2YCRA

Crystal structure of checkpoint kinase 2 in complex with inhibitor pv976
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
282
Chain Sequence
VYPKALRDEYIMSKTLGSGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTAKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structural Characterization of Inhibitor Complexes with Checkpoint Kinase 2 (Chk2), a Drug Target for Cancer Therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 282
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ycrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ycrA01
5KZ0A 4FTLA 2YDKA 3BQCA 2EUFB 4ZTQA 4EONA 3CKWA 2PE2A 4O21A 4DEDA 3CD8A 3MVMA 4DGGA 4RFMA 2JDRA 2Z7LA 2JIVA 3GFWA 3HMPA 2ZMCA 4GRBA 1JSUA 3F82A 1TVOA 1H8FA 2VGPA 3ZBXA 3C4XA 5G1XA 1W98A 3RM7A 4JRVA 1OL1A 1M7QA 5I9YA 4TYHA 3QQFA 2REIA 4D5KA 3Q9YA 4KUJA 3SV0A 4D2WA 5CT0A 5BX0A 5TOZA 2FSLX 2QU6A 5IH6A 2J50A 4FOCA 2UZNA 4QP8A 3G0EA 5AIRA 1CKPA 1Q5KA 2XK4A 3ZSHA 3A4OX 4TPTA 5B2MA 2X7OA 4YZMA 1CSNA 2VWYA 2PZ5A 4QMWA 2V55A 5TR6A 1YI3A 5H3QA 4FK3A 3R83A 3FJQE 2VTJA 4YPSA 5TF9A 4IM0A 2UVZA 3F2AA 2Z7SA 3IW4A 5BUEA 5KKRB 3BGQA 3L8PA 4NFNA 4DINA 3GC8A 1SVHA 2V7AA 1ZLTA 2QNJA 3HEGA 1VYWA 3JPVA 3FZTA 3FQSA 4EH3A 4EJ7A 4F7NA 3TUCA 2ITOA 5BUJA 4IAAA 3TIYA 3VUDA 2PY3A 4LV5A 3BLRA 1H0VA 5HG7A 3ZXTA 5ANKA 1KWPA 3AC2A 4ZXTA 3SQQA 3TACA 4O7WA 3R00A 5H9BA 4BWPA 5CQUA 4K9YA 2HXQA 4QNYA 4A9RA 3RNYA 4P5QA 5BMMA 2CLQA 2QOKA 2VRXA 4FSNA 4K77A 1QMZA 3SLSA 4XBRA 5EI2A 2PZIA 4BDCA 2UVXA 3QRKA 2ACXA 5IA5A 5HNGA 4IDTA 4BCIA 3P7BA 3AC5A 3BQRA 3KXHA 2C6OA 2PVKA 4YO4A 5M56A 3LJ0A 3KXMA 4EEVA 2JFMA 4LGDA 3Q5ZA 2R2PA 4IVDA 4PP9A 5HBHA 3RMFA 4ANMA 4S34A 3ORMA 3QYWA 4KSQA 4MXYA 1QPEA 2I0HA 2YIYA 3BHTA 5AR3A 2VWBA 2CMWA 4IQ6A 3W2CA 4BCGA 4BDIA 3L8XA 2OIDA 4MF0A 2JD5A 2O65A 3FZSA 3O17A 4MD7E 3FYJX 2HK5A 3IO7A 4EI4A 1KUTA 4UMTA 3FL5A 3QX2A 4FL3A 1YXSA 5C9CA 3B8RA 5L2SA 3ANQA 2I0VA 3RPVA 5IZFA 4F7SA 3UNZA 4FT9A 4XG8A 4FBXA 2J2IB 3LJ1A 2J90A 4MK0A 2XEZA 2OH4A 3DBDA 3FKOA 2BZHB 1YHVA 2QOFA 2VO3A 3OCGA 2IJMA 3OBJA 4C7TA 4DEEA 4E4NA 3CSVA 3EQGA 5CI6A 2GHMA 2BKKA 3TIZA 1YOLA 3EQBA 4ZJIA 4NT4A 2XRWA 3UE4A 3CPCA 3JS2A 3RBWA 3S95A 5K5NA 4PTGA 4R8QA 3UO5A 4A9TA 2X9FA 3R63A 5J9ZA 3HAVA 1E1VA 3ZO4A 4NW6A 4E4XA 5K4IA 3ZO1A 4OTDA 5CF5A 4O7RA 2WTDA 4L52A 4AAAA 4IJ9A 3PLSA 4XV2A 3W32A 4FSZA 3T3VA 3KMUA 4O0SA 1WZYA 1MP8A 3Q9XA 1OKZA 1XWSA 1FINA 2PVLA 2RF9A 4YZBA 2CCHA 3PWYA 1OL5A 1JKLA 4XG2A 1P4OA 3QYZA 3TKIA 4AWIA 5LJJA 1OUYA 2VTPA 5FP6A 1MQ4A 3ZTXA 4WOVA 3ZEPA 3HV5A 5BVEA 1W83A 2RL5A 3IECA 4JR3A 4MQ1A 1GY3A 3FXZA 4PDPA 1YDRE 3KXXA 4RSSA 4I1ZA 3MVHA 4LOOA 3C5IA 4ZTLA 3AD5A 4NL0A 3ZZWA 4AGUA 3PXRA 2W1HA 5DR2A 2W06A 5I9ZA 2OIBA 1RQQA 3PPJA 4G17A 4QP6A 3GOPA 3WOWA 4EOKA 2ZV9A 4WNOA 4YHTA 2OXYA 5CEMA 1JVPP 4Q9SA 3NYXA 3P7CA 5LXMA 3FMMA 3L9MA 1IA8A 5FBOA 1YW2A 4QTEA 3OY1A 2R7BA 