4NUSA

Rsk2 n-terminal kinase in complex with ljh685
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
307
structure length
301
Chain Sequence
THHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATFYFDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Ribosomal protein S6 kinase alpha-3
publication title Novel potent and selective inhibitors of p90 ribosomal S6 kinase reveal the heterogeneity of RSK function in MAPK-driven cancers.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 301
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nusA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nusA01
3PWDA 3E87A 1QL6A 4OBPA 1YOMA 3I0QA 2C6MA 2XJ2A 4JVGA 4EZ7A 3ZBFA 1OKZA 2P33A 4FSTA 1B38A 1OVEA 5AM6A 3BYVA 1ZLTA 1XJDA 3W2PA 5E7RA 4TNBA 3VBQA 5F4NA 5E91A 3HDMA 4CFFA 5IUIA 4AS0A 1V0OA 3NR9A 4O2ZA 4OTFA 3DLZA 1Q99A 4FICA 4AGWA 3VS5A 5DR2A 3FLWA 3M2WA 3NX8A 2AC5A 3QKMA 2VTOA 2HELA 3FLZA 3BHVA 2UW8A 3P08A 4HW7A 2RFNA 1UVRA 4TL0A 4FKVA 5EQYA 3SAYA 4HVIA 3KULA 2PE0A 2BDJA 3I5ZA 4HGSA 4R5YA 3RGFA 2WIHA 4BICA 3RINA 2XNNA 1PXIA 2W1CA 3P9JA 4FSRA 3Q2JA 4IB1A 3UOJA 1RW8A 4C8BA 2CKEA 3FHIA 2FH9A 3U4UA 4ONAA 5D9HA 3MH0A 5IH5A 2JC6A 5TR6A 1Q41A 1WFCA 5J1WA 4QMWA 1JVPP 1JKTA 5FP6A 5KMOA 2X7FA 3I1AA 4KIKB 5BVOA 3K2LA 3ODZX 2JEDA 3KXXA 4U80A 4AAAA 5IQDA 2WTKC 3UO4A 2RG6A 3UP2A 2BDFA 4HGLA 2CKQA 4YHTA 2PULA 4RVLA 5J1VA 4MKCA 3MIYA 5HD4A 4ZY4A 1YDTE 5KMKA 5ANDA 4O0YA 4FV9A 3OBGA 5HORA 1DI8A 2GSFA 2JIIA 4E8AA 4UMPA 2A2AA 4BDIA 4C59A 1WBSA 4O91A 4ZTRA 2VGOA 5C8MA 4QYEA 3W2CA 1ZY5A 3ORXA 2BTRA 5LWNA 3AMBA 1WBWA 3LMGA 3Q4CA 3TDVA 5K3YA 5H2UA 2OH0E 2QG5A 2W5AA 4RX8A 1YXUA 3UG1A 1H07A 1LEZA 4FT5A 4GSBA 2C6IA 2PVLA 3S00A 2PE1A 2EUFB 2OK1A 2R3LA 3P7AA 5AR3A 4BB4A 5A14A 3U6HA 2NNWB 2I0VA 3CQUA 4BTMA 1YWVA 2QOIA 4H05A 5AV2A 3QGWA 4L6QA 4Q9SA 3AC5A 3ZXZA 3MJ1A 2VTIA 2XBJA 3VRYA 4IAAA 4BDDA 2AUHA 3FZPA 3F69A 3KFAA 3MB6A 4UMUA 2HZ4A 1VYWA 4I41A 3R8LA 4EH5A 4R7BA 4FT9A 3HDNA 3Q5IA 4JAIA 1YXXA 3K5UA 4C57A 1RDQE 1QPCA 5FBOA 1M7QA 5H8EA 4D4YA 5M4FA 3OFMA 1R78A 2XVDA 3FSFA 3MFTA 3QX2A 4PDOA 2X4ZA 3EQFA 5I4NA 3HVCA 5AP3A 4U40A 5FP5A 4FSQA 1H8FA 3G6HA 3FMJA 2PZRA 3G6GA 3A7IA 2ZAZA 5GZAA 4FKTA 2VWVA 4R3CA 3BX5A 1OITA 3ENHA 3PVUA 4G3CA 4OTIA 2Y4IC 3TNWA 3V51A 3QAME 4PP9A 4QMUA 4TXCA 1FBNA 4O7WA 2VTSA 4TRLA 4AACA 5IUGA 5FDXA 5DH3A 1KV2A 2XP2A 4M8TA 3NNXA 4KKEA 2WQBA 5HG5A 4IFGA 4QMYA 2UZBA 4S34A 2UZNA 3TNQB 2B0QA 3OEFX 5F1ZA 4FNZA 2G2HA 3P4KA 3RAIA 4DEIA 3JR1A 2PUNA 2XA4A 1PY5A 5TT7A 1TVOA 1URWA 3HUBA 2QOLA 5JFWA 3FMHA 2X2KA 4MVFA 5JQ5A 2OF4A 3FLNC 5K9IA 4QP9A 5DBXA 2W1IA 3ZU7A 4YP8A 3WZDA 4TT7A 3IW4A 5JH6A 2YJSA 3E5AA 4MWHA 3JY0A 4IDTA 3PG3A 4DBNA 2YDJA 4XS2A 3W2RA 2GQRA 2R3MA 3OUNB 1JSUA 3DZQA 3R7EA 4FZAB 3CS9A 3ODYX 4EOMA 5C4KA 3LJ1A 4M14A 1ZMVA 4F9CA 1BX6A 4BGGA 4KABA 5HU9A 5IF1A 4AGCA 3UZPA 4ANOA 4C38A 4NSTA 3PPKA 3GU5A 2FSLX 3CGOA 3BGPA 4XJ0A 4CKRA 5K0XA 3E8EA 4S32A 4U6RA 4FL1A 4D1ZA 3MWUA 2RL5A 1JKKA 1GJOA 1QPEA 4BZDA 2VO7A 5LWMA 4LOPA 5AR7A 4H3PA 4LUEA 3KXZA 1Q8ZA 2UW4A 5BUIA 4BN1A 3V6SA 3CLYA 2WD1A 3PVWA 3TTJA 4B8MA 4E93A 5EHLA 3MB7A 4IJPA 4O81A 2BAKA 2JLDA 3RI1A 4HCVA 4NKAA 5CF6A 2VTMA 2WQEA 3RAHA 4E6AA 5CSPA 4FEXA 3ZLYA 3RWPA 3R9DA 3TNIA 4MQ2A 5JKGA 3C51A 1ZMUA 4YHJA 4EK5A 4OW8A 2XNEA 4MNEA 3QQHA 3DKFA 4MXAA 5JZJA 3MPMA 4WRGA 4G9RA 4TYEA 5CSXA 3VQUA 2ZV2A 3VBVA 5H9BA 4AP7A 1JPAA 4ZSAA 1KSWA 2ZJWA 3LMIA 3D5WA 4XUFA 1BI8A 3QWJA 2PHKA 4QP2A 4D0WA 3VBYA 4CT2A 1U54A 2YM5A 5AUXA 2J4ZA 2VWZA 3SOCA 2I40A 4MXCA 4HGTA 2X0GA 3WF8A 2V7AA 5DEWA 3LFEA 1FINA 4F9BA 4G3GA 3BU3A 1H27A 3R8MA 1MRUA 4X3JA 4MX9A 4R1YA 3V8WA 3VBXA 5T68A 3HAVA 2OXXA 4RA5A 5C01A 3DQWA 4PDSA 3VS3A 2BUJA 3AD6A 5IH4A 1KOBA 1YXVA 4RJ5A 2WGJA 3NUNA 5FBNC 3SW4A 2VTNA 4FIGA 4J96A 2Z7SA 4FT7A 4PTCA 4RIOA 4TYGA 4XYFA 5CENA 4C0TA 3SRVA 4OTHA 2VV9A 3N51A 5EKNA 3QTQA 2X8IA 2HXLA 4PL3A 4W9WA 5FEEA 5KBQA 4QT1A 1T46A 2QHNA 3I6UA 4D4SA 4ZSGA 4UY9A 2UVZA 3A7HA 2EXCX 5IISA 4FSZA 4RPVA 3BHYA 3VHEA 4DH8A 3TZ7A 2XIRA 4GU9A 4L7FA 4JX3A 2OSCA 5M44A 3MA3A 4JR7A 3FSKA 4DEGA 3BQCA 4ACHA 4K0YA 3FBVA 4I94A 4HVGA 2XS0A 1UWJA 1OPKA 2PZYA 3NZ0A 4NZWB 4CD0A 1FMOE 3EQHA 5E8XA 2J9MA 3TM0A 3OHTA 4XBRA 1O6LA 2B52A 1IRKA 3MVMA 3IGGA 4PUZA 1Y6AA 2YA9A 5E8UA 3C4CA 4JLCA 4MWIA 4O1OA 4EQCA 3BHTA 3P0MA 4PMPA 4APCA 5KHXA 2HYYA 4AOIA 4FTQA 3WE4A 4QMOA 3C1XA 3JPVA 3RHXA 4U5JA 4IMYA 3HKOA 4RFYA 3MS9A 4IAIA 4PRJA 4RQKA 5D7VA 2P0CA 5AR8A 3ZONA 5L6PA 3KEXA 4WHZA 2BRNA 2WOTA 1OMWA 2EB2A 1ZMWA 5IG1A 4H36A 2CLXA 3PVBA 4Q2AA 5CYIA 4TYJA 5J8IA 3FMLA 3PWYA 5A4EA 3QHRA 2DWBA 2GU8A 3D14A 3ZBXA 1J7LA 3KY2A 2R3GA 2ZDUA 3LQ5A 4QMNA 4PL4A 5LVOA 3AD4A 4HNIA 4GIIA 2NP8A 4DTKA 1YQJA 2Q0BA 4OGRA 3A4OX 3IDBA 3FUPA 4I5CA 2QU5A 1PHKA 2NO3A 4MF1A 3LW0A 3R73A 4DITA 4BF2A 5CALA 3C4EA 3BPRA 4N6YA 4CFMA 2OIDA 3NLBA 4QP3A 4F7SA 4R1VA 5A46A 5CAOA 4P7EA 2IG7A 2YN8A 3JVSA 4DEBA 2GQSA 2EB3A 3PFQA 4FVPA 4C58A 3MI9A 3EQRA 3EQIA 1H0VA 3MTFA 4I3ZA 4PMMA 2R3JA 5DA3A 3C4WA 2YCFA 4IX3A 5JN2A 5JFXA 4DAWA 4YC8A 4J71A 4EH9A 3LJ0A 5HO8A 4IC8A 3TV4A 3R7YA 4RWJA 2QONA 3V6RA 4O0TA 1W84A 