3RM6A 5LXMA 1OBGA 1S9JA 5BUEA 4AU8A 3AXWA 1V1KA 3AC2A 4M68A 5E7RA 3RHXA 1BMKA 1K2PA 2QR7A 3FMLA 3LFEA 4XLVA 5C8KA 4MD8E 4AA4A 4CCUA 1MP8A 3SG9A 4DCAA 4JDJA 3AC5A 3W33A 3OXZA 3VVHA 4RWLA 2P0CA 4UB7A 5M4IA 3UPZA 3SW7A 4CVAA 3R1YA 1PXMA 4F99A 3FKLA 3R00A 4GG5A 4TYEA 4WSYA 4IACA 2O5KA 4LGGA 5CU2A 3VS1A 4F6WA 5BX0A 3QRIA 1ZYDA 4TYIA 3MS9A 4FC0A 4AOJA 4TTHB 3RMFA 2B4SB 4BI2A 2PZYA 5AIRA 4LI5A 3ZCLA 3P08A 1PMVA 4QTBA 4ANQA 3VBXA 3SRVA 4DBNA 2IJMA 4IAYA 4ANBA 3CJFA 5I0BA 3T9TA 2W9ZB 4JVGA 5AR4A 4PMPA 4RMZA 1MRUA 2CKOA 4C7TA 3TWJA 2GNFA 3QALE 3TIYA 4CKJA 3U6JA 2BFXA 3QHWA 3TJCA 1Q5KA 3F6XA 4RJ3A 4X2GA 3KGAA 4YZDA 1H4LA 4O96A 3OFMA 5EKOA 4FIHA 5EW9A 4FL1A 5JZJA 4YU2A 3QTQA 2GQSA 2H6DA 4CFVA 4R78A 2Z2WA 3D9VA 4QMVA 4WG4A 3R7YA 4D2PA 4PDPA 4G34A 3MJ1A 2CSNA 3AG9A 4UZDA 3NCGA 1W98A 4JBVA 2IW9A 4BCKA 4L52A 4W9WA 4ZP5A 4KKEA 2JITA 3VUIA 4IEBA 3VNTA 4WKQA 2WMQA 4DTBA 4IMYA 3I7BA 1VYZA 1ZARA 4M84A 3UPXA 4DTKA 3EZRA 3ZXTA 4EHGA 1NT2A 4S32A 3U4UA 4RJ8A 5L3AA 3FI3A 1Q8UA 2WTKB 3O8TA 4TZRA 3NVMB 4DGOA 3BBTB 3H0ZA 4R5YA 3K3IA 2QOOA 3E88A 5D12A 3QQHA 3PPZA 3QRTA 4OR5A 5KMIA 2UZBA 5EI2A 4CSVA 4ZTHA 2PMNX 4FBXA 4F6SA 3SAYA 3F5PA 4Y5QA 5KHWA 1EH4A 5DI1A 3FI8A 4OTPA 2ERKA 4XV2A 5HCXA 4C4JA 1XO2B 3MH0A 3CKXA 4QP1A 4D1SA 3EIDA 3MH3A 4CT1A 3IOKA 5D1JA 1F5QA 4BDEA 3BBWA 4RJ7A 3HMNA 4MD7E 3VUMA 3AGMA 2VWYA 3W8LA 1CM8A 4KKGA 1SVGA 1WCCA 1O6KA 3BV3A 5IQIA 2WMXA 5CSHA 3EYGA 3IO7A 3DFAA 4KIKA 4O0XA 1Y91A 3NUYA 2XIRA 4IANA 4RWKA 4LRKA 4FKTA 4QP6A 3FLNC 4ALUA 1G8AA 3PJ3A 4TNDA 1Q97A 1O6YA 3C0GA 3GOPA 3IW7A 4TXCA 5DEWA 5DR2A 5ETAA 1ZOEA 2NRYA 3WARA 4ACHA 4MNEA 5KO1A 4P5QA 4QPSA 5A3XA 1FINA 3MH1A 3LM5A 4HGSA 4GYIA 4M67A 5HBHA 5AP4A 2PUPA 1KV1A 4XG9A 4L3LA 5KNJA 2GS6A 4RFZA 2PVYA 3NUAA 2CNVA 2PZ5A 1UWHA 2OJGA 3EFLA 5J1WA 4BIBA 1K9AA 4NFNA 3PXKA 2DWBA 5EQPA 2ITPA 3BLQA 1PXKA 2EWAA 2XKDA 2GCDA 4OBPA 3ZSGA 3WF7A 3TZ8A 3R9OA 3DKGA 4WHZA 2G2FA 4CLIA 5H3QA 1ZY5A 2GQGA 3O50A 4V0GB 3IGOA 3ZC6A 2WEVA 3TCPA 1Z57A 2WQOA 3OWPA 5L8LA 5HVYA 5L8JA 3ETAA 3V5QA 4WBBB 3ZS5A 1H28A 3P86A 3OEFX 5K0KA 3KMUA 4UBAA 1XJDA 3RVGA 3OY3A 1M2PA 4FV9A 4YLKA 2WQEA 4JT3A 5KKRC 1S9IA 2Z7RA 4XV9A 5GZ8A 3LMHA 3EQBA 4BICA 2X1NA 3HRCA 5C9CA 4BZNA 3VBYA 4FTRA 3R30A 