4YNOA

Crystal structure of mapk13 at inactive form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
350
structure length
342
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLAGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 13
publication title IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 342
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ynoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ynoA01
4GIIA 3CP9A 4G3DA 1WBWA 2ZYBA 3FMLA 3H9OA 4L7SA 1WVWA 4I23A 3PYYA 1Y8GA 5CVGA 4L8MA 3VUMA 3SD0A 2Y4PA 2OIDA 4APCA 4I41A 4BDIA 5E8WA 2BRHA 4WA9A 4C4HA 3PVWA 3QHRA 2J0KA 3EQPA 3OY3A 3VBYA 5CSHA 2JAMA 3OUNB 3FMEA 4LL0A 1YHVA 2UW0A 4BZOA 5AUTA 5L2SA 5C4KA 2VO6A 3GU7A 3L9NA 4UXLA 3K2LA 2XNNA 4FVQA 3O2MA 4FL2A 1M7NA 2WTIA 4WG4A 4O0SA 5FLFA 2PZ5A 3V6RA 4AZTA 1IAJA 4BKZA 2WTDA 5FEEA 2RFNA 4JNWA 2X6EA 4U0IA 3Q53A 2ITYA 2EXEA 4Y46A 3TL8A 5M57A 2QD9A 4AW1A 5AUYA 3FXWA 2LGCA 3PLAE 1OKVA 2C68A 1CTPE 5D12A 1G8SA 3UNKA 1Z57A 3E87A 4JS8A 5HCXA 3P78A 2VTIA 4O1OA 1PKDA 3WZUA 3EJ1A 5KUPA 1UA2A 2X39A 4H05A 1SNXA 3CKXA 4G6LA 2JD5A 4W4WA 4E4LA 3WZJA 5CAUA 3FBVA 3NEWA 5EYDA 4CZYB 5J7HA 5JQ5A 3EQHA 3ZMMA 1B6CB 5J95A 2UZNA 3RK5A 4AZWA 4FVPA 5E8ZA 4O7VA 4JG6A 4IAAA 1W8CA 4FGBA 4LM5A 3UYSA 3W33A 2F2UA 1U4DA 2C3JA 3CXWA 4AQCA 2PUNA 4YHTA 2GNFA 1MQ4A 1FINA 4FT3A 2XMYA 3NUNA 2ZV8A 4IWDA 4XNEA 3JVSA 5F95A 3UBDA 1QPJA 3WZKA 4WG5A 4DFNA 4PQNA 4BZDA 3ZBXA 3AGLA 4EK6A 2YZLA 5CAQA 4XUFA 3A7JA 3QCQA 4WUNA 2CGUA 4QT1A 3RNIA 5M06A 2XIRA 4BRXA 2BCJA 4MD7E 2CGXA 4Y83A 1F5QA 4ITIA 1YOJA 2I0VA 4PPCA 4CYJA 3QUDA 3I0OA 2ZV9A 3FMMA 4RVMA 2VWUA 3KVWA 3RVGA 5DE2A 2YCQA 5ACBC 4PNKA 1BI8A 4J96A 4RLLA 5HNBA 4DH1A 1QPDA 3K5VA 4BDKA 4J52A 1GNGA 4UWYA 5BNJA 4IFCA 5F1ZA 2GTNA 2G15A 4XG3A 3KRRA 1KE6A 3QKLA 2BR1A 4L9IA 5C26A 2AYPA 4FSWA 3UOKA 4AFEA 1WBTA 5BMMA 4G9RA 5I9ZA 2C6DA 4FV0A 3FQHA 3U6JA 4F6UA 3ID6C 5HBHA 3M1SA 4I24A 3VNTA 2QG5A 3GEQA 4MWIA 3RPVA 5D9HA 3NZ0A 4V01A 2OK1A 4KBAA 3A7IA 4IQ6A 4XV9A 2PVLA 2UZBA 3OS3A 2HW7A 3ZLXA 1O6YA 2RG6A 5EM8A 5IEXA 3LCTA 1E9HA 3QCYA 3QGYA 4WHZA 3PJCA 3QLGA 5IUGA 4R7IA 1IA9A 3AMBA 3MVHA 4IX4A 3ZUVA 5EI6A 5HTCA 5AR2A 5IH6A 2QO9A 5DPVA 2OZAB 3JXWA 4DFUA 4CQEA 5C27A 4HGEA 4KBKA 4G2FA 1APME 5K0KA 1Q97A 4LOPA 2BMCA 2C3LA 1PXPA 3IDPA 3NYXA 3R7VA 5CS6A 3HRCA 4QMWA 3KRWA 3VUKA 2V7AA 1JKKA 5HOAA 4LUDA 4C35A 2I0HA 3ZO4A 4DGLC 4RX8A 2VV9A 4AT4A 4UMUA 4M69B 5HO7A 3SG9A 2X7FA 3N4VA 4APPA 2X1NA 4GUEA 3FLYA 3VRYA 4DTKA 5AP7A 1HOWA 4X6QC 3BQCA 4AN9A 4PL4A 3HECA 4FKQA 3VIDA 2FSLX 3GU6A 4CNHA 1IAHA 5D7AA 1BKXA 3ORTA 3F2AA 3NS9A 4UEUA 5LMKC 4Y72A 4CTBA 3LFAA 4IAKA 3FLWA 3KXXA 5CF8A 2CSNA 4AZVA 5EYCA 3WE8A 5K9IA 3UIMA 2BHEA 4OAUC 1YI3A 3I7CA 4BTKA 4J97A 4DGGA 4GG7A 4WNKA 5IQIA 4DTAA 1UU9A 4D2WA 1CSNA 5AR8A 3CD3A 3C4WA 3TIZA 1OMWA 4EL9A 4D5KA 2AUHA 4FUYA 3R9RA 2OXXA 2VWZA 3H3CA 3VVHA 3DJ5A 2C30A 3HRBA 3QTXA 4UYNA 1P4FA 5LMAA 4PMSA 3AGMA 3HMMA 3CD8A 1UVRA 1DI9A 4IH8A 4P2KA 3UJGA 5E8UA 1E1XA 3VUHA 4ZMEA 3BEGA 3ACKA 3ENMA 5CXHA 2EXMA 2C5XA 3NW7A 4M13A 4D2TA 4WRGA 4UV0A 2G2HA 4YJSA 4QTCA 3UG1A 4F7JA 3ET7A 4FEWA 4BC6A 2ERZE 2J4ZA 4L53A 1DAWA 5DFPA 5AUXA 5IQFA 1PJKA 5D7VA 4FBXA 3T9TA 3FYJX 3EFWA 3KF4A 3EN5A 3RI1A 3ETAA 3RZBA 3L1SA 1FMOE 3BLHA 4FTLA 2E2BA 5CSPA 4BKYA 1ZXEA 5LCKA 2XF0A 3EL8A 5B7VA 5CVFA 3S0OA 3O96A 4ZY5A 1UU7A 2JIIA 1KOAA 2EVAA 3F5GA 4QTDA 1Z9XA 4YC3A 3U51A 4F70A 3FLQA 3V04A 1ZZLA 4FT0A 3F2NA 3DFAA 3DY7A 3R01A 4QNAA 2OF4A 3A99A 4YJPA 3QTQA 4ZSLA 1JSUA 2ESMA 2GCDA 3LJ2A 3R8PA 4O0YA 3ZOSA 4EUTA 4NZWB 3R7IA 3COIA 3DK6A 2W5BA 4LRMA 4Y5QA 2PHKA 3U6HA 1Y6AA 1YRPA 4V04A 5FM2A 1JKLA 5DT3A 4G6NA 1LP4A 5EI8A 1VYWA 2P2IA 3VHEA 4J1RA 4AXAA 1F3MC 2DWBA 4C7TA 5EQEA 5HG7A 4ANSA 4R5YA 2BZKB 3SAYA 2UW4A 4FSNA 3PIXA 5FEDA 4A06A 5JFXA 2I0YA 5E92A 1ZOGA 3PXRA 3IW6A 4DEHA 4F99A 3EB0A 2X4FA 5D41A 3PXFA 3F6XA 3PPZA 4E3CA 4RWJA 2A19B 4IVAA 3ZZEA 3JS2A 2VX0A 2J51A 2ZAZA 1H28A 2F7XE 3PE2A 2FYSA 4GJ2A 5EM6A 4BCMA 2I7QA 3AQVA 4KUJA 4X2NA 3UC4A 3KK8A 3R8MA 4AN3A 2W1EA 2GNHA 3QD0A 4TNBA 4EJNA 1VEBA 5M4IA 3AC2A 1PXNA 4JLCA 3QZIA 1MRYA 4IX3A 2PULA 3Q32A 4MK0A 4RIWB 3QZHA 1KV1A 2BFYA 3O8PA 4TYIA 5A4EA 4D58A 4C4FA 2VN9A 2VX1A 1YWRA 2BPMA 2ITVA 3BGPA 2B54A 3HL7A 4JRVA 3VC4A 5JKGA 3KULB 5CANA 4FV5A 2WMBA 4E6AA 4ANMA 2G1TA 1YKRA 4JAIA 3QU0A 1R1WA 3VQUA 2F9GA 4XP2A 2ZB1A 4M0YA 2IVSA 4LG4A 4CQGA 3DJ7A 4Y8DA 1W83A 4LRKA 4QMLA 4B7TA 4ZTSA 4F08A 4XEYA 1YHSA 4N6YA 4BWXA 5IA1A 4R5SA 2O5KA 4GG5A 4HNIA 4M12A 5LVNA 2WQOA 3T3VA 3R02A 4KD1A 3AXWA 3BQRA 3ZLSA 2W7XA 2PVMA 2PTKA 4GS6A 1Q8WA 4OT5A 1OPLA 4P7EA 4J8MA 1JWHA 3MWUA 3QRTA 4WO5A 4AOTA 3DXPA 1OPJA 2XEZA 2Z7LA 3EQCA 3NNXA 3IPHA 4O91A 4TYHA 2YM7A 3NNVA 4H3PA 2HK5A 1OIQA 2RSVA 3PSBA 2PZYA 4FMQA 2C6TA 2YM4A 3GBZA 4FIGA 4DT8A 2XJ1A 4CG9A 4TYGA 4WIHA 2CCHA 4FTNA 2QO7A 1UNGA 3LCKA 1EH4A 1PMUA 2IZRA 3KXGA 3O51A 4QD6A 5TE0A 2XNEA 3NW5A 5DR6A 1XJDA 2VTQA 3SHEA 2OJJA 4ALWA 4BBFA 2WTVA 4I4EA 4CD0A 4CFVA 3C7QA 3EKKA 3GCSA 5AP2A 3FHIA 4FG7A 3MDYA 4E6CA 2X8IA 4ALUA 4QP1A 4TKSA 3EN9A 3E93A 3KF7A 3ZSGA 2PL0A 3DGKA 3BBWA 5IF1A 