5I5ZA 5L2QA 4I5PA 4WD5A 3D5XA 4QMQA 5J9YA 2WMRA 3H10A 3ZRMA 3VVHA 4R3PA 4S2ZA 3L1SA 4O86A 2J5FA 4AF3A 1ZAOA 3RZBA 3EN6A 2P2IA 2XNMA 3F5GA 4D2SA 3U6IA 3Q6WA 4B99A 4BIDA 3F66A 2J51A 4AZEA 3LXKA 3CP9A 3QZHA 4KS8A 4KRDA 2J7TA 4YNEA 5LARA 3LFSA 2V55A 4GUEA 4B6LA 4YR8A 4RIWA 3K3IA 3IDPA 3QKLA 4B7TA 2WEIA 4IE9A 1Q3WA 2Z2WA 4QMZA 3AG9A 3IK3A 4BCQA 2Y4PA 3UOHA 4W4VA 3MIAA 3MPAA 2DS1A 2UUEA 5AMNA 4CYJA 4BDBA 2VWXA 4A9UA 3SGCA 4EHZA 3O17A 4NCTC 4BTJA 1S9IA 5HG7A 1KE6A 3QGYA 4Y72A 3ORKA 4UWBA 3R2BA 4HNFA 2XK3A 2PUIA 2OG8A 3NIZA 2C0TA 1GY3A 3F2AA 3P23A 4MTAA 3D83A 4AG8A 1YXSA 1ZYCA 4Y83A 4ALWA 4O7SA 4ZMFA 4EK8A 3OP5A 1FGIA 4MXYA 3ZO1A 4BFMA 4TWOA 4EOQA 2HAKA 2JGZA 3PXKA 2O2UA 3LM0A 1U59A 3R2YA 3TG1A 2HK5A 5LXMA 3LCOA 3DB8A 5ETCA 1DI9A 4UB7A 3VUGA 4E5BA 4DE4A 2XIXA 4RLLA 2JAMA 4BHZA 4DTBA 4ZLOA 3IGOA 3V8SA 3MFRA 3WF6A 3S1HA 4OBOA 2OFVA 1URCA 4XMOA 5TO8A 4D2TA 3DBDA 1H25A 3OY1A 4IZ5A 4FIEA 2FYSA 3EN9A 3GCQA 3HV6A 2PMIA 1X8BA 4YUQA 3DNEA 1J3HA 3P7CA 4IM0A 4MBJA 2YERA 4GT3A 2JBOA 4QTCA 3PIZA 3ZDIA 3A2CA 3BGZA 4LRMA 4DHFA 2J0MB 3OD6X 4L68A 4G3EA 1UKIA 3G0FA 4YSMA 1LEWA 3DK6A 4YNOA 2XK6A 1MP8A 4E4NA 2PZIA 4GCJA 2OZAA 1Q61A 1GIIA 5JRQA 4EH3A 4JIAA 2VTJA 5EDQA 2W1EA 4FKGA 4RT7A 4QP6A 5BVWA 2WMXA 4D4VA 2BALA 4F99A 1R0EA 2IWIA 1A48A 5AV0A 1MUOA 1JWHA 1GZNA 3D2IA 2RFSA 4MYGA 4YLLA 4I5MA 4JG6A 2QNJA 3RALA 3GT8A 4LV5A 3D7TB 4N4SA 4NW6A 4M3QA 3BV2A 3GQLA 1A06A 5D1JA 4PX6A 2VZ6A 3TV7A 4UMRA 4MQ1A 4JQ7A 3F82A 3CJGA 1U5RA 3FKNA 5M07A 4QYFA 4WG3A 5HLPA 4UYAA 1OBGA 4KIOA 4NTSA 4AFJA 5IEXA 3LXNA 3E93A 4CQEA 4C2WA 4I20A 2ZVAA 3AC2A 4WIHA 2C6TA 4E5WA 2XK7A 2G15A 3KRJA 4MF0A 1NVQA 5E1SA 2EVAA 3C13A 4CCBA 5LQFA 3NUYA 2W4OA 3IS5A 3QHWA 3P1AA 3OG7A 4U79A 3GUBA 5AIRA 2B7AA 5I9VA 5E90A 3NUPA 2RKUA 2PVKA 4N57A 4E73A 2BZKB 5ANOA 4GKHA 4GG5A 2W9FB 1TKIA 5AR5A 5CZHA 4QMLA 5FDPA 3QA0A 2X1NA 4FC0A 4JDHA 2UVXA 4IEBA 4ZZMA 1P14A 5JZNA 4C36A 1M17A 2C1BA 2PWLA 2YFXA 4E4XA 3OY3A 5E8WA 1SMHA 2JDOA 4O38A 5HNBA 3FJQE 4FMQA 4CLJA 4CEGA 2PUUA 3OF0A 3F7WA 5E8VA 2W05A 3EL8A 4G5JA 1H1SA 4X2JA 4D55A 3CY2A 2IVTA 4MXZA 2XRWA 2CPKE 2YIYA 1WZYA 3C0IA 3NDMA 2BFXA 2R3HA 3NYVA 4DT9A 2JDTA 2QLQA 1F0QA 3E8NA 4O6EA 2YZAA 3B8QA 4IAZA 4R8QA 5HTIA 1L8TA 3GFWA 1CMKE 3FC2A 3LFDA 5HO7A 1OECA 4A4XA 2UW5A 4M15A 3TKHA 4KBAA 4C33A 4LGGA 4J52A 4LI5A 3FI8A 2FGIA 5EQEA 3H30A 2XF0A 4BIEA 3PXZA 4KNBA 4LL0A 3KA0A 3HRBA 2I1MA 3RJCA 2UVYA 3EKKA 3VS7A 1W98A 3FMEA 4Q5HA 2W4JA 3DY7A 4FTTA 2GFCA 3W55A 5L3AA 4FIIA 2GHGA 4JQEA 2PMNX 3KKVA 3MH3A 5BMMA 5DYJA 4M0YA 1YWNA 4LRKA 4RIYA 4KUJA 1PW2A 5HOAA 5CTPA 2R64A 4S33A 5AP2A 4ZSLA 3TUBA 2XKEA 3QYZA 2IW8A 1GZKA 3VF8A 2X2MA 3AQVA 4CKJA 4O96A 4L3JA 5BVKA 4GFOA 3IOPA 5HO6A 2B9JA 3FMMA 1H08A 3CD8A 4FYOA 2B1PA 4FTLA 5JGDA 1SZMA 1OIRA 2ITPA 1ZZ2A 1CKIA 3NW5A 4BC6A 4FL3A 5TE0A 1E1XA 4X2GA 1OGUA 4R7IA 4EORA 5JT2A 2QURA 1W82A 1ZY4A 3VHKA 4ACDA 2JD5A 3QCYA 2PU8A 4QP4A 3QTSA 4KB8A 4O0VA 4PNKA 2XYUA 3WOWA 2FSMX 3DKCA 4M7IA 1ND4A 4E26A 5EYDA 3CD3A 2BRHA 4IBMA 4ANSA 4YO6A 3QRTA 3TIYA 3L8XA 5C26A 2YDKA 3HYHA 4I0TA 3HRFA 2QOBA 3FQSA 2V5QA 4DGLC 3E64A 5E8YA 4Q5EA 3SKCA 4RVKA 3O2MA 3WZUA 5E1EA 4CZTA 3PJ3A 2F7XE 4Y73A 3V01A 4FTOA 3HP5A 3F2NA 1Q4LA 4RJ7A 4V01A 3A61A 5AP1A 4LGDA 3VULA 4AE6A 3RCDA 3N4UA 2GQGA 4JRVA 5DEYA 5ETFA 5F95A 3TXOA 3UGCA 4BIBA 4DGGA 2JDVA 3W2OA 4EOKA 3HMMA 3T3UA 2W17A 5EDRA 3DA6A 3BLQA 3FI3A 5L2IA 3PY1A 3QRUA 2F57A 4FTNA 3VUDA 2PVJA 3GP0A 4CTCA 2QD9A 3ZO4A 4GYGA 2C30A 3GQIA 3C0GA 3A8WA 1H1QA 1IEPA 4AZVA 5K4JA 4TKSA 2GTMA 2GNHA 4PPCA 3TUDA 5CEPA 2BILB 1Y6BA 4CCUA 3CIKA 2VX1A 4WUNA 1F5QA 2W06A 5M55A 4ANQA 3V3VA 4UZDA 5CT7A 5IU2A 5BYLA 3KB7A 4QPSA 4EQMA 2VTAA 2GNLA 5CEIA 4QMSA 4EONA 5C27A 1SNUA 4IFCA 2ZMDA 4QYGA 3ZMMA 5CS6A 2QKRA 4JI9A 4EQUA 3PTGA 1PMUA 4I1ZA 5FEDA 3BYUA 4N70A 3FDNA 4UEUA 2X8EA 5I9YA 4QMTA 5L8JA 3GOPA 1NVRA 3IW7A 3VJNA 3QTIA 1WVXA 2IJMA 3ROCA 4HZRA 5LOHA 2F4JA 4G6NA 2WO6A 2C47A 1B6CB 1GNGA 5HCXA 3ERKA 5LVPA 4U43A 3EL7A 2BHEA 4R77A 4XRJA 3ZEWA 2WMVA 5EKOA 4QTDA 5G6VA 3TCPA 2OBJA 3U9CA 3ORLA 1OIQA 2IZUA 3OCSA 3R02A 5AV3A 4JJRA 3OC1A 3KQ7A 3CKWA 4A07A 4B8LA 4I21A 3HX4A 2BKZA 3IOKA 3KRWA 4IANA 2GS2A 4RA4A 4X0MA 5E8SA 3LAUA 4YTIA 4ASXA 3O7LB 2Z7RA 4WNMA 3TZ9A 1W7HA 1Y8GA 3GU8A 2RFEA 1M2QA 2UZUE 3CSVA 5CANA 1XH7A 2CMWA 2G2IA 1CSNA 2QHMA 2WMWA 3PA3A 4GG7A 4LM5A 5CSHA 4F7LA 1ZYSA 2R4BA 1MQ4A 4XLVA 3FZTA 2UZLA 2ZOQA 5T3QA 4DH7A 5J7BA 3U8WA 5M57A 3IDCA 3V5JA 2CJMA 3MTLA 3QRJA 2YCRA 1DAYA 4ZTMA 5M08A 2BZHB 1M14A 1NXKA 5IA2A 2H6DA 4C7TA 1RE8A 1Q8UA 3FMKA 3RK7A 1LR4A 4BDJA 3IW8A 3PLSA 4C62A 3C5IA 1XO2B 3VW6A 2XMYA 5A4QA 3NCZA 3KF7A 2UZTA 1P4OA 4ZEGA 2Q0NA 1M2PA 2V0DA 3KL8A 3QBNA 4HOKA 4KBKA 4W9XA 4XP3A 4ASDA 5A6OA 3KC3A 3DFCB 1XQZA 3PE1A 4NTTA 3ORPA 3RPSA 4YBKA 3WBLA 3DJ6A 2W5HA 3THBA 1Q5KA 4I6FA 5I3RA 3IW5A 2GNIA 3Q96A 1V0PA 2VTTA 2XNBA 3HRCA 3KXNA 3OT8A 4FKJA 5IA5A 4O7VA 5IH6A 2QO7A 2UZEA 1K2PA 4JG7A 4PPBA 2CGVA 3N9XA 2C3IB 4GU6A 2BMCA 3SG8A 3RKBA 3NIEA 3LCDA 4MAOA 4O0WA 3B8RA 3KU2A 4WT6A 5FG8A 4BI0A 3ZFMA 1UKHA 3FMDA 3WF7A 2ZM1A 2QOKA 4YZMA 2R5TA 4PWNA 4XOYA 5DRBA 3UC4A 3BEAA 