1URWA 2W17A 2WMBA 2X8DA 3LW0A 1Y6BA 3THBA 5TR6A 5LCKA 2EXEA 3EN6A 3Q9ZA 4E26A 4I22A 4E4MA 4MX9A 4HPUE 2REIA 3TNQB 2YM7A 5JQ8A 2YITA 2FSLX 2HXLA 3OZ6A 5IMEA 5DNRA 2BAQA 4O86A 2HW6A 5M51A 3D14A 3UGCA 4FEXA 3V8WA 2OGVA 2C5XA 2JKMA 4AZWA 3C13A 5HBJA 1XKKA 5IA2A 2IZUA 2WB8A 5BVDA 3R63A 4WUAA 4HVHA 4UY9A 4ENXA 3ZFYA 2X7FA 3R1NA 4FV1A 4RIYA 3PVGA 4FL2A 4YC8A 4A9TA 4N70A 3RK7A 3VRYA 1IA9A 4MXAA 3Q2JA 4BDCA 4CQGA 2VGOA 3POOA 2XK9A 4XUFA 3GCSA 2XUUA 5EQYA 4Z7GA 4JX3A 4P5ZA 4FG9A 3RZFA 3ZFMA 2BCJA 2PMIA 5E92A 3HAMA 5JN2A 4J52A 3TDWA 1JKKA 4ACGA 2YCFA 3TV7A 3F88A 2R2PA 2YERA 2YAAA 3OCGA 4NM0A 5EM7A 2HYYA 4B8MA 2C3JA 3TKUA 5J7HA 4NWMA 2GU8A 2W9FB 3ODZX 4OBOA 5HG9A 4DYMA 2FA2A 3MI9A 4EBVA 2WXVA 4U40A 3NW7A 3BYUA 3I4BA 3OW3A 1PXOA 3QBNA 4K8AA 2OZAA 4KBAA 5L8KA 4EONA 5EM6A 5CEKA 3KXMA 2F57A 5JFSA 4IIRA 4YZCA 1OM1A 3GCVA 5EDQA 3GBZA 3ERKA 4CZUA 3R73A 3OOGA 4IAKA 4LOOA 2ITTA 3P7BA 1BX6A 3P79A 3HX4A 2OXYA 3OXTA 2ITYA 5FWKK 4NM3A 4I5MA 4YNEA 1W84A 4L67A 4GEOA 5AP1A 4AGCA 4RIWB 3SG8A 4O84A 2PULA 2VWVA 5JRSA 3SA0A 4OTRA 3QXPA 3G2FA 4J53A 5DVRA 4BVUA 3F61A 5EDPA 2YHVA 3HA8A 1YXUA 4BTJA 1BKXA 2QOLA 3FMHA 1UU3A 3C1XA 4QTDA 4RLLA 4RVMA 4DEIA 3P9JA 4EI4A 3QWKA 3SX9A 3GVUA 2UW9A 5CI6A 2RF9A 5K5XA 2OH0E 2GNHA 4FTOA 4R1YA 5HVKA 4UMPA 2YCSA 3ZEPA 2QKRA 5JQ5A 4HNIA 4YTIA 4A07A 4EH6A 5L2QA 2UVYA 2WIHA 1WBPA 3RCDA 3FXXA 3DGKA 5TO8A 1OBDA 3ZUTA 5HU3A 5CAUA 3M11A 1JLUE 3PIXA 3OROA 3A4OX 3CP9A 4A4XA 2Y4IB 5IQFA 5M08A 4HGEA 4TN6A 3V3VA 4J97A 5KBRA 2G01A 4WRSA 5FRIA 2XNPA 4BBMA 4H58A 5BVKA 4DF3A 4ZJIA 4XOZA 1OL5A 2OXXA 3NYNA 4NFMA 3REPA 2QR8A 3DKFA 1HOWA 4FZ6A 2VTNA 2A0CX 2R5TA 3SD0A 4B4LA 4IXPA 4YBJA 4EHEA 3QWJA 2XA4A 4PRJA 3FSFA 3OCBA 5BMSA 5EKNA 3HKOA 2ZDUA 4RVKA 2BR1A 3Q4ZA 4MYGA 3SKCA 1B38A 4CZTA 3BYMA 5L2SA 2ZJWA 3QKLA 4B6LA 4BB4A 2PVRA 4IWPA 2BHEA 4RVLA
chains in the Genus database with same CATH superfamily