2CGUA 2IZRA 1OMWA 1W82A 2H8HA 2WQOA 2YISA 4OBPA 4CMUA 5BVNA 2Y9QA 1GZNA 1R0EA 2C5YA 3FLZA 3MY1A 2F2UA 2VUWA 4FC0A 4BCFA 4D5HA 4DEGA 4YLJA 4DITA 4HCUA 4RZVA 3E8CA 2JKOA 4BWXA 3G90X 4OTIA 1UKHA 2HWOA 1BL6A 4XJ0A 2FVDA 3DXQA 5EKNA 3EN5A 3NMUF 4X2KA 1DI9A 4X3FA 5HI2A 3EN9A 4JDKA 5HG8A 3PIZA 1WVWA 4RT7A 2OJ9A 4WIHA 2C5VA 2GNGA 5E4HA 3DKGA 4TWCA 2UW0A 5FDPA 4II5A 3VBQA 3LMHA 3BGZA 5HO8A 3FZRA 3S2PA 3LHJA 3PVGA 4CFMA 2HYYA 5CU4A 4B6LA 3UVPA 4M97A 4E8AA 3PA3A 3PYYA 3PVBA 3QD4A 3KF4A 5CAUA 4GW8A 3I6UA 4FG8A 1ZMWA 4M12A 2OG8A 4DHFA 3MPAA 2E2BA 3QHWA 3WZKA 4USFA 3TDVA 3QBNA 5AIKA 3ZXZA 4ASZA 4FKIA 1PXPA 5IQDA 5M4FA 3U6IA 4KAOA 3CC6A 4M69B 2X39A 1UU3A 1H1SA 3D5WA 4QQ5A 5T68A 5HQ0A 1BKXA 4GH2A 3P5KA 4MWHA 4WNMA 1GIJA 4I5HA 3OWKA 4BCNA 4JBOA 1OKWA 2WGJA 4CD0A 2YN8A 1DAYA 4TWNA 5J7BA 2G01A 2ZM1A 4X2GA 3VS1A 4WHZA 1Z5MA 5HEZA 1OL6A 3RK7A 3FPMA 4J71A 4F6SA 2QKWB 2IVVA 3D7TB 4KIOA 4RPVA 2UUEA 3R9RA 3DQWA 4OBQA 4CKIA 4YGAA 4O82A 5AP7A 2P55A 3NUXA 3NW5A 4EHEA 4MAOA 1Q24A 1CMKE 3GU7A 4PMPA 5AR7A 4PWNA 2R3IA 4PMTA 3CBLA 2BAJA 2XNNA 2R3GA 1XH4A 3DDQA 2ZVAA 1V0BA 2EVAA 4QD6A 4QYEA 5AM6A 4BFMA 4O81A 1ZY5A 3R7UA 3CY2A 2QG7A 1URWA 2VWUA 3DAKA 1KE7A 3DS6A 3KN6A 3RZFA 2IWIA 4E7WA 2VTRA 4IX5A 2UW9A 2W5BA 4Z9LA 5FBNC 5KUPA 3ZM4A 3HECA 3NSZA 2BAKA 1KV2A 3BBTB 3QA8A 2X4ZA 5K0XA 5AR8A 5HHWA 5KMOA 4IC7A 4H1JA 4KKHA 4GIIA 3FXWA 3FKLA 2J51A 3EQCA 5TT7A 4HVGA 3BV2A 4R7IA 4O7SA 1YI6A 4G9CA 5D11A 3FEGA 3O2MA 2XCKA 3UVQA 4XCUA 2PVHA 4G34A 3AMYA 3CCNA 2PVNA 2J4ZA 1QCFA 4UX9A 4ZZOA 5DR6A 3VQUA 1U5QA 3TNWA 3V6RA 2X7FA 5JZNA 3BE2A 2OFVA 3OS3A 3UQCA 2YJSA 4UY9A 5K5XA 5M53A 3BEGA 3QALE 4LYNA 4FIJA 1ZYCA 3PUPA 1JSTA 4O38A 2GQGA 4JDHA 4GT4A 3FI4A 4A4XA 2KTYA 4G3CA 3DBCA 4MXCA 4U44A 4ZS0A 4W8EA 1WVXA 3G6HA 4BDAA 4QMNA 2XNBA 1W8CA 4HYHA 3U55A 4DLJA 1NVRA 3H0ZA 5AP2A 3TNIA 4JJRA 4UEUA 3ZDUA 5EDRA 4D1ZA 2ZAZA 4IMYA 2QOIA 1JOWB 3I5ZA 2G1TA 2XBAA 3DZOA 1VEBA 4U3YA 2VWIA 3MFSA 3P86A 5E90A 3PG3A 2I6LA 4CZUA 2H9VA 3DAJA 3DTWA 5AWMA 1Y8YA 3E8NA 4ZEGA 3VBYA 3LJ2A 4CZYB 3CJGA 3W8LA 4QQTA 2Z7RA 4H3BA 3ROYA 4G5JA 4OAVB 3AOXA 2RKUA 3BZ3A 3KQ7A 3CR0A 4BDEA 3WZJA 4FK6A 4H3PA 4UMQA 3LCTA 3F3VA 5A4LA 3JXWA 4IADA 4B4LA 5AJQA 3A60A 3S4QA 3VHKA 4F64A 4GFGA 3R22A 4ASDA 4WSYA 2XVDA 2E9VA 4Q5EA 4YLKA 3FSKA 4G6LA 4MQ2A 2OU7A 2VZ6A 4XG4A 2F57A 2JIUA 3ODZX 5F95A 1FGKA 3CPBA 1IA9A 2CGVA 1NVSA 3QA0A 3POZA 1YRPA 4ZTMA 4CMTA 3C4WA 4QP1A 5LVOA 3D2IA 1VR2A 1YOMA 2HAKA 4WBBB 3LQ3A 3C4EA 2WMWA 3E64A 3MPTA 4JNWA 2ONLA 3RPYA 4KRDA 4S33A 4JAJA 5IQIA 5HVYA 3V3VA 4QMTA 1I09A 4H1MA 4FE2A 3P1AA 3MA3A 5JMSA 2ZV2A 2UZUE 3ROCA 3VUKA 1SNXA 2GNLA 5F1ZA 1M2RA 5J5SA 4OTRA 2ITVA 4BCMA 5D9HA 2VX1A 3O23A 5DFPA 5DR9A 2JDVA 1M2QA 5ANJA 2ITNA 2CGXA 3Q5IA 3V6SA 4AGWA 3R0TA 4OR5A 1VJYA 1ZZLA 4MNFA 1XHAA 3MH3A 1PKGA 4NJDA 2UW6A 2YCFA 3I1AA 4QTCA 2OW3A 4FKUA 4TNBA 3FY2A 5CQWA 