4YNOA

Crystal structure of mapk13 at inactive form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
350
structure length
342
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLAGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 13
publication title IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 342
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ynoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ynoA01
2VWZA 3SW7A 3L8XA 2YAKA 5CNOA 5IPJA 4FTRA 3Q32A 4MXZA 4YTFA 3UQCA 5HX6A 3U6HA 2Z02A 4RFZA 3FLQA 3TZ8A 4BCFA 5DOSA 4I0RA 5EM6A 3TJCA 3KK9A 3CLYA 2W0JA 3FZSA 4L43A 4OTGA 1OIRA 3WZUA 4EYMA 4DEDA 4UWBA 3F9NA 3OMVA 3MH3A 4IX3A 1Q97A 3LPBA 4XV9A 2PYWA 3NAYA 2X7FA 4EOJA 4K77A 3RM6A 1KE9A 4ZIMA 4C4JA 3G90X 4IBMA 3ACKA 1UVRA 3U9NA 3RTPA 4H36A 5HO7A 4U42A 2X6DA 3FI8A 4O6EA 4YR8A 5AP2A 4CZTA 3ZHPC 4R3PA 2R3OA 5HNIX 3A4PA 5EG3A 3FZPA 5JQ8A 3A4OX 2ZB0A 4EOMA 3F3ZA 2WQNA 1ZMVA 2PUUA 2QOCA 3KXMA 3NNWA 4P4CA 4CCBA 3KXZA 2B9FA 2GHMA 4PPAA 5I0BA 4O81A 3K3IA 2YWVA 4C2WA 3DNDA 2C6KA 3DBDA 4Q2AA 4W4XA 1Y8GA 4I4EA 4J8NA 3UMXA 2PUIA 2VO6A 3I6WA 2YCFA 4USFA 1JSTA 3DKFA 3JY9A 2OU7A 5H8BA 5CT0A 4E5BA 4GUBA 2BRNA 3HA6A 2XM8A 4IX5A 3HMOA 3IW7A 5AX9A 2B0QA 4LRMA 2IPXA 2BHHA 2YM5A 4RIYB 5HIDA 3HNGA 4ZLOA 3PIXA 3BLHA 3BE9A 2JC6A 4MBLA 5A6OA 5DGZA 4I24A 5AP3A 5AV2A 3MIAA 3RINA 3DJ5A 3HUCA 4ITHA 3S95A 4UYAA 2G15A 4DYMA 4F9CA 4B7TA 5LMKC 4BDDA 4TT7A 3OVVA 4F9YA 3FUPA 2C0IA 1OKWA 1A48A 4XBUA 3BYSA 2P3GX 2PVYA 3LFCA 3NCZA 4MNEA 4IE9A 5AA9A 3ZS5A 3OXZA 4XP2A 2VO0A 3I1AA 4J96A 4U8ZA 3LXKA 5C8KA 4BVUA 3QUDA 4NUSA 5IH4A 5EM7A 3SDJA 2R3IA 3FMKA 4OAUC 2XKEA 3CS9A 4BCJA 3QQGA 4FYNA 4ID7A 3BIZA 5L2QA 4AUAA 3A8XA 2VUWA 3PPJA 3ZONA 4F7JA 4C2VA 3HZTA 5E8ZA 4CNHA 3LFAA 4MNEB 4RMZA 1VYZA 3R8LA 2O2UA 3R2YA 4AX8A 2R7IA 3KA0A 3UG1A 1LEWA 2A0CX 3B8RA 3PVGA 4A4XA 4EONA 1VJYA 4RA4A 4UZDA 5I9YA 2YLFA 4E3CA 3QF9A 4G34A 4FKQA 5KMKA 4LL5A 4PX6A 4ZSJA 3GOPA 2HXLA 4I5CA 4H3BA 4AZEA 3JR1A 2W4KA 3H9RA 4F65A 5BUIA 2WMAA 2EXMA 3EWHA 4I0TA 4W4VA 3Q6WA 5DI1A 2XNOA 4XG4A 5DN3A 1AQ1A 1Y8YA 4FK6A 1QPJA 3DQWA 1R78A 5HCXA 3D0EA 4D2PA 4WKQA 3UZPA 4HYUA 5CEMA 4OTFA 2VD5A 3LM0A 2W9ZB 2HK5A 5D9HA 1UNGA 5M4UA 2A4LA 3NUNA 3U8WA 3V5LA 4BI1A 4QYEA 2J5FA 2OFUA 1WBVA 2OI4X 2QO2A 4WBBB 4B4LA 3BHTA 4S2ZA 4AZFA 4CVAA 1FGKA 3G33A 1FVTA 3HMNA 4RC4A 2QONA 4EOPA 2AC3A 2WXVA 4HNFA 3THBA 5K3YA 3CSVA 3TWJA 1Q8WA 2G2FA 3QUEA 3UVPA 4R1YA 3VQHA 3FZTA 5CS6A 2F4JA 3RPYA 4YUQA 2PZ5A 1IAJA 3DKGA 3K3JA 2XJ1A 2OWBA 3M11A 4O2PA 3SV0A 5IMEA 3H9OA 3KXHA 5GIPE 4KBCA 3F88A 2VNWA 2VWUA 5TKDA 4YC8A 2GHGA 4FBXA 3PXFA 4YTCA 2EUFB 3FDNA 4DFYA 3BQCA 4YHTA 2J50A 3L9NA 4M84A 2W1HA 3TXOA 4LOOA 3W32A 4QTEA 2FVDA 2WMQA 3E7VA 4FKUA 3JUHA 4C37A 2WTKC 3O8TA 2RGPA 4JQ8A 5I9XA 3CTHA 3TV4A 2GQSA 4OTIA 3SHEA 3KRRA 2C47A 3W8QA 4AU8A 3FI3A 4OAVB 3PLSA 5HTBA 2VZ6A 4QYGA 3UPZA 5IQFA 4GK4A 4JG6A 4F4PA 1OB3A 2CNVA 2ITZA 3C0GA 3D9VA 4XBRA 2YIYA 3H0YA 4GT3A 4FTQA 3FL5A 4TY1A 1RQQA 2Z7LA 3FXZA 4FTJA 4UY9A 3EL8A 4YZNA 2BKZA 4JDKA 4N70A 4B0GA 1KWPA 1UNLA 3ET7A 1AGWA 1WBNA 4OBPA 4EK6A 4ZZOA 4TWNA 1FGIA 4FIJA 3FLZA 3OCSA 5LQFA 4TYHA 2GNLA 2WB8A 3FZRA 4D9UA 2YLEA 4IVDA 2E9OA 3S1HA 3COHA 1H1SA 3TNIA 4ZLYA 1Q61A 5J9ZA 4CKIA 3Q04A 2HCKA 4QMVA 3ZLWA 2C1BA 3DAEA 3WARA 1BLXA 5EYCA 5LMAA 4U40A 3D14A 3UG2A 5K5XA 4Z7HA 1TQIA 5BVDA 4XEYA 4AE6A 3PVUA 2UZDA 4TYHB 2P2HA 2XZSA 2PMNX 3UZRA 3ORZA 1J7IA 5C26A 1SVEA 4EEVA 4YMJA 5KMNA 2R9SA 4YP8A 1YOMA 3DXNA 3NYVA 3U6IA 2WQMA 2OG8A 2JDRA 2JGZA 4FV5A 1GOLA 4IACA 4C61A 1JQHA 3BRBA 2YFXA 2AYPA 4QOXA 3U51A 3R71A 4ANNA 2W06A 5JRSA 2VGOA 1K9AA 5EYMA 5I4NA 3BWFA 5M4FA 3PRIA 4IM2A 4ENYA 4FEXA 2OF2A 4L68A 2E9PA 4KIKA 4LMUA 4PMMA 5ETFA 3E62A 2R3HA 2OJJA 1JKTA 2PVRA 3EN9A 4IMYA 4EOOA 1OPLA 3VJNA 1W83A 3QTSA 2WU7A 5E4HA 4IANA 1V0OA 3B2WA 4C3RA 2PWLA 4EC9A 3S0OA 1XH8A 1CDKA 2QHNA 5JZJA 1PKDA 1WMKA 1WBSA 4CXAA 1I09A 3PSCA 3UNZA 3OFMA 4DEBA 4Q5HA 4EHVA 4E4LA 4J53A 4QP2A 4NM0A 1JWHA 1Q99A 2JIIA 1GJOA 3LCSA 4S33A 3QZGA 2B53A 3ZUUA 4H58A 4C7TA 3MI9A 5M07A 2QODA 3OTVA 2YCSA 4KIQA 4EH2A 5FP5A 4ZSEA 4M68A 5AAEA 4YC3A 3PIZA 2R0IA 3E8EA 1U5RA 2W9FB 1OITA 2LAVA 4ASZA 3EZVA 3GXLA 5HE3A 3O51A 5KZ0A 4DLIA 4HVDA 5KNJA 5LMKA 4RIOA 3F3WA 1KV2A 4BCNA 4EK8A 2G1TA 4IVBA 4IX4A 1GIJA 2ITNA 3CBLA 4M7IA 4ALWA 3W2SA 5I9VA 2XBJA 3A7GA 3WZJA 4FV8A 3CR0A 2Q0NA 4ZTRA 2JLDA 2QG7A 3PJ2A 2GNGA 1Y6AA 5HO8A 4NKSA 3R7IA 4EH7A 2A1AB 3B2TA 5HGIA 2OBJA 4AGCA 3NNVA 2BALA 4ZSAA 1J7LA 4M69A 4IWPA 4QMPA 5HLNA 3NIZA 3QKKA 3IG7A 3QHWA 5LJJA 3SAYA 1ZXEA 3CQEA 4CD0A 1NW1A 1O9UA 3DU8A 5F4NA 2ZVAA 2ZOQA 3ZEPA 5JFVA 4ZTNA 4IW0A 5B2KA 3FMLA 3ROYA 3RNYA 1PKGA 4RA5A 3QRKA 4RFYA 3W2CA 3ZRKA 4R6VA 4M69B 3FLWA 3QQUA 4RFMA 1BX6A 3UQGA 2W4JA 3DB6A 4FL3A 3CY2A 4WOVA 3ZZWA 4EZ3A 3LFEA 3FYJX 4U44A 3V6SA 3C9WA 3IKAA 3V5QA 3ZMMA 3M1SA 2HXQA 2P33A 3OW4A 1MRVA 4CZYB 3DZOA 4XP0A 1MQBA 4IAYA 4O7SA 2F2CB 4GV1A 4NM5A 4TN6A 1BYGA 2RSVA 3NUAA 3KQ7A 5EKNA 2ITXA 3FLNC 4YZMA 4PTGA 3R22A 3W16A 3FSKA 3EL7A 4ZXTA 3I6UA 5E8XA 4EH3A 4G5JA 4A9RA 4GMYA 5M51A 4EC8A 4AZVA 1SVHA 4GFMA 