2BAJA 4O1PA 4JBQA 1UKHA 5DGZA 3NUXA 1SYKA 3NFGB 5CU6A 4MXOA 5B2MA 4XHKB 5CENA 3CLYA 4ZK5A 3BPRA 4FKWA 3OHTA 4NU1A 5IG1A 4ORKA 4G9CA 2OU7A 4YPDA 4RPVA 3UQGA 3PG3A 3MY5A 5IEVA 3NZ0A 4IB3A 2DUVA 3EWHA 5KMKA 2JKKA 5D10A 4H05A 4ZS0A 2XK4A 4V05A 3UO4A 3VS6A 3R7EA 5AFVA 3R8UA 3DLSA 4EH9A 5A4QA 3GFWA 1W2DA 1JAMA 2ITNA 2QG5A 3L1SA 3R21A 4IX6A 3B8QA 5EHOA 4EOKA 3HDMA 4ZTMA 4BCHA 1IEPA 5HZNA 2QNJA 3D7TB 1IA8A 1J1BA 3CBLA 3KF7A 2XF0A 5CVHA 2QU5A 3L8XA 3QU0A 5IF1A 3OUNB 3IG7A 4U41A 4QOXA 2UZUE 4YHTA 1QPDA 3BL9A 1PYEA 3GEQA 4EL9A 4TY1A 5ETIA 5AAFA 5M4CA 5M56A 3LQ3A 2X0QA 4FNYA 4MCVA 3NW6A 1KE9A 2JEDA 5JFWA 5J95A 1H1PA 4IAFA 2IZRA 2VWUA 4P7EA 1OB3A 1OGUA 2HY81 3C4CA 3U9CA 3VULA 3W2SA 5B2LA 2A27A 2B7AA 5JK3A 3U55A 2W96B 4CG9A 3QTXA 3H9OA 4PY1A 5CT0A 2R9SA 4BWXA 1ZYJA 4JL9A 5ANOA 3FEGA 4E20A 2V55A 3GCUA 4BCMA 4OAVB 3QZGA 4R7BA 3EJ1A 1DI8A 2I1MA 4BKYA 4D4RA 3U6IA 2QURA 3V5WA 2QOFA 3PVBA 5HG8A 5A46A 2XKFA 3ORXA 3BEGA 2JKOA 2UZNA 4DH5A 3ZZEA 4ZMFA 3TIZA 1ZWSA 2C5OA 2XZSA 4LV8A 2CJMA 4DA5A 1IAHA 4U97A 4YLJA 3F5GA 5LWMA 4FVQA 3TZMA 4OTWA 4X6QC 3IDBA 2YCQA 1W82A 2YAKA 2XEYA 3F2AA 4GT3A 4N6ZA 4FTQA 3M2WA 3W2QA 1FVVA 5T6KA 2G2HA 2YM4A 2IEWA 3R8VA 4I5HA 4O0TA 3AC3A 3Q9WA 4Z3VA 4QEBA 2WQNA 2E9OA 5A14A 4PMSA 5CI7A 1Q3WA 5E1EA 4EOJA 5CU0A 4EZ5A 3PE1A 1T45A 4JAIA 2G2IA 3AC4A 4GV1A 4GUBA 2C68A 3JPVA 4ZY4A 3TKIA 1NVSA 1WBVA 3QZIA 2IVTA 4UWBA 1NVRA 5HD4A 2JDSA 3ZRKA 1E1VA 3NUPA 4TPTA 4XG7A 3C4FA 2R3PA 4DBXA 4FKRA 4FKPA 2CHLA 4BC6A 4JBPA 2QU6A 3MFUA 3OOMA 4GK3A 4XG2A 4FGRA 3AKKA 4YO6A 4MXCA 2QD9A 3IOPA 3TNIA 2WMAA 3OEZA 3PXZA 1G5SA 4F7JA 1B39A 5G6VA 1AD5A 3I0OA 3ZBXA 4AA0A 4B7TA 3GENA 1DI9A 3DCVA 3HNGA 3OVVA 2OG8A 4KRDA 4FTNA 4MF0A 4ZS4A 3QA0A 5HNGA 1YI6A 3ANQA 3DBEA 3LCDA 1XH9A 3E8EA 3OTVA 4PMMA 2I0YA 5FTOA 3V8TA 1J1CA 4AG8A 4DFYA 3ZLWA 1FMKA 3PVUA 4FIIA 4HPTE 3RAHA 4I92A 5HTIA 3HUCA 2XJ1A 1OIRA 3MPMA 4D1XA 3COKA 2W1IA 1CMKE 1Y6AA 3R9NA 3UBDA 4M7IA 4MXZA 4XCUA 5LARA 4AQCA 2J7TA 2IW6A 3A62A 3O7LD 4CMUA 4ZLZA 4RC2A 1BI8A 4WIHA 5BV3A 4KIPA 4MBIA 5HCYA 2FSTX 3RAKA 5FQDC 1KSWA 3B8RA 3SW4A 5DEYA 5IH4A 3FMDA 4C61A 4MEDA 1PXLA 4BDAA 1WAKA 3I6UA 3QYWA 5CAQA 4AXEA 3QXOA 3W1FA 2PZIA 2BKKA 3NFFB 4RX7A 4RZVA 3P4KA 2QONA 4DITA 4EC8A 4DFNA 4GUEA 1Q8TA 3E7OA 4WG3A 2UZDA 1FMOE 4BWKA 4UALA 4FICA 3OBGA 4A9YA 3R9DA 4O0WA 4YJNA 4L8MA 4APCA 4ARKA 5L2IA 1PKDA 1A48A 2GTNA 1BL7A 3OW4A 4TWNA 4IM3A 3RK5A 3IW4A 2ERZE 2GTMA 2UZEA 2IW8A 4I4FA 4RFMA 3VUKA 5LQFA 5BQ0A 4PL5A 4ZEGA 4FEUA 4EOMA 4J1RA 2ITWA 4NUSA 3PIYA 3TZ9A 4G5JA 4MF1A 3EL8A 3RPYA 4Y95A 