2YWPA 3UZRA 2GMXA 3EIDA 4O0RA 4DE4A 3DAKA 4UMTA 4UMPA 4W8DA 2ONLC 1KV2A 3COHA 2FB8A 3GU8A 5EHYA 4GK4A 1GY3A 2A1AB 2E9VA 2Z7RA 4FTQA 1SVGA 1E1VA 2OH4A 2PMNX 4UB7A 5HVYA 4F64A 4I0SA 5HD4A 5FEQA 2YLFA 5HU9A 3P79A 4QQTA 4RC4A 1ZYDA 3TUDA 4J98A 2IVTA 4QTEA 4IZ7A 1JKTA 3MVMA 3WF5A 5LWNA 3GNIB 3MIAA 3CKWA 3OTUA 4M3QA 4UMQA 3BWFA 4BCNA 4HPUE 3UZTA 5CSWA 3D94A 1XH7A 2W5AA 4JBQA 1ZRZA 2H6DA 3BYSA 3G15A 3MPMA 2YACA 3G0EA 4HVHA 1PMNA 2WB8A 3GUBA 4MBJA 4LMUA 4BDFA 5HLNA 2YIXA 4K8AA 3FKLA 3NAXA 3GFEA 4M7IA 4F4PA 3UQFA 4EOLA 2VTRA 3NWWA 3O7LB 2FSTX 3DT1A 2XNMA 4D2SA 3VUIA 3OHTA 3PSDA 4MNEB 2RKUA 2V55A 5CX9A 4FUXA 2EUFB 5FD2A 2BFXA 3DXNA 4YNEA 3UGCA 3G9NA 5AP5A 4U9AA 2B55A 3RPRA 5KKRC 4FICA 3BHVA 4IEBA 3AC1A 2P0CA 2HW6A 2W4KA 3LJ1A 4ZXTA 5HE2A 5DLSA 4YZNA 4O96A 3V5JA 3MH3A 3DV3A 3H30A 4BKJA 5J9YA 1DM2A 1Q61A 1KE5A 2WKMA 1OL6A 2QQ7A 2Z8CA 4GU9A 3TG1A 4B8LA 5GZ8A 4FG8A 1VJYA 2GQSA 4FSZA 4FNZA 4RJ8A 2WEIA 1J7IA 3QZFA 1FPUA 2QOBA 5ANEA 5GZ9A 3PSCA 5IQHA 5DT4A 2XBAA 3DS6A 3FPMA 5IA5A 5JGDA 5CVHA 5LOHA 4ZTLA 2PY3A 2OKRA 3C9WA 5H8BA 4A9YA 5A46A 4N70A 4RWIA 4FIIA 3PVBA 4RSSA 4O84A 3D15A 2WXVA 4C3RA 4AAAA 3QQGA 1H1SA 1XH8A 4YSMA 3H4JA 1LPUA 4C58A 2ETKA 3FKOA 4U42A 4TWOA 3WZDA 4O86A 1F0QA 5J87A 4L45A 3FL4A 3ITZA 2BZJA 4MYGA 4HGLA 4CTCA 2PZPA 5I3RA 1OL2A 1WBOA 2O64A 3C5IA 5EK7A 3ANRA 4NTSA 3ZUTA 3N4TA 2CLXA 5K0XA 4EBWA 2PE2A 4D1SA 4GH2A 4I0RA 2QOOA 4MXYA 5E8YA 3OMVA 5AP0A 3AT4A 3O71A 4MD9E 4FNYA 4O38A 2BDFA 4MXZA 2J5EA 4V05A 3W8LA 3TXOA 1PRYA 2YAAA 3MGYA 1GZOA 4GVAA 4QMZA 3V8WA 3ORLA 4KS7A 3O8TA 3RK9A 3LM5A 3WF6A 3ZC5A 3NIZA 2C3KA 3PG1A 2J0LA 1IA8A 3GOPA 3IOPA 4YZCA 4USEA 3ULZA 3CJGA 1Z5MA 4KINA 5DI1A 4QMYA 4ERWA 3BYMA 3GT8A 2KULA 4FL3A 2YIQA 5JRQA 2C5NA 1I09A 3KKVA 2ERKA 4KIKB 2WGJA 4OTWA 4RWKA 4OTIA 4I0TA 4O2ZA 3KRLA 3FWQA 3VS5A 3BU6A 3EFLA 5HG5A 5KMMA 3NYVA 3ZS5A 5L2IA 5I4NA 4PRJA 4NEUA 2HAKA 3SW4A 2GHLA 3CPBA 1A9UA 3AD4A 1H27A 2BROA 3TV4A 4IMYA 4IIRA 5KE0A 1H0VA 4C61A 3MA3A 3MVJA 5IDNA 4L3JA 4L7FA 2PE1A 3FYKX 2QOIA 4AG8A 2QU5A 3RM6A 1IG1A 3VW6A 4OTFA 4O7LA 3R1SA 4OGRA 5FM3A 2HWPA 3QWKA 3E7VA 2RGPA 2C6IA 4H39A 4G5JA 3HUBA 2WELA 5GJGA 5DYJA 1M52A 1Q99A 2UZEA 1MRUA 2GNGA 2NRUA 3JPVA 4X21A 4IM3A 4WRSA 3SQQA 4CT2A 5HU3A 3NUAA 2PSQA 4KRCA 5CF4A 5J5TA 3P7AA 3FLSA 3DCVA 2JEDA 4F9WA 4ZTMA 3VS4A 4EEVA 1XH9A 4G3CA 5ANGA 1OIYA 2ONLA 4FI1A 2O65A 2EB2A 2WMAA 1LR4A 2VTJA 3RCJA 3DFCB 2X2KA 3TZ9A 3I6WA 2NNWB 2W1HA 4D4RA 1FQ1B 3FZPA 4FKPA 4DGNA 3RAHA 5HX6A 3OEZA 4QMUA 3BHHA 2C4GA 4QP4A 2HY81 4II5A 2UW5A 3EL7A 1GZNA 4FYNA 3IG7A 5K3YA 4F0IA 4QMQA 4EC8A 4E5BA 4IW0A 3LFSA 3ANQA 4R1YA 4R6VA 3D2KA 4R77A 3FZ1A 2QODA 4S30A 4UZHA 3F69A 2PZRA 3F7WA 2WIHA 5I9UA 2RFDA 3Q4TA 4C4EA 2XH5A 3E63A 3FKNA 2BDJA 4U97A 4WSQA 4X2KA 4XRLA 5HIDA 2OJIA 3UO4A 1IASA 1WBSA 2DYLA 5FWKK 3NYNA 4YJQA 3OXIA 4EKKA 1P4OA 4I6BA 4JBPA 2QHMA 1OUYA 1JQHA 4FV8A 2OICA 3DLZA 3K54A 3UYTA 4NM0A 4CFNA 4BIEA 4E1ZA 1FVVA 3LFNA 3QXOA 3ODYX 1BX6A 4JOAA 5FTOA 4MVFA 3KFAA 5K4IA 2JKKA 5DNRA 3I0QA 3LCDA 5FXQA 3CQWA 3OD6X 4L01A 3D7TB 3GVUA 5IEYA 5EYMA 4TT7A 1H26A 3R28A 4OBQA 2Q0BA 5EOLA 2XRWA 1OBDA 4WG3A 1ZZ2A 5ETIA 3FSFA 2WU7A 3Q4ZA 3EQIA 5GJFA 5J7BA 3ZU7A 3JUHA 3LQ5A 3ZLWA 3D0EA 4AE6A 3DJ6A 3R8ZA 3NCZA 3NUSA 5CAVA 3QC9A 3R63A 2JIUA 1XBAA 1AGWA 5K5XA 4PNIA 3W2OA 3L8PA 5E8XA 1M14A 3OCGA 4FT5A 3ATSA 1UU3A 2UZUE 2EB3A 3UP2A 3FL5A 3PY3A 4FKGA 2OFUA 4PX6A 2FUMA 2QKWB 5DR9A 2C5OA 3IGGA 3NR9A 4U43A 2RIOA 3HZTA 2IN6A 3W16A 4YPSA 5IMEA 3NRMA 4L3LA 3Q52A 1MUOA 4BDBA 2R3QA 3OWKA 4K1BA 4F9CA 1IRKA 1UKHA 5HO6A 1NXKA 5F20A 4B0GA 2JLDA 5JGBA 2XNBA 3NUXA 3AMAA 3Q6WA 2YZAA 4JIAA 3ZXTA 2OZAA 4ZK5A 4GVJA 2W9ZB 3CTQA 2P3GX 3TM0A 2YCFA 4BDCA 3OC1A 4ITJA 3CE3A 3ZRLA 3PVGA 4M67A 2CNQA 2CNVA 4Q5HA 4DH7A 4L67A 4QRCA 2VNYA 4HVIA 4CZUA 4ZY6A 4BN1A 2X6DA 4E8AA 3BIZA 3R73A 4C33A 2WAJA 4ZLYA 2GQGA 3NMUF 4BDDA 3LVPA 3DTWA 4M69A 4ZP5A 1T46A 1XHAA 3QKMA 3QD2B 4FV9A 4XH6A 3CSVA 3DBDA 3OWLA 3P7BA 5ICPA 3PJ1A 3C50A 3DTCA 3EFKA 5CF6A 3KMUA 4PTGA 4C4JA 4C36A 1LEWA 2VNWA 2QONA 2XCHA 3FMNA 3R7OA 3D5XA 4TZRA 3QRIA 2ZMCA 4FGRA 3EZVA 1M2PA 2X8EA 4NU1A 2ITQA 3H10A 3Q60A 2VGOA 4LRJA 4PDYA 5IEVA 4CG8A 3ZM4A 4YJNA 1W84A 3MJ1A 4WD5A 3P86A 3ZRKA 1Q41A 3SXFA 4P4CA 2YN8A 5M4FA 5M55A 3W1FA 4UZDA 5H3QA 3FMHA 5H8EA 4Z55A 3KGAA 4S2ZA 3ZO3A 5KHXA 2HOGA 3TDWA 5DEWA 4EOKA 4JAJA 3FLNC 5CZIA 5I9XA 3TUCA 4D55A 1OBGA 1REJA 2C6OA 2F4JA 3O50A 3CGFA 4PP9A 1GZKA 4O81A 3EYHA 5DH3A 4YJUA 2BZHB 3HKOA 5EW8A 5ANOA 1BL7A 4HYHA 3Q5IA 1XO2B 4JDKA 2B4SB 3PJ2A 5CU3A 2BDWA 2Z7QA 3DA6A 4U80A 5E1EA 2E9OA 3EQRA 3W2CA 1WFCA 3E62A 5HORA 4MXXA 5FXRA 5AM6A 1YXUA 4MCVA 4EBVA 1V0OA 3ZDIA 3VS7A 4Z16A 3ATTA 3OT8A 4O1PA 3GGFA 3HMIA 2OH0E 3LLTA 4MD8E 4YLLA 4DINA 5ANJA 2Y7JA 3CC6A 3R1QA 4CRSA 5ETAA 4IWQA 4HW7A 1OGUA 2W1ZA 1HCLA 5KMLA 3SW7A 5HLPA 2YCSA 5HBEA 3CPCA 4FKJA 5IUIA 3R83A 2Z02A 4KSPA 3HP2A 4V0GB 3UE4A 3NDMA 3F61A 1S9JA 3KY2A 2JKMA 2PWLA 3DU8A 3DBFA 4QYGA 3QBNA 3F66A 4IADA 4IJPA 4MWHA 3CS9A 5JK3A 2JKOA 3T3UA 5BVOA 5KO1A 4DEGA 2JBPA 1TQIA 3DKFA 4FTRA 5HCZA 2QC6A 1P2AA 4TWCA 5CQUA 2GS2A 