4O0RA 2UZOA 5ETAA 5CXZA 3GC0A 5FD2A 4QMOA 3BYSA 4YNEA 5CY3A 3FBVA 3HX4A 3OCSA 3ZRLA 3SG8A 3M42A 3PJ1A 5HOAA 4MBLA 3OFMA 3LZBA 4D1SA 4OUCA 3UO4A 4J7BA 4NM0A 1DAWA 3QAME 3D9VA 4R1YA 5B2KA 4EK4A 3NVMB 3OWLA 4YP8A 4BTKA 2WELA 4L00A 2R64A 4UN0C 4BICA 4RRVA 4H58A 5C4KA 4QQJA 3VW6A 1AQ1A 4FICA 5H8GA 3A99A 4G3EA 2RG6A 2C68A 3ORNA 4ID7A 1YDSE 4USEA 5FTGA 1U54A 4JOAA 3GP0A 5EFQA 5HGIA 4Z7GA 4J53A 5AAGA 3PPKA 3O7LD 3HRCA 3BYUA 5DIAA 3R8VA 3TNQB 5HIEA 5EM7A 3EOCA 4IZ7A 4L6QA 4LI5A 4EKLA 1UU7A 4YZ9A 4BHNA 4AZWA 3TZMA 1A48A 3WF5A 3E88A 4BVUA 2A4LA 2PMOX 2X0GA 3EIDA 2DS1A 4I92A 4YURA 3DJ5A 2YCRA 2WMXA 2J5EA 4F70A 2YWVA 2BFYA 3HLLA 2RFSA 3NNUA 5CT7A 3UOHA 3ZCLA 3ZFYA 2YZAA 3QZGA 3OY3A 2WD1A 4JL9A 3TTIA 4BZNA 4LRJA 5CEQA 3DAEA 1NY3A 4NZWB 4MKCA 4XLVA 3R02A 2C6IA 2WOUA 3R8ZA 4FNZA 3R9OA 2C5OA 4FTJA 3HL7A 4O0XA 5C8MA 4GJ2A 1E9HA 5LMBA 3QTXA 4ANSA 3HA6A 3BELA 2J0JA 5CSXA 4XLIA 5IDPA 1IEPA 5CZIA 4GU9A 5CNOA 4PRJA 2XIRA 3ZLWA 3R01A 3WZEA 3I4BA 1F5QA 4G16A 4FKVA 4JBQA 5AP5A 3S0OA 4EH4A 4I41A 3BGPA 1SYKA 3L9PA 4GVJA 3VRZA 5A6NA 3OWJA 3AT3A 4CQGA 4BR3A 3H4JA 3RHKA 3THBA 4FMQA 4M66A 4FGBA 2CJMA 2ERZE 4FTAA 5DH3A 4AP7A 4ZP5A 3MFRA 2BCJA 3BRBA 3TV6A 4JVGA 4R3RA 3LM5A 1MRUA 4C57A 1OPJA 3ACJA 5EW8A 5JFSA 2SRCA 3A61A 3RGFA 5IQGA 1J91A 4LMNA 3KRRA 4C3FA 5AP3A 5EQEA 4V01A 3U4UA 5M44A 3PXQA 2XEYA 4I4EA 4RGJA 4Y8DA 5CVFA 4CT2A 5K0KA 4D2TA 4EWQA 2R3LA 3LMIA 3BU6A 3LFCA 4CFVA 5CVGA 2UVYA 4AXAA 4C3RA 5CF8A 4FV9A 2HZNA 4QP4A 4LUEA 4TYHB 5ANEA 3LM0A 3Q4ZA 3RI1A 2WXVA 4WSQA 4ZTHA 3MH1A 3QRTA 1FMKA 3SOAA 2YM8A 3V51A 4AZTA 4BF2A 4EL9A 3D5VA 3R9NA 4BCOA 4BTJA 4DFNA 4EORA 3NNXA 2YACA 3K5UA 3HP5A 4LQMA 1KOBA 3C0GA 4E93A 3ALOA 3K5VA 5I9VA 2W1DA 4NM7A 4F1MA 3EL7A 3H9FA 3UPZA 2VWZA 3H9OA 4NW5A 3A7GA 4U43A 2QOOA 3PPZA 3LVPA 4IFGA 3RWQA 4I93A 4Y73A 3F3ZA 4YJVA 2QOBA 4FUYA 4R1VA 3PRFA 5FLFA 2WMSA 4FVPA 1ZARA 3ORZA 5C27A 4KKGA 3FQEA 5F9EA 3NUAA 2BRNA 3VS5A 4Z7HA 3OEFX 3VS6A 3FPQA 3CTQA 4RJ8A 1SMHA 4C58A 5IA2A 1OPLA 4FV0A 4JR7A 5ANDA 5EQYA 3BBWA 3GNIB 4ZY4A 5GZ9A 1Z57A 2GPHA 4E5WA 1NVQA 3FAAA 3VAPA 3HMIA 3WF6A 3MTLA 4P7EA 3GI3A 3MIYA 4RX5A 2HZ4A 3KVWA 4AW0A 4DT9A 4EC9A 5AEPA 3QRJA 4YNOA 3Q96A 2ITYA 4DA5A 1URCA 3UVRA 4YUQA 3IOPA 2F9GA 5L6WL 1LEZA 2JKMA 3COKA 3FC2A 3KXNA 4ANNA 3HUCA 3UYSA 4RC3A 5CU0A 3HRFA 3DY7A 1UU8A 4L9IA 1UWJA 3R1NA 3NUUA 4KS8A 2C3JA 2BVAA 2F4JA 4FL1A 1WMKA 4TYJA 3T3UA 3UOLA 4YJOA 3AMBA 5K3YA 4EBVA 1W84A 1XBAA 3OUKA 4JX7A 5F4NA 1U46A 3EN6A 3IW8A 4U0IA 2PMIA 5FWKK 2X2MA 5CENA 3A2CA 4B9DA 2WTWA 3O96A 1UNLA 1KOAA 4HVHA 4F63A 3HNGA 2E9PA 4ANLA 2J7TA 4YMJA 1YQJA 5CYIA 3VUTA 3A4PA 3FY0A 3O8TA 2HXLA 5HO7A 5KMLA 3IDBA 2X7GA 4FSUA 2JEDA 2X81A 4DGNA 1YXVA 5JRQA 4BTFA 2XA4A 2QVSE 3NYVA 3DBQA 1OKYA 2GNJA 1J1CA 3PTGA 3KEXA 2HENA 4XEYA 4O1PA 2PTKA 3K2LA 1ZMUA 2C47A 4IZAA 5EH0A 4C2VA 5M09A 4D4SA 4I0SA 5KBQA 3A7FA 5C1QB 