2B55A 2C68A 2OH0E 3ZO4A 1KV1A 4FT3A 4YLLA 2C5YA 4K11A 1JVPP 4M8TA 3VQUA 4YJTA 1ZOHA 4ZTHA 3G0FA 5HE1A 5L4QA 3HGKA 5DPVA 3QL8A 4YSMA 3GI3A 4KNBA 4FTAA 3NNXA 4LI5A 4RJ4A 4G3DA 4X21A 4ASDA 3ZO3A 3CJFA 4ACHA 4USEA 4FG9A 2B52A 3UOJA 4DT8A 4I93A 4FL1A 4U81A 4C3PA 4HCUA 4UEUA 3MVLA 4C33A 3ZM9A 3JXWA 3E3PA 2QU5A 2I40A 2XBAA 4Y95A 5A4CA 3NEWA 2WAJA 3PSDA 4KRDA 4O0VA 2QOFA 1SYKA 4FG8A 1OIUA 4NT4A 2VNYA 4JDHA 4RC2A 3QCQA 5HVYA 4BTMA 4YJVA 3PP1A 4NM7A 3C4EA 3LLTA 4NTTA 4QP9A 4AXAA 4F0GA 3P9JA 3QX4A 5FXRA 3NSZA 5E90A 5ETAA 4PTCA 4EYJA 2HY0A 3PXYA 5CYIA 2GFCA 2VTOA 2KTYA 2QOIA 3ERKA 5KUPA 5KMLA 2WTKB 4HVGA 3ORTA 1YVJA 1WVWA 3R8ZA 2IO6A 2WEIA 3KEXA 4C38A 3RBWA 2J0IA 2X4FA 3OY1A 4RWKA 5ANIA 1XKKA 3ZRLA 2HELA 5CI6A 4KD1A 1WZYA 4D2TA 3GOKA 4FIEA 4MTAA 5IDNA 2YIQA 1G3NA 4KKGA 2UZOA 4AW0A 5E8WA 2WTIA 5HBJA 5IA3A 4LL0A 5B0XA 2HWOA 1ZAOA 4PP7A 4DTAA 3ZCLA 4P90A 2GNFA 3QXPA 3QLGA 3UOHA 2GS2A 4CYJA 1OI9A 2W1GA 2X7GA 4YJRA 4R7HA 3VUKA 4EH4A 2C6IA 3I4BA 5AP0A 2JFMA 4PWNA 3Q4UA 5GHVA 4A9YA 4EL9A 1W84A 1XH9A 4BI0A 2XNNA 4CRSA 3ETAA 4FTUA 3DBEA 5GJFA 2Q0BA 5C8MA 3C0HA 3EN7A 1XH4A 3C13A 3TJDA 4D2SA 5HTIA 2YM3A 3KMUA 4FKTA 4WO5A 4K8AA 5IF1A 2NNWB 4O7RA 3RVGA 4IH8A 3I7BA 1HCKA 2B7AA 2PVNA 2UZEA 5EDQA 4LOPA 3FKOA 4OTPA 1Q8UA 4FGBA 4F1OA 3O0GA 4QPMA 5IQIA 4ACMA 2ETMA 5BYLA 2C3LA 4N6YA 3AMYA 4DGLC 4MBJA 2WMRA 3F82A 5CVHA 3R8PA 3R02A 4K33A 3W2PA 1OECA 3QTQA 4XRJA 2PVKA 3D83A 3NLBA 2YEXA 3R2BA 3Q9WA 4NM3A 4G6LA 4FVRA 5KBQA 4DA5A 2FGIA 4MVFA 4L44A 3RZFA 1ZYCA 2DS1A 3CY3A 3REPA 3MFRA 4IWQA 4O96A 2BRBA 3FMDA 4S30A 3UOKA 3N4TA 4HNIA 2JKQA 3QFVA 3LJ2A 1ZZ2A 3AGLA 2XRUA 3AC4A 4AZTA 5JGDA 3IOPA 2HW7A 2W1ZA 4GVJA 4AS0A 2VTLA 3OEZA 4J8MA 3V5TA 3V8WA 4AQCA 3FC1X 1WFCA 2V5QA 4RG0A 2BTRA 3G6HA 3Q53A 4DH1A 3PVWA 3COMA 3TT0A 3KY2A 1MQ4A 4ANBA 3ZTXA 4MK0A 4BY9E 2V22A 4WSQA 5E8SA 3ZRMA 5BX0A 1WBOA 4HGEA 1ZYJA 4CEGA 4IAIA 2BILB 1F0QA 2OZAA 5AR3A 4D4SA 1IAHA 3NYNA 3DKOA 4MXYA 2X8IA 3Q9YA 4X2KA 2BUJA 2O0UA 2FB8A 3PRFA 3QRUA 2RIOA 2GCDA 1PW2A 3EN5A 1Z9XA 3MBLA 4I6HA 4F09A 2VTRA 4RQKA 5E1SA 2OZAB 2VWXA 4UXLA 5L6WL 4D58A 5HZNA 4JBOA 5CQWA 4O83A 3OC1A 3QTUA 4EBWA 4M3QA 5DHJA 4FSQA 2IW9A 4AT4A 3BCEA 2YIXA 3V04A 5CASA 2A2AA 1YQJA 5K0XA 4QNYA 4FEVA 5DBXA 2W1FA 5LVOA 3TDWA 2XVDA 3E7OA 2IWIA 3DBFA 3G51A 4E6AA 3QLFA 3MY5A 5H2UA 4D2VA 4DC2A 4XYFA 4U43A 2J0KA 3SOCA 2I0YA 3EFJA 2Z7RA 3CQUA 4L00A 5CNNA 2VTJA 3GENA 3O7LD 1GZKA 5AUTA 1BMKA 2C1AA 5TO8A 1JAMA 3O7LB 2CCHA 5HG7A 1PXJA 1RDQE 4I5HA 4IFGA 2PUPA 2BZKB 4TWCA 2IW8A 4D0WA 2X2LA 4IHPA 4ZTLA 4A9SA 4DH3A 2A19B 3F5XA 3OUKA 3PG1A 3RAKA 1LEZA 2EWAA 3G2FA 2C0OA 3TTIA 4RLLA 5KBRA 5HE2A 3DQXA 2XKDA 2YIWA 5FBOA 4QP3A 1FOTA 1MUOA 3I7CA 4BFMA 2QO9A 2O63A 4DGOA 4EQUA 5C4KA 3L8VA 4JR3A 2CGXA 4FOBA 4RJ6A 4X2JA 3VHEA 5AADA 5F1ZA 4NJDA 5J7HA 4RVKA 4O38A 2EB3A 3R7EA 2QG5A 1OM1A 3F6XA 3RALA 4IFCA 4OW8A 3R28A 3D5XA 4BCGA 5HLWA 5EM8A 4OTDA 3NMUF 3OWLA 3PY0A 3WYXA 4R8QA 2CNQA 2XK4A 5ACKA 2HZNA 3OWPA 4QMMA 4DCAA 4MWHA 2Z7SA 4I41A 4FX3A 2XEYA 3DKCA 3GEQA 4MHAA 3MYGA 4WNPA 5J8IA 3OF0A 1PMVA 3C7QA 3HVCA 5FG8A 2C6LA 4JNWA 2EU9A 1VYWA 3VJOA 2CJMA 4LGDA 2IZRA 4DCEA 4Z55A 1IA9A 3GCUA 3P23A 4IDTA 4IB0A 4D55A 3KN6A 1PJKA 2XK8A 5FGKA 5I9WA 5F20A 3DY7A 4BHNA 3LMIA 3Q52A 2F7XE 1M7QA 1BL7A 3K2LA 2XIXA 2OIBA 3QA8A 4NZWB 5DT0A 5TT7A 4ARKA 5JFXA 1XH7A 4O0SA 4UMRA 5LXMA 3BGQA 2Z60A 4YZDA 3NVMB 2WIPA 4X3FC 4TNBA 2R3GA 4CRLA 4DAWA 5DR9A 2ZYBA 4JQEA 5M4CA 1SNXA 4JQ7A 2ITQA 4MAOA 4WUAA 2BRMA 3PXZA 2AC5A 2CMWA 3QD3A 4FTIA 3IPHA 5JRQA 4OBQA 2R3LA 4GEOA 4C57A 4EH5A 5IEYA 5J87A 3I0OA 1Z57A 2VTMA 5A9UA 5DH3A 3NR9A 4B6LA 2WMSA 4WG4A 3QTWA 1G8SA 3RK5A 4ERKA 5D7AA 4FEUA 4ALUA 2BPMA 3C4ZA 3MDYA 4G2FA 4DEHA 5J79A 2B54A 1OKZA 3BHVA 3SG8A 4N4SA 4QP1A 1JNKA 2XUUA 2O64A 3COIA 4ZLZA 3FJQE 1ZYSA 4QNAA 1FVRA 1ZY4A 3R7OA 4FSRA 2PY3A 4RJ3A 3VAPA 3EQRA 3AQVA 4QYFA 3CPCA 3PYYA 4QQTA 2R3RA 3Q3BA 3AC1A 3HL7A 4AN3A 1G8AA 3A61A 4XJ0A 2UZVA 4R77A 4PTEA 2WOTA 3ORKA 1ZARA 2PHKA 2ITUA 5LCKA 3SLSA 2CGVA 5CU0A 5LOHA 4YO6A 5IA4A 3UZTA 1PXNA 2BIKB 2XNPA 3R9HA 4MXCA 3GGFA 4D4RA 4Q5EA 3HRFA 1NY3A 3TTJA 2FSLX 5EDPA 1EH4A 4HGSA 4FV7A 3MH0A 4BKYA 3QBNA 3PJ1A 5ANKA 5AV1A 3LIJA 3O8PA 4IVCA 5AP5A 3S2PA 2NRYA 2PZPA 2OFVA 4GJ2A 3N4VA 4ZY5A 4RC3A 5FD2A 2YJSA 2HIWA 4TYEA 2IN6A 4MXOA 4YJOA 4U97A 3MFSA 1KOAA 4M12A 4Y73A 2OGVA 3EQGA 4QP8A 1M14A 2WOUA 4O84A 3D5VA 3ODZX 3QQHA 4FKRA 4TYIA 2DUVA 4QMNA 1ZMUA 3R00A 5C9CA 1T46A 3PWDA 4JX3A 5JN2A 1OBDA 3Q5ZA 4FGRA 2DWBA 2O3PA 4MX9A 2JAVA 3QD2B 4RLKA 1QPDA 4W4WA 5LARA 3CKXA 1B6CB 3OHTA 4F1TA 3BEAA 2UW6A 3ORLA 4GIIA 5L6OA 2PVJA 2QVSE 1F5QA 4BR3A 3ZC6A 4ONAA 5CU3A 3TIZA 3S00A 4EQMA 3EIDA 3BU3A 3HECA 4D0XA 5CAQA 3DA6A 4GCJA 4G3EA 1K3AA 4RIYA 1ZLTA 4Y8DA 3BV2A 3FKNA 4ZY4A 2WNTA 4FSUA 4ACGA 4S34A 3AMBA 3GC9A 4LV5A 5J1VA 5K4IA 2GPHA 3TZMA 2XKCA 3ZSIA 1ZZLA 4FKOA 5H8GA 4BZOA 3VNTA 1DI8A 2W5BA 4F0FA 1WBTA 2UVXA 5L2WA 4GIHA 2VTTA 5FTQA 2NO3A 3QC9A 3LMGA 4FV1A 4OBOA 3GBZA 4P7EA 1URWA 2YAAA 3DCVA 4RPVA 5GZ9A 4O7VA 3PXRA 3NDMA 3FXWA 4J52A 5HQ0A 2GNHA 4GUEA 3IW8A 4Q9SA 4RT7A 2UVZA 3E92A 