2I0HA 4O7ZA 3L8PA 1E9HA 3FEGA 1PMVA 1V0BA 1YKRA 4NU1A 1OUKA 4OTQA 4F6UA 3OBJA 5L2TA 5JGBA 3ZLXA 4C4FA 2E9NA 4C4HA 1XH6A 5DHJA 5IKWA 4DFZE 5GZ8A 3PXYA 4JG8A 2BTSA 3GCVA 5HQ0A 1P4FA 3SXFA 2CN8A 2ZDTA 5J7HA 4G16A 3UVQA 4G34A 2QLUA 3ATTA 2IW6A 4NM5A 4EHVA 4QNYA 2R3PA 2IZSA 3DAEA 1WAKA 2OH4A 2PMLX 1Q8TA 3QX4A 4II5A 4L3PA 3ZM4A 5A6NA 2JBPA 1YDRE 2ZV8A 3R1NA 4AT5A 4BCJA 1UU7A 4KRCA 5M4UA 5DPVA 3F3ZA 4PNIA 2XEZA 3KULB 3II5A 3MVLA 4I22A 4AN3A 2BVAA 4YJSA 4JRNA 3BLRA 2C68A 5BYZA 4V0GA 3NCGA 4RGJA 3Q32A 4E3CA 2IPXA 2JIVA 3S3IA 4PDYA 4JBQA 5A3XA 4AA4A 2PVHA 3OWLA 3R9OA 4TPTA 4QTBA 4A06A 4F64A 4M97A 4EH6A 2YHVA 5J87A 5DFPA 4FGBA 4NH1A 2W1GA 3LVPA 4BKYA 4OAVB 5D41A 3DXNA 2C0IA 4K33A 4L00A 5E4HA 4L42A 5TOZA 3KGAA 5LMAA 4FTRA 3Q3BA 3RHKA 1HCLA 2QODA 4GIHA 5CI7A 3VS4A 3PJ8A 4NJ3A 1OKWA 4CTBA 5GIPE 4DLJA 2J0JA 4F1TA 1G3NA 5JSMA 3QC9A 2OLCA 3UPZA 1Q8WA 3OWPA 3UQCA 2ITVA 3BWJA 3KN5A 4EC8A 4EUTA 5H8BA 2XYNA 5AAFA 5JEBA 4E5AX 3BCEA 4GL9A 4QTAA 4TNDA 4B0GA 4ERKA 5A4CA 1GZOA 3A62A 3CTHA 2HXQA 2GHLA 4JBOA 3EOCA 4C3PA 4RJ6A 5D11A 3LPBA 5EDPA 4DT8A 2I0YA 3H9OA 5D12A 2XIKA 3QQJA 3UE4A 2YWVA 3BBTB 1VR2A 3EZRA 2R7IA 3OTVA 4U0IA 3DBEA 4OTGA 3I81A 4LQMA 3LFBA 3R30A 4RLKA 4FSYA 2R0UA 4C3RA 3L9PA 4QMXA 3ZFXA 4H1MA 3QYWA 2FSOX 3DPKA 5AR2A 3ORNA 5L2SA 2C5NA 4FTUA 2XNGA 1PXPA 1OL2A 3V5WA 3Q60A 4FT0A 3UG2A 1OM1A 3O71A 5KCVA 4EYJA 1WBOA 4XG7A 2JITA 4XG3A 1UA2A 5CSWA 3KN6A 4X3FA 5EOLA 1JKLA 4O1PA 3ZSHA 4LG4A 5AAEA 5CF4A 3FE3A 4EKKA 4DEDA 5HEZA 3V5TA 3SVVA 4FKLA 3W10A 3G9NA 4FZDB 4BWPA 3A7FA 4HVDA 2ESMA 4WBOA 4AXAA 4IM2A 5DOSA 4O82A 3PSCA 3R1YA 3QCXA 4CQGA 4JT3A 3QD0A 2XCHA 3QTUA 2BPMA 4UMQA 3ZUVA 5JMSA 5HNIX 4FTKA 4BCNA 4DGNA 3UO5A 3ATSA 4IB3A 2OU7A 4FKWA 4BY9E 4NW5A 4IAKA 4IHPA 2QR8A 5HG8A 1BL6A 1JAMA 3V8TA 2OIQA 1E1VA 4NWMA 5K5XA 5JGAA 5D10A 3R7OA 4QMPA 3UNJA 3RNYA 4FTIA 3VUTA 4DH1A 2VD5A 3I7BA 3QQKA 2XJ0A 5IUHA 1NT2A 3NYNA 3Q9XA 3ZUUA 2F2CB 5B2KA 5ACBC 5ITAA 1AGWA 2F7EE 3DJ5A 5LVMA 1O6KA 2QKWB 2ZYBA 4IIRA 3REPA 4F1OA 2F7ZE 2PY3A 4O84A 3ACKA 3R8VA 4DG0E 4AGUA 5IA1A 3GU7A 1Y91A 4YC6A 1MRYA 3G0EA 3FQEA 3NNUA 1IR3A 2REIA 2VTRA 4RFZA 5GNKA 3AGLA 4CV8A 1P2AA 2O3PA 4FIFA 3PZEA 4AT3A 4CFWA 2XZSA 4RJ8A 5BUJA 3HV5A 5ACKA 2XK9A 3DTWA 5IDNA 1Y8YA 3I6WA 2VX0A 4DG2E 4FOBA 4TYHA 4W8EA 4YO4A 4K6ZA 1H24A 3UDBA 4DG3E 3COIA 1XH9A 4RWIA 4TW9A 5B2LA 2O8YA 4QP1A 3R7UA 5AP0A 4FZ7A 5CF8A 3UIXA 2Z8CA 1Q62A 2R3FA 5F20A 2QG7A 5GJFA 3A7JA 2GNGA 3MSSA 3JXWA 1PXKA 2CLQA 4UMTA 4U7ZA 5GZ9A 1G8SA 3OWJA 4TTHB 3TDWA 3LQ8A 5M51A 5FTOA 2UW6A 3UC3A 3VAPA 4ERWA 3EJ1A 3UO6A 2XBAA 4Y5QA 3GCSA 4NUSA 4ZIMA 5IEVA 2W1DA 4MNEB 5CVGA 1PXMA 2NPQA 2VU3A 2ZB0A 3EIDA 5CEMA 1ZYDA 4S31A 3R9NA 4XV3A 1FMKA 3C4XA 4M12A 2JIUA 4UBAA 3FHRA 4BBMA 3O0GA 5C8KA 3VN9A 3LOKA 4F0IA 2H96A 1U54B 3UYSA 4IX4A 3ZC5A 3ZRKA 3U9NA 4B4LA 2BAQA 4RWLA 2IVUA 2UW0A 2YCQA 1XHAA 4QQJA 4AUAA 1REJA 3G5DA 2IZTA 3GXLA 4K77A 2W96B 3PY0A 3QQLA 3I60A 2YLEA 4X21A 4ZXTA 3UIUA 2HIWA 3AT2A 3EH9A 4KAOA 3ZO2A 5IZFA 4L9IA 5KE0A 4KA3A 1APME 1M2RA 3FYKX 2HENA 2OJIA 3PYYA 5HCYA 3T3VA 3EHAA 3ZSGA 3NUAA 2BIKB 3NYOA 1YI6A 1XH5A 2WMUA 2YABA 2Z7LA 3OS3A 2VX3A 2YISA 3SRVB 4ZZNA 3UJGA 5JK3A 1DS5A 4U9AA 4J99A 3V04A 3RAWA 2OJGA 5KBRA 3MN3A 5FXRA 4Z55A 1AD5A 4J8MA 3G33A 3LFQA 4IVBA 3VJOA 4EH8A 4ZJVA 4BTKA 4ZY6A 3S95A 4H58A 4ZSJA 3UBDA 4USEA 2XNPA 1VJYA 3IPHA 4C35A 2QQ7A 5EHOA 2WTJA 2V62A 4EZ3A 4CFVA 1NW1A 3A99A 5EQPA 4QOXA 3QKKA 3SDJA 2X8DA 5IQFA 4CZYB 4F9YA 4APPA 3B2WA 1R39A 1XKKA 4EEVA 4DYMA 5BNJA 2E9OA 2PE2A 3CY3A 4MCVA 5HHWA 2YDIA 3RAKA 4GK4A 4GVJA 1OB3A 2YCSA 2B9FA 5AP6A 3WYXA 4DFUA 2A4LA 5BPYA 4Y85A 4L52A 4O21A 4M69A 3ZXTA 4FKQA 1A9UA 2KTYA 3NNVA 5AX3A 3TJCA 1JOWB 3E88A 5HGIA 3QZGA 5ANIA 1PXNA 4EOSA 5J79A 4QMMA 3ANQA 5IDPA 2Y0AA 5JFVA 4C61A 3D15A 4DBXA 2CN5A 5EW9A 3PLAE 3VW8A 5BVNA 3UNKA 3UP7A 5HTCA 5L8LA 4D5HA 3HEGA 1YHSA 3NGAA 4XP2A 3R04A 2PZ5A 2XM9A 3U51A 4YLKA 1F3MC 1BL7A 4N0SA 3BU6A 2NRUA 4G5PA 2Q83A 5M09A 2PK9A 5LMKA 2Y6OA 2WMQA 1T45A 3CTJA 1VYZA 3DAKA 2R9SA 1K9AA 4AA5A 3PJ1A 3ETAA 3RPRA 3D94A 3MDYA 3BBWA 4B9DA 3U54A 2BZJA 4X7QA 4DH5A 5J9LA 3F61A 5EHYA 3H9FA 5KUPA 4IVCA 4E20A 2JKOA 3CXWA 5HVYA 4AWIA 3PDTA 4C4JA 4OLIA 4AOTA 2JFMA 4NJDA 4K18A 3ZLWA 5KNJA 3MW1A 2GCDA 3QLGA 4UYNA 4YJRA 5EI8A 2CNUA 3HV4A 3R83A 1Z57A 3T9TA 3PE2A 3G2FA 1YHVA 2YZLA 1WBNA 4TWCA 4M69B 4FKPA 3RZFA 1OUYA 4WKQA 3LFFA 1XR1A 2QU6A 4YPDA 2GTNA 3PVGA 4AN2A 4HYHA 2ETRA 3O23A 3QXPA 4CSVA 4D9TA 5DT0A 3FZRA 3H0YA 3NWWA 4O6LA 4OT6A 3GC0A 3KMMA 1U5QA 4ZS4A 4JBPA 4QD6A 2O63A 5ICPA 5KX8A 4P2KA 4CFNA 3MY5A 4FTJA 5IA0A 4AFEA 5KHWA 3KXGA 4DFLA 3HL7A 2OXDA 4W4XA 3SLSA 3BE2A 3QTRA 1YRPA 4L43A 3D0EA 4RIWB 2YLFA 4FV4A 2BZIB 1KOAA 2C6EA 3DTCA 4FV2A 4W8DA 5ETAA 4P4CA 5TKDA 3MGYA 3F3VA 4EHGA 1UU9A 3PA4A 4USFA 4X2FA 4D4RA 2IW9A 3OCBA 2ACXA 2WQNA 5EK7A 4IXPA 1CKPA 4BDCA 4FEWA 4PMTA 2QOHA 4I6HA 4GV1A 4RC3A 3VS1A 4EZ5A 1Y57A 5B2MA 4GJ3A 4ALVA 3GC7A 1SYKA 3COHA 3GU6A 3O8TA 4FODA 4XCUA 1PXJA 3RM6A 3W32A 3AXWA 3P78A 4AZWA 4HVHA 3FLQA 4PMSA 4BYJA 5HU3A 4GMYA 5H8GA 3HP2A 3DKOA 3DZOA 3NUSA 1ZOGA 3DK7A 3WYYA 4FBXA 5HBEA 2OI4X 