1JOWB 3BI6A 4HYHA 5FDXA 2P55A 4M0ZA 1KOBA 3EQPA 3LCKA 2XEZA 3CD8A 1FVTA 1DS5A 2XNMA 4D0XA 2XK3A 2B9FA 5KE0A 4FA2A 3RGFA 2QI8A 4DC2A 3OUKA 5HBEA 3KL8A 3EYHA 3FYJX 4GK4A 5FP5A 5LCJA 3Q5ZA 1RJBA 3E87A 3QUPA 4IDVA 4FRFA 2RFEA 3P7CA 4U44A 4TKSA 2CCIA 3MN3A 4WOVA 4I21A 3W55A 4CTCA 2GPHA 3NAYA 1M7NA 5CYIA 5HQ0A 3QLGA 2X81A 2YA9A 3K3JA 3NS9A 1WVYA 4FTMA 4G3EA 3EB0A 4FZ7A 4FV2A 4PUZA 2R3KA 2RFNA 3LM0A 4I6HA 4QYHA 3R7VA 3HV3A 5FGKA 5J1VA 2Q0NA 4FKUA 4FUXA 4FMQA 4NM5A 4DH7A 1G3NA 5F94A 5J7BA 3A61A 1REKA 3PSCA 3MPAA 2VO6A 3A7HA 1OGYA 3R01A 4JDKA 4DEAA 5ANIA 1OKYA 4IM2A 4LOQA 5HCZA 1OIQA 2FYSA 3TL8A 2V5QA 1M7QA 3Q3BA 3NIEA 3QAME 3W2OA 5EYCA 5L6PA 3CTQA 3ZLSA 4MHAA 4IJPA 3EHAA 2AC5A 1CDKA 3LCTA 4XS2A 4YJQA 4L7FA 4U0IA 4CYJA 4YTFA 2PPQA 4DGMA 1PW2A 1YDTE 2QQ7A 2R3IA 3BWJA 3S95A 4AGWA 4IX5A 4BGHA 3SXSA 4C4EA 4TYHA 3UYSA 2HW7A 4AGDA 4AXCA 4JDIA 3TTIA 3WE4A 4AZTA 4BCJA 3GXLA 1M2RA 4B8LA 2FB8A 4ERKA 4ZSGA 3FL5A 3U8WA 5AA8A 1G8JA 4IDTA 4M66A 4HGTA 3Q5IA 3F9NA 4D2RA 5FP6A 2HZ0A 3P7AA 2WOTA 5IUHA 4HVGA 2AC3A 3E7VA 4JS8A 3GC9A 4FYNA 4E73A 3HEGA 4MWIA 5ANGA 2GNGA 2J2IB 2XKCA 3FY0A 5HG7A 3R02A 5CF4A 5IH6A 5L4QA 3M42A 3OP5A 4HVDA 1Y8GA 3R2YA 4L3JA 3VHEA 3F5XA 3EFWA 3KK9A 4GT4A 2JIUA 3VS5A 5HORA 3WYYA 1UNGA 3KRRA 2EXMA 3NMUF 2XNGA 3HV4A 4JQ8A 5M09A 2VWBA 3GB2A 3ZDIA 4O0YA 3BV2A 5FG8A 4QMYA 5L6OA 4RWIA 3UOJA 5GIPE 3H9RA 4BN1A 5CAPA 2QO2A 5LMKC 3QUEA 4TWCA 5GJDA 3ZEWA 1PKGA 3O23A 4U5JA 5C1QB 3F3VA 2C0TA 2C6IA 2UVZA 2XNNA 2YN8A 2XAOA 5F95A 4YP8A 4YTCA 3FLSA 5LVNA 5JKGA 4YGAA 4LL5A 3O2MA 4U9AA 4EWQA 3R1QA 1U46A 4QYEA 4XMOA 3COHA 4EOSA 4RLKA 3Q96A 4FUYA 2W5BA 4XH6A 1O9UA 1Q8WA 3D15A 3HZTA 4HYIA 2UW4A 2RIOA 1H1QA 3QZHA 2FO0A 4GJ3A 1H08A 1IASA 2A98A 2PVKA 4UXQA 3IS5A 3NSZA 3ZONA 4D4SA 2RFSA 3LFFA 4RG0A 3HMPA 3L9PA 5HHWA 1OKVA 3D5WA 5J9LA 2W05A 4KD1A 4AZFA 2Y0AA 2C69A 3KC3A 3PJ1A 4GW8A 1GZNA 4FKJA 3SV0A 3DKCA 4TWOA 2VWZA 5J79A 3O17A 4CTBA 3U54A 3H0YA 2P4IA 3DNDA 4GVAA 2QLUA 3PVWA 3BHHA 3K2LA 3PY3A 5CSXA 3U87A 3ZO4A 5HLNA 1GIHA 2IF8A 4ITHA 5DMZA 4RGJA 4CEGA 2C6TA 4FEWA 2XBAA 4ANSA 4BJJA 2J51A 3R22A 4FKVA 4F78A 3FE3A 2PVLA 2Q0BA 2XANA 4KRCA 5A4EA 3OT3A 2OJ9A 4EK6A 1U5QA 2PVHA 4MH7A 4PQNA 5AUUA 2Q83A 1U59A 5DR9A 4PDYA 1YWRA 