1WBVA 2XKCA 4OUCA 3VBTA 3EZRA 3UMXA 4BY9E 1ZYSA 3L8SA 5IKWA 3E8DA 4CT1A 1GIJA 2J7TA 4AA4A 1UNHA 3LFDA 5CZHA 4MXCA 3RPYA 2UUEA 3MA6A 4QMNA 2OG8A 2DUVA 2XUUA 3PY0A 1PXOA 3D83A 1B39A 3OW3A 3KCFA 5TKDA 4ENXA 5JFWA 4PPBA 4L3PA 2PUPA 1RDQE 2HENA 4RJ3A 4KKEA 4RFZA 4YJOA 3NUYA 4ANNA 3VQHA 3PY1A 3L8XA 5CT7A 1ZY5A 4AGUA 4EOQA 1NW1A 3IKAA 2VX3A 4CFWA 1RQQA 4N6ZA 5AUVA 3SLSA 3HMNA 2O8YA 3HV3A 3O23A 4LOQA 4MQ2A 4AZEA 1R3CA 2X7OA 3FZTA 5DBXA 5IA4A 1NY3A 4C02A 1H1WA 5GIPE 4C2WA 4QMOA 2W05A 3WZEA 3BPRA 3VS6A 2YM6A 4UWBA 4RIWA 2I0EA 2C47A 3CGOA 4FZ7A 3WBLA 2XCKA 4FSQA 1PXKA 5DN3A 1JKSA 2XNGA 2HZIA 2IVVA 3KULA 2C6MA 5DVRA 4O7RA 3HVCA 3ELJA 5FP5A 4J7BA 3V6SA 4GFGA 4AWIA 4RG0A 4HVDA 4IXPA 5HTIA 3BE2A 5TF9A 2VWVA 3RJCA 4OTQA 3POOA 4L52A 5T6KA 3C0HA 5AUZA 3FPQA 2WTCA 1CKJA 4K6ZA 3R7GA 3SOCA 4JIKA 5E8VA 2PK9A 3UNZA 4DCEA 1J7UA 4QQCA 3O7LD 5HVJA 3BYOA 4FF8A 5IU2A 4LGDA 5AIKA 4AGWA 4NTTA 4CMOA 4GIHA 4ORKA 2JBOA 3RAKA 3A2CA 2ITPA 3MN3A 3UTOA 4C3FA 3Q9WA 1OL7A 3G5DA 4RFMA 4YTFA 3IOKA 3QL8A 4H58A 2R3GA 4NWMA 4EK8A 3GI3A 4FG9A 5H2UA 4XRJA 1JBPE 2ITUA 3R7YA 1SYKA 4FKRA 3KN5A 3CY2A 4QTAA 4X2GA 4A07A 2YERA 5HHWA 3AC3A 4GK3A 4Q9ZA 4LFIA 2GFSA 3GFWA 1CKPA 2W06A 2HWOA 4UALA 1BYGA 4EH8A 4EZ3A 4JX3A 3REPA 2ZM3A 1QMZA 2BRGA 4EJ7A 3IS5A 3LAUA 4DLIA 5CU2A 1OM1A 5C8MA 3R00A 2XK4A 3LFQA 1IR3A 3C4ZA 5EHLA 2ZV2A 4BF2A 2PUIA 3BHYA 3U54A 3RNYA 1PYXA 1OI9A 4HGSA 4RJ6A 4FV1A 4AT5A 1L8TA 2B9IA 3R1NA 1RE8A 4IWPA 5J8IA 2QO2A 4E4XA 2CN5A 4CCBA 4QPAA 2OF2A 3RTPA 3NNWA 4BFMA 3Q2MA 1VZOA 2QURA 3QGWA 3OWPA 5AR4A 2C0IA 4U3YA 4JDIA 1XH6A 3NX8A 4XJ0A 1JOWB 5AR7A 3BX5A 3CCNA 5HG8A 5F94A 2HYYA 2ITTA 5L6PA 3PTGA 4QMSA 4F7NA 3MFUA 3QYZA 3SXRA 1W7HA 3PIZA 4E4NA 2V62A 3QA0A 4O0WA 5EH0A 3FJQE 4N4SA 5DA3A 1U59A 3R2YA 4U41A 2UW9A 4IZ5A 3GCUA 5HD7A 2J6MA 5CNNA 3W2RA 2UZVA 2UW3A 3MS9A 1W98A 3K3IA 5D11A 2A2AA 4AOIA 5L2TA 4EWQA 4F1TA 3U9NA 2WOTA 4EOSA 4B9DA 2J0JA 2QNJA 5CWZA 2VD5A 4CYIA 5AM7A 5IH4A 3FI4A 4IBMA 4HYIA 3ULIA 3RZFA 4FOCA 4FTUA 1JSVA 2RFEA 4ACMA 5JFSA 1OKZA 4LV5A 4A9UA 3MY0A 2UVXA 4ZSJA 3I5NA 4DEBA 5D1JA 2PVFA 3S4QA 2QCSA 3KQ7A 4GYGA 2F2CB 4FTJA 2ZM4A 3PP0A 3MH2A 4MNEA 3FMJA 4D1XA 3SGCA 4DH5A 4J8NA 1CKIA 3PWYA 4CKRA 2W1DA 4CKJA 2PMIA 3GP0A 4A9RA 2X4ZA 4CV9A 5CQWA 2H8HA 3DBCA 4HCVA 1UWJA 3UMWA 5BYYA 3JR1A 3KCKA 1GIIA 3WE4A 3HAVA 4CSVA 4PV0A 4JI9A 4EOPA 2X9EA 4M68A 4MQ1A 4Q9SA 4D9UA 5EOBA 5LVLA 4M84A 3UQCA 4XG4A 1ND4A 2BKKA 3OY1A 1X8BA 1M2RA 3WYYA 4I93A 3FSKA 5F4NA 1JLUE 3QD4A 3S1HA 4HZRA 5E8SA 5CAOA 2YM8A 3PXYA 5EDRA 5HICA 1KUTA 4AU8A 3NAYA 3KEXA 4FYOA 4EHZA 3TZMA 4IAFA 2WTKC 3NSZA 5FTGA 2HELA 2PMLX 4XBRA 1SM2A 5L2QA 3C4CA 3MV5A 4U6RA 5IA0A 5CEPA 3PXZA 3F7ZA 1URWA 3EKNA 3JYAA 2XIXA 5G6VA 4FKSA 4D2RA 4GEOA 5KZIA 3I7BA 5LMBA 4G6OA 3HDNA 3LHJA 1H1QA 3HA6A 3DZOA 3ZDUA 4HCTA 2C5VA 4MTAA 5ITAA 5LCJA 2VU3A 1O6LA 1PW2A 4QP8A 5AX3A 4IB0A 3HAMA 2CDZA 2CKOA 3LMHA 4AW5A 3O8UA 3H0ZA 3D5WA 2BAJA 5B0XA 5TO8A 4AW0A 3VS1A 2WU6A 4G3EA 3FMKA 4FV6A 4BBEA 5AV4A 4I5PA 3G9LX 4O22A 3DKGA 4PDOA 4G31A 5JZNA 2Z7SA 3SXSA 4F7LA 3GQLA 5FXSA 4GL9A 3V5PA 3FQEA 2XBJA 3G51A 4KABA 3FXXA 4KSQA 5GNKA 4P5QA 3ZTXA 2UVZA 5IQGA 3F3ZA 4I5HA 4XLIA 4D2VA 1JAMA 3MVLA 3EFJA 4ZSGA 3DDQA 2R3LA 2W17A 1IEPA 4BVUA 3AG9A 2QLUA 4KIKA 4RBLA 5DOSA 4FKTA 4L6QA 5HE3A 3VBVA 4RPVA 2OGVA 5IQAA 4FV4A 4YZ9A 3RAWA 3SRVB 1KSWA 2IO6A 2V0DA 5C01A 1ZMWA 4EKLA 1Y91A 2YCRA 3D14A 3ZONA 3I79A 4JT3A 3TJDA 4R3CA 4U8ZA 3CR0A 4BCQA 3ZO2A 2HIWA 3S3IA 4U7ZA 4ZTHA 4MHAA 4TWNA 4C59A 2YJSA 3R8LA 3UOLA 4DH3A 5AAEA 2ZDTA 2WNTA 4NM7A 5GZAA 2GPHA 3LPBA 3TACA 2J2IB 4KBCA 2R7IA 2ETMA 5E7RA 3BKBA 4F7SA 4H36A 5E90A 2BAKA 2XYNA 3MI9A 3A60A 4BCOA 5IZFA 4FEXA 3NLBA 2VTPA 3RAIA 5IPJA 5JEBA 2R5TA 4XG9A 2GNLA 4RJ4A 5JGAA 4F6WA 3R9OA 4FTKA 3DB6A 1K2PA 4AOJA 4UBAA 4EQUA 2P4IA 3V5WA 4DN5A 3TNPC 4F65A 3OXZA 2ITNA 3G90X 1JSTA 4EHEA 4YJRA 3B2WA 4N57A 3ODZX 3BLRA 3RP9A 3HDMA 4DFBA 3OF0A 1PY5A 2O0UA 5IQDA 4CMTA 3A8WA 3KRXA 4FT9A 4U40A 2GDOA 2Z60A 3PE1A 4BCIA 4GFMA 4I94A 1U5QA 4P90A 3MFRA 2ZMDA 4YO4A 4FV2A 2B9HA 3QQUA 3JY9A 4DG0E 1OIRA 1XR1A 3NCGA 2E9UA 3NYOA 5ANIA 3GENA 4G34A 1K9AA 4TXCA 4W8EA 4F0FA 3W8QA 1PHKA 4OAVB 3A62A 5M4UA 4WOVA 3HA8A 4GKIA 1AQ1A 5BYZA 4NKSA 2H9VA 4DBNA 2XIKA 3PA4A 4G9CA 1H4LA 4AUAA 3PJ8A 4EH3A 3PRFA 2FSMX 3GC8A 3QD3A 3L9PA 4FZFB 3OWJA 5AJQA 3ZFYA 2QKRA 3QCXA 4AS0A 5IDPA 2C6LA 2JFMA 5LJJA 3TWJA 4BB4A 1OKWA 3A7FA 3ORKA 3PXKA 2QU6A 3QA8A 2CN8A 3R2BA 1Y57A 4I6FA 4IX6A 4NM3A 5CEKA 4YBJA 4P5ZA 2ACXA 3UPXA 5J79A 3PUPA 1OB3A 1RJBA 1YDTE 1YW2A 1J3HA 3ALNA 5EI2A 3VS0A 3SVVA 4BI1A 4FKWA 2VTAA 1XH5A 1LEZA 2WPAA 4LGGA 3Q2JA 4H1MA 3MY5A 3D7TA 4XP0A 3RMFA 4ANLA 5HQ0A 3R1YA 2XKFA 4Z9LA 5T68A 4YHJA 4CXAA 4H1JA 4ZTNA 2X9FA 2BTSA 2R3OA 2XK9A 5EDPA 4CEGA 4QYHA 1M2QA 5CENA 4M8TA 4DEAA 1PMEA 1LUFA 4CGAA 3BYUA 2YDJA 4NM5A 3PDTA 5DRDA 2I1MA 5CEQA 4Z7HA 5BX0A 4NJDA 4HZSA 2XYUA 5DHJA 3TNQB 3ZEWA 3LFCA 3OUKA 3QZGA 4JRNA 4DHFA 2GFCA 4C8BA 2GHGA 3ROCA 3LKMA 4R78A 5M56A 5L3AA 4GT4A 2VAGA 4AACA 5CYIA 3UC3A 4EONA 5LXMA 3PIYA 5CALA 5C03A 2BUJA 4YTIA 3W2QA 4TN6A 4C0TA 2Y8OA 4C62A 