4LGHA 3OXIA 3ZH8A 3TIZA 1SNXA 3C5UA 3RBWA 4BDKA 3FYJX 5JRSA 4JAJA 4XG2A 4YJTA 5JFSA 4A9TA 5AV1A 2HOGA 2C69A 1SVEA 2H8HA 3MYGA 5C9CA 4M67A 4C2VA 4FSMA 1NA7A 4XP0A 5EOBA 4EJ7A 5EM8A 4BKJA 5AV4A 4Y5HA 5HIBA 4LRJA 5I9ZA 2OW3A 3BI6A 5IQHA 3R01A 1PMEA 2PMOX 2WKMA 4IACA 3CEKA 1V1KA 4FKIA 4X2KA 5D7AA 3RVGA 4DEAA 4E1ZA 4F7JA 4FR4A 2OICA 3DXPA 4FYNA 2CGWA 4WRSA 4K2RA 2V7OA 4KWPA 3ZLSA 3GB2A 4FI1A 4OAUC 4Z9LA 4WO5A 1SVHA 2R2PA 5HKMA 3LHJA 2X6DA 3MA6A 1XWSA 1WBTA 3QCSA 3BQRA 2OZAB 4IQ6A 4CFUA 4XRLA 5J5SA 4Y95A 5HVKA 3NSZA 4PP7A 3EFJA 3MY0A 3PRIA 3QALE 4F6WA 4KINA 3RNIA 3NW7A 4FVRA 4L8MA 4TWPA 1AQ1A 3RTPA 4YZ9A 4RC4A 4ZS0A 1QPDA 2P2HA 1KE8A 3QQUA 4RVMA 5CQUA 3WF9A 2ZB1A 2F2UA 2OJ9A 4ANNA 5ANGA 4EK4A 2XK8A 1XH4A 4L67A 2VWYA 3DJ7A 2OFUA 2BR1A 3A60A 5KO1A 3ZZWA 3OROA 4ACCA 3R6XA 3E3PA 4F6SA 3DDQA 4MBLA 3TUCA 4P90A 2VO6A 4UV0A 3DNDA 3NRMA 4YURA 1GAGA 2ITUA 2YM6A 3DQXA 3NVKI 3ANRA 5BYYA 4JQ8A 4K8AA 4JIKA 4ZK5A 5AUVA 3U4WA 2X81A 3H3CA 2IN6A 3QL8A 2E9PA 2J0KA 2BIYA 4E6CA 3PIYA 3M11A 1J1CA 2XIYA 4FTMA 4A4OA 4AZSA 2WNTA 4DLIA 4O7LA 3QTWA 3CKXA 2P4IA 3KRXA 4JS8A 2WZJA 3KVXA 1OI9A 4YLJA 4D1XA 1YW2A 2QI8A 2CGUA 4UXLA 3A7GA 5CQWA 5KMLA 1UNGA 4Z7HA 3RMFA 2R3NA 4UWYA 3F6XA 4D2VA 4EOOA 2XM8A 3D5VA 1PJKA 3U87A 3FY2A 4ENXA 3IG7A 2ETMA 3VQHA 3QU0A 3HGKA 4V05A 3BEGA 4J97A 4Y8DA 3TL8A 3UIMA 5I0BA 4EI4A 2XB7A 1G8AA 4FSUA 4BL1A 2WXVA 4YTHA 4EHEA 4UX9A 2GNJA 5CU2A 4FT3A 4I92A 2XK4A 4GK3A 2B4SB 4MXXA 4U3ZA 2WU7A 4QRCA 3LCKA 3NYXA 2BRBA 2JDRA 3ITZA 4GT5A 3C0HA 4F0FA 1BYGA 2C3LA 2WMSA 2LAVA 3A8XA 5M53A 4DGMA 2PVMA 1BI7A 4ZLZA 1YXTA 3OMVA 4WSYA 4UZHA 3U55A 4YZNA 3TZ8A 4FEVA 2UZVA 5CAUA 2C5YA 3WARA 2IVVA 3OEZA 4BBEA 1B39A 3VRZA 4RIYB 4I5HA 3EYHA 4I6QA 2C5VA 5FM2A 4GVAA 5CAPA 5M56A 4FOCA 5JQ8A 4XG8A 2F9GA 5ANJA 4FIJA 3W33A 4DCEA 4O0RA 2WELA 2Y7JA 4FNWA 3W2QA 4WOVA 3QWKA 4BZOA 4C4EA 4YJUA 3RM7A 1O6YA 4BZNA 2BAJA 3PSBA 4NIFA 4HCTA 1YWRA 3NW6A 5EI6A 4N6ZA 3IO7A 3ZO3A 4JDIA 4FK6A 2WTIA 4FSWA 5AUWA 4XHKB 3GBZA 4RFMA 3UTOA 2X39A 4OTWA 5HE0A 5KMJA 5A54A 2Y6MA 3NAXA 3E8CA 5T6KA 4HGEA 4EK3A 3VBTA 2W9ZB 4DCAA 3SV0A 5I9XA 2YIWA 3CJFA 2GFSA 4AU8A 1XH8A 2PL0A 2ITOA 4J7BA 3NPCA 4GKIA 4R7HA 2ITWA 2OGVA 1UWHA 3ZEPA 4F0GA 2RF9A 2W4KA 4P5QA 5CY3A 3H4JA 3ZYAA 1PXLA 3BELA 2WMAA 3AC4A 4I4FA 3HMNA 4K1BA 5DGZA 5AADA 2UW7A 2WU6A 4MBIA 2XKDA 3KRRA 3QFVA 5CVHA 2G2FA 3BKBA 4HJOA 5EYMA 4BTFA 1YI3A 4EWHA 1QMZA 2GMXA 3ZRLA 4RRVA 4FL2A 4U3YA 4KSPA 1KE5A 2OKRA 1IA9A 2XH5A 4BCMA 3DV3A 3LCTA 2UW9A 3LIJA 3EFWA 5CX9A 4F9AA 3KXMA 4H1JA 3KRLA 4ZSEA 2QO9A 5HD7A 4C4GA 3EN4A 3IECA 4EOPA 1SVGA 2WHBA 3AD5A 2OIBA 3TT0A 5AUTA 4AE9A 3AC3A 1YHWA 3P5KA 3AMAA 5B0XA 4YU2A 5CXZA 5GIOE 2WOUA 3OCTA 3Q2MA 4MXOA 3I7CA 2YM8A 3QD3A 5I3OA 2UW3A 4BDGA 4PY1A 5DT4A 4IB5A 4DEEA 3HA6A 2KULA 4J8NA 2OWBA 3MV5A 1Z5MA 3F5PA 4NEUA 4FV6A 5J95A 2E2BA 4BWKA 3SD0A 4O0SA 2A1AB 4R5SA 4GYIA 4IAYA 5DG5A 3G15A 4FKOA 2BHHA 4W4WA 3RWQA 1ZXEA 4F65A 2CHLA 3N4TA 5FEQA 3SQQA 5IQCA 5E92A 3VUMA 1FQ1B 4BI2A 4I0RA 4BRXA 4BHNA 3MFUA 3HA8A 4DH3A 1GIJA 2YWPA 4IADA 1QPJA 3DCVA 3OCGA 4NYEA 5DI1A 3R22A 5LMKC 2YACA 3QTXA 2ZV7A 4QMVA 2SRCA 1PKDA 5BVDA 1GZ8A 3GU4A 3TTIA 2XUUA 4O27B 4UWCA 4KIKA 4RZVA 4DN5A 5J5TA 4J98A 3FPQA 5LCKA 4H3BA 3MVHA 4FE2A 3HECA 5IQIA 4FKUA 1LPUA 3EB0A 4PQNA 2FB8A 3IONA 3ORZA 4OTPA 4BDEA 1CDKA 2VTHA 3RPOA 1XBBA 5CT0A 2XKCA 3CE3A 5K0KA 2HY0A 2HZ0A 4XG9A 4O0UA 1VZOA 3DS6A 4E7WA 2NRYA 5DN3A 5KMNA 3PIXA 2UZDA 5BVFA 1M7NA 1G5SA 2X7OA 4FZFB 5AFVA 3DAJA 1CM8A 5FXQA 3GNIB 4ZY5A 4YMJA 4D5KA 5AUYA 2YAKA 1STCE 2WTWA 4D9UA 2JDSA 3GC9A 4YBJA 2VWBA 3R8ZA 1HOWA 4AQCA 3F3TA 1JBPE 3EFLA 3QUDA 5M4CA 5DWRA 4JDJA 5AP5A 3MJ2A 4NCTA 4S30A 4IX5A 4AZFA 3EN7A 3CBLA 2EXMA 4M68A 1OL1A 2C6DA 5HTBA 3CC6A 5FQDC 5C03A 5LVLA 3VS2A 1R1WA 4F7NA 3G9LX 3GGFA 3FL4A 4BDAA 2QC6A 4L3LA 5GJGA 5IMEA 2X4FA 4G3DA 5G1XA 4ACGA 3S0OA 5AA8A 4W4YA 2CSNA 2W5BA 3F7ZA 2XJ1A 4FF8A 1BLXA 4G31A 4F1MA 3KCFA 3LJ2A 2CCIA 4YJNA 3TNPC 4C37A 4LUDA 4CFXA 1UNLA 4F09A 3MESA 2BKKA 4BCPA 3E63A 5IA3A 4XNEA 4LOOA 4RZWA 2G9XA 4J95A 2F49A 1ZWSA 4YJPA 2HZIA 3EQPA 1EH4A 5A9UA 5KKRB 5LVNA 5M4IA 3I79A 4MK0A 4YZCA 3ZFYA 4F08A 5CXHA 3L9LA 3RK5A 4LL5A 2OF2A 4JR3A 4ASZA 3AMYA 1JNKA 1ZYJA 3H9RA 2I6LA 3POZA 1OIUA 2ZM3A 3OTUA 4O7NA 4GW8A 4MEDA 4O7RA 3VS6A 4U81A 5AP7A 3ORIA 3DK3A 4CG9A 1BKXA 3QQGA 3NNWA 4ZTQA 4IJ9A 4ZP5A 3VC4A 4LMUA 3R1SA 3R7GA 5HE2A 4GEOA 1GOLA 4QQ5A 4GRBA 3FXXA 5CEKA 3KVWA 3B2TA 2XRUA 4D2WA 2GDOA 4ASEA 3NUUA 3HNGA 4BYIA 1KV1A 3M1SA 3E3BX 3ZCLA 4JNWA 4NK9A 2B9HA 4YHFA 3QXOA 4CXAA 3ZS5A 3O51A 5HBHA 3ZZEA 3WZJA 4CMUA 4F63A 3UMWA 3MH2A 4V0GB 5FRIA 3HMOA 4ALUA 3ACJA 5HLNA 3VNTA 2Z02A 2RIOA 4G3FA 4PF4A 3R9RA 2ITZA 5HI2A 4BGQA 1FVTA 5HZNA 4P5ZA 4JX7A 5CF5A 5KMIA 2RGPA 5DT3A 4Z16A 3E7VA 3QZFA 2JFLA 3EMGA 5CU4A 5HESA 5HE3A 2ERZE 3R9HA 3S4QA 3BYSA 4FG9A 3ZSIA 2H9VA 5C1QB 5CEOA 3CCNA 4K11A 1OKVA 4I0SA 2FO0A 3ENMA 4YJQA 4BWXA 5ANKA 2ETKA 3Q9WA 3Q6UA 4I23A 4MD7E 3MFSA 4L01A 3VUHA 4KS7A 5M06A 4LMNA 2DQ7X 2PVRA 5KZ0A 4MNFA 3KMWA 4K9YA 3GC8A 4G9CA 1H28A 2CKPA 1YDSE 3SOAA 2WEVA 2ZV9A 3GVUA 2EU9A 5EFQA 5AEPA 5F94A 5AUZA 2I0EA 