3VS2A 4FR4A 3RJCA 5B0XA 3LXKA 4XRJA 4EZ3A 4EHZA 3BYMA 2QOCA 5CTPA 4PTCA 2W0JA 3QTIA 2C3KA 4P2KA 3DZQA 4GEOA 4QMUA 3SAYA 2BILB 2P3GX 4UWCA 4WUAA 4DH5A 4E6AA 2UZDA 2WEVA 1U4DA 4TN6A 4C4EA 4EYJA 3P0MA 3JVRA 3JY9A 4XG9A 4F08A 4O7NA 4S32A 3R30A 4FYOA 5DWRA 2C6DA 4D2PA 3TWJA 5DPVA 4M14A 2EWAA 3LPBA 5E1SA 5AP0A 4B99A 2PULA 3A8XA 1OUKA 2JC6A 1Y6AA 2J6MA 5BUIA 3DGKA 4UZHA 3NEWA 4PPAA 2HW7A 5IKWA 3RWPA 4AZVA 1OIUA 3GU5A 4FSRA 4IZYA 5EYKA 3U54A 2OZAB 3FLQA 4XHKB 4BRXA 4X2JA 2WMQA 3MBLA 3AGMA 3KULA 4NCTA 2J0MB 3MW1A 4WBOA 1FVRA 3DK7A 2VAGA 5IEVA 3BHUA 4O7TA 2CNVA 4PNKA 4FA2A 4DH1A 3EFWA 5AFVA 3O50A 4IB1A 5EYCA 5GJDA 1APME 4JQ7A 4ZTSA 3FLYA 5L6OA 2VTIA 2GNHA 2YERA 4BBEA 4UWBA 3DTCA 5I5ZA 1XH6A 3DKCA 4G31A 5KBRA 1UWHA 3W2QA 3KRLA 4DBNA 4G9RA 3PXZA 5BNJA 5HTBA 3OEZA 2C0TA 4D2SA 5GIPE 3IPHA 3REPA 4BI2A 4HVDA 3KK9A 4GK2A 4RJ4A 3CQUA 4AA0A 5JQ8A 2YWPA 5CSHA 2VTOA 2R3QA 2XK8A 4CFNA 4ZAUA 5HZNA 2ZOQA 3PJCA 4U9AA 4A9SA 4EBWA 2OWBA 3CLYA 1PXJA 5IU2A 3VN9A 4AX8A 3GVUA 1H4LA 4ZMFA 1L3RE 4P5ZA 3QC4A 3SW4A 3UBDA 3GU6A 2FSOX 4DTKA 3F88A 4E4MA 2HCKA 3TM0A 1EH4A 3FMKA 4IFCA 4ZTRA 3ZSGA 3C51A 3EYGA 5DT0A 4EOJA 2CN8A 3GOKA 4FIIA 3UOJA 4DAWA 4QMXA 3JYAA 4J8NA 4HNFA 3UP7A 2HELA 4E1ZA 5JEBA 2HY0A 5F20A 3WZUA 3M11A 4TTHB 4J8MA 5M4CA 3ID6C 3SKCA 3G6GA 2VTMA 4O91A 5HE3A 2JITA 4FKOA 4IE9A 5T3QA 3UZTA 5AUTA 5C4LA 3TT0A 4E6CA 2H96A 1G8SA 1QPDA 4IJPA 3ZZEA 5JZJA 5IISA 4WD5A 2DWBA 2WHBA 4YPDA 5CX9A 4RX9A 4JG7A 5HTIA 2JDTA 3OG7A 2YLEA 5AP6A 4M84A 5ETCA 1YWRA 2W9FB 2BFXA 4YO6A 3S1HA 3R71A 3TN8A 2HY81 2JDSA 4MWIA 2ZDUA 4IB3A 4O6EA 3Q53A 4GFOA 4QYGA 3IK3A 2UV2A 3HZTA 3NW7A 4ITIA 4ZY6A 5DA3A 3WARA 4MYGA 4F9BA 4J95A 1H1QA 4HGLA 4KA3A 5HD4A 3NZ0A 3PZHA 4G2FA 3QKMA 2GQSA 4DFBA 3F5PA 4BIEA 3P78A 3KC3A 5L2IA 2BALA 3OT8A 2R3MA 4FKTA 3ZYAA 4IXPA 2GQRA 2BTRA 4FTCA 4QMYA 4RJ5A 5CLPA 3DFAA 5A3XA 2C30A 2RG5A 5EM8A 3RTPA 4AU8A 2V0DA 2UW5A 1H00A 4R7BA 3P08A 3EQFA 4Q2AA 4BYJA 2X9EA 3UIMA 2ZDTA 1FGIA 4ASXA 4MHAA 4IHPA 2P0CA 1PXMA 5AUWA 4QMSA 1GIHA 4FODA 2ZB0A 3R7EA 4BCPA 4G3DA 3H10A 2WU7A 1PMUA 3Q4CA 3LXPA 1UNGA 2QODA 3CD3A 2WTJA 2JAMA 4BB4A 1TKIA 4NIFA 1ZWSA 4HZSA 2BZKB 3WZDA 3MY0A 4D55A 4RIOA 5IQBA 4C59A 4ANBA 3BYOA 5CXHA 1GOLA 2G9XA 3NR9A 5GHVA 3R7YA 3PVUA 2R3KA 3GCUA 5J8IA 4I94A 2NP8A 4UYAA 4IACA 1BI8A 4NU1A 3N9XA 4ANQA 4FTMA 2R3NA 4YBJA 4ZLZA 5A4CA 5CALA 2QLUA 2JBOA 3MJ1A 3ODYX 4W4VA 3HMOA 1JPAA 1R39A 4HZRA 5EYMA 3GCSA 4Z16A 4GK3A 3OTVA 3GQIA 2OXDA 2V22A 3UG2A 4BIDA 1H27A 5LWMA 3FE3A 3HMMA 4QMZA 3QQGA 3ZH8A 3W8QA 4FEUA 3F3WA 1PF8A 2W1IA 2XB7A 3HV7A 3FMJA 3R2BA 1PYXA 3ZLYA 2Z02A 4ZK5A 4IAFA 4RIYA 2B9JA 2CSNA 4L3LA 3U6HA 1GAGA 3UGCA 2XJ1A 4RIWA 3DLSA 5A4TA 5ANGA 4FTRA 2XIKA 4ZSLA 3F5UA 3LE6A 5CEPA 1FVTA 4DFUA 1QL6A 3AC3A 3VBWA 5IQAA 3TJCA 3SGCA 3RAIA 4FKWA 4NKSA 4MH7A 3L9NA 1CKIA 4IM3A 4WT6A 1JQHA 3W16A 3OXIA 1Q8TA 2PMNX 2X8DA 