3BKBA 3PUFC 2PUNA 2PMOX 4LDTA 4WO5A 1YOJA 3UP7A 1JVPP 3C51A 2X0GA 1I09A 2A19B 3KKVA 3QZFA 1TKIA 3R71A 5CVGA 5JMSA 2YIWA 1JPAA 3NYVA 4NEUA 3ZSHA 4KUJA 3NWWA 3OS3A 4O7ZA 4OLIA 5J9ZA 2Y7JA 2WTJA 4NW5A 5AR7A 5AX9A 2HOGA 5I4NA 1TQIA 2JAMA 4FKOA 4MWHA 4ANOA 4OUCA 4D5HA 4C34A 1RW8A 4JOAA 3WF6A 5GINE 2QCSA 3LE6A 5I9UA 2ZMDA 3TV6A 3A2CA 3FMJA 5IEXA 3L8SA 4FKGA 4KS8A 4KS7A 4AACA 5KMNA 3HAVA 2PL0A 2WMWA 4D4YA 3DBDA 1G8SA 2HZ4A 1L8TA 2PUIA 4EK5A 1AQ1A 4J95A 4DG0E 3TUCA 4DGLC 1YHWA 3D4QA 3A7JA 1NA7A 2CPKE 3DS6A 3SHEA 4FSNA 1W8CA 4BTKA 3PJ8A 3ENHA 3ORZA 1P4OA 4JI9A 1YWVA 4EH4A 1GNGA 2GDOA 5AR2A 3UZPA 3WZDA 1YI3A 4ZSAA 4YMJA 3VQUA 1OKZA 3C7QA 5IMXA 4F7SA 4K6ZA 4LQMA 2BRMA 3CSVA 1XH5A 2XBJA 4BBFA 2I7QA 2HZIA 4JQ7A 4NT4A 4LFIA 4CGAA 4ID7A 4XV3A 5A4CA 1MUOA 1ZMVA 4AZEA 4FTKA 4YSMA 4EKKA 4TYJA 2OLCA 5EI8A 4KBCA 2XYUA 3VW6A 3V51A 4I94A 3UG1A 4GFMA 4E5WA 3MA6A 2BKZA 5IU2A 2WKMA 3I81A 5EOBA 3H10A 1KOAA 2YEXA 5HKMA 3F2RA 2J0KA 3Q2MA 3FY2A 2BMCA 3GGFA 4HNFA 4QT1A 4CV9A 2WTDA 3UNKA 5M4FA 3Q4UA 2UW0A 3E3BX 3AGLA 4R3CA 3LQ5A 1UNLA 2OF2A 2CNQA 4N6YA 2ZB0A 2C5YA 2HXQA 4RC4A 4WSQA 3LJ0A 3BLHA 5HO8A 3RTPA 4ALWA 4LL0A 4FNZA 4YR8A 1SVHA 1XH7A 3FL4A 4GCJA 3VUHA 3KB7A 2E2BA 5HO6A 3D5XA 3MVMA 4R5SA 3WI6A 5A54A 3FC2A 3G9LX 3VUTA 5AV0A 1XQZA 5CZIA 3AT2A 5FTQA 4DFZE 3L9LA 3R9RA 3NUUA 2YDKA 4D1ZA 5A6OA 3F5UA 5AAGA 4C8BA 4QRCA 4C3PA 2VTRA 5CSVA 4EZ7A 4F9BA 3P5KA 5CWZA 3AMYA 4FSQA 4RJ4A 3SC1A 3UTOA 3VBVA 3LMIA 4CFNA 3BLRA 5AP7A 3QYZA 4II5A 4ZAUA 3UDZA 4XBUA 1O6LA 5IKWA 4NIFB 2BROA 3MB6A 5JGAA 3R1SA 4WRGA 2NYAA 5I9VA 2XK7A 1YQJA 2H9VA 4D9TA 4LGDA 1ZAOA 2YJRA 4MUQA 4QQ5A 4MK0A 3TT0A 3CQEA 4FTAA 3R7UA 3LQ8A 1WZYA 3AD4A 1T46A 3MW1A 2WTKC 3NEWA 4PF4A 3MB7A 5LWNA 4OBQA 1J7IA 3FPMA 4L43A 3TI1A 2HENA 3FXZA 4BFMA 2OO8X 4EK3A 2JIIA 3KXXA 4ENYA 2J0IA 4QD6A 3V04A 5I5ZA 3BE9A 5IH5A 3N4UA 2CGUA 4C38A 4RQVA 3UQCA 1PXNA 4IZ7A 2VTAA 1V0BA 2UW7A 4A9SA 3RCJA 5H8EA 3R8MA 3UNZA 5AAEA 2F49A 1GJOA 3CEKA 3HRBA 3JY0A 3IK3A 3DTCA 2R3FA 4NZWB 4EBWA 2P2IA 3DK7A 2VTTA 3DY7A 1TVOA 4BZDA 1JQHA 4U7ZA 2R3MA 4XP0A 3DJ5A 3LJ2A 4NW6A 1U54B 2ETRA 1JWHA 5M07A 4Z9LA 1WFCA 1H01A 1XBAA 4AXFA 3PP1A 4B0GA 3WYXA 1P14A 4BI1A 5FXSA 4FVPA 3CGFA 5AV2A 5AM7A 3WILA 4F64A 