3D9VA 4AX8A 4X2NA 4OTRA 1Q97A 3EYGA 2VO0A 4H3QA 1O9UA 4FG7A 3Q04A 3SXSA 3FXWA 1H4LA 2E9UA 2VNWA 4YPSA 5BUEA 5CVFA 4OUCA 4QPMA 4XG4A 4U8ZA 3EFKA 4PPAA 5FTQA 5BQ0A 3DU8A 2VWWA 3GENA 4USDA 2C6KA 4C3FA 2AC3A 4E4MA 1IAHA 4XOZA 3R28A 3SX9A 2EWAA 5EW3A 1LUFA 1FOTA 5ETIA 3M42A 2A27A 2ITYA 1MQBA 3FZSA 1TQMA 2B55A 3LZBA 4EKLA 2OJJA 2JKKA 4IWPA 4AGDA 3BE9A 2PUPA 3PA5A 4FEUA 4DF3A 3EQDA 4FTCA 4QQCA 4X3FB 4EYMA 3AT3A 4KKGA 2J6MA 4IZYA 3LXPA 3V5PA 3OXZA 4XV9A 2GS7A 4Z3VA 1J1BA 5AIKA 3TI1A 5EM6A 2DYLA 3F9NA 4JXFA 3OWKA 4AN9A 1WBVA 3FZ1A 4I24A 4BDHA 5IEYA 3DLSA 1UNHA 3P79A 5FD2A 4M0ZA 4XH6A 1J91A 4G1WA 5A4LA 5IQEA 5IQGA 1KUTA 5FTGA 3MPTA 3K5VA 3LXLA 3BYOA 4DFBA 1FGKA 1UU3A 1WBPA 4G6OA 5CEQA 2G1TA 5IPJA 2B53A 2YJRA 3A4PA 4WUAA 5CASA 3ALNA 3O8PA 4MH7A 1ATPE 3VF9A 3EQGA 5CAQA 3HMIA 3DBQA 4V04A 4WG4A 4WNKA 1FPUA 3POOA 3KREA 5CU6A 2C5XA 2HCKA 3UNZA 5KMMA 5DNRA 3F5XA 3WZKA 5F9EA 1K3AA 4BCKA 4F9WA 3D2KA 1QCFA 2BRGA 4I93A 1RJBA 3E62A 4AW0A 3E7OA 2YAAA 3CGFA 3VUKA 2WMBA 5C8NA 5BMSA 2VO3A 3JS2A 1BUHA 5HE1A 3CPBA 3DXQA 3HV7A 2XCKA 3I4BA 2BRMA 2VWIA 2WQOA 3EQCA 4FNYA 2QOQA 4DGOA 5AM7A 3QA8A 4OT5A 2IVSA 1KWPA 3LKMA 4IB0A 2W1HA 5FXSA 3GFEA 5CAVA 4FKSA 1J7UA 3JUHA 2C1AA 3E8DA 4TYHB 3BGQA 3UVRA 2HY81 2R3OA 4JL9A 1U46A 3RK9A 2ONLA 4BVUA 1H1PA 4R78A 4A9YA 4HCUA 4DFNA 5CNNA 2C4GA 3O96A 3R7VA 5LJJA 2DUVA 3LFAA 1PYEA 4NT4A 4YZDA 4A9SA 3WIGA 3F88A 2R3KA 3KK8A 1OPJA 3O7LD 4KIQA 3ZM9A 5GINE 5HX6A 5EI2A 4CMTA 3GEQA 4AW5A 1LP4A 2CCHA 3SXRA 3VUIA 5L6OA 3GI3A 3TACA 3MH1A 4FV5A 4Q9ZA 2HWOA 2JKMA 4RG0A 3EN5A 4EJNA 4XLIA 3LLTA 1PF8A 3N4VA 3DBCA 4NFNA 1REKA 3BLHA 2VNYA 3TV6A 4WBBB 3EZVA 4WNPA 4EOLA 1Z9XA 4ANBA 2RG5A 3PPJA 4EOJA 4O7TA 1SM2A 3W8LA 1JSTA 2Z60A 4WSQA 1H26A 5A4TA 2EXEA 4ZJIA 5CU0A 4AW2A 4BR3A 4I4EA 1CKJA 2PSQA 3O8UA 5GJDA 1JLUE 2J0LA 4IWQA 3P7BA 3JVRA 2YIXA 4JDKA 4WG5A 2HW6A 3ROYA 4IH8A 3TEIA 4LOQA 1WCCA 3TNHA 3PJCA 4TY1A 3AC1A 3TWJA 2QVSE 5K4IA 2PYWA 1ZARA 5FM3A 2UZOA 1TQPA 4FA2A 5EH0A 5DIAA 4ZTLA 3RP9A 5EG3A 4FZ6A 4J53A 4TYIA 4BCOA 4EOIA 2B54A 3FY0A 3ZDUA 4YZBA 3AT4A 3MVJA 4O2PA 3PG1A 4YJOA 4BCFA 4CMOA 3UZTA 2X9FA 3I0OA 1H00A 3VS0A 4E6DA 3Q52A 3R1QA 4L46A 2ITXA 4GS6A 3KF4A 4YSJA 5H3QA 2WAJA 4ORKA 3ZOSA 2BFYA 4IX6A 3Q4UA 3RPVA 3V5QA 3SA0A 1IA8A 3UZRA 1OZ1A 4L45A 3BV3A 4IAFA 3FZOA 4MHAA 5IA4A 5J9ZA 3R71A 2J2IB 4GK2A 5CWZA 3VWAA 5BX0A 4NFMA 2VTQA 3ORMA 1OL7A 3DOGA 3EQBA 3KK9A 3OW4A 4QP8A 4CNHA 5CLPA 5DE2A 5HBJA 4ID7A 1IG1A 3HUCA 5DLSA 2VTLA 4A7CA 4ZMEA 2YM3A 2XKFA 3JY9A 4DEHA 4D0XA 3C9WA 3CQEA 5KKRC 3PP1A 1MRVA 4D2RA 4D58A 3EKNA 4GFGA 4M13A 5FWKK 4BKZA 2YIQA 4OR5A 3TKIA 2GHMA 4AOJA 1ZYLA 1ZOHA 1PMNA 3UYTA 1WVYA 3WIKA 2QR7A 1TQIA 3R21A 3R63A 3QD2B 3Q4TA 3FXZA 4IC7A 3LLAA 3ZHPC 3V5LA 1YOJA 3AGMA 3R8PA 3F3WA 4RX7A 4Z7GA 5HIDA 1JKSA 2R7BA 1ERKA 4RC2A 2FUMA 4EH7A 4KSQA 2PVFA 1WVWA 2OZOA 3UQGA 1WMKA 4ENYA 2J90A 3HZTA 3ET7A 3FI4A 2CDZA 2Y8OA 5DMZA 5AWMA 3HV3A 4QO9A 4AT4A 4DINA 3UMXA 4KKHA 2C3KA 2G01A 4FSNA 1IAJA 4R6VA 3QD4A 2VAGA 1R3CA 4BGHA 1UU8A 5L4QA 1Q3DA 4IVAA 3LFCA 2XNOA 4RBLA 3Q53A 3OOMA 4ZLYA 4FVQA 3D7TA 2HZNA 2WTDA 3OT3A 3FLSA 4EBWA 1YI4A 2JAVA 2PTKA 2WIPA 5I9UA 4G6LA 5AA9A 3P86A 1KE9A 2GS6A 3VBWA 1I44A 3LM5A 3PSDA 4KIPA 1W0XC 4LFIA 5LMBA 3QLFA 5EM7A 4BCIA 3FV8A 3QRIA 2I7QA 2BDWA 4PV0A 1H1WA 5EW8A 1M52A 2A0CX 2P3GX 4XV1A 4EWQA 2X9EA 3Q5ZA 2J0IA 4UN0C 1XBAA 4FX3A 1W83A 3LFNA 4YTCA 4FIHA 3T9IA 2O64A 3WI6A 4G2FA 2Y9QA 4U44A 3QUPA 4QTEA 4GT4A 3NS9A 3TZMA 4RWKA 4KBCA 4HVSA 1W8CA 5AAGA 1OIYA 4C34A 4ITIA 2UV2A 3RCJA 2JKQA 3T8OA 4O7YA 2BCJA 4RMZA 4FV1A 4C4IA 4FTAA 4IWDA 3HAMA 4R3RA 3BHUA 3PY3A 3QUEA 4ZJJA 4CGAA 4XG6A 3PJ2A 4I6BA 2WPAA 5FUTA 3OVVA 2AYPA 4RVTA 5CSVA 4FGRA 5HICA 1KE7A 5IQBA 3AOXA 4RJ4A 4DFYA 1PYXA 4NM0A 1S9JA 4FG8A 4U41A 3ID6C 3ZC6A 3C7QA 4IDVA 4YGAA 3BWFA 2RSVA 2C6LA 2Z7QA 3UOKA 5C4LA 4IW0A 5LCJA 3KXHA 1HCKA 4QQTA 3DDPA 4EL9A 4ZAUA 2O5KA 1JQHA 2J50A 2WTKB 2QO2A 3ULZA 2W99B 3E92A 3H0ZA 4GJ2A 4LV8A 4ITHA 1Q8YA 3IW6A 4D28A 4FNXA 3GCUA 2WFYA 2W7XA 3W16A 3W1FA 5DR9A 4ZTNA 3ULIA 1XBCA 4Y46A 4O0XA 3F5UA 3WF5A 1OBDA 3QTZA 3CTQA 2O65A 3W8QA 3BIZA 3IQ7A 3PPZA 4DTAA 4O22A 4YC3A 3AC8A 1OPLA 2ITNA 3Q9ZA 4UXQA 2QCSA 1FVVA 4X3FC 2CNQA 3QCQA 3SC1A 3FKLA 4BI1A 1H01A 3UQFA 4ANLA 4QPAA 4ANMA 3SG9A 4ZTSA 4AW1A 3LQ3A 4IZ7A 3F2RA 3QC4A 2GNFA 3UIBA 4CT1A 4RQVA 1I09A 2BROA 2VUWA 4EC9A 4E4LA 4ZTHA 4CRSA 4FV3A 1OL6A 2VWUA 3IKAA 3NUXA 1ZRZA 3ELJA 4CG8A 3I5NA 3PUPA 4L44A 5TF9A 2ITQA 4ITJA 3JYAA 4IVDA 3QF9A 4F70A 3CQWA 5DVRA 2H34A 3VO3A 5GHVA 3W18A 3FWQA 3ALOA 4ARKA 1YVJA 1J7IA 2C3JA 2QOFA 3UVPA 4FK3A 5AP4A 2OJFE 3OZ6A 3COMA 2RFDA 5BVEA 3C4FA 2VGPA 2WTCA 4H39A 2C6OA 1H1RA 1L3RE 4IWOA 3R8UA 4DFXE 4X6RA 1PXOA 3MY1A 3QRKA 3L8VA 4LYNA 3G90X 3L9MA 4TZRA 3LMHA 4JOAA 2HW7A 2W1FA 5E8TA 3C4ZA 3ZTXA 4RX9A 3FC1X 5CI6A 5HX8A 4FKRA 1H0WA 5CNOA 3BZ3A 3S2PA 3QZIA 3FI2A 4DA5A 3FMNA 4BDFA 4YTFA 5B7VA 3KMUA 2WTVA 3ZUTA 3CR0A 2OXYA 2WB8A 2W1ZA 5HNGA 3L9NA 4IM3A 3FKOA 2XIZA 5E8ZA 2Y4IB 2IZRA 4BBFA 1ZZLA 4AA0A 4GUBA 4FV0A 4PL5A 2OO8X 5ANEA 3COKA 2VN9A 2W0JA 3BYMA 3UODA 3PRFA 2YIRA 3DT1A 4CVAA 5L6WL 3DFAA 3FQHA 