5ETFA 5C26A 4EJNA 3NLBA 4U7ZA 4E6DA 4ZZMA 4IAKA 3WYYA 3SA0A 4RWKA 1H1PA 2Z7QA 3R1YA 4LV8A 4F1TA 3GCQA 3VHEA 3UNKA 4AACA 2IPXA 2HW6A 4KSPA 4JLCA 2R3OA 3LW0A 2BDJA 3FI2A 4HGSA 4FIEA 3AT2A 3DPKA 2B4SB 2PZPA 5G6VA 3F9NA 1PRYA 2W96B 4LOPA 2XYUA 5EI8A 4YTFA 2G2IA 3FKNA 4U45A 4F09A 3RK9A 1P4FA 2UZLA 4DFZE 4CTCA 2JLDA 1JKSA 3BI6A 3DNDA 4X3FC 4JBVA 3QTRA 3T8OA 4L8MA 2IVTA 4FT5A 5A9UA 3F2NA 1WFCA 1F0QA 4RVLA 4A06A 4MCVA 3UZRA 3ZUTA 5KHWA 3MYGA 4NYEA 3I0QA 4GVAA 3EQRA 2I0YA 3OCBA 3V5TA 4AT4A 4RVTA 3QQJA 4PNIA 3CEKA 5HTCA 3C4CA 5CSWA 4FSMA 4KNBA 5DBXA 2ZJWA 2C6EA 3FZPA 4K1BA 4XYFA 5CU2A 1JKKA 1JSVA 3KGAA 3FHIA 4YSMA 4QYYA 5CEKA 3SRVB 3TZ8A 4DT8A 2JFLA 3PE2A 3R04A 2KULA 4O0YA 5HU9A 3VUGA 3R2YA 5AV2A 1PXIA 3NX8A 4QMVA 4JI9A 2V7OA 3NVKI 4IANA 2ZM3A 2LAVA 1I44A 2W05A 3U8WA 1KV1A 3EH9A 2ITZA 4GL9A 1SNUA 4QP9A 5FTOA 1TQIA 4C0TA 1U54B 4DC2A 2BROA 4FV6A 4AA4A 3RPRA 4DH8A 4YJPA 3FI3A 2ESMA 4V0GA 1FOTA 4YZCA 2A27A 2QOLA 5FM3A 4ASEA 4QQCA 3SD0A 5GZ8A 3ZC6A 1LP4A 1ZYDA 5HD7A 3DA6A 1J3HA 2VTNA 3KRXA 2XRUA 2IVUA 3QZHA 1LEWA 3UJGA 4MXOA 3VF9A 4ZZNA 5IUHA 2CKOA 4J99A 3G5DA 4D28A 5IQFA 3AXWA 1XBCA 2YIQA 4ERKA 5IUGA 2WMRA 2QHNA 4HGTA 4EUTA 4EZ5A 3UPXA 1SVGA 2XIXA 3FQHA 4XS2A 5JN2A 4O86A 1AGWA 3OUNB 3LXNA 1Y57A 4G1WA 4YHJA 3PY3A 4ZSJA 3TI1A 4O84A 3EHAA 4RFYA 4RQKA 3VW8A 3WF9A 3C0HA 2VX0A 2QO2A 2BAQA 3QGWA 5I3OA 3ZO2A 5DGZA 1MRVA 4X2NA 1YXTA 2VTQA 1JNKA 5AADA 4O7LA 1YXXA 4RZWA 2QU5A 3NPCA 4IC8A 5HCXA 2GFCA 1VZOA 3TUBA 1Y8GA 3NW6A 2B53A 3TKUA 5HLNA 5CF4A 4AN9A 4PDYA 3FSFA 3UC3A 4E73A 4IB0A 3R8LA 2NRYA 3IS5A 4PL5A 4EZ7A 3E7VA 3PXYA 2W1EA 3II5A 2HWPA 4HW7A 3BEAA 3GC9A 1QPCA 4UALA 3ZONA 2VO6A 3R7GA 3HV6A 2HZ0A 3P4KA 4L01A 1GIIA 3AG9A 3IDCA 5JRSA 4FZ7A 4ACCA 5IMXA 2OF4A 5JFVA 4Q9ZA 3V5JA 2PVJA 3KREA 1YWNA 5L4QA 2CPKE 3DK3A 3R9HA 3PP1A 4K18A 3E63A 2PZRA 5CSVA 5EI6A 4AZSA 2XUUA 3LAUA 5BVFA 2FH9A 2HOGA 2PZYA 4LUDA 5AR5A 3V5WA 3QUPA 2J0IA 1ZAOA 3VNTA 5IEXA 2AYPA 5HCZA 3SG9A 3F66A 4RVMA 4J98A 4QYFA 3RAHA 3NRMA 4MBIA 4C4HA 3BIZA 3LLAA 5CWZA 2OICA 3CE3A 3VS0A 5J7HA 4MTAA 4DBXA 3BU3A 4JS8A 4AGCA 4ARKA 2WQEA 5GNKA 1HOWA 1PKDA 4OTPA 3D14A 3K3JA 3ZC5A 2PK9A 5AAFA 1IRKA 3ORLA 3QTUA 4C4JA 3D5UA 4KBKA 3COHA 4L7FA 4H05A 2VO7A 3DB6A 4N0SA 4XUFA 5L3AA 1OZ1A 4KIPA 4X2FA 4G3FA 5ACKA 2XK9A 2ZV8A 4KD1A 4OGRA 3C50A 3PE1A 4ANOA 4D2RA 1GZKA 3NCGA 2ONLC 5E1EA 4DGLC 5BYZA 5J79A 3QRIA 4TRLA 1YVJA 5TKDA 3EZVA 3R7OA 5JK3A 5BVDA 3PFQA 3TXOA 3QLGA 1PXLA 3FMHA 1H07A 4RIXB 5IDNA 2VU3A 5AX3A 3G33A 1PW2A 5KCVA 3DXNA 4FVRA 4QTAA 1A9UA 3KVXA 3DKFA 4KBAA 4FV4A 3SC1A 1B38A 4XX9A 4ZIMA 4APPA 3AC8A 1WBWA 2W1FA 1H0WA 3T9TA 3AD6A 4IAIA 2F7XE 3CQWA 2OJGA 4JX3A 2VX3A 1L8TA 3OBGA 3MVLA 5M55A 4YC8A 1TQPA 4RVKA 3TKHA 2GNFA 3EN7A 4NKAA 4EKKA 4YTIA 4HJOA 4I5PA 5M51A 1UA2A 1P5EA 4O96A 2BDWA 2X6DA 5HU3A 5ANIA 1YI4A 4ZJJA 3Q60A 3R8MA 5I3RA 2YM5A 2OJFE 3MTFA 3CY3A 