3SOAA 2JKKA 4KSPA 3E87A 2W1CA 5AV4A 3ZDIA 5I5ZA 3BYUA 3AD5A 4BCKA 3BX5A 4Y72A 3BU6A 4XG9A 1YOJA 1NVSA 4AN9A 1A9UA 3EN6A 3ZFMA 5FM2A 4YJUA 4CCUA 1KUTA 4PDSA 3VC4A 1ERKA 2J0LA 2WZJA 3FI4A 4J71A 3PE1A 4UN0C 5DE2A 4CMTA 5HCYA 3HKOA 5HO6A 3TNQB 2Y9QA 3LQ8A 4HZRA 4RQVA 4DHFA 4GT5A 1FBNA 3SC1A 2WTVA 3EFLA 3ANRA 5HICA 2PVMA 4DEIA 2ZDTA 3MSSA 1BI7A 3WI6A 1IA8A 4FTTA 3H4JA 3V6RA 3NX8A 4KS8A 4O21A 3OS3A 4C59A 5CSPA 3IO7A 3TNPC 3CTJA 2WEVA 4TZRA 1V1KA 4YJNA 5B2MA 2ITTA 4FTNA 4BBEA 3K54A 4U41A 4EZ5A 4EK3A 4CGAA 2BR1A 2XNMA 2IVSA 4FR4A 4ZMFA 3LCTA 3F5UA 3ULZA 4EKLA 5H3QA 4TNDA 5AUWA 2QCSA 2EB2A 4L7SA 5EHOA 3H3CA 4WBOA 4QD6A 4JIKA 3PSBA 3UC4A 1J91A 4DEAA 3ZLYA 4OR5A 3AOXA 3U4UA 2F57A 4DFLA 1SVGA 3QCSA 4GG5A 4X6RA 4KBKA 3I81A 2ESMA 3VIDA 4ERWA 2NP8A 4JRVA 1RJBA 3EYGA 2WMXA 3HV6A 2UVYA 3CXWA 3KMWA 3K5VA 1H1RA 1XH6A 1Q62A 5CF5A 3HV7A 3P7AA 4ZAUA 1TQMA 3ZUTA 5IZFA 5KKRC 4X3FA 2HOGA 3PY1A 1U5QA 4EOKA 4WRSA 2XK3A 4Z9LA 2JDVA 4I6FA 4BDAA 4DN5A 1YKRA 3KCFA 4OT6A 2NRUA 3RPVA 3IDCA 4CFWA 2QR8A 2PE2A 2G2HA 4QTCA 4I22A 4IZ7A 4R1VA 1YHVA 2V62A 3FYKX 3O17A 2QKWB 2QD9A 4X3FB 3AC5A 4DEEA 1PXIA 1YWRA 2E2BA 4KS7A 4PMSA 2RG5A 3RAHA 4XX9A 4D4YA 3IONA 1A06A 2PUNA 4NK9A 4YHJA 5E7RA 5GJGA 5AMNA 3VBTA 4BDIA 1LUFA 1JSVA 5DMZA 4QYHA 3PZHA 3KMMA 3PPZA 3C51A 3NS9A 4XCUA 1E1XA 4O1PA 3FQHA 3ZOSA 3FEGA 3FQEA 4ZEGA 3RK7A 1ZRZA 2ZB1A 4AT5A 5EH0A 4YTIA 4CFNA 2C3IB 3DS6A 4F7SA 5IEXA 3SVVA 1OIQA 3QQFA 4XNEA 1OL5A 5M4IA 3ALOA 4IJPA 4MCVA 2PPQA 2X7OA 4RGJA 5A14A 3BLRA 4R78A 1QMZA 2ZDUA 3EOCA 4C62A 3ZLSA 3RNIA 3DK3A 5AV0A 3BHUA 1GZOA 1WAKA 5CU4A 2VU3A 3HMMA 3C0IA 4NW6A 1Q3DA 4YC6A 2YN8A 3OXTA 4A4LA 4AW2A 1OUYA 4BDFA 5DWRA 2IJMA 2OIQA 4GYIA 4RJ7A 2XNEA 5IQAA 3NW5A 3R8MA 2XIYA 3SRVA 1FINA 4PP9A 5FXQA 1J1CA 5DFPA 5AUZA 4F0IA 2DYLA 4ZSGA 5AX3A 2PL0A 3DOGA 2VGPA 5EQPA 1H08A 3DGKA 4NW5A 5FEDA 4CYIA 3C5UA 2H6DA 3PPKA 4H1MA 4A4OA 4BB4A 4W4YA 3ID6C 3WYYA 3QX2A 2C5NA 5J95A 1J1BA 3MTFA 3TZ7A 4YURA 3AG9A 5TR6A 3ITZA 3N51A 3SRVB 3LQ3A 3KB7A 3MH1A 5ITAA 3F66A 4G9CA 4DTBA 2VAGA 3QU0A 4QMXA 3SG9A 4TL0A 1XH5A 4IC7A 5JK3A 1R3CA 4FV2A 1VR2A 3CKWA 3VUHA 4F9WA 3IGOA 4FV4A 4GT4A 3N9XA 2UZTA 4MQ1A 4E73A 1CM8A 3U9CA 4PDOA 4WSYA 1M17A 1UV5A 4E6DA 2QOHA 3LMHA 1FMKA 1GNGA 2GDOA 4FVPA 5BVKA 3DXQA 3QCYA 3FMNA 3H30A 2EXEA 3KVWA 4USDA 4LFIA 5LWNA 2RKUA 3HMPA 1PXPA 3UJGA 5K4JA 2Z2WA 4NCTC 3W2RA 4RIXB 3SXRA 4HW7A 4XV3A 5HBEA 4UMUA 2J9MA 2OIDA 3KXGA 4HVSA 4U45A 2PMOX 1TKIA 4DH7A 1M2RA 3C5IA 1U59A 1H4LA 4RJ8A 2OICA 4FNZA 4JR7A 1CKPA 5EM5A 5HI2A 5KZIA 1ND4A 4O0XA 4W8EA 4A9UA 4R5YA 3RMFA 3UP2A 4D28A 4HYHA 1FQ1B 4BL1A 4BDCA 5AJQA 3BYVA 3DBCA 4I94A 3ZO2A 4XG8A 4HPTE 4F9AA 2ZV9A 4JAJA 5EHLA 3AD6A 4RJ5A 4LGHA 4QMZA 5G1XA 4U80A 4IM0A 4YLJA 5CEQA 1GY3A 5CEKA 4O6LA 5HTCA 4DLJA 3MB6A 3KF7A 4TW9A 3ZBFA 2OLCA 1PXOA 2F7ZE 5DRBA 1LR4A 3UBDA 4Q9ZA 4OT5A 5C4LA 3VS3A 4LYNA 5TF9A 5IA2A 5AAGA 3HYHA 4YSJA 5FTOA 1GAGA 4L3PA 4FZ6A 3VUMA 2BZHB 5M55A 5HEZA 5HU9A 3NW6A 4BCPA 4RX7A 1PRYA 4FTCA 3VUDA 4KUJA 1UU3A 4BYIA 4O22A 1UU7A 1S9IA 2PVHA 2VX0A 1Y6BA 3E5AA 5D10A 5C01A 3S3IA 4JIAA 2C69A 2B9HA 5JH6A 1OL1A 4L53A 4FI1A 4FEWA 3O2MA 2X0GA 4HYIA 3EYHA 4JS8A 5ANEA 4QTDA 4EK5A 4ASEA 5IQGA 5CQUA 2QO7A 5J5SA 1B39A 4MF0A 4FZDB 2GQRA 5FEEA 1Y57A 2BDWA 3OTUA 4BDGA 1UWJA 3QYWA 3T9IA 4K9YA 3SXFA 5ANGA 1YXSA 4BBMA 5J1WA 3FXXA 3NRMA 2I0VA 4IAFA 1IASA 1Q8ZA 1XWSA 1YWVA 3PXQA 3QRIA 4J97A 5HKMA 4FYOA 3VS2A 5HE0A 4FNWA 4WNMA 4L67A 3ENMA 2RG6A 3PJCA 3TUDA 3A7FA 3RAWA 4AGUA 4ANSA 4IZYA 3UPXA 3OBJA 2R2PA 1Q4LA 5JEBA 4CZUA 1SZMA 4GS6A 3E64A 4W8DA 1ZY5A 3BHYA 4C0TA 4LG4A 1U46A 3E8DA 2FSTX 4JXFA 3ZFXA 4MEDA 3VN9A 4GKIA 4I5MA 2XIRA 5CWZA 4FZAB 2BZJA 3D4QA 4ZS0A 1APME 3R1SA 2UZLA 4XS2A 3PJ8A 4CV9A 3VF8A 4DG2E 2ZM3A 3KVXA 3BELA 1PY5A 4F7LA 1P4OA 4LGGA 3RPRA 5KKRB 1YXVA 2BRHA 1GIHA 2C6OA 5HLPA 4H39A 4IQ6A 4YNEA 5GZAA 4X3JA 3U87A 5CZIA 4LUEA 3TI1A 1STCE 5LVLA 3KN5A 4GU6A 2REIA 4YU2A 4P5ZA 2XRWA 3A7JA 3R1QA 5EK7A 3UNJA 2I7QA 2Y6MA 2ZMDA 4LRKA 4B9DA 3R6XA 2XJ2A 2QNJA 2YHVA 3D5WA 3GC0A 3NW7A 3QALE 4GG7A 4WNKA 5DG5A 1ZMWA 5DVRA 3DXPA 3RWPA 5JFWA 4U79A 4UBAA 4PNIA 2CGUA 4FIIA 3FMMA 3P5KA 3QTZA 5D11A 4L45A 5C27A 3MFTA 3A7IA 1DAWA 4FA2A 3QYZA 5F9EA 3T8OA 2IG7A 5D1JA 3SD0A 1XHAA 3NUXA 3RHKA 4DG0E 4CFMA 4O0UA 5CI7A 1H1WA 3FPMA 5EHYA 5HD7A 4DITA 4M0YA 3BKBA 4G3FA 3QUPA 1W7HA 2I0HA 4RRVA 1REJA 5CLPA 3LXLA 1E1VA 3SKCA 5IA1A 4YTHA 1WBPA 2ZV7A 2ETKA 5FXSA 3T3VA 3WE4A 4N0SA 3E8NA 4C4EA 1XBCA 5AUVA 5LCJA 2B1PA 5AP7A 4BCQA 5DR2A 3KULA 3ZU7A 4DGMA 3NNUA 1VEBA 2YACA 5KMIA 4RWLA 4KKEA 4XLVA 4NFMA 3MS9A 3GU7A 1PMEA 2UW0A 3G5DA 3SX9A 5IEVA 2VN9A 2R7BA 5H8EA 5L8JA 3LFQA 3U6JA 4MXXA 3PIYA 3F7WA 4YJPA 1IRKA 5DT4A 3VF9A 3C1XA 3IS5A 3KULB 4FUYA 1W82A 4LUDA 4ENXA 5DR6A 5AP6A 4EH9A 4QQJA 5CSHA 4QTBA 4AE9A 2C6TA 4BTFA 2XM9A 4TWPA 3WIGA 5A46A 4NYEA 3ZLXA 4MQ2A 4R7IA 3VUIA 5JKGA 1YXTA 4BIBA 4TKSA 3HRBA 3TKHA 1U54A 2YWPA 4EBVA 3RGFA 2HW6A 3BLQA 4D1ZA 2QLUA 3NVKI 3BGZA 3MWUA 3KRXA 2QQ7A 4OTRA 5G6VA 2IVVA 3QWKA 5HD4A 4W9WA 1XR1A 3A99A 3OXIA 4L7FA 4Y5HA 5GNKA 5IKWA 5IA5A 2RFEA 4AA0A 2HYYA 