2XNOA 2QOQA 3TIYA 4ASZA 4DFXE 1J1BA 3C4XA 4FZAB 4PDSA 4EOOA 2QOCA 4YR8A 2RG5A 3F5XA 3UG2A 3KA0A 5TR6A 2F57A 5KBQA 3MBLA 1OVEA 5DEYA 5C9CA 3ZXZA 3VJOA 4UX9A 4IM2A 2XK6A 4KA3A 2R3IA 3HX4A 5HBJA 1H1RA 4ITHA 2JDRA 5L8KA 2X7GA 3RALA 1ZY4A 4ACHA 1G3NA 2GNIA 4XV2A 5M07A 4BL1A 2PMOX 5CEOA 4ENYA 3RKBA 2G2IA 4ZLZA 4GSBA 2Y4IB 1R39A 5HNGA 4XX9A 4WSYA 3POZA 4D1ZA 2XP2A 3IGOA 4YBKA 5B2MA 3LE6A 3OCSA 4XG2A 3C13A 2P55A 4KS8A 5AP1A 2XM9A 4Q2AA 4F1MA 1OIUA 1W82A 4WBBB 3UIBA 1K3AA 3LQ8A 2GS6A 4XOYA 3RBWA 4B6LA 5I9YA 4ZIMA 4FTTA 2FGIA 3VAPA 4BHNA 4J53A 4QOXA 4UY9A 2VWBA 3RGFA 2A27A 4OTPA 4EORA 2B7AA 1QL6A 2HZ4A 4B4LA 4JL9A 4X3JA 4S31A 4BWKA 5CASA 4MXAA 1ZAOA 4O7WA 4YZDA 1WCCA 5AWMA 3OROA 3V5LA 4AP7A 4AT3A 2GU8A 2QHNA 3G0FA 4PWNA 5K5NA 4XS2A 3FI2A 3BGQA 2BHHA 1Q3DA 3CQEA 5D10A 3THBA 3HRFA 3E92A 4MNFA 4IB3A 3A4PA 2W1IA 4MEDA 3U87A 2YLEA 2V5QA 4A9SA 5HLWA 2E9NA 3QRUA 4Y95A 4MF1A 2QOFA 3BWJA 3MW1A 3QQJA 3OW4A 5AR5A 4O0XA 4EOIA 4PUZA 4TRLA 2VTNA 3ORIA 2EXCX 3KMMA 3QWJA 4R1VA 3QTUA 4QP3A 4HYSA 3COMA 4RIYB 3DKOA 2WIPA 4CLJA 3LXNA 4G5PA 5HIEA 3VBWA 2R0IA 4DITA 3HUCA 4I5CA 2WQEA 2YDKA 4DGOA 4M14A 5CSVA 5A4LA 4R7HA 3FLZA 1VR2A 3LJ0A 5HESA 3LFFA 4C37A 4FV3A 4I6HA 4IFGA 3IW4A 3PVUA 4JR3A 4KIPA 3LXLA 4M15A 4XG7A 3WF7A 1UV5A 1GAGA 3WILA 3K3JA 5A6NA 4V0GA 4GT5A 1GZ8A 3MJ2A 2YDIA 4FC0A 3HEGA 4LUEA 4X7QA 5I0BA 1VYZA 1M17A 3QHWA 2J50A 4UN0C 5DMZA 2OLCA 2J0MB 3ZUUA 3LFEA 4XV1A 3V51A 1Q24A 1JNKA 2VO0A 1NT2A 4RVLA 4DFZE 2FO0A 2I6LA 2ZOQA 4HJOA 4YP8A 3F3TA 3TTIA 4BDEA 4ZMFA 3VF8A 3Q96A 2WEVA 2XM8A 4IAYA 4IVBA 4WUAA 2XK7A 3VRZA 1BLXA 3FY2A 4QMXA 3AD5A 2YISA 4AF3A 3KRJA 4EYJA 3I4BA 1XH4A 2RFSA 3IQ7A 5FUTA 3PFQA 3R71A 4QQ5A 3HGKA 2JAVA 5A9UA 4JVGA 5ETCA 4O82A 4JQ7A 4RA5A 4A7CA 1PF8A 4EI4A 4O0VA 3DAEA 2IW8A 3VHKA 4JXFA 4LMNA 4JBOA 3MH0A 5EKNA 4TYEA 5EM7A 2F49A 4U5JA 2Q83A 2HZ0A 1SMHA 4O2PA 3VUGA 2PYWA 2QVSE 4XMOA 2UV2A 2ITZA 4MBIA 4YJTA 4FK6A 3BU3A 1GJOA 4BHZA 4GKHA 2PVHA 5J1VA 3PRIA 3KK9A 5HEZA 3KB7A 4PY1A 3ZCLA 5BUJA 4RIOA 3GC7A 3GQIA 1KWPA 4FSTA 4ZY4A 4F6SA 2B53A 1OL1A 2XK3A 4UMRA 1G8AA 3RPOA 4YUQA 2CJMA 1G5SA 4ALVA 3BV2A 2UZLA 3UNJA 4GRBA 3HMPA 3PWDA 3M11A 4NJ3A 4QMVA 4HGTA 5EQYA 2OJ9A 3ZYAA 4IZAA 4FZDB 4EYMA 4IACA 3BV3A 2FVDA 3AT2A 3PPJA 2OXYA 2PUUA 4RMZA 5EYKA 4IAZA 3A8XA 4W4VA 4HYUA 3I81A 2YIWA 3EOCA 3VUDA 3ZC6A 5DGZA 3H0YA 4F9BA 4RQVA 3LMGA 4YO6A 2OWBA 2YFXA 1H24A 1OUKA 1YHWA 4OTHA 5BVKA 4AN2A 4TL0A 5IA3A 3AD6A 4L00A 4BGQA 4EH2A 2R3HA 4OR5A 2G2FA 2AC5A 4IVCA 4RVKA 1OKYA 2F7EE 4FKUA 4W9WA 1KE8A 1REKA 3COKA 3I5ZA 4DC2A 5BVNA 5CU4A 3GC9A 4RQKA 2HXQA 5HI2A 3PZHA 2JKQA 4GT3A 4QO9A 4QP9A 1ZOEA 5IMXA 2VWWA 3BELA 3OBJA 4PP7A 4USDA 4NCTC 3EWHA 4PDPA 2C0OA 4EH5A 4XP3A 5CI6A 5I9WA 4EQMA 3Q9YA 3FZRA 2QOLA 4J71A 2QOHA 5AP4A 2VGPA 3P1AA 5HE1A 1UWHA 3LLAA 5AFVA 2Y9QA 4BGGA 1Q5KA 3NVMB 3TKHA 2WMXA 4X0MA 4D9TA 4F1OA 3R9HA 3FAAA 4ANOA 1PXLA 2R3JA 1ATPE 3HP5A 4LOOA 4HVGA 1V1KA 3EH9A 2GHMA 4RX9A 4NH1A 5DRBA 4JQEA 4ANBA 3EN6A 3NNUA 5A14A 5FDPA 3WIKA 3BRBA 4I22A 2IW6A 3HNGA 4EH9A 5KMOA 4JJRA 1FBNA 3ORPA 5LVMA 2BTRA 3HV6A 3EQGA 2UW7A 2G9XA 5HG9A 5IH5A 4K18A 4K0YA 5E1SA 4PTEA 4WNPA 2C3IB 2XK8A 1YXVA 4OTDA 5CT0A 1M7QA 3AT3A 2R3NA 2VTSA 3CY3A 5J9ZA 4YSJA 5M4CA 4QP7A 4IX5A 5M44A 2R3MA 3TZ7A 2X2LA 4IM0A 4E7WA 5HVKA 1WVXA 4U3ZA 4CRLA 2VWYA 1FVRA 2O3PA 1JVPP 3UOHA 4JG8A 2WQMA 3ALOA 3MYGA 2IW9A 1Q3WA 1H07A 4YPDA 5JZJA 1Y6BA 3KMWA 4RWLA 1BI7A 1NA7A 4GW8A 4D5HA 2Z2WA 2B1PA 3G2FA 4E6DA 3BBTB 1OZ1A 2Q0NA 2GSFA 2XS0A 2JC6A 4QYEA 5KBRA 3QCSA 4TNDA 3DQXA 3LCSA 4D4YA 3GXLA 3DNDA 4U79A 2B0QA 4DGMA 3H9FA 2QOKA 3VJNA 4EQCA 2BIYA 4FODA 2EU9A 3NUUA 2OIBA 4ONAA 4IE9A 4IZYA 4R8QA 4BTJA 2PU8A 4KWPA 3Q9XA 2QG7A 3GCPA 5KNJA 5FBNC 1WAKA 4K77A 4ID7A 4E20A 4G17A 3II5A 3MB6A 3OCBA 1HCKA 5JH6A 3F3UA 4DCAA 2P2HA 4NSTA 2OO8X 2ZVAA 2ZDUA 5BVDA 3U55A 5M08A 3LZBA 3ZEPA 4X6RA 4AZFA 4A9TA 1CM8A 3JVRA 2PVRA 2J5FA 4FK3A 2XKDA 4E5AX 4D0XA 3B8RA 1S9IA 2HCKA 3MPTA 3TNIA 4E5WA 5E4HA 3A61A 5CAPA 5IISA 1SZMA 4FV7A 3Q9ZA 4X2FA 5A6OA 3ZH8A 1YOMA 4AA5A 5EHOA 4Z7GA 4ZTRA 2W9FB 4HVSA 2W96B 5FP6A 2FSOX 4XLVA 3RK7A 3TKUA 3QRKA 1AD5A 3DBEA 4S32A 5LARA 4A4XA 4NW6A 4EH7A 3F5PA 4IWOA 1UU8A 4FTIA 3HV7A 3SOAA 5KKRB 2GQRA 4CCUA 1L3RE 2IG7A 4BYJA 4PMPA 3CQUA 3IW7A 4RX7A 3KXNA 3EYGA 4BCPA 1URCA 2C6KA 3FC2A 3TT0A 3DB8A 4ANQA 4FKVA 1H1PA 4C38A 4FNWA 4C3PA 1XBCA 4DAWA 3EMGA 4FIJA 3GOKA 4NL0A 2YM3A 3M2WA 4RIXB 4KNBA 4ACDA 2OJFE 4DFYA 3ZM9A 2YM5A 1KE9A 4I21A 1ZMUA 2Y4IC 3C1XA 4MH7A 3DK3A 4FEVA 3DXQA 4KAOA 3IW5A 3E8CA 3HV5A 2BILB 4O7NA 4C4GA 4ASEA 2PVNA 4DEEA 4U44A 4EK3A 4FIFA 2OU7A 3A7HA 3FQSA 4L42A 1UNLA 5ANDA 3SRVA 4ZJVA 3QXPA 1OL5A 4OBOA 1H01A 4CFMA 4FSMA 3OG7A 4FIHA 4D2PA 3VBQA 3EN4A 4IDVA 1FVTA 4DF3A 4YC6A 2PZIA 3R7UA 3I60A 2A0CX 2XVDA 4UYAA 4D28A 3TZ8A 3P5KA 4TPTA 1NVSA 1ZOHA 4NCTA 4ACGA 5E9EA 2XJ2A 1BMKA 3I6UA 1DS5A 3UVQA 2CKQA 2XJ0A 3FY0A 4JQ8A 4UWCA 4X3FB 1KE7A 3VF9A 2CMWA 5EM5A 3AOXA 5EKOA 4QMPA 3ZBFA 4ZZMA 5C8NA 2W4JA 3F88A 4AGDA 2WMUA 2J0IA 3OZ6A 3RINA 4CMUA 4F0GA 2BRMA 3V5QA 3C5UA 3QQHA 4H3BA 2BALA 3MTFA 3AC4A 2I40A 4IB1A 4BGHA 