4KABA 4AW1A 4W9XA 4EOSA 4EH6A 1M17A 2XNEA 4QTBA 1WBNA 4M13A 3QQLA 2C1AA 3ERKA 4KIKB 3E92A 4I23A 5J95A 4TYIA 2WB8A 3Q9WA 4TWPA 4RMZA 4MXZA 3QKLA 4I3ZA 4BGQA 1OI9A 1UV5A 3MSSA 3FMEA 4Y83A 3E7OA 3LFSA 4F0GA 3QTWA 5CF6A 5AUXA 4F7LA 4CFXA 2YAAA 3BU5A 2UZEA 1BLXA 2EXMA 4MXAA 4EUUA 2I0EA 2WQMA 5HIDA 4CEGA 4EHGA 4FGRA 4GJ3A 3N4UA 2F2CB 1ZYLA 5BQ0A 5LOHA 1H25A 3E5AA 2B0QA 1B6CB 4TWOA 1YKRA 1JBPE 4RX8A 3D94A 1STCE 2BIYA 3IG7A 2ZYBA 4I0TA 5LMAA 4NH1A 2BRGA 5EK7A 1Q8WA 2CKEA 3QRUA 3QUEA 4K11A 3KRWA 2P2HA 5CI7A 4QMQA 2PYWA 5J87A 4BDDA 3BLHA 5AV3A 4EHVA 4FX3A 3C4ZA 2WMAA 4O6LA 2BIKB 3K54A 4A9YA 3PJ3A 4C62A 4R5YA 3MJ2A 4C4FA 5K9IA 1ZXEA 2ITUA 2IG7A 2P4IA 2J9MA 2QC6A 4UZDA 5JGDA 4K0YA 4O2PA 1OBDA 3ZS5A 1R0PA 3KMWA 3VS7A 2C4GA 4I5MA 4BDHA 3ZUUA 5EDPA 5A14A 2CKQA 3KU2A 3A62A 3EFJA 4KRCA 4IB5A 2UZTA 3LOKA 2ITQA 1WAKA 2Z60A 3QCYA 3FHRA 3O0GA 3ULZA 4FV3A 2Z8CA 5DHJA 3QGYA 2G2FA 3ALNA 3EQPA 5AR4A 5FXQA 3ZEWA 4W9WA 3QD3A 5JSMA 3QCSA 4H36A 1H24A 3UQFA 2QHMA 3MPMA 4U81A 4G6OA 3VBTA 2YCSA 3WILA 5I0BA 1E1XA 3R21A 2DQ7X 2R7IA 5CAOA 1R78A 1OECA 2OGVA 3OOGA 2WIPA 4FT3A 3PRIA 3R7VA 3KFAA 1R1WA 2WMTA 1WCCA 3CTJA 5E8ZA 1H1WA 5AV0A 4I21A 3MIAA 2Y6OA 2OBJA 5FTQA 4CYJA 5D41A 4PF4A 5AA8A 4FYNA 3W2OA 5IA1A 4FKPA 4AQCA 3D7TA 4EOMA 4IVAA 4E20A 4ITHA 2XS0A 3WF7A 5FDXA 5DNRA 3FWQA 1CKJA 2YIXA 1F3MC 1GZOA 4BCQA 2BUJA 2YFXA 4RJ6A 4FZ6A 3RPOA 2ZB1A 4QMMA 4R7HA 2W99B 3Q9ZA 3EN4A 3KB7A 4U80A 3OZ6A 3ATTA 1ERKA 3LFBA 5DE2A 5BYYA 3HGKA 1H08A 2RIOA 2QOHA 2GCDA 3IQ7A 3A7JA 1UNHA 3PIXA 3QD0A 4RJ7A 4RA4A 2CN5A 2RFEA 2IVSA 2R3FA 3I7BA 5DG5A 3UMWA 3UOKA 3EQHA 3CTHA 5ICPA 3ZHPC 2WKMA 4ENXA 3PVWA 5A6OA 4FUXA 1Q97A 1RJBA 1ZRZA 3C9WA 4ERWA 3U6JA 3MH2A 3MN3A 2W5HA 2YZLA 5L6PA 3NCZA 2JKQA 2XKCA 3PY1A 4GK4A 2O2UA 3SOCA 3R8PA 2P2IA 4PUZA 4WG3A 3ZFXA 5AX9A 5M4UA 4Y72A 5CU3A 5EHYA 3N4TA 4BKYA 4TY1A 5HE0A 1BMKA 2OK1A 4LM5A 3H3CA 4YJNA 5KO1A 3E87A 2Y4PA 5A4EA 3LQ5A 2OJJA 5EOLA 3UIXA 2PVYA 4FI1A 4QOXA 4AFJA 3VUMA 3FLSA 4FEVA 3F7ZA 1XH5A 5JFWA 3MB6A 4MNEA 5AAEA 2J0LA 5HG9A 2OLCA 2AC3A 3MV5A 3RCJA 5HX8A 4L3PA 2OF2A 2NNWB 3ORPA 4RWLA 4DLIA 4YC3A 3RK5A 2CNQA 3IGOA 4FKQA 2IZTA 4WUNA 4LRKA 2QLQA 3N4VA 4JT3A 4N6ZA 4RG0A 3P79A 4O0TA 3TDWA 4R6VA 4XH6A 2C1BA 3QWKA 3L8SA 4QMLA 2F49A 4C02A 4CLJA 3EFLA 3NDMA 4UBAA 2OXXA 2IW8A 4BCJA 1FQ1B 3DQXA 4OTGA 3A7IA 4R3PA 4PV0A 3QCQA 1AD5A 4B8LA 3QCXA 3C1XA 1Q8UA 4FTQA 4UWYA 5DRDA 2QI8A 4GUBA 3U87A 4JAIA 3VWAA 1H1RA 4UB7A 5KMKA 4QRCA 5EDQA 3GCPA 4LL5A 4OAUC 1IAHA 3MFUA 2UW7A 4JXFA 5HG5A 3IKAA 5AUZA 3TUDA 5FQDC 2XIZA 2XK7A 3COIA 4IAZA 2R3JA 4DEHA 4ONAA 5L8JA 2X8EA 5IQEA 3QL8A 3TV4A 2HIWA 3MWUA 3O8PA 5HKMA 2VTSA 4TXCA 1K3AA 3P23A 4KIQA 5IG1A 3BLQA 4MVFA 5KZIA 4M7IA 2C6MA 2BR1A 3IONA 4DGOA 3RVGA 4BDJA 1SVEA 5E8TA 3OTUA 3U9NA 2JDOA 2X2KA 3WBLA 4HGEA 4RWIA 1OIRA 4U97A 2WTKB 2YDJA 1WBTA 3PA4A 3CQEA 2YITA 3S3IA 4O7YA 