3D2IA 3HAVA 4H05A 1TQPA 5E8UA 2X6EA 4F70A 2FYSA 4J99A 3MFUA 1U54B 4M14A 4NCTA 3WZEA 4KSQA 3ZC5A 3IW6A 5BUJA 5M53A 5IQDA 1HCLA 2BFXA 3HV5A 3G9NA 3KKVA 1OKYA 2Z7QA 3P1AA 2YM8A 4IJ9A 3TKIA 4E20A 4EOIA 5T3QA 1UKHA 3ORNA 4HGLA 4IWDA 4Y85A 4JT3A 4BC6A 2ZM1A 1P5EA 4AGWA 5I3RA 3WZKA 4QMTA 4C8BA 2GHLA 4ZTQA 2XMYA 5FLFA 2Y7JA 3V5WA 1NXKA 4Z3VA 1QPCA 3R9NA 1OPKA 5CY3A 3O8UA 4BZNA 3PVBA 4O7WA 5CXZA 4IVAA 4JBVA 3HUBA 4LMNA 4MD7E 1MRYA 3RPOA 4AZSA 1H25A 3QWJA 4ZK5A 4BKZA 1QPEA 1E9HA 4IZ5A 2HZIA 5HESA 2UZWE 3W55A 4XOYA 4RX9A 3RI1A 4QQ5A 3I0QA 4JBQA 4UZHA 5HG5A 5A4TA 3LFNA 5AP1A 5E1EA 3RCDA 3MJ2A 1Y91A 3WF7A 4U9AA 3HLLA 4G17A 4MNFA 4QP4A 3LQ5A 4RVLA 4BKJA 3EMGA 3U54A 4DH5A 4K1BA 4QMLA 2OF4A 3UODA 2JEDA 4EWQA 5DA3A 3PDTA 1V0PA 3G0EA 3P7BA 4DBXA 4PDYA 3WBLA 1M7NA 4QP7A 4AOTA 5L8LA 4EOQA 2YDIA 3QAME 2VRXA 3EQBA 3MW1A 4P2KA 2R3FA 4O7YA 1OKVA 3GP0A 1R0PA 2CSNA 3GFWA 2JIUA 4IB5A 3BYOA 4QRCA 3PWYA 4AF3A 1Q8TA 4BDEA 2VTQA 4X0MA 2PU8A 5E8VA 3BEGA 4CTCA 5D12A 4HPUE 4YJSA 2G01A 4FSNA 3OOMA 4TRLA 3KXNA 3KL8A 4PL4A 5CAPA 3VBVA 4C58A 4F9BA 2CNUA 3G6GA 4J7BA 2J90A 3DJ6A 4WIHA 5BVNA 4O0YA 5BUEA 5HU3A 1P2AA 3D94A 5KMMA 1FVVA 3VS4A 3QKLA 4I3ZA 4J98A 4P5QA 1OL2A 2FUMA 1CKIA 1W0XC 1NT2A 2CDZA 4TYGA 4IXPA 2J5EA 5J7BA 2BKKA 2H96A 4AN2A 2YISA 5FRIA 3D7ZA 3R21A 3QXOA 3U55A 5I3OA 3OT8A 4FV9A 3ULIA 1M52A 3DDPA 3LJ0A 4BRXA 4E4XA 3UYTA 3UO6A 4BDJA 2GS7A 4IADA 4ORKA 3FY2A 4GJ3A 2JBPA 5KMOA 4BCOA 3R30A 3TNWA 4UXQA 5IISA 1WCCA 1W8CA 3RKBA 3VS1A 2WTCA 4OLIA 2VTAA 3DBQA 3MVMA 4UWCA 3FSFA 4AOJA 5AR7A 2PVLA 2J7TA 2QHMA 3DAKA 4GK3A 4PUZA 4QP6A 3QRJA 3PXKA 4H3QA 3ELJA 3I60A 3UC3A 4AA5A 3JVRA 5CAUA 4Y5QA 4ZY6A 5CAVA 5KMJA 4GYGA 4GSBA 5CZHA 3M42A 4D5KA 1CSNA 1KE5A 3FZOA 4KKHA 4QPAA 5JQ5A 3RZBA 4FIFA 4XG7A 2V55A 2YITA 3WILA 3UOLA 4UYNA 3PUPA 3V01A 2RFDA 1YHWA 3NCGA 4MF1A 5KCVA 4RSSA 5EOBA 3VS6A 5B7VA 5E8YA 3TV7A 3W8LA 3ZXZA 5A4EA 5EOLA 3LFFA 1HOWA 1DAYA 3DB8A 3GU4A 4NH1A 4FTLA 5JFSA 4I5PA 5EQEA 5HG9A 5K0KA 2C3JA 4UALA 2CKQA 3C4WA 3W2OA 3DFCB 4CFVA 1QCFA 5JSMA 2ZAZA 3MY1A 2C5VA 3LKMA 4XLIA 5CVGA 5KHWA 3V5JA 3GU5A 4YLKA 3GUBA 1ZOGA 1OBGA 4FKJA 4APCA 5J9LA 2CCIA 3PG3A 4C4FA 2QKRA 1YRPA 2RL5A 3BPRA 3KU2A 4QMSA 3EQCA 3GU6A 5DIAA 4EI4A 5IQBA 3WF6A 5EI2A 3MIYA 5HVKA 4FNYA 3MA6A 3LFBA 4BGGA 3NUPA 4C34A 5KO1A 5CT7A 1ZWSA 3Q2JA 5AUUA 3CJGA 4NFNA 5E8TA 3OT3A 3PP0A 3QQLA 2J4ZA 2H9VA 3GC8A 4J95A 3WF8A 5AV3A 3VRZA 2R3PA 2F49A 3GCSA 2BHEA 3OWKA 4DG3E 3CGOA 4O7TA 2W1DA 5HVJA 5L3AA 4U0IA 4ACCA 1OL7A 1YWNA 3LAUA 4OTQA 5CX9A 4AP7A 3EKNA 4MYGA 4WG3A 4YGAA 4JX7A 1DM2A 4FZFB 3D7TA 4PDPA 3ZM4A 3KREA 2V7AA 1XO2B 3ORXA 3UQFA 4FSMA 3LLAA 4FUXA 4R5SA 2XP2A 3ZSHA 4KBAA 4FV3A 2XEZA 3RM7A 4X2NA 3SA0A 3ZO1A 3EQIA 5JT2A 5T68A 3WZDA 4O0RA 3OCBA 3Q6UA 4YBJA 3ROCA 1ZYDA 4FT5A 2CPKE 2VX1A 2JFLA 2R5TA 4KWPA 5AIRA 3D7TB 4O27B 2C3KA 3UTOA 4D2RA 4E8AA 5C03A 2IZTA 4AFEA 3EFKA 4JOAA 4XHKB 5T6KA 2WELA 3OEFX 1PYEA 1YDSE 4X2GA 2B9JA 2GNJA 4FEQA 5CXHA 3F69A 4GW8A 4I6BA 1SNUA 1YXXA 4PF4A 3SQQA 1YHSA 2PZYA 3VUGA 2QLQA 5L2TA 5B2LA 2VTNA 3KGAA 2X8EA 2BTSA 1GZ8A 2GTMA 2VTIA 4GU9A 4CG8A 2ITYA 4KRCA 1NVRA 4IB1A 4S32A 4E5AX 4HCTA 4IZAA 4F6SA 5IUHA 3JS2A 3HV3A 4PQNA 4U3ZA 3QKMA 4CG9A 4O91A 3MN3A 3A8WA 4R7BA 4AA4A 2BVAA 3BBWA 2IVUA 4X6QC 4V04A 4YZ9A 4HVHA 2YERA 3E93A 4JBPA 4BN1A 4DTKA 3F3VA 4F6WA 1YI4A 3MPAA 1PHKA 2YZLA 4FKWA 4CQEA 3FHRA 2PTKA 3BI6A 4F6UA 1YI3A 4C35A 4ANMA 3EQDA 2CLQA 3V51A 5EI6A 4AWIA 1JKLA 1X8BA 4G1WA 4BBFA 2QR7A 4BWKA 3ATSA 5AR4A 3EKKA 5KX8A 4QMOA 4XRLA 4IB3A 5ANOA 3Q4CA 3BE2A 4KA3A 3G15A 4ZOGA 5M08A 3F61A 2YCRA 5M56A 4R3CA 1ZOEA 3RHXA 3TKUA 5BMSA 2GU8A 2R3QA 2J0JA 4GL9A 3ZZEA 1R0EA 3C4FA 3W18A 3O71A 5AR8A 3QGYA 5CF8A 4G3GA 3LCKA 4PL3A 2X9FA 2XK7A 2YJRA 3HV4A 4B8LA 3SXSA 4BIDA 3DTWA 4NIFA 4EOSA 2QI8A 1OUKA 3FQSA 2ZV8A 3PE2A 2CKOA 2ITPA 4I6QA 2PK9A 1JBPE 3VW8A 2XF0A 2XJ0A 4ACDA 3H0ZA 2EVAA 2X9EA 3FE3A 4AGDA 4FIHA 2E9NA 4V05A 4BGHA 1GZNA 3VVHA 5DNRA 4EHEA 2VWWA 2CKEA 2A27A 2XA4A 4NIFB 4WHZA 2JBOA 3FHIA 2VO7A 2BDFA 2VWVA 2IVTA 2WQEA 1OZ1A 3P0MA 3V8SA 3R1YA 4U5JA 3ODYX 5EW9A 5EFQA 1SMHA 2BAKA 4LM5A 3BYMA 4FMQA 3P7CA 5HBHA 1MP8A 3A7HA 5EYDA 3DDQA 1O6KA 4O0WA 3B8QA 2F7EE 3D2KA 1H01A 3R7GA 5AUXA 5AR2A 3AXWA 3QD0A 3C4XA 5LVMA 3R8VA 4MKCA 5F95A 4E1ZA 2OJIA 2WO6A 3D5UA 3V5PA 3VS0A 1DS5A 1YI6A 3OZ6A 4AOIA 2XYUA 3FLYA 5L2SA 2ITVA 3SW4A 1OIYA 3MPTA 5AR5A 2YIRA 3PLAE 2UW9A 2XIZA 5AWMA 4HZSA 3L1SA 3LM5A 4FV0A 2R0UA 4PRJA 4UMPA 4I21A 3LFDA 2JD5A 5BYZA 4FE2A 1P4FA 3CC6A 3LVPA 5AAFA 3P86A 4EUTA 2UW7A 3I79A 3GCPA 4PL5A 3DTCA 4FIGA 3IOKA 3VULA 4DE4A 4YZCA 2ZMCA 4C4GA 4V0GA 5CENA 3ZSGA 3ZEWA 4BCIA 4EK4A 3PFQA 4EUUA 2W99B 5EW8A 4A9TA 5EKOA 1DI9A 3FMHA 3QZFA 3UO5A 3HA8A 3FMEA 4KB8A 5BVOA 1JOWB 2X8DA 4B99A 3L8SA 4RX8A 2ETRA 4V0GB 3CD3A 3LXNA 4ZMEA 3MGYA 4MH7A 3MB7A 3VUTA 3QA0A 5BYYA 1LP4A 3BGPA 3OG7A 3R8UA 3DPKA 3TG1A 5IH5A 3KFAA 4LQMA 5BQ0A 4XH6A 2PVFA 4UB7A 4IX6A 3EQPA 3POOA 3OUNB 2ZV2A 3SGCA 3CTQA 4O82A 3G9LX 1RW8A 4TYJA 5FM3A 2WGJA 3NIEA 3EB0A 1NVQA 2IW6A 5EQYA 5IUGA 1H00A 5FBNC 1Q41A 3OROA 2X81A 5IH6A 4ZS4A 1KE8A 2I0EA 4EH8A 