4O7ZA 1U54B 1J1CA 4D4SA 3RCDA 3ERKA 1PMVA 2C0TA 4RT7A 4BCFA 1H08A 4GJ3A 2WFYA 2OBJA 5CNOA 4EHGA 2R4BA 2BIKB 1RW8A 4I6QA 2FH9A 4HNFA 4EOMA 5AMNA 4C4IA 3WF9A 2HZNA 4AFJA 5K4JA 4QMMA 1P5EA 3RM7A 3OXTA 4PL3A 4NT4A 3LXPA 5GJDA 4CV8A 5EQPA 4NUSA 5KMKA 3VO3A 2HXLA 3VW8A 2VTMA 2VO3A 2BRNA 4PMMA 4NIFB 3QTWA 4YNOA 2YJRA 3CBLA 4DLJA 2B52A 3ZFXA 3QYWA 3KC3A 1UKIA 5BVWA 2WMTA 2CPKE 5EW3A 3QTZA 3KREA 3PXQA 5H9BA 3NIEA 4E6QA 4AZSA 4FEUA 5AIRA 5DT0A 4E93A 4W4YA 5I5ZA 4BCHA 3ORMA 2X2MA 3UIXA 1YI4A 5KMNA 5TOZA 4BI0A 3L9LA 3ACJA 4F09A 5DG5A 1J91A 3G6HA 4YZBA 1T45A 4L68A 5CTPA 4D0WA 4QYFA 3LFBA 5LVPA 2IZSA 2H34A 4OLIA 4O7TA 1CDKA 4GMYA 4M66A 3C51A 2PPQA 5EG3A 4MKCA 4NW5A 2WTJA 4QPSA 5CEIA 2YIYA 1XWSA 1YWNA 4M0ZA 5EDQA 4EUUA 1MRVA 3DKCA 4E73A 4DG3E 5BMSA 4N0SA 5FRIA 2C1BA 3TEIA 2UZWE 1JPAA 1R78A 4S33A 1XQZA 4I1ZA 3KVXA 4EK4A 3U6IA 2OJGA 3S2PA 1ERKA 4JDHA 4YURA 4O7YA 4O83A 2UZOA 3HMOA 4E4MA 2WZJA 3BHTA 3OT3A 4QYYA 2WHBA 3GU4A 3ZSIA 5IQEA 4ZZNA 1WMKA 1ZARA 3N4UA 2WD1A 1P14A 3D2IA 3D5VA 4XOZA 5TT7A 3IK3A 3FXZA 3UO6A 3SX9A 3FHRA 5BUEA 5I9VA 5M51A 3W2PA 2IVUA 4MX9A 3TV6A 2VTHA 4QMTA 1YXXA 3AC8A 4FVRA 3DQWA 4BBMA 4DEIA 3KXHA 2UZDA 3QX4A 4Y73A 3W10A 2R3PA 4C57A 1OITA 4FKIA 3U8WA 3E7OA 1XKKA 1Q62A 4U81A 1PXIA 3MY1A 3TUBA 3ENHA 3WIGA 3IW8A 5CLPA 4USFA 1YDRE 2WTWA 2YWVA 2UVYA 4YMJA 1ZYJA 4FT7A 3V8SA 4BZNA 5M53A 1V0BA 4JG7A 5DWRA 3OP5A 3FZOA 3ZZWA 3QRJA 3SDJA 5EFQA 4CFXA 3HYHA 3S95A 3P7CA 3VULA 5A4QA 3UODA 4RLKA 4EH6A 5J1WA 3O17A 5IQBA 4PMTA 4W9XA 4DH8A 4ZZOA 2NRYA 3QQKA 3EHAA 2CKEA 4GUBA 3RHXA 5CSXA 5FBOA 3OCTA 2CGVA 2ZM1A 2J90A 3QTRA 3MFSA 5B2KA 1Q4LA 1Q8TA 2CLQA 3BEAA 3TV7A 5A4CA 3KXMA 4TTHB 3GCQA 3QALE 4O6LA 5AV1A 4Y5HA 3B2TA 3UPZA 2BKZA 4KRDA 4JX7A 3E64A 5I3OA 4KIOA 3QUEA 2EWAA 3MIYA 5HTBA 3N51A 3UP7A 2YEXA 5HX8A 3NW6A 4XG8A 4B8MA 4G3GA 5BQ0A 3RHKA 4AA0A 3DLSA 2J9MA 4OBPA 4F9YA 3ZO1A 2CKPA 3ZLYA 2V22A 3QFVA 2XIZA 4O0TA 4NFNA 3WARA 2YHVA 3DPKA 4XCUA 3A4OX 3IECA 5CY3A 5BVFA 3T9IA 4IJ9A 5AV0A 4L46A 4BIBA 5CU0A 3LQ3A 2OSCA 2OZOA 3JY0A 4NYEA 3DK7A 4IC8A 4Q5EA 4LYNA 2CNUA 1FGIA 5L2WA 5CF5A 3DBQA 3M42A 1DI8A 3OTVA 2QR7A 3ORZA 1R0EA 4L43A 4DEDA 3QTSA 3NPCA 5AA9A 1BUHA 5GHVA 4FTAA 3PZEA 5E91A 1H00A 3LXKA 5KX8A 4QPMA 2ZB0A 1TVOA 5ANKA 4RIYA 4O0UA 4WKQA 3E5AA 4U45A 4BDHA 4CKIA 3SV0A 5LMKA 3Q4UA 5FDXA 1PXJA 4OW8A 4K33A 5HNIX 4CFFA 4EK5A 4WNOA 3RPSA 4ZTQA 3D5UA 1WZYA 1SNUA 1NVRA 3EQFA 4FSRA 4XBUA 2OXDA 3LW0A 3TTJA 3FZSA 4E26A 4EZ7A 4IVDA 4ZJIA 1YI6A 4FKOA 3BU5A 3MH1A 4HOKA 2YAKA 3I1AA 4O6EA 4FOBA 5AAFA 4DBXA 4QQJA 3KU2A 3C4FA 3LCOA 4IC7A 3DZQA 5AEPA 1YVJA 3P0MA 2P33A 3CTHA 2VWXA 3PG3A 5AR3A 4RZVA 1KOBA 1H8FA 4FA2A 3V3VA 3O0GA 2ETRA 3E3BX 4RJ5A 5EW9A 2IJMA 5HO8A 3R7EA 3BLQA 3TDVA 1CMKE 1O6KA 2C69A 2QLQA 3R30A 4YTHA 1OPKA 3QTIA 2BVAA 5FG8A 4ZLOA 2NPQA 5JRSA 3TI1A 3LM0A 4AGCA 3TNHA 3F2RA 4BCGA 4BI2A 5JN2A 1DAYA 1XBBA 3G6GA 3IDCA 3WOWA 4A4LA 2ZV7A 4NK9A 1A48A 4CLIA 5KMIA 3D4QA 3FEGA 2X0GA 4IDTA 2Y0AA 2ITXA 4JR7A 4UXQA 5IQCA 3F82A 4F63A 3UOJA 3R04A 1NVQA 3E8NA 4AW2A 3FI8A 3TKIA 4I5MA 2GTMA 4PPAA 2B9JA 2YA9A 5HIBA 5B2LA 5L8LA 3U4UA 3MESA 4DT9A 4O21A 2WMQA 4O7SA 3UZPA 5J5SA 1FMKA 3MSSA 4C2VA 3CEKA 3Q6UA 1PKGA 2VTLA 3F3WA 2QI8A 3G33A 3ZHPC 1U5RA 3GB2A 3CJFA 2OIQA 3ZFMA 1Q8UA 4KKHA 3OFMA 3W32A 4J99A 5C1QB 2REIA 5L8JA 3R8UA 1ZYCA 3IDBA 4LI5A 2ZJWA 2WO6A 4RJ7A 2BRBA 4AX8A 3UO5A 1U46A 3W18A 3DAJA 4IANA 4H3QA 4YTCA 3C0GA 2WOUA 3L9MA 4FTOA 5DR2A 2R0UA 3UDBA 3P4KA 4HPTE 4DA5A 2VTTA 2Y6MA 1YOLA 4WBOA 2JDSA 3R0TA 2XEYA 3F9NA 3Q5ZA 2W1CA 4DTBA 4LV8A 1ZWSA 3FC1X 5HZNA 5IA2A 4K11A 3BGZA 3F3VA 3QC4A 3GCVA 3EQBA 5JFVA 5LWMA 2O2UA 4TW9A 2R9SA 2W1FA 3E8EA 4FZ6A 3GC0A 3C4EA 2PVKA 4FKLA 1QPEA 4I92A 2RL5A 4PF4A 2XZSA 3OEFX 4K9YA 5L6WL 2FA2A 4FL1A 2XB7A 4FEQA 5L4QA 2C6EA 5AX9A 1GIHA 4BDGA 2IPXA 5BYLA 1FOTA 2JDVA 5CEMA 2C1AA 3HLLA 4A4OA 2C5YA 2F7ZE 2W1GA 4X3FC 1A06A 4XV3A 3UVRA 4DFLA 3ZRMA 3Q4CA 3SA0A 4FNXA 5BVEA 4YZMA 4I4FA 1PXMA 5KMJA 4I3ZA 1I44A 4K2RA 2R64A 4ZJJA 5ACKA 2H96A 3VUTA 1Q8YA 5JQ8A 2XNPA 1WVYA 4YGAA 4DYMA 1BL6A 3QKKA 4FX3A 4YLKA 4YJVA 4ERKA 4LQMA 4MAOA 4I20A 3TNWA 3F5UA 4QTBA 2VRXA 4BDAA 3RWQA 2W0JA 3VS3A 4ZAUA 5JMSA 2WMVA 4LGHA 1ZYLA 4M97A 1WBNA 2R7BA 2WMSA 5FGKA 4ASDA 3OOMA 3A7GA 5IG1A 3MB7A 4FTMA 3W55A 2IWIA 1FGKA 2PVYA 4BCJA 3BE9A 2UZTA 4PTCA 3E3PA 4ZOGA 4L44A 4FSUA 3QQLA 4RC2A 4TYHB 2JIVA 5KHWA 2LAVA 4NFMA 4EC9A 3QF9A 3WF8A 2W99B 3WI6A 1YWVA 2XRUA 3EN7A 4G1WA 5FTQA 3MPAA 3NGAA 2X81A 3BYVA 1SVHA 2WQBA 2NP8A 5AA8A 4BTMA 5CXZA 3AMYA 4ZS0A 4FE2A 3MTLA 2PVJA 2G01A 4Z3VA 3R9NA 2VO7A 2R3RA 4ZEGA 4R7BA 1GOLA 3DOGA 4GK2A 3BHUA 4KB8A 4R3RA 4ZSEA 2BZIB 3QQFA 3ORXA 2SRCA 4XHKB 3IONA 3UVPA 3WYXA 4FIEA 4Y85A 2NO3A 1Y8YA 2OW3A 3FMDA 3T8OA 3V01A 3L8VA 3R22A 5AUUA 5HGIA 3R9DA 2R3FA 4TY1A 4EOJA 3PLSA 3PA3A 4S34A 3PA5A 4BWPA 5F9EA 1ZLTA 4WT6A 1YDSE 4RZWA 4BIDA 2WMWA 4RGJA 2CGWA 4FR4A 4EHVA 4G16A 4EWHA 3EQDA 3QX2A 2V7OA 5AAGA 1ZMVA 1WBPA 4JDJA 4W4XA 3S00A 3E88A 4NKAA 3PJ3A 2IZUA 4OTGA 2A4LA 2DS1A 2HY0A 5GIOE 3VBXA 4RX5A 2OFVA 5HCYA 4GYIA 3ROYA 3N9XA 4QNYA 5M09A 5ETFA 4ZSAA 3D7ZA 