2VTHA 1YDTE 2FA2A 5M07A 2J5FA 4CT1A 2H34A 2R3HA 4WRSA 4E26A 2C0IA 3CIKA 3D7ZA 3G0FA 4LFIA 3W2PA 4L53A 3BHYA 1PJKA 2YJRA 3VUHA 2OI4X 3NUSA 3QZIA 3VS3A 4PP7A 4CG8A 1W0XC 1Y6BA 4YJRA 4E5BA 2YIWA 1ZZ2A 2WQNA 2BTSA 2QCSA 2ITXA 4W4YA 4FZDB 5BVKA 3GUBA 2CGWA 4HPTE 4GG7A 4FZFB 1FPUA 3NAYA 3QLFA 4QYHA 2OO8X 4EH7A 3ZO3A 4I0RA 4BZOA 3UNJA 2PUPA 4F4PA 2XNGA 1WBVA 3GENA 1W7HA 5EW3A 4D4VA 1H28A 3DJ7A 3A8WA 3RZBA 1OL7A 2Y7JA 2PPQA 4M67A 5FUTA 3AMAA 1ND4A 4NCTC 3EQDA 3ORKA 1XO2B 4H3QA 4JBPA 2GTMA 5HIBA 4BDFA 1MUOA 5E8WA 3V5PA 4BCKA 4QP2A 1Z9XA 5E8SA 4AT5A 4RFZA 3R1SA 4Y5HA 4C61A 1RDQE 2XH5A 4EQCA 4GUEA 4FKJA 4AUAA 5CAPA 5LMKA 2P33A 5B2LA 1ZMVA 2WTCA 3PSCA 3LCDA 3CS9A 1YXUA 4Z55A 4BN1A 1G3NA 4GMYA 1IG1A 3ZBFA 3AD4A 3QFVA 4ACGA 3MESA 3F5XA 2W9ZB 4O0WA 5HVKA 2YM4A 3L9LA 5M08A 3TV7A 3UIBA 3DT1A 4JQEA 3W1FA 4WG4A 3Q3BA 2CCIA 4L46A 1V1KA 3FMNA 3DFCB 4ACDA 1PHKA 2UZVA 3FZ1A 3MY5A 4NM3A 4C2WA 4L7SA 5HNBA 2C6TA 1Q62A 4LGGA 1MRYA 4FTTA 3PXFA 4S31A 3DK6A 4P90A 5JH6A 4AW5A 1IAJA 4A7CA 4DCAA 3ANRA 4UMRA 4EQMA 4X3FB 5LWNA 3DLZA 4BKJA 3HKOA 4I22A 4WNPA 1LR4A 3HVCA 4UXQA 4NWMA 3LMGA 3UO6A 3B2TA 1J7LA 2G15A 4BI1A 2CNUA 4O22A 4DCEA 3DCVA 2C5NA 3VQHA 3OP5A 4BBMA 4P4CA 4D4YA 4DEBA 5A46A 3PLAE 3RNIA 3LCOA 3R6XA 4X6QC 2ITWA 2AUHA 4AZFA 3LCKA 3PZEA 2A19B 2UZBA 4EOQA 3POOA 5IEYA 3QTSA 3ZOSA 3LFFA 4V0GB 5FGKA 4MX9A 4IM2A 5D10A 3Q4UA 5FEQA 3UODA 3LKMA 4FTIA 4J97A 5L2QA 4C8BA 4L3JA 4DG0E 3F5GA 2VTTA 4EOLA 4EQUA 4K6ZA 2WPAA 3QXOA 1SM2A 4IIRA 2VTLA 3RINA 1UKIA 2VNYA 3DXPA 4FSWA 2LGCA 1FMOE 2B55A 3OHTA 4FNYA 4X21A 2CKPA 4GSBA 4OT5A 4GFMA 3ZM9A 3COMA 5E8YA 3HAMA 3OD6X 2R4BA 4UXLA 2OZOA 4CG9A 5IH5A 3PJ2A 3GBZA 5M06A 5DRBA 2W4JA 3OF0A 5E9EA 1OM1A 2FO0A 2YA9A 3GCVA 3OW3A 4PMSA 4IX6A 5CS6A 2B9HA 4UMPA 4CYIA 4DFLA 5KMJA 4C4IA 2HZIA 3FLWA 3M1SA 4LGHA 3W55A 3KN5A 4FV2A 3VRYA 4CV8A 5CAQA 2R9SA 4I6BA 5L2WA 1NT2A 4YZNA 2OH0E 3KCFA 2Z2WA 3HV4A 3LQ8A 4PDOA 4WRGA 5HBEA 4ZSAA 2VWXA 4FV8A 4ZLOA 2RGPA 4YTCA 4DTAA 4FG7A 4YHFA 2XNMA 5FM2A 5C8NA 4BI0A 5DYJA 4JDJA 3KF7A 4AOIA 2E9UA 3QTQA 4W4WA 1G8AA 2OFUA 4DFXE 4W8DA 1M52A 5EM6A 4ACHA 3SVVA 4JIKA 1VYZA 4TZRA 3BYVA 3HA8A 4FSQA 4M68A 4M0ZA 5DVRA 3GEQA 5GIOE 1XR1A 3OC1A 3OT3A 4R77A 4FTKA 3GB2A 4MEDA 4I20A 4U5JA 4MD8E 3NNVA 1DM2A 1GNGA 3EJ1A 4HCVA 3ZU7A 2WTKC 2YM7A 4FIFA 3MGYA 2JAVA 3SW7A 5EHOA 2PMLX 2GTNA 4RWJA 5I4NA 5J9YA 2J0KA 3QQUA 4PPCA 4RA5A 1OL2A 1RE8A 4ZY5A 3KY2A 3SHEA 1FBNA 2GFSA 2IN6A 5LVNA 5DOSA 3DU8A 2G2HA 2XJ0A 2O0UA 3CXWA 4XP3A 3ZRKA 4AF3A 4HOKA 4XP0A 3VJOA 2FSMX 3LFAA 5FRIA 4FEWA 2ETMA 3FMLA 4W4XA 3ZSIA 4QPMA 4IX3A 4C34A 2XK6A 5JGBA 1BX6A 3PP0A 3JUHA 5KMNA 1YWVA 4FZAB 3B2WA 1R3CA 4WO5A 3G2FA 5A54A 2W4KA 3WYXA 1KE8A 2NO3A 4AG8A 4OTFA 4CGAA 5IQHA 3H30A 5JKGA 4IW0A 4M0YA 4JQ8A 5IF1A 4TKSA 5J9LA 2O63A 3CJFA 4Y85A 3CP9A 5J5TA 4WNKA 3RCDA 5DT3A 2R3PA 4RJ3A 2C3LA 1HCLA 2W1ZA 2O64A 