4EQCA 2FA2A 1KOBA 5CSXA 2VX3A 3V8TA 4YHFA 4FK3A 4N57A 3QZIA 5FP6A 4BI2A 3GQIA 4DH8A 4ZTMA 2WTDA 4OTWA 4MBIA 4FSYA 3ZFYA 4BWPA 5L8KA 2Q83A 3L8PA 3TDVA 4BICA 1YDTE 2X2KA 4RZWA 5EYKA 4BDHA 5CEPA 1FPUA 3GNIB 3IK3A 2JITA 4M15A 2W7XA 2QOLA 3QQJA 2W17A 4F99A 1TVOA 3DAJA 2PSQA 4A07A 2CHLA 3Q9XA 5ACBC 3KCKA 3Q96A 4YZBA 4FTOA 4C02A 2X1NA 4DGGA 5CAOA 4DF3A 4AZWA 1UU8A 3EN4A 2AUHA 2SRCA 4ANOA 2QU6A 4QPSA 4FICA 2E9VA 3DNEA 1IEPA 3HDNA 4BZDA 3EQHA 5JGBA 1M2PA 2XB7A 2XYNA 3R01A 2JDTA 2PE1A 3NUUA 3F2AA 3PA3A 2F9GA 4IWOA 5CSWA 4M67A 3MV5A 3V3VA 2LGCA 4Z16A 1BI8A 2OXDA 3HDMA 3Q5IA 5CSVA 3QC4A 3L9MA 4AG8A 4X7QA 4E6CA 2O5KA 3LCDA 3LZBA 4RIXA 1REKA 3UMWA 2OJGA 4LRJA 4WNOA 3R7VA 3II5A 4CTBA 5FUTA 4ZZMA 1FMOE 2GTNA 3E88A 2OW3A 3L9PA 4WG5A 3R83A 2G9XA 5A54A 4ZZNA 4DGNA 3RK9A 5IMXA 4NU1A 5E92A 4XUFA 4IC8A 1H07A 4IIRA 4R3RA 3LE6A 3OOGA 4CQGA 3TV6A 3F5GA 4IM3A 2UW3A 3TCPA 4FKSA 2UZBA 4JDJA 5HX8A 4ZJVA 4PPCA 4DFZE 2YDJA 4BCHA 5E91A 3AC8A 3R9RA 1V0BA 2JKMA 3UIUA 2XCHA 4KIKB 4BDBA 4D4VA 2PMLX 3FC2A 4E4NA 3CP9A 3QTIA 4GVAA 3DZQA 2OXYA 2ZM4A 5HIEA 4ASXA 4L01A 3BV3A 3UDBA 5K9IA 3NPCA 2YDKA 4EWHA 4JDIA 4JVGA 3IGGA 4KIOA 4Z7GA 3IW4A 5KHXA 3IDPA 1PXLA 3QTRA 5CEIA 4CLJA 3F2RA 2XNBA 2J0MB 3TZ9A 3VO3A 2DQ7X 3DJ7A 3ORMA 4JL9A 4YNOA 4ZTSA 3RAIA 3GFEA 2OZOA 3R7YA 2YZAA 3RCJA 4MD9E 2WQOA 4HCVA 4OGRA 5ANJA 4BTKA 2X4ZA 2ACXA 4G5PA 5HG8A 4KABA 4PNKA 4CKJA 4PMPA 2Y4IC 5A6NA 2GSFA 5FTGA 2BDJA 1B38A 2P4IA 3CEKA 3M2WA 3NWWA 3P78A 5AEPA 5BVWA 1PYXA 3GC7A 3NGAA 3QGWA 4FODA 4E4MA 4CKRA 3OCTA 4A7CA 3DK7A 3MH2A 4KIPA 4HOKA 4IDVA 4WRGA 3UIBA 1OL6A 2CKPA 4NKAA 2ONLC 3DLSA 3ATTA 3LOKA 2R3JA 5DRDA 3GB2A 2CN5A 5IG1A 4LV8A 4MXAA 4GK2A 4WUNA 1XBAA 3MVHA 3GQLA 2UW8A 5JZNA 4AW1A 1PXKA 2R3MA 4RVTA 4PMTA 1MRUA 1KE6A 4ZSLA 5AA8A 5CALA 1H27A 3Q4TA 4YBKA 2JDSA 4L6QA 3KRLA 3RWQA 4GH2A 2O8YA 3KRJA 2C5OA 5AM6A 4NWMA 3PJ3A 4DFBA 1Q5KA 2HZ4A 5J9YA 3RPSA 1YDRE 4L3LA 3GCVA 1PXMA 3OP5A 4AACA 1O6YA 4ZJJA 4E93A 3EHAA 1PMUA 2HZ0A 3R9DA 3JYAA 4BGQA 2C4GA 2V0DA 5D41A 1UKIA 4FVQA 2Y6OA 2WQBA 3AT3A 4B8MA 5EI8A 2NPQA 1PF8A 4XG3A 1U4DA 2X2MA 3T9TA 4FSWA 5TE0A 4K2RA 1BUHA 4FC0A 5AP4A 3S4QA 5LVNA 1H1QA 4JRNA 2C6EA 2WMUA 3L9LA 2J2IB 5M09A 1URCA 4OUCA 2VWBA 1OGUA 1PMNA 2XK6A 1JLUE 3UO4A 1BL6A 3VBYA 1RE8A 3TACA 2OXXA 1J3HA 2WTJA 3QQKA 2WKMA 4JJRA 4M97A 5AUYA 3QHRA 3DLZA 3NZ0A 4HVIA 1JKSA 3QD4A 2R3NA 3O23A 3F5PA 3F3UA 4IAZA 4RBLA 2IZUA 3UE4A 4C36A 4C4IA 4PV0A 3A62A 3W10A 3R63A 2RFNA 4FTKA 1JSUA 4NTSA 3BQRA 3TEIA 3UNKA 4OTHA 4O7LA 4C4HA 4J1RA 5CF6A 2VWYA 1R1WA 3GT8A 4HJOA 4JI9A 3POZA 1NA7A 1H28A 1WBWA 4BHZA 2XS0A 4XV1A 3VW6A 3O50A 4FT0A 2RF9A 2HWPA 5IDPA 3FBVA 4UV0A 4FZ7A 4F1MA 4APPA 3VRYA 3COKA 3FZ1A 3LXPA 1Z5MA 4QMQA 2OH4A 3I5ZA 3ORPA 4IAAA 3LJ1A 4L3JA 5I9UA 3T3UA 4D1SA 4AW5A 3WIKA 3CCNA 2WFYA 4M13A 4EH6A 1GIIA 4GRBA 3TNHA 4BF2A 4G16A 4I23A 2UUEA 4F7NA 3NYXA 4WT6A 4G3CA 2JKOA 2RFSA 2UW4A 3R0TA 3BZ3A 2OK1A 5ETIA 5DEYA 2H8HA 3E63A 3UP7A 5CU2A 3QTXA 4YO4A 4NSTA 4DFNA 1SM2A 5CF4A 4FKLA 3NAXA 5FQDC 4RVMA 4PPBA 4DEGA 5I9ZA 4CSVA 3UYSA 4F64A 3MESA 2BIYA 2OSCA 4QYYA 3HP5A 1IR3A 4JAIA 4JG7A 3OWJA 5CVFA 3ZYAA 2UV2A 1KE7A 2VTSA 2XH5A 5BMMA 1JPAA 4G31A 3CE3A 4I20A 4ALVA 4ANQA 3FI2A 3AD4A 1G5SA 1H0WA 2YM7A 2CN8A 4FTMA 4FSTA 3AC2A 5C8NA 4L52A 3Q9ZA 2O65A 3ORIA 2EXCX 4I0SA 4QTAA 4C3FA 3CQWA 3HP2A 3HEGA 4WA9A 1Q8YA 2P0CA 3K5UA 4BTJA 3HX4A 1H8FA 2JIVA 3N4UA 2IZSA 5BVEA 5IU2A 5A3XA 5LWMA 5DLSA 3PZEA 2WMTA 1WVXA 4MWIA 1R39A 4UMTA 2ITOA 3R1NA 4RWIA 2GQGA 2C6DA 2W5HA 3UVRA 1P14A 4FKPA 3FY0A 2QOOA 4QMWA 3BHHA 1H24A 3FPQA 4HGTA 3Q4ZA 4E26A 1S9JA 1Q24A 1AD5A 5A4LA 2C6MA 3IECA 4CT1A 2BRGA 2R64A 4O7NA 4XG2A 4YPSA 2GS6A 5D7VA 2QOKA 4BYJA 4I1ZA 2I6LA 3P4KA 4CFFA 1H26A 3ENHA 3OD6X 4F63A 2Y4PA 5CEOA 2WTWA 2PULA 4HYSA 3MPMA 2Z8CA 5FWKK 2CLXA 3FLSA 3MJ1A 4EORA 4D9TA 3A60A 5KE0A 3EFWA 4H1JA 3IW5A 4CMUA 3F7ZA 4DFUA 4FSZA 4QMUA 5A4QA 3LFSA 3QRTA 4JLCA 3EQFA 2BROA 2F2UA 2C0TA 4FKVA 4FT7A 4U7ZA 3VWAA 3AGMA 4XV2A 3R04A 5DEWA 1CMKE 4G9RA 3OY3A 5FDXA 4AAAA 3LW0A 2YA9A 3VBXA 5EDRA 4G6OA 4E7WA 5ICPA 4CT2A 2UZUE 3R73A 5AFVA 5JGAA 4QT1A 5HORA 3DK6A 5IQCA 4Y46A 3JVSA 2GNIA 4L8MA 4CLIA 3FV8A 1XQZA 2ERKA 3AMAA 3VS5A 4IAKA 3EJ1A 4XP3A 3TUBA 1L8TA 5L6PA 1ZYLA 2ITWA 5FDPA 5E9EA 4CFXA 3AC3A 2FSMX 1Q3WA 1T45A 3TL8A 3HAMA 3ANQA 3KF4A 5EW3A 5F94A 5GIOE 3ALNA 5BVFA 2YM4A 1IG1A 1BKXA 4M66A 2V7OA 4GFOA 1F3MC 1W98A 2G2IA 4CMOA 5GZ8A 2ONLA 2P55A 2KULA 1VZOA 4LOQA 2B4SB 3Q2MA 3KRWA 4PY1A 2XNGA 5IQEA 3IDBA 2Y4IB 3RP9A 3RJCA 3C50A 2J6MA 3FAAA 4W9XA 4DINA 4RIWA 4FV6A 3UIXA 3VS7A 2VWIA 4U6RA 2W5AA 4Y83A 2ZJWA 1OVEA 2OKRA 3ZXTA 1YXUA 2BFYA 5HNBA 4TPTA 4EZ7A 3U4WA 3H10A 3OBGA 4JG8A 4QMYA 4WD5A 5CTPA 5IA0A 3VHKA 3FL4A 2XKFA 4E6QA 1XJDA 1UU9A 4N6ZA 4EJNA 1M2QA 4U3YA 2W1EA 3FMJA 4V01A 3ZH8A 3PA4A 4RIWB 3C4CA 4UWYA 4QO9A 3LHJA 4ZP5A 2XK9A 2B9IA 3NYOA 1KSWA 2QOQA 2C30A 3GCQA 2GFSA 2QC6A 4NJ3A 4FL2A 2W4OA 4K0YA 4XMOA 4AFJA 4EJ7A 4KINA 3H9FA 3TM0A 3R7UA 2WMVA 4FNXA 5HHWA 4ZJIA 2BCJA 3W2QA 4IEBA 5HCZA 5IQHA 3AT2A 5L2IA 5LMBA 3WE8A 4TXCA 4O2ZA 4UX9A 3EZRA 2WU6A 5ANDA 4I4FA 