3QLFA 4IB5A 2BAQA 2OI4X 3NUPA 2IZTA 4BR3A 3AC5A 1R0PA 3MFTA 3PPKA 4GCJA 5C4LA 4XYFA 3VS2A 3ORNA 2YITA 2JDOA 1J7LA 4HCUA 3CTJA 1STCE 2PE0A 4CVAA 2JDTA 5CI7A 4MBLA 4YHFA 4IHPA 3UQGA 1TQMA 3W2SA 4BDJA 4O27B 4YC8A 4IAIA 3LOKA 4GV1A 2R3KA 4G3FA 5AP6A 2O63A 4TYJA 2X8DA 3VWAA 4RVTA 5L6OA 3FI3A 4GFOA 5AADA 2XIYA 4BCKA 3H9RA 2GNJA 1MQBA 2VUWA 4QP6A 5A4TA 2DQ7X 2QR8A 4QP2A 3PP1A 4RIXA 2W4OA 3B8QA 1YXSA 5IUHA 4F9AA 4RA4A 5BPYA 3BI6A 5CU6A 5BUIA 4BYIA 2JFLA 3UIUA 1YQJA 2WTKB 1O9UA 4EH4A 1Q8ZA 2XKEA 3U4WA 3NVKI 4LL5A 5HKMA 5AV2A 3KXZA 5T3QA 4DG2E 3U9CA 4EZ5A 5GINE 5LQFA 3V8TA 2RF9A 5LVOA 4PL5A 4AE9A 5AUWA 5HE0A 2AC3A 3FDNA 3FE3A 5KCVA 5KZ0A 4J95A 3GU5A 4KKGA 3RWPA 5G1XA 3TJCA 4ASXA 4YU2A 2UW6A 2GS7A 2KTYA 3FV8A 3P9JA 3P23A 1QCFA 2YIRA 1H0WA 3TN8A 3HV4A 4TWPA 3FUPA 1TKIA 4R3PA 2ITWA 2UW8A 4BICA 2JGZA 1W0XC 1MP8A 3OBGA 1H25A 3KN6A 4C34A 4X3FA 3LIJA 3OOGA 5A3XA 3CIKA 1QPCA 4YLJA 4B99A 5JT2A 4D4VA 4BTFA 5C8KA 1B38A 1TQPA 3CLYA 3K5UA 3OVVA 4RC3A 5H8GA 3QUPA 3LMIA 2VTOA 2VZ6A 4RRVA 4FSYA 2B9FA 4CZTA 1U54A 4XG6A 1V0PA 5E8TA 3Q04A 3C0IA 2XA4A 3BCEA 3R21A 5AV3A 2JITA 2CCIA 2YABA 3VN9A 4GU6A 3IO7A 4OTRA 2WQNA 4X2JA 2W5HA 4OT6A 3R8VA 4ACCA 3DDPA 1OECA 1YXTA 2ITOA 2Y6OA 3BZ3A 3P08A 4FTCA 2WMRA 4RFYA 2CHLA 5A54A 4MXOA 5J9LA 5JSMA 3V5TA 4MF0A 3SKCA 3Q3BA 2E9PA 3SC1A 3KL8A 3QAME 5DIAA 4ARKA 4NIFA 4JBVA 3DNEA 4KIQA 4CFUA 3SG8A 3ZSHA 5AP3A 4ZS4A 1SVEA 1PYEA 3R6XA 5FQDC 3TCPA 4WNMA 2VWIA 3D9VA 2R2PA
chains in the Genus database with same CATH superfamily
4GIIA 3CP9A 4G3DA 1WBWA 2ZYBA 3FMLA 3H9OA 4L7SA 1WVWA 4I23A 3PYYA 1Y8GA 5CVGA 4L8MA 3VUMA 3SD0A 2Y4PA 2OIDA 4APCA 4I41A 4BDIA 5E8WA 2BRHA 4WA9A 4C4HA 3PVWA 3QHRA 2J0KA 3EQPA 3OY3A 3VBYA 5CSHA 2JAMA 3OUNB 3FMEA 4LL0A 1YHVA 2UW0A 4BZOA 5AUTA 5L2SA 5C4KA 2VO6A 3GU7A 3L9NA 4UXLA 3K2LA 2XNNA 4FVQA 3O2MA 4FL2A 1M7NA 2WTIA 4WG4A 4O0SA 5FLFA 2PZ5A 3V6RA 4AZTA 1IAJA 4BKZA 2WTDA 5FEEA 2RFNA 4JNWA 2X6EA 4U0IA 3Q53A 2ITYA 2EXEA 4Y46A 3TL8A 5M57A 2QD9A 4AW1A 5AUYA 3FXWA 2LGCA 3PLAE 1OKVA 2C68A 1CTPE 5D12A 1G8SA 3UNKA 1Z57A 3E87A 4JS8A 5HCXA 3P78A 2VTIA 4O1OA 1PKDA 3WZUA 3EJ1A 5KUPA 1UA2A 3PUFC 2X39A 4H05A 1SNXA 3CKXA 4G6LA 2JD5A 4W4WA 4E4LA 3WZJA 5CAUA 3FBVA 3NEWA 5EYDA 4CZYB 5J7HA 5JQ5A 3EQHA 3ZMMA 1B6CB 5J95A 2UZNA 3RK5A 4AZWA 4FVPA 5E8ZA 4O7VA 4JG6A 4IAAA 1W8CA 4FGBA 4LM5A 3UYSA 3W33A 2F2UA 1U4DA 2C3JA 3CXWA 4AQCA 2PUNA 4YHTA 2GNFA 1MQ4A 1FINA 4FT3A 2XMYA 3NUNA 2ZV8A 4IWDA 4XNEA 3JVSA 5F95A 3UBDA 1QPJA 3WZKA 4WG5A 4DFNA 4PQNA 4BZDA 3ZBXA 3AGLA 4EK6A 2YZLA 5CAQA 4XUFA 3A7JA 3QCQA 4WUNA 3UDSA 2CGUA 4QT1A 3RNIA 5M06A 2XIRA 4BRXA 2BCJA 4MD7E 2CGXA 3W0NA 4Y83A 1F5QA 4ITIA 1YOJA 2I0VA 4PPCA 4CYJA 3QUDA 3I0OA 2ZV9A 3FMMA 4RVMA 2VWUA 3KVWA 3RVGA 5DE2A 2YCQA 5ACBC 4PNKA 1BI8A 4J96A 4RLLA 5HNBA 4DH1A 2AEGA 1QPDA 3K5VA 4BDKA 4J52A 1GNGA 4UWYA 5BNJA 4IFCA 5F1ZA 2GTNA 2G15A 4XG3A 3KRRA 1KE6A 3QKLA 2BR1A 4L9IA 5C26A 2AYPA 4FSWA 3UOKA 4AFEA 1WBTA 5BMMA 4G9RA 5I9ZA 2C6DA 4FV0A 3FQHA 3U6JA 4F6UA 3ID6C 5HBHA 3M1SA 4I24A 3VNTA 2QG5A 3GEQA 4MWIA 3RPVA 5D9HA 3NZ0A 4V01A 2OK1A 4KBAA 3A7IA 4IQ6A 4XV9A 2PVLA 2UZBA 3OS3A 2HW7A 3ZLXA 1O6YA 2RG6A 5EM8A 5IEXA 3LCTA 1E9HA 3QCYA 3QGYA 4WHZA 3PJCA 3QLGA 5IUGA 4R7IA 1IA9A 3AMBA 3MVHA 4IX4A 4QEBA 3ZUVA 5EI6A 5HTCA 5AR2A 5IH6A 2QO9A 5DPVA 2OZAB 3JXWA 4DFUA 4CQEA 5C27A 4HGEA 4KBKA 4G2FA 1APME 5K0KA 1Q97A 4LOPA 2BMCA 2C3LA 1PXPA 3IDPA 3NYXA 3R7VA 5CS6A 3HRCA 4QMWA 3KRWA 3VUKA 2V7AA 1JKKA 5HOAA 4LUDA 4C35A 2I0HA 3ZO4A 4DGLC 4RX8A 2VV9A 4AT4A 4UMUA 4M69B 5HO7A 3SG9A 2X7FA 3N4VA 4APPA 2X1NA 4GUEA 3FLYA 3VRYA 4DTKA 5AP7A 1HOWA 4X6QC 3BQCA 4AN9A 4PL4A 3HECA 4FKQA 3VIDA 2FSLX 3GU6A 4CNHA 1IAHA 5D7AA 1BKXA 3ORTA 3F2AA 3NS9A 4UEUA 5LMKC 4Y72A 4CTBA 3LFAA 4IAKA 3FLWA 3KXXA 5CF8A 2CSNA 4AZVA 5EYCA 3W0OA 3WE8A 5K9IA 3UIMA 2BHEA 4OAUC 1YI3A 3I7CA 4AQKA 4BTKA 4J97A 4DGGA 4GG7A 4WNKA 5IQIA 4DTAA 1UU9A 4D2WA 1CSNA 5AR8A 3CD3A 3C4WA 3TIZA 1OMWA 4EL9A 4D5KA 2AUHA 4FUYA 3R9RA 2OXXA 2VWZA 3H3CA 3VVHA 3DJ5A 2C30A 4DHZA 3HRBA 3QTXA 4UYNA 1P4FA 5LMAA 4PMSA 3AGMA 3HMMA 3CD8A 1UVRA 1DI9A 4IH8A 4P2KA 3UJGA 5E8UA 1E1XA 3VUHA 4ZMEA 3BEGA 3ACKA 3ENMA 5CXHA 2EXMA 2C5XA 3NW7A 4M13A 4D2TA 4WRGA 4UV0A 2G2HA 4YJSA 4QTCA 3UG1A 4F7JA 3ET7A 4FEWA 4BC6A 2ERZE 2J4ZA 4L53A 1DAWA 5DFPA 5AUXA 5IQFA 1PJKA 5D7VA 4FBXA 3T9TA 3FYJX 3EFWA 3KF4A 3EN5A 3RI1A 3ETAA 3RZBA 3L1SA 1FMOE 3BLHA 4FTLA 2E2BA 5CSPA 4BKYA 1ZXEA 5LCKA 2XF0A 3EL8A 5B7VA 5CVFA 3S0OA 3O96A 4ZY5A 1UU7A 2JIIA 1KOAA 2EVAA 3F5GA 4QTDA 1Z9XA 4YC3A 3U51A 4F70A 3FLQA 3V04A 1ZZLA 4FT0A 3F2NA 3DFAA 3DY7A 3R01A 4QNAA 2OF4A 3A99A 4YJPA 3QTQA 4ZSLA 1JSUA 2ESMA 2GCDA 3LJ2A 3R8PA 4O0YA 3ZOSA 4EUTA 4NZWB 3R7IA 3COIA 3DK6A 2W5BA 4LRMA 4Y5QA 2PHKA 3U6HA 1Y6AA 1YRPA 4V04A 5FM2A 1JKLA 5DT3A 4G6NA 1LP4A 5EI8A 1VYWA 2P2IA 3VHEA 4J1RA 4AXAA 1F3MC 2DWBA 4C7TA 5EQEA 5HG7A 4ANSA 4R5YA 2BZKB 3SAYA 4DDIA 2UW4A 4FSNA 3PIXA 5FEDA 4A06A 5JFXA 2I0YA 5E92A 1ZOGA 3PXRA 3IW6A 4DEHA 4F99A 3EB0A 2X4FA 5D41A 3PXFA 3F6XA 3PPZA 4E3CA 4RWJA 2A19B 4IVAA 3ZZEA 3JS2A 2VX0A 2J51A 2ZAZA 1H28A 2F7XE 3PE2A 2FYSA 