5CF5A 4EOPA 3V6RA 2IN6A 4I24A 3ZC5A 3UOLA 4YPSA 4HJOA 3VWAA 2VTQA 4CRSA 3D5VA 2VTOA 4HOKA 1YHVA 4KAOA 4FNWA 4USDA 3GU8A 4ALVA 2EUFB 2OXDA 1SVEA 4RT7A 5J8IA 3S2PA 4O7WA 5M55A 4DFLA 4RIXB 5CT7A 5DOSA 4EH2A 5LMKA 1H07A 1OL6A 2JIVA 4R7IA 5FBNC 3CGOA 1ERKA 3PRFA 4F0GA 5EW3A 2B55A 2V0DA 2PE0A 3R6XA 3U9NA 4FIFA 2PWLA 3B2TA 3R8ZA 5H8GA 2IVSA 4DEBA 2XK8A 4QMSA 2C4GA 3EN9A 1UVRA 1HCKA 3QD2B 4FV5A 4O0RA 3CTHA 2OI4X 5CLPA 2RGPA 4XG4A 5IA4A 3K5VA 4LUEA 2V7AA 2XKEA 3EL7A 3NUNA 4I6QA 4YZMA 2O0UA 5AWMA 4E3CA 4UZHA 2PVJA 4X6RA 3W2RA 3FAAA 4C58A 3NX8A 2VO7A 4GVJA 4G6NA 1GIIA 1Q4LA 2R7IA 4MXYA 2W7XA 4XYFA 5DA3A 5DT0A 5C01A 5KCVA 1KUTA 1DAWA 5FBOA 4ZSEA 5C4LA 2HZNA 2Z7SA 3DV3A 3VBWA 4E4NA 3TUDA 3QCQA 1BL6A 2J50A 5IA0A 4O0VA 2A4LA 2WU7A 5GHVA 3PTGA 2X2MA 4DFXE 4IM0A 3TZ7A 4XRJA 4KA3A 1H0WA 2HELA 4JG8A 2X0PA 5EI6A 5IA5A 4JG6A 4C4IA 5HOAA 1BUHA 2CGWA 4ZOGA 4WNMA 1KE8A 1JNKA 2PY3A 2R0IA 4FTIA 3KIOC 5C4KA 3SLSA 3TEIA 3GCQA 3IECA 3OMVA 4X3FA 3IDCA 3N51A 3A7FA 4G3CA 4M13A 4QYFA 3TTJA 4D5KA 3SOAA 4ANLA 2JKQA 4UXLA 4C57A 4K0YA 4KSQA 2J0MB 4HYUA 2WFYA 2CLXA 3P0MA 4FE2A 3TNHA 5E8VA 4JXFA 2Y9QA 4BCOA 4I1ZA 1H1WA 3F7WA 4F63A 5EM5A 4FSZA 4PPAA 3DT1A 5CZHA 3DA6A 5KMLA 3G15A 3ACKA 3EQDA 3PJ2A 3FQEA 2W1ZA 2Y4PA 3DNEA 4K11A 4AT4A 4EH7A 1OPKA 4DTAA 4PDSA 4F0IA 3MIAA 4MBJA 4K1BA 1OUKA 5A9UA 5JEBA 4OAUC 3H4JA 3VHKA 2C6MA 1H24A 5CF6A 4AE9A 1ZLTA 1R39A 2OFVA 3SXFA 1OIYA 3UG2A 4CT2A 3UVQA 4DGGA 5IQBA 2GFSA 4L7SA 4M97A 3RPVA 3ML1A 3FI2A 3SQQA 2JFLA 4QNAA 3S3IA 4ACCA 4N0SA 3MY1A 4YC6A 4M12A 5LVOA 4KNBA 3I0QA 2FSOX 3EQCA 4AF3A 3BQRA 3UQFA 2EVAA 2UZVA 2AUHA 3MFTA 4FEQA 3OWJA 2O63A 2LAVA 5EFQA 2BHHA 3VQHA 4C2VA 3DK3A 3QQKA 3HUBA 4BTFA 2JBOA 4H39A 2R3NA 2BZJA 5IQAA 1V0OA 4DN5A 4E5AX 4FT5A 2FSMX 4F7NA 3FMKA 5EDRA 3W0OA 1KE7A 1H00A 4IFGA 3PJCA 2NRUA 3W2CA 4FSUA 4XJ0A 4B9DA 4UMRA 2BDFA 3LFSA 2YCRA 4ZSLA 5AMNA 1OMWA 4DGNA 5KHXA 3PXQA 3BHVA 5JGDA 2BAKA 3S4QA 2CGXA 2QC6A 3C4WA 3PY0A 2F7XE 4I3ZA 2ZM3A 4UYAA 4JX7A 3ZDUA 5EG3A 3EN5A 3IKAA 4D0WA 1OITA 2I0VA 2QOCA 4BDFA 4D2VA 4DT8A 4XG8A 5M57A 1TQPA 5E8TA 3I7CA 2YIYA 2CN8A 2C5NA 4L00A 2F4JA 2QOKA 2I6LA 4IBMA 3RHKA 3RM7A 4FKLA 2R3GA 4FR4A 1IR3A 3R7OA 3N4TA 4Q2AA 2Y4IC 5LOHA 4IC8A 3ZH8A 4E8AA 3AMAA 