5AX9A 4OBQA 3EWHA 4RX5A 4FV8A 3NVMB 2LGCA 4OTDA 1BMKA 3DKGA 4M84A 3BRBA 4XV2A 2O0UA 1GIHA 5CZIA 5FGKA 4MD8E 2CKOA 2CNVA 2R3IA 2PZPA 2VRXA 4WA9A 4NM3A 3TN8A 2R0IA 3Q4ZA 2R3QA 3NMUF 4XX9A 3PZHA 4TN6A 2X7GA 1DM2A 3OOGA 3WE8A 4A9RA 4RIXA 4E6QA 4EH2A 3DGKA 4D2PA 3TJDA 2GPHA 4CZUA 4ZZOA 3DB6A 4FUXA 2A19B 4L7SA 3UOLA 4X6QC 2VTPA 4QYYA 1UV5A 3O50A 5CU3A 3LCSA 2FA2A 2PVYA 4JBVA 5EYCA 2PPQA 2QOOA 1FVRA 3F3UA 4J1RA 3NAYA 2C0OA 3GCPA 3HMPA 4AZTA 5HG9A 4CKIA 4G17A 4EH4A 4U45A 4UALA 3OXTA 4NL0A 3R00A 5HLWA 1VEBA 1P5EA 2FVDA 5L2WA 3FPMA 1ZOEA 4WNOA 3QQFA 3OUKA 4ACMA 2ONLC 4EK6A 1JSVA 5HCZA 2YITA 1U4DA 5K5NA 5EM5A 4U42A 3U6JA 1DAWA 5KZIA 2X2LA 2IO6A 5AR4A 4PTGA 2E9VA 4L53A 2C5OA 3PXRA 4NM7A 4PDPA 4EBVA 2YEXA 5IQAA 4M66A 4QNAA 2YM7A 2J5EA 4FUYA 4YJVA 4XBUA 5HIEA 2WMTA 4RJ3A 2ZM4A 3W2SA 5L8KA 3D7ZA 4HZSA 3R7IA 3BU5A 3GOKA 2HWPA 2ERKA 1IASA 4CYIA 3SHEA 4CV9A 3PP0A 3LE6A 4DC2A 3UPXA 3CPCA 3MBLA 3OW3A 3PXQA 3HLLA 4HYSA 4MD9E 1R0PA 4RIXB 5I9WA 1RQQA 4HPUE 1CTPE 3RPYA 2YM4A 4O83A 1PKGA 2P55A 2V22A 4U97A 3G51A 3K3JA 4GFMA 4HPTE 3WILA 2PVNA 3C50A 1OKYA 3PXFA 4FV7A 4GH2A 3FLYA 4XEYA 3WZEA 4A4LA 3DBFA 4HYUA 4NIFB 4BCGA 4C02A 3D5UA 3TKUA 5IMXA 2ITTA 4EUUA 2ZMCA 4QP7A 3R0TA 5E9EA 5DR6A 2X6EA 1NVSA 3L8SA 2QOCA 4NKSA 5AJQA 2R3RA 4HYIA 1OL5A 3VIDA 2CGXA 2WQMA 4KD1A 5HVJA 4F4PA 4TWNA 3K54A 3FAAA 1NY3A 1PRYA 4FEQA 3ORTA 1Q24A 4D1SA 3KCKA 3Q9YA 4PTEA 2XEYA 3D4QA 4QYHA 4CLIA 3FL5A 3SW7A 2FSTX 5EYKA 4ZOGA 2UZWE 5FLFA 4CRLA 4IZAA 5DRDA 5AUUA 4BCHA 4RSSA 2B9IA 3BHHA 3NEWA 1YOLA
chains in the Genus database with same CATH superfamily
3PWDA 3E87A 1QL6A 4OBPA 1YOMA 3I0QA 2C6MA 2XJ2A 4JVGA 4EZ7A 3ZBFA 1OKZA 2P33A 4FSTA 1B38A 1OVEA 5AM6A 3BYVA 1ZLTA 1XJDA 3W2PA 5E7RA 4TNBA 3VBQA 5F4NA 4LDTA 5E91A 3HDMA 4CFFA 5IUIA 4AS0A 1V0OA 2X0PA 3NR9A 4O2ZA 4OTFA 3DLZA 1Q99A 4FICA 4AGWA 3VS5A 5DR2A 3FLWA 3M2WA 3NX8A 2AC5A 3QKMA 2VTOA 2HELA 3FLZA 3BHVA 2UW8A 3P08A 4HW7A 2RFNA 1UVRA 4TL0A 4FKVA 4QEBA 5EQYA 3SAYA 4HVIA 3KULA 3NFFB 2PE0A 2BDJA 3I5ZA 4HGSA 4R5YA 3RGFA 2WIHA 4BICA 3RINA 2XNNA 1PXIA 2W1CA 3P9JA 4FSRA 3Q2JA 4IB1A 3UOJA 1RW8A 4C8BA 2CKEA 3FHIA 2FH9A 3U4UA 4ONAA 5D9HA 3MH0A 5IH5A 2JC6A 5TR6A 1Q41A 1WFCA 5J1WA 4QMWA 1JVPP 1JKTA 5FP6A 5KMOA 2X7FA 3I1AA 4KIKB 5BVOA 3K2LA 3ODZX 2JEDA 3KXXA 4U80A 4AAAA 5IQDA 2WTKC 3UO4A 2RG6A 3UP2A 2BDFA 4HGLA 2CKQA 4YHTA 2PULA 4RVLA 5J1VA 4MKCA 3MIYA 5HD4A 4ZY4A 1YDTE 5KMKA 5ANDA 4O0YA 4FV9A 3OBGA 5HORA 1DI8A 2GSFA 2JIIA 4E8AA 4UMPA 2A2AA 4BDIA 4C59A 1WBSA 4O91A 4ZTRA 2VGOA 5C8MA 4QYEA 3W2CA 1ZY5A 3ORXA 2BTRA 5LWNA 3AMBA 1WBWA 3LMGA 3Q4CA 3TDVA 5K3YA 5H2UA 1VLRA 2OH0E 2QG5A 2W5AA 4RX8A 1YXUA 3UG1A 1H07A 1LEZA 4FT5A 4GSBA 2C6IA 2PVLA 3S00A 2PE1A 2EUFB 2OK1A 2R3LA 3P7AA 5AR3A 4BB4A 5A14A 3U6HA 2NNWB 2I0VA 3CQUA 4BTMA 1YWVA 2QOIA 4H05A 5AV2A 3QGWA 4L6QA 4Q9SA 3AC5A 3ZXZA 3MJ1A 2VTIA 2XBJA 3VRYA 4IAAA 4BDDA 2AUHA 3FZPA 3F69A 3KFAA 3MB6A 4UMUA 2HZ4A 1VYWA 4I41A 3R8LA 4EH5A 4R7BA 4DDIA 4FT9A 3HDNA 3Q5IA 4JAIA 1YXXA 3K5UA 4C57A 1RDQE 1QPCA 5FBOA 1M7QA 5H8EA 4D4YA 5M4FA 3OFMA 1R78A 2XVDA 3FSFA 3MFTA 3QX2A 4PDOA 2X4ZA 3EQFA 5I4NA 3HVCA 5AP3A 4U40A 5FP5A 4FSQA 1H8FA 3G6HA 3FMJA 2PZRA 3G6GA 3A7IA 2ZAZA 5GZAA 4FKTA 2VWVA 4R3CA 3BX5A 1OITA 3ENHA 3PVUA 4G3CA 4OTIA 2Y4IC 3TNWA 3V51A 3QAME 4PP9A 4QMUA 4TXCA 1FBNA 4O7WA 2VTSA 4TRLA 4AACA 5IUGA 5FDXA 5DH3A 1KV2A 2XP2A 4M8TA 3NNXA 4KKEA 2WQBA 5HG5A 4IFGA 4QMYA 2UZBA 4S34A 2UZNA 3TNQB 2B0QA 3OEFX 5F1ZA 4FNZA 2G2HA 3P4KA 3RAIA 4DEIA 3JR1A 2PUNA 2XA4A 1PY5A 5TT7A 1TVOA 1URWA 3HUBA 2QOLA 5JFWA 3FMHA 2X2KA 4MVFA 5JQ5A 2OF4A 3FLNC 5K9IA 4QP9A 5DBXA 2W1IA 3ZU7A 4YP8A 3WZDA 4TT7A 3IW4A 5JH6A 2YJSA 3E5AA 4MWHA 3JY0A 4IDTA 3PG3A 4DBNA 2YDJA 4XS2A 3W0OA 3W2RA 2GQRA 2R3MA 3OUNB 1JSUA 3DZQA 3R7EA 4FZAB 3CS9A 3ODYX 4EOMA 5C4KA 3LJ1A 4M14A 1ZMVA 4F9CA 1BX6A 4BGGA 4KABA 5HU9A 5IF1A 4AGCA 3UZPA 4ANOA 4C38A 4NSTA 3PPKA 3GU5A 2FSLX 3CGOA 3BGPA 4XJ0A 4CKRA 5K0XA 3E8EA 4S32A 4U6RA 4FL1A 4D1ZA 3MWUA 2RL5A 1JKKA 1GJOA 1QPEA 4BZDA 2VO7A 5LWMA 4LOPA 5AR7A 4H3PA 4LUEA 3KXZA 1Q8ZA 2UW4A 5BUIA 4BN1A 3V6SA 3CLYA 2WD1A 3PVWA 3TTJA 4B8MA 4E93A 5EHLA 3MB7A 4IJPA 4O81A 2BAKA 2JLDA 3RI1A 4HCVA 4NKAA 5CF6A 2VTMA 2WQEA 3RAHA 4E6AA 4O4CA 5CSPA 4FEXA 3ZLYA 3RWPA 3R9DA 3TNIA 4MQ2A 5JKGA 3C51A 1ZMUA 4YHJA 4EK5A 4OW8A 2XNEA 4MNEA 3QQHA 3DKFA 4MXAA 5JZJA 3MPMA 4WRGA 4G9RA 4TYEA 5CSXA 3VQUA 2ZV2A 3VBVA 5H9BA 4AP7A 1JPAA 4ZSAA 1KSWA 2ZJWA 3LMIA 3D5WA 4XUFA 1BI8A 3QWJA 2PHKA 4QP2A 4D0WA 3VBYA 4CT2A 1U54A 2YM5A 5AUXA 2J4ZA 2VWZA 3SOCA 2I40A 4MXCA 4HGTA 2X0GA 3WF8A 2V7AA 5DEWA 3LFEA 1FINA 4F9BA 4G3GA 3BU3A 1H27A 3R8MA 1MRUA 4X3JA 4MX9A 4R1YA 3V8WA 3VBXA 5T68A 3HAVA 2OXXA 4RA5A 5C01A 3DQWA 4PDSA 3VS3A 2BUJA 3AD6A 5IH4A 1KOBA 1YXVA 4RJ5A 2WGJA 3NUNA 5FBNC 3SW4A 2VTNA 4FIGA 4J96A 2Z7SA 4FT7A 4PTCA 4RIOA 4TYGA 4XYFA 5CENA 4C0TA 3SRVA 4OTHA 2VV9A 3N51A 5EKNA 3QTQA 2X8IA 2HXLA 4PL3A 4W9WA 5FEEA 5KBQA 4QT1A 1T46A 2QHNA 3I6UA 4D4SA 4ZSGA 4UY9A 2UVZA 3A7HA 2EXCX 5IISA 4FSZA 4RPVA 3BHYA 3VHEA 4DH8A 3TZ7A 2XIRA 4GU9A 4L7FA 4JX3A 2OSCA 5M44A 3MA3A 4JR7A 3FSKA 4DEGA 3BQCA 4ACHA 4K0YA 