4GJ2A 5EM6A 4BCMA 2I7QA 3AQVA 4KUJA 4X2NA 3UC4A 3KK8A 3R8MA 4AN3A 2W1EA 2GNHA 3QD0A 4TNBA 4EJNA 1VEBA 5M4IA 3AC2A 1PXNA 4JLCA 3QZIA 1MRYA 4IX3A 2PULA 3Q32A 4MK0A 4RIWB 3QZHA 1KV1A 2BFYA 3O8PA 4TYIA 5A4EA 4D58A 4C4FA 2VN9A 2VX1A 1YWRA 2BPMA 2ITVA 3BGPA 2B54A 3HL7A 4JRVA 3VC4A 5JKGA 3KULB 5CANA 4FV5A 2WMBA 4E6AA 4ANMA 2G1TA 1YKRA 4JAIA 3QU0A 1R1WA 3VQUA 2F9GA 4XP2A 2ZB1A 4M0YA 2IVSA 4LG4A 4CQGA 3DJ7A 4Y8DA 1W83A 4LRKA 4QMLA 4B7TA 2NYAA 4ZTSA 4F08A 4XEYA 1YHSA 4N6YA 4BWXA 5IA1A 4R5SA 3BLAA 2O5KA 4GG5A 4HNIA 4M12A 5LVNA 2WQOA 3T3VA 3R02A 4KD1A 3W0SA 3AXWA 3BQRA 3ZLSA 2W7XA 2PVMA 2PTKA 4GS6A 1Q8WA 4OT5A 1OPLA 4P7EA 4J8MA 1JWHA 3MWUA 3W0PA 3QRTA 4WO5A 4AOTA 1TZDA 1OPJA 2XEZA 3DXPA 2Z7LA 3EQCA 3NNXA 3IPHA 4O91A 4TYHA 2YM7A 3NNVA 4H3PA 2HK5A 1OIQA 2RSVA 3PSBA 2PZYA 4FMQA 2C6TA 2YM4A 3GBZA 4FIGA 4DT8A 2XJ1A 4CG9A 4TYGA 4WIHA 2CCHA 4FTNA 2QO7A 1UNGA 3LCKA 1EH4A 1PMUA 2IZRA 3KXGA 3O51A 4QD6A 5TE0A 2XNEA 3NW5A 5DR6A 1XJDA 2VTQA 3SHEA 2OJJA 4ALWA 4BBFA 2WTVA 4I4EA 4CD0A 4CFVA 3C7QA 3EKKA 3GCSA 5AP2A 3FHIA 4FG7A 3MDYA 4E6CA 2X8IA 4ALUA 4QP1A 4TKSA 3EN9A 3E93A 3KF7A 3ZSGA 2PL0A 3DGKA 3BBWA 5IF1A 2YWPA 3UZRA 3O5AA 2GMXA 3EIDA 4O0RA 3VONA 3DAKA 4DE4A 4UMTA 4UMPA 4W8DA 2ONLC 1KV2A 3COHA 2FB8A 3GU8A 5EHYA 4GK4A 1GY3A 2A1AB 2E9VA 2Z7RA 4FTQA 1SVGA 1E1VA 2OH4A 2PMNX 4UB7A 5HVYA 4F64A 4I0SA 5HD4A 5FEQA 2YLFA 5HU9A 3P79A 2XALA 4QQTA 4RC4A 1ZYDA 3TUDA 4J98A 2IVTA 4QTEA 4IZ7A 1JKTA 3MVMA 3WF5A 5LWNA 3GNIB 3MIAA 3CKWA 3OTUA 4M3QA 4UMQA 3BWFA 4BCNA 4HPUE 3UZTA 5CSWA 3D94A 1XH7A 2W5AA 4JBQA 1ZRZA 2H6DA 3BYSA 3G15A 3MPMA 2YACA 3G0EA 4HVHA 1PMNA 2WB8A 3GUBA 4MBJA 4LMUA 4BDFA 5HLNA 2YIXA 4K8AA 3FKLA 3NAXA 3GFEA 4M7IA 4F4PA 3UQFA 4O4BB 4EOLA 2VTRA 3NWWA 3O7LB 2FSTX 3DT1A 2XNMA 4D2SA 3VUIA 3OHTA 3PSDA 4MNEB 2RKUA 2V55A 5CX9A 4FUXA 2EUFB 5FD2A 2BFXA 3DXNA 4YNEA 3UGCA 3G9NA 5AP5A 4U9AA 2B55A 3RPRA 5KKRC 4FICA 3BHVA 4IEBA 4JMQA 3AC1A 2P0CA 2HW6A 2W4KA 3LJ1A 4ZXTA 5HE2A 5DLSA 4YZNA 4O96A 3V5JA 3MH3A 3DV3A 3H30A 4BKJA 5J9YA 1DM2A 1Q61A 1KE5A 2WKMA 1OL6A 2QQ7A 2Z8CA 4GU9A 3TG1A 4B8LA 5GZ8A 4FG8A 1VJYA 2GQSA 4FSZA 4FNZA 4RJ8A 2WEIA 1J7IA 3QZFA 1FPUA 2QOBA 5ANEA 5GZ9A 3PSCA 5IQHA 5DT4A 2XBAA 3DS6A 3FPMA 5IA5A 5JGDA 5CVHA 5LOHA 4ZTLA 2PY3A 2OKRA 3C9WA 5H8BA 4A9YA 5A46A 4N70A 4RWIA 4FIIA 3PVBA 4RSSA 4O84A 3D15A 2WXVA 4C3RA 4AAAA 3QQGA 1H1SA 1XH8A 4YSMA 3H4JA 1LPUA 4C58A 2ETKA 3FKOA 4U42A 4TWOA 3WZDA 4O86A 1F0QA 5J87A 4L45A 3FL4A 3ITZA 2BZJA 4MYGA 4HGLA 4CTCA 2PZPA 5I3RA 1OL2A 1WBOA 2O64A 3C5IA 5EK7A 3ANRA 4NTSA 3ZUTA 3N4TA 2CLXA 5K0XA 4EBWA 2PE2A 4D1SA 4GH2A 4I0RA 2QOOA 4MXYA 5E8YA 3OMVA 5AP0A 3AT4A 3O71A 4MD9E 4FNYA 4O38A 2BDFA 4MXZA 2J5EA 4V05A 3W8LA 3TXOA 1PRYA 2YAAA 3MGYA 1GZOA 4GVAA 4QMZA 3V8WA 3ORLA 4KS7A 3O8TA 3RK9A 3LM5A 3WF6A 3ZC5A 3NIZA 2C3KA 3PG1A 2J0LA 1IA8A 3GOPA 3IOPA 4YZCA 4USEA 3ULZA 3CJGA 1Z5MA 4KINA 5DI1A 4QMYA 4ERWA 3BYMA 3GT8A 2KULA 4FL3A 2YIQA 5JRQA 2C5NA 1I09A 3KKVA 2ERKA 4KIKB 2WGJA 4OTWA 4RWKA 4OTIA 4I0TA 4O2ZA 3KRLA 3FWQA 3VS5A 3BU6A 3EFLA 5HG5A 5KMMA 3NYVA 3ZS5A 5L2IA 5I4NA 4PRJA 4NEUA 2HAKA 3SW4A 2GHLA 3CPBA 1A9UA 3AD4A 1H27A 2BROA 3TV4A 4IMYA 4IIRA 5KE0A 1H0VA 4C61A 4DHIB 3MA3A 3MVJA 5IDNA 4L3JA 4L7FA 2PE1A 3FYKX 2QOIA 4AG8A 2QU5A 3RM6A 1TFFA 1IG1A 3VW6A 4OTFA 4O7LA 3R1SA 4OGRA 5FM3A 2HWPA 3QWKA 3E7VA 2RGPA 2C6IA 4H39A 4G5JA 3HUBA 2WELA 5GJGA 5DYJA 1M52A 1Q99A 2UZEA 1MRUA 2GNGA 2NRUA 3JPVA 4X21A 4IM3A 4WRSA 3SQQA 4CT2A 5HU3A 3NUAA 2PSQA 4KRCA 5CF4A 5J5TA 3P7AA 3FLSA 3DCVA 2JEDA 4F9WA 4ZTMA 3VS4A 4EEVA 1XH9A 4G3CA 5ANGA 1OIYA 2ONLA 4FI1A 2O65A 2EB2A 2WMAA 1LR4A 2VTJA 3RCJA 3DFCB 2X2KA 3TZ9A 3I6WA 2NNWB 2W1HA 4D4RA 1FQ1B 3FZPA 4FKPA 4DGNA 3RAHA 5HX6A 3OEZA 4QMUA 3BHHA 2C4GA 4QP4A 2HY81 4II5A 2UW5A 3EL7A 1GZNA 4FYNA 3IG7A 5K3YA 4F0IA 4QMQA 4EC8A 4E5BA 4IW0A 3LFSA 3ANQA 4R1YA 4R6VA 3D2KA 4R77A 3FZ1A 2QODA 4S30A 4UZHA 3F69A 2PZRA 3F7WA 2WIHA 5I9UA 2RFDA 3Q4TA 4C4EA 2XH5A 3E63A 3FKNA 2BDJA 4U97A 4WSQA 4X2KA 4XRLA 5HIDA 2OJIA 3UO4A 1IASA 1WBSA 2DYLA 5FWKK 3NYNA 4YJQA 3OXIA 4EKKA 1P4OA 4I6BA 4JBPA 2QHMA 1OUYA 1JQHA 4FV8A 2OICA 3DLZA 3K54A 3UYTA 4NM0A 4CFNA 4BIEA 4E1ZA 1FVVA 3LFNA 3QXOA 3ODYX 1BX6A 4JOAA 5FTOA 4MVFA 3KFAA 5K4IA 2JKKA 5DNRA 3I0QA 3LCDA 5FXQA 3CQWA 3OD6X 4L01A 3D7TB 3GVUA 5IEYA 5EYMA 4TT7A 1H26A 3R28A 4OBQA 1G8KA 2Q0BA 5EOLA 5BV3A 2XRWA 1OBDA 4WG3A 1ZZ2A 5ETIA 3FSFA 2WU7A 3Q4ZA 3EQIA 5GJFA 5J7BA 3ZU7A 3JUHA 3LQ5A 3ZLWA 3D0EA 4AE6A 3DJ6A 3R8ZA 3NCZA 3NUSA 2A98A 5CAVA 3QC9A 3R63A 2JIUA 1XBAA 1AGWA 5K5XA 4PNIA 3W2OA 3L8PA 5E8XA 1M14A 3OCGA 4FT5A 3ATSA 1UU3A 2UZUE 2EB3A 3UP2A 3FL5A 3PY3A 4FKGA 2OFUA 4PX6A 2FUMA 2QKWB 5DR9A 2C5OA 3IGGA 3NR9A 4U43A 2RIOA 3HZTA 2IN6A 3W16A 4YPSA 5IMEA 3NRMA 4L3LA 3Q52A 1MUOA 4BDBA 2R3QA 3OWKA 4K1BA 4F9CA 1IRKA 1UKHA 5HO6A 1NXKA 5F20A 4B0GA 2JLDA 5JGBA 2XNBA 3NUXA 3AMAA 3Q6WA 2YZAA 4JIAA 3ZXTA 2OZAA 4ZK5A 4GVJA 2W9ZB 3CTQA 2P3GX 3TM0A 2YCFA 4BDCA 3OC1A 4ITJA 3CE3A 3ZRLA 3PVGA 4M67A 2CNQA 2CNVA 4Q5HA 4DH7A 4L67A 4QRCA 2VNYA 4HVIA 4CZUA 4ZY6A 4BN1A 2X6DA 4E8AA 3BIZA 3R73A 4C33A 2WAJA 4ZLYA 2GQGA 