5E1SA 5FM3A 1LR4A 4JIAA 3UMXA 3WIKA 4YJRA 3OCTA 4YJUA 5HTCA 4A9RA 4GIIA 3FHIA 3E62A 3ZSIA 2V7OA 2WTCA 1B6CB 4WNOA 3P1AA 3DLZA 3KEXA 4ANMA 3PUPA 2HWPA 3EQGA 2ZM1A 5BVNA 3PA5A 1GIJA 4Z16A 4IJ9A 1Q61A 5HE2A 5DR6A 5DN3A 2NNWB 5EYKA 4DAWA 4EH5A 5K4JA 1PXJA 3UYTA 3H3CA 3Q04A 2ZV2A 1LEZA 4FOCA 4FV0A 4BDGA 1XH4A 5CNNA 4WT6A 2C3LA 5HX8A 5IUGA 3GU6A 2IVVA 2ITXA 5F20A 2EB2A 5HI2A 3CQWA 4X7QA 2VO3A 4ONAA 3EKNA 5DBXA 3T3VA 3ZO2A 4LRJA 5KMMA 1ATPE 4XP3A 3MVHA 5JZNA 3DPKA 3UC3A 5BVEA 5L6WL 2XK6A 3R2BA 3TNPC 1CKJA 4QMMA 3PXFA 5EH0A 3VJNA 2C6DA 2R3RA 2WTVA 3F3WA 4O91A 4UWYA 4HZSA 4YLLA 2UZLA 2AEGA 3T8OA 3EMGA 4H1MA 5L2TA 4EHVA 4G1WA 3MPTA 3VO3A 4QTEA 4XG3A 5C26A 1BYGA 4QDEA 4KIQA 3KULB 1E1XA 2CDZA 4YC3A 2QHMA 4DG3E 4Y73A 1Y8YA 4O22A 4D55A 3HL7A 2NP8A 2PE1A 5CVFA 4LV5A 4OT6A 1FQ1B 1JSUA 5GZ9A 4OTIA 3RPRA 4RQKA 3HDNA 1OZ1A 2XNEA 3UO5A 3HP2A 3WF9A 4ZJVA 4ZTLA 2PVNA 1JKTA 3MVJA 2VTHA 4FV4A 4GJ2A 4TL0A 4FT3A 2CKEA 4DG2E 4FX3A 2XRUA 3FPQA 5CALA 1PXIA 2W99B 4BYJA 4BHZA 1AGWA 4IAZA 4AT3A 4A9UA 3WZJA 2NO3A 2VWWA 3WZKA 3S0OA 4Z7HA 3DK6A 4G31A 3PLSA 4ACMA 4BKJA 3KREA 3KN6A 2X7GA 4BIDA 5H9BA 5TKDA 1LPUA 3FZPA 1M52A 4R1VA 3LLTA 3DXPA 2ONLC 3SRVB 1BLXA 3MYGA 3NCZA 4FK6A 3MGYA 4D4VA 4EH3A 3BE2A 3KCFA 4S2ZA 3PE2A 4PTEA 4X2FA 3R9HA 3ZRLA 3ZU7A 4EYJA 3A7IA 3ET7A 4V0GA 4HW7A 3VN9A 4XX9A 1OL1A 3OWKA 2ITOA 2YM3A 4EOOA 2XCKA 2B9JA 3LFNA 4RA4A 3K54A 1W0XC 4FV6A 5TOZA 5DT4A 4YHJA 4DHFA 1YRPA 4C4FA 2YM5A 1PMEA 3UNJA 3DB6A 3QD4A 3DTWA 4DHIB 5JSMA 1XBCA 4NCTC 3C5IA 4C35A 2RG6A 3VS7A 1REJA 4WA9A 2HIWA 1H25A 4PL3A 4M15A 3DJ7A 4IWQA 4GL9A 4L3PA 3ROCA 4G3FA 3KY2A 3IONA 3DDPA 4J8MA 2R0UA 4EUTA 2AYPA 4CYIA 2G1TA 3I5NA 3Q9YA 1LEWA 3FJQE 4NTSA 4EK8A 5A4TA 3DXQA 4G2FA 1STCE 4L46A 3V5JA 3TV4A 1J3HA 4OTFA 5AUXA 3C50A 4O4DA 1Z5MA 4NJDA 5AP2A 3Q6UA 3QQJA 3ZZWA 4RX9A 1WBSA 3FLYA 4DE4A 2Y8OA 3FXWA 3L9NA 2PYWA 4FI1A 4RC3A 4YJVA 4W8DA 4C59A 4RJ6A 1YXTA 5EW8A 3QTIA 4HCUA 5HU9A 2O8YA 3HRFA 3VBQA 3NUSA 3QRUA 1K3AA 2C5VA 5GJGA 1YHSA 2H8HA 3HVCA 4LOPA 3RINA 2RL5A 4EQMA 3OY1A 2W4KA 3GQLA 4FT0A 3VS3A 4F9YA 2BILB 3DAJA 3UP2A 3LHJA 4O7YA 2Y6OA 4F08A 2BZIB 2PVMA 2XS0A 3F69A 4IX3A 2JDVA 5T68A 4DINA 2B1PA 5M44A 3PDTA 1SZMA 5AA9A 1JBPE 5HO7A 3L9MA 3RI1A 