3FBVA 4I94A 4HVGA 2XS0A 1UWJA 1OPKA 2PZYA 3NZ0A 4NZWB 4CD0A 1FMOE 3EQHA 5E8XA 2J9MA 3TM0A 3OHTA 4XBRA 1O6LA 2B52A 1IRKA 3MVMA 3IGGA 4PUZA 1Y6AA 2YA9A 5E8UA 3C4CA 4JLCA 4MWIA 4O1OA 4EQCA 3BHTA 3P0MA 4PMPA 4APCA 5KHXA 2HYYA 4AOIA 4FTQA 3WE4A 4QMOA 3C1XA 3JPVA 3RHXA 4U5JA 4IMYA 3HKOA 4RFYA 3MS9A 4IAIA 4PRJA 4RQKA 5D7VA 2P0CA 5AR8A 3ZONA 5L6PA 3KEXA 3BLAA 4WHZA 2BRNA 2WOTA 1OMWA 2EB2A 1ZMWA 5IG1A 4H36A 2CLXA 3PVBA 4Q2AA 5CYIA 4TYJA 5J8IA 3PUFC 3FMLA 3PWYA 5A4EA 3AKKA 3QHRA 2DWBA 2GU8A 3D14A 3ZBXA 1J7LA 3KY2A 2R3GA 2ZDUA 3LQ5A 4QMNA 4PL4A 5LVOA 3AD4A 4HNIA 4GIIA 2NP8A 4DTKA 1YQJA 2Q0BA 4OGRA 3A4OX 3IDBA 3FUPA 4I5CA 2QU5A 1PHKA 2NO3A 4MF1A 3LW0A 3R73A 4DITA 4BF2A 5CALA 3C4EA 3BPRA 4N6YA 4CFMA 2OIDA 3NLBA 4QP3A 4F7SA 4R1VA 5A46A 5CAOA 4P7EA 2IG7A 2YN8A 3JVSA 4DEBA 2GQSA 2EB3A 3PFQA 4FVPA 4C58A 3MI9A 3UDTA 5BV3A 3EQRA 3EQIA 1H0VA 3MTFA 4I3ZA 4PMMA 2R3JA 5DA3A 3C4WA 2YCFA 4IX3A 4DDGA 5JN2A 5JFXA 4DAWA 4YC8A 4J71A 4EH9A 3LJ0A 5HO8A 3W0NA 4IC8A 3TV4A 3R7YA 4RWJA 2QONA 3V6RA 4O0TA 1W84A 5I5ZA 5L2QA 4I5PA 4WD5A 3D5XA 4QMQA 5J9YA 2WMRA 3H10A 3ZRMA 3VVHA 4R3PA 4S2ZA 3L1SA 4O86A 2J5FA 4AF3A 1ZAOA 3RZBA 3EN6A 2P2IA 2XNMA 3F5GA 4D2SA 3U6IA 3Q6WA 4B99A 4BIDA 3F66A 2J51A 4AZEA 3LXKA 3CP9A 3QZHA 4KS8A 4KRDA 2J7TA 4YNEA 5LARA 3LFSA 2V55A 4GUEA 4B6LA 4YR8A 4RIWA 3K3IA 3IDPA 3QKLA 4B7TA 2WEIA 4IE9A 1Q3WA 2Z2WA 4QMZA 3AG9A 3IK3A 4BCQA 2Y4PA 3UOHA 4W4VA 3MIAA 3MPAA 2DS1A 2UUEA 5AMNA 4CYJA 4BDBA 2VWXA 4A9UA 3SGCA 4EHZA 3O17A 4NCTC 4BTJA 1S9IA 5HG7A 1KE6A 3QGYA 4Y72A 3ORKA 4UWBA 3R2BA 4HNFA 2XK3A 2PUIA 2OG8A 3NIZA 2C0TA 1GY3A 3F2AA 3P23A 4MTAA 3D83A 4AG8A 1YXSA 1ZYCA 4Y83A 4ALWA 2AEGA 4O7SA 4EK8A 4ZMFA 3OP5A 1FGIA 4MXYA 3ZO1A 4BFMA 4TWOA 4EOQA 2HAKA 2JGZA 3PXKA 2O2UA 3LM0A 1U59A 3R2YA 3TG1A 2HK5A 5LXMA 3LCOA 3DB8A 5ETCA 1DI9A 4UB7A 3VUGA 4E5BA 4DE4A 2XIXA 4RLLA 2JAMA 4BHZA 4DTBA 4ZLOA 3IGOA 3V8SA 3MFRA 3WF6A 3S1HA 4OBOA 2OFVA 1URCA 4XMOA 5TO8A 4D2TA 3DBDA 1H25A 3OY1A 4IZ5A 4FIEA 2FYSA 3EN9A 3GCQA 3HV6A 2PMIA 1X8BA 4YUQA 3DNEA 1J3HA 3P7CA 4IM0A 4MBJA 2YERA 4GT3A 2JBOA 4QTCA 3PIZA 3ZDIA 3A2CA 3BGZA 4DHZA 4LRMA 4DHFA 2J0MB 3OD6X 4L68A 4G3EA 1UKIA 3G0FA 4YSMA 1LEWA 3DK6A 4YNOA 2XK6A 1MP8A 4E4NA 2PZIA 4GCJA 2OZAA 1Q61A 1GIIA 5JRQA 4EH3A 4JIAA 2VTJA 5EDQA 2W1EA 4FKGA 4RT7A 1W2FA 4QP6A 5BVWA 2WMXA 4D4VA 2BALA 4F99A 1R0EA 2IWIA 1A48A 5AV0A 1MUOA 4AQKA 1JWHA 1GZNA 3D2IA 2RFSA 4MYGA 4YLLA 4I5MA 4JG6A 2QNJA 3RALA 3GT8A 4LV5A 3D7TB 4N4SA 4NW6A 4M3QA 3BV2A 3GQLA 1A06A 5D1JA 4PX6A 2VZ6A 3TV7A 4UMRA 4MQ1A 4JQ7A 3F82A 3CJGA 1U5RA 3FKNA 5M07A 4QYFA 4WG3A 5HLPA 4UYAA 1OBGA 4KIOA 4NTSA 4AFJA 5IEXA 3LXNA 3E93A 4CQEA 4C2WA 4I20A 2ZVAA 3AC2A 4WIHA 2C6TA 4E5WA 2XK7A 2G15A 3KRJA 4MF0A 1NVQA 5E1SA 2EVAA 3C13A 4CCBA 5LQFA 3NUYA 2W4OA 3IS5A 3QHWA 3P1AA 3OG7A 4U79A 3GUBA 5AIRA 2B7AA 5I9VA 5E90A 3NUPA 2RKUA 2PVKA 4N57A 4E73A 2BZKB 5ANOA 4GKHA 4GG5A 2W9FB 1TKIA 5AR5A 5CZHA 4QMLA 5FDPA 3QA0A 2X1NA 4FC0A 4JDHA 2UVXA 4IEBA 4ZZMA 1P14A 5JZNA 4C36A 1M17A 2C1BA 2PWLA 2YFXA 4E4XA 3OY3A 5E8WA 1SMHA 2JDOA 4O38A 5HNBA 3FJQE 1OGYA 4FMQA 4CLJA 4CEGA 2PUUA 3OF0A 3F7WA 5E8VA 2W05A 3EL8A 4G5JA 1H1SA 4X2JA 4D55A 3CY2A 2IVTA 4MXZA 2XRWA 2CPKE 2YIYA 1WZYA 3C0IA 3NDMA 2BFXA 2R3HA 3NYVA 4DT9A 2JDTA 2QLQA 1F0QA 3E8NA 4O6EA 2YZAA 3B8QA 4IAZA 4R8QA 5HTIA 1L8TA 3GFWA 1CMKE 3FC2A 3LFDA 5HO7A 1OECA 4A4XA 2UW5A 4M15A 3TKHA 4KBAA 4C33A 4LGGA 4J52A 4LI5A 3FI8A 2FGIA 5EQEA 3H30A 2XF0A 4BIEA 1ST0A 3PXZA 4KNBA 4LL0A 3KA0A 3HRBA 2I1MA 3RJCA 2UVYA 3EKKA 3VS7A 1W98A 3FMEA 4Q5HA 2W4JA 3DY7A 4FTTA 2GFCA 3W55A 5L3AA 4FIIA 2GHGA 4JQEA 2PMNX 3KKVA 3MH3A 5BMMA 5DYJA 4M0YA 1YWNA 4LRKA 4RIYA 4KUJA 1PW2A 5HOAA 5CTPA 2R64A 4S33A 5AP2A 4ZSLA 3TUBA 2XKEA 3QYZA 2IW8A 1GZKA 3VF8A 2X2MA 3AQVA 4CKJA 4O96A 4L3JA 5BVKA 4GFOA 3IOPA 5HO6A 2XARA 2B9JA 3FMMA 1H08A 3CD8A 4FYOA 2B1PA 4FTLA 5JGDA 1SZMA 1OIRA 2ITPA 1ZZ2A 1CKIA 3NW5A 4BC6A 4FL3A 5TE0A 1E1XA 4X2GA 1OGUA 4R7IA 4EORA 5JT2A 2QURA 1W82A 1ZY4A 3VHKA 4ACDA 2JD5A 3QCYA 2PU8A 4QP4A 3QTSA 4KB8A 4O0VA 4PNKA 2XYUA 3WOWA 2FSMX 3DKCA 4M7IA 1ND4A 4E26A 5EYDA 3CD3A 2BRHA 4IBMA 4ANSA 4YO6A 3QRTA 3TIYA 3L8XA 5C26A 2YDKA 3HYHA 4I0TA 3HRFA 2QOBA 3FQSA 2V5QA 4DGLC 3E64A 5E8YA 4Q5EA 3SKCA 4RVKA 3O2MA 3WZUA 5E1EA 4CZTA 3PJ3A 2F7XE 4Y73A 3V01A 4FTOA 3HP5A 3F2NA 1Q4LA 4RJ7A 4V01A 3A61A 5AP1A 4LGDA 3VULA 4AE6A 3RCDA 2XANA 3N4UA 2GQGA 4JRVA 5DEYA 5ETFA 5F95A 3TXOA 3UGCA 4BIBA 4DGGA 2JDVA 3W2OA 4EOKA 3HMMA 3T3UA 2W17A 5EDRA 3DA6A 3BLQA 3FI3A 5L2IA 3PY1A 3QRUA 2F57A 4FTNA 3VUDA 2PVJA 3GP0A 4CTCA 2QD9A 3ZO4A 4GYGA 2C30A 3GQIA 3C0GA 3A8WA 1H1QA 1IEPA 4AZVA 5K4JA 4TKSA 2GTMA 2GNHA 4PPCA 3TUDA 5CEPA 2BILB 1Y6BA 4CCUA 3CIKA 3AKJA 2VX1A 4WUNA 1F5QA 2W06A 5M55A 4ANQA 3V3VA 4UZDA 5CT7A 5IU2A 5BYLA 3KB7A 4QPSA 4EQMA 2VTAA 2GNLA 5CEIA 4QMSA 4EONA 5C27A 1SNUA 4IFCA 2ZMDA 4QYGA 3ZMMA 5CS6A 2QKRA 4JI9A 4EQUA 3PTGA 1PMUA 4I1ZA 5FEDA 3BYUA 4N70A 3FDNA 4UEUA 2X8EA 5I9YA 4QMTA 5L8JA 3GOPA 1NVRA 3IW7A 3VJNA 3QTIA 1WVXA 2IJMA 3ROCA 4HZRA 5LOHA 2F4JA 4G6NA 2WO6A 2C47A 1B6CB 1GNGA 5HCXA 3ERKA 5LVPA 4U43A 3EL7A 2BHEA 4R77A 4XRJA 3ZEWA 