4EHZA 3W1FA 2HY81 4TTHB 2OJFE 4A06A 2VTHA 3Q60A 2YM6A 4CFUA 3WF5A 4O7ZA 2VO3A 2HENA 3UGCA 2BAJA 2E9UA 4FT9A 3TIYA 2H34A 4FOCA 4G6NA 3GVUA 2BZIB 4E5WA 3P08A 4O0TA 3QZHA 2XCKA 3W33A 3ZUVA 5CANA 1O6LA 2BAQA 1UWHA 3AT4A 4KAOA 2FSOX 2PE0A 2GMXA 3KXXA 4XG6A 1YW2A 2WHBA 1WVYA 4TWOA 4BWXA 5LVPA 3D15A 4NEUA 4DBNA 2YABA 1UA2A 5HIBA 4RWJA 3WOWA 3OW3A 1L3RE 2Y0AA 5M44A 3VBQA 4YPDA 5J5TA 4NL0A 4ITIA 3P79A 3NUSA 2PZIA 5BPYA 2WMBA 2X39A 5FEQA 3DT1A 3QCXA 2Y8OA 1CKJA 4ITJA 3KC3A 5HOAA 3MY0A 4D1XA 2P2IA 4F08A 5DT3A 4BDKA 4CV8A 4L42A 3DV3A 4O1OA 4EHGA 5BNJA 5GINE 4II5A 1J7UA 5M57A 3MTLA 4FF8A 4S31A 3PTGA 4XOZA 1XBBA 3A2CA 3O96A 2QURA 4FKIA 4X2FA 4YJQA 2OJ9A 2PMIA 2W1IA 5ETCA 4EOLA 2FO0A 3R9OA 1I44A 3DFAA 2CGWA 3CD8A 3TUCA 4GKHA 1JKKA 2C5XA 2VV9A 4BCMA 3TN8A 2XIKA 1ATPE 5AIKA 3E3BX 3IQ7A 2J51A 3ACJA 3FWQA 3LCOA 3NUYA 2I1MA 3OCGA 4K18A 2JAMA 2PZRA 1K2PA 3CIKA 3CPBA 3JPVA 3MVJA 3VBWA 5CU6A 1CTPE 4L9IA 1OPJA 4RZVA 5IUIA 2W96B 4M0ZA 1YOLA 3PY3A 3PA5A 4H3PA 3EH9A 4FG7A 2UW5A 4MD8E 4FKGA 3F3TA 4UMQA 4RX5A 1QL6A 3BBTB 2YCQA 3I5NA 2JDOA 2QOBA 3UVQA 5M06A 4L46A 4EKKA 5HNGA 2BMCA 5GJDA 2UZNA 4D2WA 3E8CA 3ZBXA 2ERZE 3UIMA 4O86A 3ZDUA 3KK8A 5AM7A 1OMWA 2R3KA 3MA3A 4ANLA 3BWJA 4DT9A 3F2NA 4GFGA 5H9BA 3HMIA 3WF9A 2WD1A 4BIEA 2W05A 2WPAA 1UNHA 2VTPA 4I92A 4K6ZA 4QQCA 5JMSA 5K5NA 3FKLA 5DYJA 2WIHA 4DFXE 3BU5A 2HAKA 3HRCA 5TOZA 5C1QB 2OO8X 3CGFA 4AT3A 1H1PA 3GU8A 1LPUA 2WMWA 4D5HA 3JY0A 2R4BA 1H0VA 2FH9A
chains in the Genus database with same CATH superfamily
2VWZA 3SW7A 2XAMA 3L8XA 2YAKA 5CNOA 5IPJA 4FTRA 3Q32A 4MXZA 4YTFA 3UQCA 5HX6A 3U6HA 2Z02A 4RFZA 3FLQA 3TZ8A 4BCFA 5DOSA 4I0RA 5EM6A 3TJCA 3KK9A 3CLYA 2W0JA 3FZSA 4L43A 4OTGA 4DHJA 1OIRA 3WZUA 4EYMA 4DEDA 4UWBA 3F9NA 3OMVA 3MH3A 4IX3A 1Q97A 3LPBA 4XV9A 2PYWA 3NAYA 2X7FA 4EOJA 4K77A 3RM6A 1KE9A 4ZIMA 4C4JA 3G90X 4IBMA 3ACKA 1UVRA 3U9NA 3RTPA 4H36A 5HO7A 4U42A 2X6DA 3FI8A 4O6EA 4YR8A 5AP2A 4CZTA 3ZHPC 4R3PA 2R3OA 5HNIX 3A4PA 3P5JC 5EG3A 3FZPA 5JQ8A 3A4OX 2ZB0A 4EOMA 3F3ZA 2WQNA 1ZMVA 2PUUA 2QOCA 3KXMA 3NNWA 4P4CA 4CCBA 3KXZA 2B9FA 2GHMA 4PPAA 5I0BA 4O81A 3K3IA 2YWVA 4O4BB 4C2WA 3DNDA 2C6KA 3DBDA 4Q2AA 4W4XA 1Y8GA 4I4EA 4J8NA 3UMXA 2PUIA 2VO6A 3I6WA 2YCFA 2XAOA 4USFA 1JSTA 3DKFA 3JY9A 2OU7A 5H8BA 5CT0A 4E5BA 4GUBA 2BRNA 3HA6A 2XM8A 4IX5A 3HMOA 3IW7A 5AX9A 2B0QA 4LRMA 2IPXA 2BHHA 2YM5A 4RIYB 5HIDA 3HNGA 4ZLOA 3PIXA 3BLHA 3BE9A 2JC6A 4MBLA 5A6OA 5DGZA 4I24A 5AP3A 5AV2A 3MIAA 3RINA 3DJ5A 3HUCA 4ITHA 3S95A 4UYAA 2G15A 4DYMA 4F9CA 4B7TA 5LMKC 4BDDA 4TT7A 3OVVA 4F9YA 3FUPA 2C0IA 1OKWA 1A48A 4XBUA 3BYSA 2P3GX 2PVYA 3LFCA 3NCZA 4MNEA 4IE9A 4O4CA 3ZS5A 3OXZA 4XP2A 5AA9A 2VO0A 3I1AA 4J96A 4U8ZA 3LXKA 5C8KA 4BVUA 3QUDA 4NUSA 5IH4A 5EM7A 3SDJA 2R3IA 3FMKA 4OAUC 2XKEA 3CS9A 4BCJA 3QQGA 4FYNA 4ID7A 3BIZA 5L2QA 4AUAA 3A8XA 2VUWA 3PPJA 3ZONA 4F7JA 4C2VA 3HZTA 5E8ZA 4CNHA 3LFAA 4MNEB 4RMZA 1VYZA 3R8LA 2O2UA 3R2YA 4AX8A 2R7IA 3KA0A 3BLAA 3UG1A 1LEWA 2A0CX 3B8RA 3PVGA 4A4XA 4EONA 1VJYA 4RA4A 4UZDA 5I9YA 2YLFA 4E3CA 2X0PA 3QF9A 4G34A 4FKQA 5KMKA 4LL5A 4PX6A 4ZSJA 3GOPA 2HXLA 4I5CA 4H3BA 4AZEA 3JR1A 2W4KA 3H9RA 4F65A 5BUIA 2WMAA 2EXMA 3EWHA 4I0TA 4W4VA 3Q6WA 5DI1A 2XNOA 4XG4A 5DN3A 1AQ1A 1Y8YA 4FK6A 1QPJA 3DQWA 1R78A 5HCXA 3D0EA 4D2PA 4WKQA 3UZPA 4HYUA 5CEMA 4OTFA 2VD5A 3LM0A 2W9ZB 2HK5A 5D9HA 1UNGA 5M4UA 2A4LA 3NUNA 3U8WA 3V5LA 4BI1A 4QYEA 2J5FA 2OFUA 1WBVA 2OI4X 2QO2A 4WBBB 4B4LA 3BHTA 4S2ZA 4AZFA 4CVAA 1FGKA 3G33A 1FVTA 3HMNA 4RC4A 2QONA 4EOPA 2AC3A 2WXVA 4HNFA 3THBA 5K3YA 3CSVA 3TWJA 1Q8WA 2G2FA 3QUEA 3UVPA 4R1YA 3VQHA 3FZTA 5CS6A 2F4JA 3RPYA 4YUQA 2PZ5A 1IAJA 3DKGA 3K3JA 2XJ1A 2OWBA 3M11A 4O2PA 3SV0A 5IMEA 3H9OA 3KXHA 5GIPE 4KBCA 3F88A 2VNWA 2VWUA 5TKDA 4YC8A 2GHGA 4FBXA 3PXFA 4YTCA 2EUFB 3FDNA 4DFYA 3BQCA 4YHTA 2J50A 3L9NA 4M84A 2W1HA 3TXOA 4LOOA 3W32A 4QTEA 2FVDA 2WMQA 3E7VA 4FKUA 3JUHA 4C37A 2WTKC 3W0OA 3O8TA 2RGPA 4JQ8A 5I9XA 3CTHA 3TV4A 2GQSA 4OTIA 3SHEA 3KRRA 2C47A 3W8QA 4AU8A 3FI3A 4OAVB 3O5AA 3PLSA 5HTBA 2VZ6A 4QYGA 3UPZA 5IQFA 4GK4A 4JG6A 4F4PA 1OB3A 2CNVA 2ITZA 3C0GA 3D9VA 4XBRA 2YIYA 3H0YA 4GT3A 4FTQA 3FL5A 4TY1A 1RQQA 2Z7LA 3FXZA 4FTJA 4UY9A 3EL8A 4YZNA 2BKZA 4JDKA 4N70A 4B0GA 1KWPA 1UNLA 3ET7A 1AGWA 1WBNA 4OBPA 4EK6A 4ZZOA 4TWNA 1FGIA 4FIJA 3FLZA 3OCSA 5LQFA 4TYHA 2GNLA 2WB8A 3FZRA 4D9UA 2YLEA 4IVDA 2E9OA 3S1HA 3COHA 1H1SA 3TNIA 4ZLYA 1Q61A 5J9ZA 4CKIA 3Q04A 2HCKA 4QMVA 3ZLWA 2C1BA 3DAEA 3WARA 1BLXA 5EYCA 5LMAA 4U40A 3D14A 3UG2A 5K5XA 4Z7HA 1TQIA 5BVDA 4XEYA 4AE6A 3PVUA 2UZDA 4TYHB 2P2HA 2XZSA 2PMNX 3UZRA 3ORZA 1J7IA 5C26A 4AXDA 1SVEA 4EEVA 4YMJA 5KMNA 2R9SA 4YP8A 1YOMA 3DXNA 3NYVA 3U6IA 2WQMA 2OG8A 2JDRA 2JGZA 4FV5A 1GOLA 4IACA 4C61A 1JQHA 3BRBA 2YFXA 2AYPA 4QOXA 3U51A 3R71A 4ANNA 2W06A 5JRSA 2VGOA 1K9AA 5EYMA 5I4NA 3BWFA 5M4FA 3PRIA 4IM2A 4ENYA 4FEXA 2OF2A 4L68A 2E9PA 4KIKA 4LMUA 4PMMA 5ETFA 3E62A 2R3HA 2OJJA 1JKTA 2PVRA 3EN9A 4IMYA 4EOOA 1OPLA 3VJNA 1W83A 3QTSA 2WU7A 5E4HA 4IANA 1V0OA 3B2WA 4C3RA 2PWLA 4EC9A 3S0OA 1XH8A 1CDKA 2QHNA 5JZJA 1PKDA 1WMKA 1WBSA 4CXAA 1I09A 3PSCA 3BL9A 3UNZA 3OFMA 4DEBA 