3NMUF 4BDDA 3LVPA 3DTWA 4M69A 4ZP5A 1T46A 1XHAA 3QKMA 3QD2B 4FV9A 4XH6A 3CSVA 3DBDA 3OWLA 3P7BA 5ICPA 3PJ1A 3C50A 3DTCA 3EFKA 5CF6A 3KMUA 4PTGA 4C4JA 4C36A 1LEWA 2VNWA 2QONA 2XCHA 3FMNA 3R7OA 3D5XA 4TZRA 3QRIA 2ZMCA 4FGRA 3EZVA 1M2PA 2X8EA 4NU1A 2ITQA 3H10A 3Q60A 2VGOA 4LRJA 4PDYA 5IEVA 4CG8A 3ZM4A 4YJNA 1W84A 3MJ1A 4WD5A 3P86A 3ZRKA 1Q41A 3SXFA 4P4CA 2YN8A 5M4FA 5M55A 3W1FA 4UZDA 5H3QA 3FMHA 5H8EA 4Z55A 3KGAA 4S2ZA 3ZO3A 5KHXA 2HOGA 3TDWA 5DEWA 4EOKA 4JAJA 3FLNC 5CZIA 5I9XA 3TUCA 4D55A 1OBGA 1REJA 2C6OA 2F4JA 3O50A 3CGFA 4PP9A 1GZKA 4O81A 3EYHA 5DH3A 4YJUA 2BZHB 3HKOA 5EW8A 5ANOA 1BL7A 4HYHA 3Q5IA 1XO2B 4JDKA 2B4SB 3PJ2A 5CU3A 2BDWA 2Z7QA 3DA6A 4U80A 5E1EA 2E9OA 3EQRA 3W2CA 1WFCA 3E62A 5HORA 4MXXA 5FXRA 5AM6A 1YXUA 4MCVA 4EBVA 1V0OA 3ZDIA 3VS7A 4Z16A 3ATTA 3OT8A 4O1PA 3GGFA 2X0QA 3HMIA 2OH0E 3LLTA 4MD8E 4YLLA 4DINA 5ANJA 2Y7JA 3CC6A 3R1QA 4CRSA 5ETAA 4IWQA 4HW7A 1OGUA 2W1ZA 1HCLA 5KMLA 3SW7A 5HLPA 2YCSA 5HBEA 3CPCA 4FKJA 5IUIA 3R83A 2Z02A 4KSPA 3HP2A 4V0GB 3UE4A 3NDMA 3F61A 1S9JA 3KY2A 2JKMA 2PWLA 3DU8A 3DBFA 4QYGA 3QBNA 3F66A 4IADA 4IJPA 4MWHA 3CS9A 5JK3A 2JKOA 3T3UA 5BVOA 5KO1A 3PFYA 1VLRA 4DEGA 2JBPA 1TQIA 3DKFA 4FTRA 5HCZA 2QC6A 1P2AA 4TWCA 5CQUA 2GS2A 1WBVA 2XKCA 4OUCA 3VBTA 3EZRA 3UMXA 4BY9E 1ZYSA 3L8SA 5IKWA 3E8DA 4CT1A 1GIJA 2J7TA 4AA4A 1UNHA 3LFDA 5CZHA 4MXCA 3RPYA 2UUEA 3MA6A 4QMNA 2OG8A 2DUVA 2XUUA 3PY0A 1PXOA 3D83A 1B39A 3OW3A 3KCFA 5TKDA 4ENXA 5JFWA 4PPBA 4L3PA 2PUPA 1RDQE 2HENA 4RJ3A 4KKEA 4RFZA 4YJOA 3NUYA 4ANNA 3VQHA 3PY1A 3L8XA 5CT7A 1ZY5A 4AGUA 4EOQA 1NW1A 3IKAA 2VX3A 4CFWA 1RQQA 4N6ZA 5AUVA 3SLSA 3HMNA 2O8YA 3HV3A 3O23A 4LOQA 4MQ2A 4AZEA 1R3CA 2X7OA 3FZTA 5DBXA 5IA4A 1NY3A 4C02A 1H1WA 5GIPE 4C2WA 4QMOA 2W05A 3WZEA 3BPRA 3VS6A 2YM6A 4UWBA 4RIWA 2I0EA 2C47A 3CGOA 4FZ7A 3WBLA 2XCKA 4FSQA 1PXKA 5DN3A 1JKSA 2XNGA 2HZIA 2IVVA 3KULA 2C6MA 5DVRA 4O7RA 3HVCA 3ELJA 5FP5A 1ST4A 4J7BA 3V6SA 4GFGA 4AWIA 4RG0A 4HVDA 4IXPA 5HTIA 3BE2A 5TF9A 2VWVA 3RJCA 4OTQA 3POOA 4L52A 5T6KA 3C0HA 5AUZA 3FPQA 2WTCA 1CKJA 4K6ZA 3R7GA 3SOCA 3ML1A 4JIKA 5E8VA 2PK9A 4BJJB 3UNZA 4DCEA 1J7UA 4QQCA 3O7LD 5HVJA 3BYOA 4FF8A 5IU2A 1OGYA 4LGDA 5AIKA 4AGWA 4NTTA 4CMOA 4GIHA 4ORKA 2JBOA 3RAKA 3A2CA 2ITPA 3MN3A 3UTOA 4C3FA 3P5JC 3Q9WA 1OL7A 3G5DA 4RFMA 4YTFA 3IOKA 3QL8A 4H58A 2R3GA 4NWMA 4EK8A 3GI3A 4FG9A 5H2UA 4XRJA 1JBPE 2ITUA 3R7YA 1SYKA 4FKRA 3KN5A 3CY2A 4QTAA 4X2GA 4A07A 2YERA 5HHWA 3AC3A 4GK3A 4Q9ZA 4LFIA 2GFSA 3GFWA 1CKPA 2W06A 2HWOA 4UALA 1BYGA 4EH8A 4EZ3A 4JX3A 3REPA 2ZM3A 1QMZA 2BRGA 4EJ7A 3IS5A 3LAUA 4DLIA 5CU2A 1OM1A 5C8MA 3R00A 2XK4A 3LFQA 1IR3A 3C4ZA 5EHLA 2ZV2A 4BF2A 2PUIA 3BHYA 3U54A 3RNYA 1PYXA 1OI9A 4HGSA 4RJ6A 4FV1A 4AT5A 1L8TA 2B9IA 3R1NA 1RE8A 4IWPA 5J8IA 2QO2A 4E4XA 2CN5A 4CCBA 4QPAA 2OF2A 3RTPA 3NNWA 4BFMA 3Q2MA 1VZOA 2QURA 3QGWA 3OWPA 5AR4A 2C0IA 4U3YA 4JDIA 1XH6A 3NX8A 4XJ0A 1JOWB 5AR7A 3BX5A 3CCNA 5HG8A 5F94A 2HYYA 2ITTA 5L6PA 3PTGA 4QMSA 4F7NA 3MFUA 3QYZA 3SXRA 1W7HA 3PIZA 4E4NA 2V62A 3QA0A 4O0WA 5EH0A 3FJQE 4N4SA 5DA3A 1U59A 3R2YA 4LV7A 4U41A 2UW9A 4IZ5A 3GCUA 5HD7A 2J6MA 5CNNA 3W2RA 2UZVA 2UW3A 3MS9A 1W98A 3K3IA 5D11A 2A2AA 2X0OA 4AOIA 5L2TA 4EWQA 4F1TA 3U9NA 2WOTA 4EOSA 4B9DA 2J0JA 2QNJA 5CWZA 2VD5A 4CYIA 5AM7A 5IH4A 3FI4A 4IBMA 4HYIA 3ULIA 3RZFA 4FOCA 4FTUA 1JSVA 2RFEA 4ACMA 5JFSA 1OKZA 4LV5A 4A9UA 3MY0A 2UVXA 4ZSJA 3I5NA 4DEBA 5D1JA 2PVFA 3S4QA 2QCSA 3KQ7A 4GYGA 2F2CB 4FTJA 2ZM4A 3PP0A 3MH2A 4MNEA 3FMJA 4D1XA 3SGCA 4DH5A 4J8NA 1CKIA 3PWYA 4CKRA 2W1DA 4CKJA 2PMIA 3GP0A 4A9RA 2X4ZA 4CV9A 5CQWA 2H8HA 3DBCA 4HCVA 1UWJA 3UMWA 5BYYA 3JR1A 3KCKA 1GIIA 3WE4A 3HAVA 4CSVA 4PV0A 2IF8A 4JI9A 4EOPA 2X9EA 4M68A 4MQ1A 4Q9SA 4D9UA 5EOBA 5LVLA 4M84A 3UQCA 4XG4A 1ND4A 2BKKA 3OY1A 1X8BA 1M2RA 3WYYA 4I93A 3FSKA 5F4NA 1JLUE 3QD4A 3S1HA 4HZRA 5E8SA 5CAOA 2YM8A 3PXYA 5EDRA 5HICA 1KUTA 4AU8A 3NAYA 3KEXA 4FYOA 4EHZA 3TZMA 4IAFA 2WTKC 3NSZA 5FTGA 2HELA 2PMLX 4XBRA 1SM2A 5L2QA 3C4CA 3MV5A 4U6RA 5IA0A 5CEPA 3PXZA 3F7ZA 1URWA 3EKNA 3JYAA 2XIXA 5G6VA 4FKSA 4D2RA 4GEOA 5KZIA 3I7BA 5LMBA 4G6OA 3HDNA 3LHJA 1H1QA 3HA6A 3DZOA 3ZDUA 4HCTA 2C5VA 4MTAA 5ITAA 5LCJA 2VU3A 1O6LA 1PW2A 4QP8A 5AX3A 4IB0A 3HAMA 2CDZA 2CKOA 4O4DA 3LMHA 4AW5A 3O8UA 3H0ZA 3D5WA 2BAJA 2XAOA 5B0XA 5TO8A 4AW0A 3VS1A 2WU6A 4G3EA 3FMKA 4FV6A 4BBEA 5AV4A 4I5PA 3G9LX 4O22A 3DKGA 4PDOA 4G31A 5JZNA 2Z7SA 3SXSA 4F7LA 2XARA 3GQLA 5FXSA 4GL9A 3V5PA 3FQEA 2XBJA 3G51A 4KABA 3FXXA 4KSQA 5GNKA 4P5QA 3ZTXA 2UVZA 5IQGA 3F3ZA 4I5HA 4XLIA 4D2VA 1JAMA 3MVLA 3EFJA 4ZSGA 3DDQA 2R3LA 2W17A 1IEPA 4BVUA 3AG9A 2QLUA 4KIKA 4RBLA 5DOSA 4FKTA 4L6QA 5HE3A 3VBVA 4RPVA 2OGVA 5IQAA 4FV4A 4YZ9A 3RAWA 3SRVB 1KSWA 2IO6A 2V0DA 5C01A 1ZMWA 4EKLA 1Y91A 2YCRA 3D14A 3ZONA 3I79A 4JT3A 3TJDA 4R3CA 4U8ZA 3CR0A 4BCQA 3W0QA 3ZO2A 2HIWA 3S3IA 4U7ZA 4ZTHA 4MHAA 4TWNA 3NFGB 3UDZA 4C59A 2YJSA 3R8LA 3UOLA 4DH3A 5AAEA 2ZDTA 2WNTA 4NM7A 5GZAA 2GPHA 3LPBA 3TACA 2J2IB 4KBCA 2R7IA 2ETMA 5E7RA 3BKBA 4F7SA 4H36A 5E90A 2BAKA 2XYNA 3MI9A 3A60A 4BCOA 5IZFA 4FEXA 3NLBA 2VTPA 3RAIA 5IPJA 5JEBA 2R5TA 4XG9A 2GNLA 4RJ4A 5JGAA 4F6WA 3R9OA