2WMVA 5EKOA 4QTDA 5G6VA 3TCPA 2OBJA 3U9CA 3ORLA 1OIQA 2IZUA 3OCSA 3R02A 5AV3A 4JJRA 3OC1A 3KQ7A 4AXDA 3CKWA 4A07A 4B8LA 4I21A 3HX4A 2BKZA 3IOKA 3KRWA 4IANA 2GS2A 4RA4A 4X0MA 5E8SA 3LAUA 4YTIA 4ASXA 3O7LB 2Z7RA 4WNMA 3TZ9A 1W7HA 1XMLA 1Y8GA 3GU8A 2RFEA 1M2QA 2UZUE 3CSVA 5CANA 1XH7A 2CMWA 2G2IA 1CSNA 2QHMA 2WMWA 3PA3A 4GG7A 4LM5A 5CSHA 4F7LA 1ZYSA 2R4BA 1MQ4A 4XLVA 3FZTA 2UZLA 2ZOQA 5T3QA 4DH7A 5J7BA 3U8WA 5M57A 3IDCA 3V5JA 2CJMA 3MTLA 3QRJA 2YCRA 1DAYA 4ZTMA 5M08A 2BZHB 1M14A 1NXKA 5IA2A 2H6DA 4C7TA 1RE8A 1Q8UA 3FMKA 3RK7A 1LR4A 4BDJA 3IW8A 3PLSA 4C62A 3C5IA 1XO2B 3VW6A 2XMYA 5A4QA 3NCZA 3KF7A 2UZTA 1P4OA 4ZEGA 2Q0NA 1M2PA 2V0DA 3KL8A 3QBNA 4HOKA 4KBKA 4W9XA 4XP3A 4ASDA 5A6OA 3KC3A 3DFCB 1XQZA 3PE1A 4NTTA 3ORPA 3RPSA 4YBKA 3WBLA 3DJ6A 2W5HA 3THBA 1Q5KA 4I6FA 5I3RA 3IW5A 2GNIA 3Q96A 1V0PA 2VTTA 2XNBA 3HRCA 3KXNA 3OT8A 4FKJA 5IA5A 4O7VA 5IH6A 2QO7A 2UZEA 1K2PA 4JG7A 4PPBA 2CGVA 3N9XA 2C3IB 4GU6A 2BMCA 3SG8A 3RKBA 3NIEA 3LCDA 4MAOA 4O0WA 3B8RA 3KU2A 4WT6A 5FG8A 4BI0A 3ZFMA 1UKHA 3FMDA 3WF7A 2ZM1A 2QOKA 4YZMA 2R5TA 4PWNA 4XOYA 5DRBA 3UC4A 3BEAA 2I0HA 4O7ZA 3L8PA 1E9HA 3FEGA 1PMVA 1V0BA 1YKRA 4NU1A 1OUKA 4OTQA 4F6UA 3OBJA 5L2TA 5JGBA 3ZLXA 4C4FA 2E9NA 4C4HA 1XH6A 4FJVA 5DHJA 5IKWA 4DFZE 5GZ8A 3PXYA 4JG8A 2BTSA 3GCVA 5HQ0A 1P4FA 3SXFA 2CN8A 2ZDTA 5J7HA 4G16A 3UVQA 4G34A 2QLUA 3ATTA 2IW6A 4NM5A 4EHVA 4QNYA 2R3PA 2IZSA 3DAEA 1WAKA 2OH4A 2PMLX 1Q8TA 3QX4A 4II5A 4L3PA 3ZM4A 5A6NA 2JBPA 1YDRE 2ZV8A 3R1NA 4AT5A 4BCJA 1UU7A 4KRCA 5M4UA 5DPVA 3F3ZA 4PNIA 2XEZA 3KULB 3II5A 3MVLA 4I22A 4AN3A 2BVAA 4YJSA 4JRNA 3BLRA 2C68A 5BYZA 4V0GA 3NCGA 4RGJA 3Q32A 4E3CA 2IPXA 2JIVA 3S3IA 4PDYA 1W2CA 4JBQA 5A3XA 4AA4A 2PVHA 3OWLA 3R9OA 4TPTA 4QTBA 4A06A 4F64A 4M97A 4EH6A 2YHVA 5J87A 5DFPA 4FGBA 4NH1A 2W1GA 3LVPA 4BKYA 4OAVB 5D41A 3DXNA 2C0IA 4K33A 4L00A 5E4HA 4L42A 5TOZA 3KGAA 5LMAA 4FTRA 3Q3BA 3RHKA 1HCLA 2QODA 4GIHA 5CI7A 3VS4A 2NYAA 3PJ8A 4NJ3A 1OKWA 4CTBA 5GIPE 4DLJA 2J0JA 4F1TA 1G3NA 5JSMA 3QC9A 2OLCA 3UPZA 1Q8WA 3OWPA 3UQCA 2ITVA 3BWJA 3KN5A 4EC8A 4EUTA 5H8BA 2XYNA 5AAFA 5JEBA 4E5AX 3BCEA 4GL9A 4QTAA 4TNDA 4B0GA 4ERKA 5A4CA 1GZOA 3A62A 3CTHA 2HXQA 2GHLA 4JBOA 3EOCA 4C3PA 4RJ6A 5D11A 3LPBA 5EDPA 4DT8A 2I0YA 3H9OA 5D12A 2XIKA 3QQJA 3UE4A 2YWVA 3BBTB 1VR2A 3EZRA 2R7IA 3OTVA 4U0IA 3DBEA 4OTGA 3I81A 4LQMA 3LFBA 3R30A 4RLKA 4FSYA 2R0UA 4C3RA 3L9PA 4QMXA 3ZFXA 4H1MA 3QYWA 2FSOX 3DPKA 5AR2A 3ORNA 5L2SA 2C5NA 4FTUA 2XNGA 1PXPA 1OL2A 3V5WA 3Q60A 4FT0A 3UG2A 1OM1A 3O71A 5KCVA 4EYJA 1WBOA 4QDVA 4XG7A 3O5AA 2JITA 4XG3A 1UA2A 5CSWA 3KN6A 4X3FA 5EOLA 1JKLA 4O1PA 3ZSHA 4LG4A 5AAEA 5CF4A 3FE3A 4EKKA 4DEDA 5HEZA 3V5TA 3SVVA 4FKLA 3W10A 3G9NA 4FZDB 4BWPA 3A7FA 3ML1A 4HVDA 2ESMA 4WBOA 4AXAA 4IM2A 5DOSA 4O82A 3PSCA 3R1YA 3QCXA 4CQGA 3UDSA 4JT3A 3QD0A 2XCHA 3QTUA 2BPMA 4UMQA 3ZUVA 5JMSA 5HNIX 4FTKA 4BCNA 4DGNA 3UO5A 3ATSA 4IB3A 2OU7A 4FKWA 4BY9E 4NW5A 4IAKA 4IHPA 2QR8A 5HG8A 1BL6A 1JAMA 3V8TA 2OIQA 1E1VA 4NWMA 4AAYA 5K5XA 5JGAA 5D10A 3R7OA 4QMPA 3UNJA 3RNYA 4FTIA 3VUTA 4DH1A 4QDEA 2VD5A 3I7BA 3QQKA 2XJ0A 5IUHA 1NT2A 3NYNA 3Q9XA 3ZUUA 2F2CB 5B2KA 5ACBC 5ITAA 1AGWA 2F7EE 3DJ5A 5LVMA 1O6KA 2QKWB 2ZYBA 4IIRA 3REPA 4F1OA 2F7ZE 2PY3A 4O84A 3ACKA 3R8VA 4DG0E 4AGUA 5IA1A 3GU7A 1Y91A 4YC6A 1MRYA 3G0EA 3FQEA 3NNUA 1IR3A 2REIA 2VTRA 4RFZA 5GNKA 3AGLA 4CV8A 1P2AA 2O3PA 4FIFA 3PZEA 4AT3A 4CFWA 2XZSA 4RJ8A 5BUJA 3HV5A 5ACKA 2XK9A 3DTWA 5IDNA 1Y8YA 3I6WA 2VX0A 4DG2E 4FOBA 4TYHA 4W8EA 4YO4A 4K6ZA 1H24A 3UDBA 4DG3E 3COIA 1XH9A 4RWIA 4TW9A 5B2LA 2O8YA 4QP1A 3R7UA 5AP0A 4FZ7A 5CF8A 3UIXA 2Z8CA 1Q62A 2R3FA 5F20A 2QG7A 5GJFA 3A7JA 2GNGA 3MSSA 3JXWA 1PXKA 2CLQA 4UMTA 4U7ZA 5GZ9A 1G8SA 3OWJA 4TTHB 3TDWA 2IF8A 3LQ8A 5FTOA 5M51A 2UW6A 3UC3A 3VAPA 4ERWA 3EJ1A 3UO6A 2XBAA 4Y5QA 3GCSA 4NUSA 4ZIMA 5IEVA 2W1DA 4MNEB 5CVGA 1PXMA 2NPQA 2VU3A 2ZB0A 3EIDA 5CEMA 1ZYDA 4S31A 3R9NA 4XV3A 1FMKA 3C4XA 4M12A 2JIUA 4UBAA 3FHRA 4BBMA 3O0GA 5C8KA 3VN9A 3LOKA 4F0IA 2H96A 1U54B 3UYSA 4IX4A 3ZC5A 3ZRKA 3U9NA 4B4LA 2BAQA 4RWLA 2IVUA 2UW0A 2YCQA 1XHAA 1XMMA 4QQJA 4AUAA 1REJA 3G5DA 2IZTA 3GXLA 4K77A 2W96B 3PY0A 3QQLA 3I60A 2YLEA 4X21A 4ZXTA 3UIUA 2HIWA 3AT2A 3EH9A 4KAOA 3ZO2A 5IZFA 3PFYA 4L9IA 5KE0A 4KA3A 4F78A 1APME 1M2RA 3FYKX 2HENA 2OJIA 3PYYA 5HCYA 3T3VA 3EHAA 3ZSGA 3NUAA 2BIKB 3NYOA 1YI6A 1XH5A 2WMUA 2YABA 2Z7LA 3OS3A 2VX3A 2YISA 3SRVB 4ZZNA 3UJGA 5JK3A 1DS5A 4U9AA 4J99A 3V04A 3RAWA 2OJGA 5KBRA 3MN3A 5FXRA 4Z55A 1AD5A 4J8MA 3G33A 3LFQA 4IVBA 3VJOA 4EH8A 4ZJVA 4BTKA 4ZY6A 3S95A 4H58A 4ZSJA 3UBDA 4USEA 2XNPA 1VJYA 3IPHA 4C35A 2QQ7A 5EHOA 2A98A 2WTJA 2V62A 4O4FA 4EZ3A 4CFVA 1NW1A 3A99A 5EQPA 4QOXA 3QKKA 3SDJA 2X8DA 5IQFA 4CZYB 4F9YA 4APPA 3B2WA 1R39A 1XKKA 4EEVA 4DYMA 5BNJA 2E9OA 2PE2A 3CY3A 4MCVA 5HHWA 2YDIA 3RAKA 4GK4A 4GVJA 1OB3A 2YCSA 2B9FA 5AP6A 3WYXA 4DFUA 2A4LA 5BPYA 4Y85A 4L52A 4O21A 4M69A 3ZXTA 4FKQA 1A9UA 2KTYA 3NNVA 5AX3A 3TJCA 1JOWB 3E88A 5HGIA 3QZGA 5ANIA 1PXNA 4EOSA 5J79A 4QMMA 3ANQA 5IDPA 2Y0AA 5JFVA 4C61A 3D15A 4DBXA 2CN5A 5EW9A 3PLAE 3VW8A 5BVNA 3UNKA 3UP7A 5HTCA 5L8LA 4D5HA 3HEGA 1YHSA 2X0QA 3NGAA 4XP2A 3R04A