4Q5HA 4EHVA 3PUFC 4E4LA 4J53A 4QP2A 4NM0A 1JWHA 1Q99A 2JIIA 1GJOA 3LCSA 4S33A 3QZGA 2B53A 3ZUUA 4H58A 4C7TA 3MI9A 5M07A 2QODA 3OTVA 2YCSA 4KIQA 4EH2A 5FP5A 4ZSEA 4M68A 5AAEA 4YC3A 3PIZA 2R0IA 3E8EA 1U5RA 2W9FB 1OITA 2LAVA 4ASZA 3EZVA 3GXLA 5HE3A 3O51A 5KZ0A 4DLIA 4HVDA 5KNJA 5LMKA 4RIOA 3F3WA 1KV2A 4BCNA 4EK8A 2G1TA 4IVBA 4IX4A 1GIJA 2ITNA 3CBLA 4M7IA 4ALWA 3W2SA 5I9VA 2XBJA 3A7GA 3WZJA 4FV8A 3CR0A 2Q0NA 4ZTRA 2JLDA 2QG7A 3PJ2A 2GNGA 1Y6AA 5HO8A 4NKSA 3R7IA 4EH7A 2A1AB 3B2TA 5HGIA 2OBJA 4AGCA 3NNVA 2BALA 4ZSAA 1J7LA 4M69A 4IWPA 4QMPA 5HLNA 3NIZA 3QKKA 3IG7A 3QHWA 5LJJA 3SAYA 1ZXEA 3CQEA 4CD0A 1NW1A 1O9UA 3DU8A 5F4NA 2ZVAA 2ZOQA 3ZEPA 5JFVA 4ZTNA 4IW0A 5B2KA 3FMLA 3ROYA 3RNYA 1PKGA 4RA5A 3QRKA 4RFYA 3W2CA 3ZRKA 4R6VA 4M69B 3FLWA 3QQUA 4RFMA 1BX6A 3UQGA 2W4JA 3DB6A 4FL3A 3CY2A 4WOVA 3ZZWA 4EZ3A 3LFEA 3FYJX 4U44A 3V6SA 3C9WA 3IKAA 3V5QA 3ZMMA 3M1SA 2HXQA 2P33A 3OW4A 1MRVA 4CZYB 3DZOA 4XP0A 1MQBA 4IAYA 4O7SA 2F2CB 4GV1A 4NM5A 4TN6A 1BYGA 2RSVA 3NUAA 3KQ7A 5EKNA 2ITXA 3FLNC 4YZMA 4PTGA 3R22A 3W16A 3ML1A 3FSKA 3EL7A 4ZXTA 3I6UA 5E8XA 4EH3A 4G5JA 4A9RA 4GMYA 5M51A 4EC8A 1ST4A 4AZVA 1SVHA 4GFMA 2B55A 2C68A 2OH0E 3ZO4A 1KV1A 4FT3A 4YLLA 2C5YA 4K11A 1JVPP 4M8TA 3VQUA 4YJTA 1ZOHA 4ZTHA 3G0FA 5HE1A 5L4QA 3HGKA 5DPVA 3QL8A 4YSMA 3GI3A 4KNBA 4FTAA 3NNXA 4LI5A 4RJ4A 4G3DA 4X21A 4ASDA 3ZO3A 3CJFA 4ACHA 4USEA 4FG9A 2B52A 3UOJA 4DT8A 4I93A 4FL1A 4U81A 4C3PA 4HCUA 4UEUA 3MVLA 4C33A 3ZM9A 3JXWA 3E3PA 2QU5A 2I40A 2XBAA 4Y95A 5A4CA 3NEWA 2WAJA 3PSDA 4KRDA 4O0VA 2QOFA 1SYKA 4FG8A 1OIUA 4NT4A 2VNYA 4JDHA 4RC2A 3QCQA 5HVYA 4BTMA 4YJVA 3W0QA 3PP1A 4NM7A 3C4EA 3LLTA 4NTTA 4QP9A 4AXAA 4F0GA 3P9JA 3QX4A 5FXRA 3NSZA 5E90A 5ETAA 4PTCA 4EYJA 2HY0A 3PXYA 5CYIA 2GFCA 2VTOA 2KTYA 2QOIA 3ERKA 5KUPA 5KMLA 2WTKB 4HVGA 3ORTA 1YVJA 1WVWA 3R8ZA 2IO6A 2WEIA 3KEXA 4C38A 3RBWA 2J0IA 2X4FA 3OY1A 4RWKA 5ANIA 1XKKA 3ZRLA 2HELA 5CI6A 4KD1A 1WZYA 4D2TA 3GOKA 4FIEA 4MTAA 5IDNA 2YIQA 1G3NA 4KKGA 2UZOA 4AW0A 5E8WA 2WTIA 5HBJA 5IA3A 4LL0A 5B0XA 2HWOA 1ZAOA 4PP7A 4DTAA 3ZCLA 4P90A 2GNFA 3QXPA 3QLGA 3UOHA 2GS2A 4CYJA 1OI9A 2W1GA 2X7GA 4YJRA 4R7HA 3VUKA 4EH4A 2C6IA 3I4BA 5AP0A 2JFMA 4PWNA 3Q4UA 5GHVA 4A9YA 4EL9A 1W84A 1XH9A 4BI0A 2XNNA 4CRSA 3ETAA 4FTUA 3DBEA 5GJFA 2Q0BA 5C8MA 3C0HA 3EN7A 1XH4A 3C13A 3TJDA 4D2SA 5HTIA 2YM3A 3KMUA 4FKTA 4WO5A 4K8AA 5IF1A 2NNWB 4O7RA 1W2FA 3RVGA 4IH8A 3I7BA 1HCKA 2B7AA 2PVNA 2UZEA 5EDQA 4LOPA 3FKOA 4OTPA 1Q8UA 4FGBA 4F1OA 3O0GA 4QPMA 5IQIA 4ACMA 2ETMA 5BYLA 2C3LA 4N6YA 3AMYA 4DGLC 4MBJA 2WMRA 3F82A 5CVHA 3R8PA 3R02A 4K33A 3W2PA 1OECA 3QTQA 4O4FA 4XRJA 2PVKA 3D83A 3NLBA 2YEXA 3R2BA 3Q9WA 4NM3A 3AKKA 4G6LA 4FVRA 5KBQA 4DA5A 2FGIA 4MVFA 4L44A 3RZFA 1ZYCA 2DS1A 3CY3A 3REPA 3MFRA 4IWQA 4O96A 2BRBA 3FMDA 4S30A 3UOKA 3N4TA 4HNIA 2JKQA 3QFVA 3LJ2A 1ZZ2A 3AGLA 2XRUA 3AC4A 4AZTA 5JGDA 3IOPA 2HW7A 2W1ZA 4GVJA 4AS0A 2VTLA 3OEZA 4J8MA 3V5TA 3V8WA 4AQCA 3FC1X 1WFCA 2V5QA 4DDGA 4RG0A 2BTRA 3G6HA 3Q53A 4DH1A 3PVWA 3COMA 3TT0A 3KY2A 1MQ4A 4ANBA 4AAYA 3ZTXA 4MK0A 4BY9E 2V22A 4WSQA 5E8SA 3ZRMA 5BX0A 1WBOA 4HGEA 1ZYJA 4CEGA 4IAIA 2BILB 1F0QA 2OZAA 5AR3A 4D4SA 4O4DA 1IAHA 3NYNA 3DKOA 4MXYA 2X8IA 3Q9YA 4X2KA 2BUJA 2O0UA 2FB8A 3PRFA 3QRUA 2RIOA 2GCDA 1PW2A 3EN5A 1Z9XA 3MBLA 4I6HA 4F09A 2VTRA 4RQKA 5E1SA 2OZAB 2VWXA 4UXLA 5L6WL 4D58A 5HZNA 4JBOA 5CQWA 4O83A 3OC1A 3QTUA 4EBWA 4M3QA 5DHJA 4FSQA 2IW9A 4AT4A 3BCEA 2YIXA 3V04A 5CASA 2A2AA 1YQJA 5K0XA 5BV3A 4QNYA 4FEVA 5DBXA 2W1FA 5LVOA 3TDWA 2XVDA 3E7OA 2IWIA 3DBFA 3G51A 4E6AA 3QLFA 3MY5A 5H2UA 4D2VA 4DC2A 4XYFA 4U43A 2J0KA 3SOCA 2I0YA 3EFJA 2Z7RA 3CQUA 4L00A 5CNNA 2VTJA 3GENA 3O7LD 1GZKA 5AUTA 1BMKA 2C1AA 5TO8A 1JAMA 3O7LB 2CCHA 5HG7A 1PXJA 1RDQE 4I5HA 4IFGA 2PUPA 2BZKB 4TWCA 2IW8A 4D0WA 2X2LA 4IHPA 4ZTLA 4A9SA 4DH3A 2A19B 3F5XA 3OUKA 3PG1A 1XMMA 3RAKA 1LEZA 2EWAA 3G2FA 2C0OA 3TTIA 4RLLA 5KBRA 5HE2A 3DQXA 2XKDA 2YIWA 5FBOA 4QP3A 1FOTA 1MUOA 3I7CA 4BFMA 2QO9A 2O63A 4DGOA 4EQUA 5C4KA 3L8VA 4JR3A 2CGXA 4FOBA 4RJ6A 4X2JA 3VHEA 5AADA 3VONA 5F1ZA 4NJDA 5J7HA 4RVKA 4O38A 2EB3A 3R7EA 2QG5A 1OM1A 3F6XA 3RALA 4IFCA 4OW8A 3R28A 3D5XA 4BCGA 5HLWA 5EM8A 4OTDA 3NMUF 3OWLA 3PY0A 3WYXA 4R8QA 2CNQA 2XK4A 5ACKA 2HZNA 3OWPA 4QMMA 4DCAA 4MWHA 2Z7SA 4I41A 4FX3A 2XEYA 3DKCA 3GEQA 4MHAA 3MYGA 4WNPA 5J8IA 3OF0A 1PMVA 3C7QA 3HVCA 5FG8A 2C6LA 4JNWA 2EU9A 1VYWA 3VJOA 2CJMA 4LGDA 2IZRA 4DCEA 4Z55A 1IA9A 3GCUA 3P23A 4IDTA 4IB0A 4D55A 3KN6A 1PJKA 2XK8A 5FGKA 5I9WA 5F20A 3DY7A 4BHNA 3LMIA 3Q52A 2F7XE 1M7QA 1BL7A 3K2LA 2XIXA 2OIBA 3QA8A 4NZWB 5DT0A 5TT7A 4ARKA 5JFXA 1XH7A 4O0SA 4UMRA 5LXMA 3BGQA 2Z60A 4YZDA 3NVMB 2WIPA 4X3FC 4TNBA 2R3GA 4CRLA 4DAWA 5DR9A 2ZYBA 4JQEA 5M4CA 1SNXA 4JQ7A 2ITQA 4MAOA 4WUAA 2BRMA 3PXZA 2AC5A 2CMWA 3QD3A 4FTIA 3IPHA 5JRQA 4FJVA 4OBQA 2R3LA 4GEOA 4C57A 4EH5A 5IEYA 5J87A 3I0OA 1Z57A 2VTMA 5A9UA 5DH3A 3NR9A 4B6LA 2WMSA 4WG4A 3QTWA 1G8SA 3RK5A 4ERKA 5D7AA 4FEUA 4ALUA 2BPMA 3C4ZA 3MDYA 4G2FA 4DEHA 5J79A 2B54A 1OKZA 3BHVA 3SG8A 4N4SA 4QP1A 1JNKA 2XUUA 2O64A 3COIA 4ZLZA 3FJQE 1ZYSA 4QNAA 1FVRA 1ZY4A 3R7OA 4FSRA 2PY3A 4RJ3A 