3ZO1A 3I5ZA 1FGKA 2ITZA 3LFDA 3UVRA 3PPKA 5HIEA 3RALA 5CF8A 5BVOA 4GRBA 2XM9A 4K77A 5ITAA 2WELA 4QDVA 5CTPA 4F65A 5HGIA 3GOKA 4IB1A 4QMXA 2QO7A 4KIKB 4O6LA 5HX6A 3NDMA 5A6NA 4QMNA 1X8BA 4O4CA 4ASDA 2YWVA 3QTUA 1KE6A 3LFAA 3UO6A 4BCGA 1UWJA 4ZZMA 4FV3A 2WEIA 4YTHA 3FZSA 4LYNA 4CCBA 4MNEB 3QUDA 4D2SA 4EYMA 3UODA 2QKWB 3W18A 4W4WA 5ACBC 3WF5A 3FZRA 4AUAA 2ZB1A 3KXNA 5FLFA 4RIWA 4F9WA 3V6SA 2GS7A 3OT8A 4C3RA 1YXXA 4FV7A 2W1GA 4CFUA 5BYLA 5GIOE 2CGVA 3W0RA 4F4PA 2W0JA 4GFGA 3ZMMA 3W0NA 4JJRA 3RJCA 3T3UA 4YUQA 2UW3A 4H36A 4MNFA 2XVDA 3GU5A 4G5PA 4U8ZA 1PMUA 1NY3A 2W5AA 4JRVA 3KQ7A 5AP5A 3VS2A 3BLAA 4HVSA 5J87A 3U4WA 2JDOA 1VZOA 4NYEA 2YISA 3JR1A 3PA3A 1YOMA 2BZKB 4AE6A 4UWCA 4BGQA 2O3PA 2VWXA 4MAOA 2BTRA 4H3QA 5E9EA 4QP4A 3EQRA 1KE5A 4YJOA 2UVXA 3FLQA 3UDSA 3E64A 2QVSE 3E92A 3RP9A 1VJYA 2W1FA 2ZV9A 3QRJA 4IE9A 4N57A 4E5BA 1CTPE 3FQSA 3PA4A 1TQMA 1YW2A 3D5UA 4YO4A 2V62A 2Y6MA 3CY2A 1VR2A 4LV7A 3H30A 1CSNA 2WZJA 4PPCA 3I79A 3CPCA 3QTZA 4IC7A 4DCEA 1URCA 3RAWA 4F70A 3JUHA 4GKIA 4RRVA 4FV8A 4I93A 4ZTQA 5LVLA 2ZV8A 3GU7A 3O96A 4Y72A 3V5LA 1E9HA 2SRCA 2W1DA 1H0VA 3AC1A 3SOCA 4DFBA 3ORKA 4AP7A 4BCPA 4FSYA 3NYOA 3A8WA 4AAYA 4U45A 1HCLA 5J9YA 4WG5A 4M14A 4XLIA 4LGHA 1IRKA 3AT3A 3LOKA 4K9YA 4S34A 4PNKA 5ICPA 3ZXZA 3RK9A 3ZBFA 4RIYB 4DEHA 2WNTA 2C47A 4OTQA 3GNIB 3KRJA 1PMNA 3DKOA 1KWPA 4G6LA 1CKPA 2VGPA 4NM7A 4R7HA 1BI7A 4E6AA 1JSVA 4FJVA 4D2WA 4ASXA 5CEMA 3UOHA 1ZRZA 2B0QA 5CS6A 5DT3A 2VAGA 3CR0A 3TJDA 5L2WA 3GC8A 2YZAA 4E4LA 2WGJA 2C6LA 3UOKA 2QOBA 3C4ZA 4E6DA 3MTFA 3OC1A 3MIYA 4ZY5A 1ZYSA 4GYGA 3DZOA 4Y5HA 4ITJA 4ERWA 3QHRA 3WIGA 1J7LA 4FZDB 4FTTA 4C02A 3UE4A 5HNBA 3D2KA 3AOXA 5D9HA 3ACJA 1OL2A 1OKWA 2ZVAA 3LLAA 2OZAB 3TN8A 2OWBA 4UMQA 4BYIA 4AOTA 4ZSJA 4E7WA 3D7TA 4JAJA 1ZY4A 4BHNA 2DYLA 2VO0A 4FIEA 3ZOSA 3CY3A 4FODA 4O6EA 2RSVA 2YIQA 1H26A 1P4FA 4QP7A 3W32A 5HVJA 3I60A 4ZIMA 4P4CA 4O4FA 4QMLA 1RDQE 3F7ZA 4J7BA 4S30A 5CEPA 1U4DA 5I9XA 4BR3A 3LMGA 4QTAA 3VF8A 1ZXEA 3RNIA 3QTWA 4CD0A 4R3PA 3A8XA 3BHUA 3ODYX 4FIGA 4M8TA 2W1HA 4AT5A 4C4HA 5E4HA 1Q24A 4O7LA 2P3GX 1XR1A 2QG7A 3ATSA 3MV5A 1GOLA 3TKHA 1GZ8A 5BNJA 4KBKA 2J4ZA 3IW6A 3HECA 3VRZA 5LMAA 2XP2A 2F2CB 5T3QA 3KA0A 3Q9XA 5F4NA 5HLWA 5B0XA 2PSQA 4D58A