3PFYA 3VAPA 3EQRA 3AQVA 4QYFA 3CPCA 3PYYA 4QQTA 4MUQA 2R3RA 3Q3BA 3AC1A 3HL7A 4AN3A 1G8AA 3A61A 4XJ0A 2UZVA 4R77A 4PTEA 2IEWA 2WOTA 1ZARA 2PHKA 2ITUA 3ORKA 5LCKA 2CGVA 3SLSA 5CU0A 5LOHA 4YO6A 5IA4A 3UZTA 1PXNA 2BIKB 2XNPA 3R9HA 4MXCA 3GGFA 4D4RA 4Q5EA 3HRFA 1NY3A 3TTJA 2FSLX 5EDPA 1EH4A 4HGSA 4FV7A 3MH0A 4BKYA 3QBNA 3PJ1A 5ANKA 5AV1A 3LIJA 3O8PA 4IVCA 5AP5A 3S2PA 2NRYA 2PZPA 2OFVA 4GJ2A 3N4VA 1TFFA 4ZY5A 4RC3A 5FD2A 3UDZA 2YJSA 2HIWA 4TYEA 2IN6A 4MXOA 4YJOA 4U97A 3MFSA 1KOAA 4M12A 4Y73A 2OGVA 3EQGA 4QP8A 1M14A 2WOUA 4O84A 3D5VA 3ODZX 3QQHA 4FKRA 4TYIA 2DUVA 4QMNA 1ZMUA 3R00A 5C9CA 1T46A 3PWDA 4JX3A 5JN2A 1OBDA 3Q5ZA 4FGRA 2DWBA 2O3PA 4MX9A 2JAVA 3QD2B 4RLKA 1QPDA 4W4WA 5LARA 3CKXA 1B6CB 3OHTA 4F1TA 3BEAA 2UW6A 3ORLA 4GIIA 5L6OA 2PVJA 2QVSE 1F5QA 4BR3A 3ZC6A 4ONAA 5CU3A 3TIZA 3S00A 4EQMA 3EIDA 3BU3A 3HECA 4D0XA 5CAQA 3DA6A 4GCJA 4G3EA 1K3AA 4RIYA 1ZLTA 4Y8DA 3BV2A 3FKNA 4ZY4A 2WNTA 4FSUA 4ACGA 4S34A 3AMBA 3GC9A 4LV5A 5J1VA 5K4IA 3BL7A 2GPHA 3TZMA 2XKCA 3ZSIA 1ZZLA 4FKOA 5H8GA 4BZOA 3VNTA 1DI8A 2W5BA 4F0FA 1WBTA 2UVXA 4AXCA 5L2WA 4GIHA 2VTTA 5FTQA 2NO3A 3QC9A 3LMGA 4FV1A 4OBOA 3GBZA 4P7EA 1URWA 2YAAA 3DCVA 4RPVA 5GZ9A 4O7VA 3PXRA 3NDMA 3FXWA 4J52A 5HQ0A 2GNHA 4GUEA 3IW8A 4Q9SA 4RT7A 2UVZA 3E92A 3SOAA 2JKKA 4KSPA 3E87A 2W1CA 5AV4A 3ZDIA 5I5ZA 3BYUA 3AD5A 4BCKA 3BX5A 4Y72A 3BU6A 4XG9A 1YOJA 1NVSA 4AN9A 1A9UA 3EN6A 3ZFMA 5FM2A 4YJUA 4CCUA 1KUTA 4PDSA 3VC4A 1ERKA 2J0LA 2WZJA 3FI4A 4J71A 3PE1A 4UN0C 5DE2A 4CMTA 5HCYA 3HKOA 5HO6A 3TNQB 2Y9QA 3LQ8A 4HZRA 4RQVA 4DHFA 4GT5A 1FBNA 3SC1A 2WTVA 3EFLA 3ANRA 5HICA 2PVMA 4DEIA 2ZDTA 3MSSA 1BI7A 3WI6A 1IA8A 4DHZA 4FTTA 3H4JA 3V6RA 3NX8A 4KS8A 4O21A 3OS3A 4C59A 5CSPA 3IO7A 3TNPC 3CTJA 2WEVA 4TZRA 1V1KA 4YJNA 5B2MA 2ITTA 4FTNA 4BBEA 3K54A 4U41A 4EZ5A 4EK3A 4CGAA 2BR1A 2XNMA 2IVSA 4FR4A 4ZMFA 3LCTA 3F5UA 3ULZA 4EKLA 5H3QA 4TNDA 5AUWA 2QCSA 2EB2A 4L7SA 5EHOA 3H3CA 4WBOA 4QD6A 4JIKA 3PSBA 3UC4A 1J91A 4DEAA 3ZLYA 4OR5A 3AOXA 3U4UA 2F57A 4DFLA 1SVGA 3QCSA 4GG5A 4X6RA 4KBKA 3I81A 2ESMA 3VIDA 4ERWA 2NP8A 4JRVA 1RJBA 3EYGA 4AXFA 2WMXA 3HV6A 2UVYA 3CXWA 3KMWA 3K5VA 1H1RA 1XH6A 1Q62A 5CF5A 3HV7A 3P7AA 4ZAUA 1TQMA 3ZUTA 5IZFA 5KKRC 4X3FA 2HOGA 3PY1A 1U5QA 4EOKA 4WRSA 2XK3A 4Z9LA 2JDVA 4I6FA 4BDAA 4DN5A 1YKRA 3KCFA 4OT6A 2NRUA 3RPVA 3IDCA 4CFWA 2QR8A 2PE2A 2G2HA 4QTCA 4I22A 4IZ7A 4R1VA 1YHVA 2V62A 3FYKX 3O17A 2QKWB 2QD9A 4X3FB 3AC5A 4DEEA 1PXIA 1YWRA 2E2BA 4KS7A 4PMSA 2RG5A 3RAHA 4XX9A 4D4YA 3IONA 1A06A 2PUNA 4NK9A 4YHJA 5E7RA 5GJGA 5AMNA 3VBTA 4BDIA 1LUFA 1JSVA 5DMZA 4QYHA 3PZHA 3KMMA 3PPZA 3C51A 3NS9A 4XCUA 1E1XA 4O1PA 3FQHA 3ZOSA 3FEGA 3FQEA 4ZEGA 3RK7A 1ZRZA 2ZB1A 4AT5A 5EH0A 4YTIA 4CFNA 2C3IB 3DS6A 4F7SA 5IEXA 3SVVA 1OIQA 3QQFA 4XNEA 1OL5A 5M4IA 3ALOA 4IJPA 4MCVA 2PPQA 2X7OA 4RGJA 5A14A 3BLRA 4R78A 1QMZA 2ZDUA 3EOCA 4C62A 3ZLSA 3RNIA 3DK3A 5AV0A 3BHUA 1GZOA 1WAKA 5CU4A 2VU3A 3HMMA 3C0IA 4NW6A 1Q3DA 4YC6A 2YN8A 3OXTA 4A4LA 4AW2A 1OUYA 4BDFA 5DWRA 2IJMA 2OIQA 4GYIA 4RJ7A 2XNEA 5IQAA 3NW5A 3R8MA 3W0MA 2XIYA 3SRVA 1FINA 4PP9A 5FXQA 1J1CA 5DFPA 5AUZA 4F0IA 2DYLA 4ZSGA 5AX3A 2PL0A 3DOGA 2VGPA 5EQPA 1H08A 3DGKA 4NW5A 5FEDA 4CYIA 3C5UA 2H6DA 3PPKA 4H1MA 4A4OA 4BB4A 3W0SA 4W4YA 3ID6C 3WYYA 3QX2A 2C5NA 5J95A 1J1BA 3MTFA 3TZ7A 4YURA 3AG9A 5TR6A 3ITZA 3N51A 3SRVB 3LQ3A 3KB7A 3MH1A 5ITAA 3F66A 4G9CA 4DTBA 2VAGA 3QU0A 4QMXA 3SG9A 4TL0A 1XH5A 4IC7A 5JK3A 1R3CA 4FV2A 1VR2A 3CKWA 3VUHA 4F9WA 3IGOA 4FV4A 4GT4A 3N9XA 2UZTA 4MQ1A 4E73A 1CM8A 3U9CA 4PDOA 4WSYA 1M17A 1UV5A 4E6DA 2QOHA 3LMHA 1FMKA 1GNGA 2GDOA 4FVPA 5BVKA 3DXQA 3QCYA 3FMNA 3H30A 2EXEA 3KVWA 4USDA 4LFIA 5LWNA 2RKUA 3HMPA 1PXPA 3UJGA 5K4JA 2Z2WA 4NCTC 3W2RA 4RIXB 3SXRA 4HW7A 4XV3A 5HBEA 4UMUA 2J9MA 2OIDA 3KXGA 4HVSA 4U45A 2PMOX 1TKIA 4DH7A 1M2RA 3C5IA 1U59A 1H4LA 4RJ8A 2OICA 4FNZA 4JR7A 1CKPA 5EM5A 5HI2A 5KZIA 1ND4A 4O0XA 4W8EA 4A9UA 4R5YA 3RMFA 3UP2A 4D28A 4HYHA 3TYKA 1FQ1B 4BL1A 4BDCA 5AJQA 3BYVA 3DBCA 4I94A 3ZO2A 4XG8A 4HPTE 4F9AA 2ZV9A 4JAJA 5EHLA 3AD6A 4RJ5A 4LGHA 4QMZA 5G1XA 4U80A 4IM0A 4YLJA 5CEQA 1GY3A 5CEKA 4O6LA 5HTCA 4DLJA 3MB6A 3KF7A 4TW9A 3ZBFA 2OLCA 1PXOA 2F7ZE 5DRBA 1LR4A 3UBDA 4Q9ZA 4OT5A 5C4LA 3VS3A 4LYNA 5TF9A 5IA2A 5AAGA 3HYHA 4YSJA 5FTOA 1GAGA 4L3PA 4FZ6A 3VUMA 2BZHB 5M55A 5HEZA 5HU9A 3NW6A 4BCPA 4RX7A 1PRYA 4FTCA 3VUDA 4KUJA 1UU3A 4BYIA 4O22A 1UU7A 1S9IA 2PVHA 2VX0A 1Y6BA 3E5AA 5D10A 5C01A 3S3IA 4JIAA 2C69A 2B9HA 5JH6A 1OL1A 4L53A 4FI1A 4FEWA 3O2MA 2X0GA 4HYIA 3EYHA 4JS8A 5ANEA 4QTDA 4EK5A 4ASEA 5IQGA 5CQUA 2QO7A 5J5SA 1B39A 4MF0A 4FZDB 2GQRA 5FEEA 1Y57A 2BDWA 3OTUA 4BDGA 1UWJA 1W2DA 3QYWA 3T9IA 4K9YA 3SXFA 5ANGA 1YXSA 4BBMA 5J1WA 3FXXA 3NRMA 2I0VA 4IAFA 1IASA 1Q8ZA 1XWSA 1YWVA 3PXQA 3QRIA 4J97A 5HKMA 4FYOA 3VS2A 4I6LA 5HE0A 4FNWA 4WNMA 4L67A 3ENMA 2RG6A 3PJCA 3TUDA 3A7FA 3RAWA 4AGUA 4ANSA 4AQKA 4IZYA 3UPXA 3OBJA 2R2PA 1Q4LA 5JEBA 4CZUA 1SZMA 4GS6A 3E64A 4W8DA 1ZY5A 3BHYA 4C0TA 4LG4A 1U46A 3E8DA 2FSTX 4JXFA 3ZFXA 4MEDA 3VN9A 4GKIA 4I5MA 2XIRA 5CWZA 4FZAB 2BZJA 3D4QA 4ZS0A 1APME 3R1SA 2UZLA 4XS2A 3PJ8A 4CV9A 3VF8A 4DG2E 2ZM3A 3KVX