4XOZA 3OROA 5AMNA 1YHWA 2YM6A 3DJ6A 5HCYA 4HVSA 2XBJA 4WG5A 3F61A 3VIDA 3WIGA 1T46A 5CASA 2VN9A 3OW4A 1H01A 1Q8ZA 3RKBA 2PE1A 2YLFA 3QQHA 2OKRA 4U41A 3TNHA 1OBGA 1LUFA 1SZMA 3ENMA 1KSWA 4M3QA 3ZLSA 4ALUA 3FDNA 5HLWA 3F3TA 3QWJA 2WU6A 4WA9A 4D9TA 2XM9A 1U59A 5HVJA 3Q2MA 3TZ9A 3EB0A 4NM5A 3JY0A 3UYTA 3D5XA 4XG6A 4XV1A 1M14A 3LCSA 2WMVA 3BHHA 3PY0A 4IVBA 3G9NA 4O0UA 3FC1X 4AOJA 4D0XA 5M57A 4HPUE 4CTBA 4GYIA 3FMDA 3TEIA 5IH4A 5B7VA 1PY5A 4RC4A 2WEIA 2PUNA 1BI7A 3O51A 4QTDA 1JAMA 4BWKA 4EC8A 2PUUA 3NNWA 2CLXA 2WMBA 4APCA 3I81A 4OLIA 4PMMA 4XV9A 3DOGA 4IX4A 3JR1A 4X6RA 4Z3VA 4ORKA 2BKZA 5KX8A 2GS7A 3M2WA 3GU8A 4Y46A 4XOYA 5AV1A 2QQ7A 2YEXA 4BZDA 4X7QA 4J52A 2R0IA 4EH2A 3MVJA 2XF0A 3KCKA 2UW4A 4YLLA 4ACMA 3IOKA 3RALA 3VF8A 5LVPA 4I6HA 3OXZA 4B0GA 5I9XA 4BY9E 5C8KA 3R1QA 4GV1A 5C03A 4F9CA 2R3RA 3JVSA 4AGDA 4DG3E 2OZAA 3EKNA 3U4WA 3LFEA 2XKFA 4ZMEA 2CDZA 3C13A 3DBEA 3P7AA 4U79A 1P14A 4DH3A 4YBKA 3EQIA 4DG2E 5HE2A 4AZEA 4PY1A 5EQPA 1CDKA 4CFUA 4BKZA 4NFMA 4O83A 3LIJA 1GJOA 2FUMA 3TCPA 3NYOA 2V5QA 3G51A 4PPBA 4F0FA 4J96A 3VO3A 3AGLA 1CM8A 4GG5A 3W2SA 4IWPA 4AFEA 1Q3WA 4FTOA 5JQ5A 3BKBA 3PG1A 4IWOA 3V8WA 1LPUA 5HX6A 5HICA 3ORXA 4LG4A 5CZHA 5ETIA 2B1PA 3KKVA 5FXRA 3VJNA 5E7RA 4RX7A 3OWPA 2WO6A 1O6KA 2UW8A 1XKKA 3QC9A 3RM6A 3EKKA 3UZPA 3BHVA 3NUYA 5H8EA 3HDMA 3NUPA 3QUDA 4PL3A 3NUNA 5L2TA 3O71A 5E92A 4FIHA 3OCTA 1REJA 4QPSA 4ITJA 4U8ZA 4CRSA 4EK8A 2QOQA 3G9LX 4TYEA 2FSTX 4TNDA 2IO6A 3GGFA 4C36A 5KKRC 4YJQA 5HBJA 4NTTA 3UC4A 5CNNA 4F9WA 1YOJA 5IQCA 4BGHA 1JKTA 3DKOA 3Q32A 3D4QA 3D83A 3ZFMA 4TL0A 3ENHA 3EYHA 1IR3A 4F6WA 3F3UA 3TG1A 1OITA 4D58A 5LVMA 3UG1A 5J1VA 3F7WA 2W1CA 4A4OA 4BDGA 3SXFA 2C5XA 2ZMDA 3MS9A 5HE1A 3V8TA 4C35A 4CZTA 4DTBA 5D12A 4EOOA 2BHEA 3TZ7A 4HYSA 3AC4A 3NWWA 4NK9A 4DN5A 2YAKA 3PIYA 4MXXA 3IDPA 4LL0A 1OIYA 4OTHA 2WTVA 3R28A 4F0IA 5D7AA 4A07A 3Q6UA 5DEYA 5AM7A 1Q41A 4C4GA 4F65A 2O3PA 3DNEA 4D9UA 5DN3A 4DEIA 4D2VA 1Q4LA 2CHLA 2XJ2A 4N4SA 5IA4A 4XP2A 3RPSA 5IA0A 3G15A 3QKKA 1YHSA 3F6XA 4EK5A 4EOIA 3GQLA 4CNHA 1ZOHA 3HMNA 4G6NA 4L43A 5DT4A 3LFDA 3KA0A 4GYGA 2OJIA 3HRBA 3MA6A 4FSYA 4RBLA 1UVRA 4XMOA 5HESA 3W18A 2YDIA 4JG8A 3C5UA 5BPYA 5L8KA 4LRMA 5AP1A 3ETAA 2B9IA 2B7AA 3HDNA 3OOMA 4FEXA 4CLIA 2F7EE 4U40A 2C6KA 3LXLA 4TYGA 4ZS4A 3IW7A 2ERKA 3MB7A 3FXXA 2A0CX 3DBFA 4QO9A 1S9IA 1X8BA 5AR2A 2RFNA 3NYNA 4B8MA 1T45A 3FV8A 2VGOA 3IW6A 4JG6A 2BRHA 2VO0A 2QG5A 3FYKX 4MNEB 4RLLA 4ZJVA 4GKIA 3P9JA 2GDOA 4ZSEA 2DYLA 5LCJA 5D1JA 3OVVA 5H2UA 2BDFA 2OSCA 4CQEA 2JKKA 3MH0A 3F2RA 3GT8A 1XBBA 4DGMA 4S30A 5KNJA 3DB8A 3HUBA 2YM3A 3W33A 3SXSA 3UMXA 4OT6A 4L44A 4N6YA 4F7JA 2IW6A 4CV9A 2EXCX 5HO6A 3EL8A 4F6UA 5KMMA 4V04A 4QT1A 3HV3A 2QR8A 5GJGA 2ZV7A 3FI8A 2EB3A 4GT5A 5E8VA 3RHXA 5CEOA 2WZJA 4G3GA 4Y95A 1Q61A 1WBOA 3NGAA 4D1XA 2Y8OA 4AS0A 5JFXA 1G5SA 3R73A 4Q5HA 4BTMA 3MFTA 3QX4A 4AE6A 3D2KA 3KXGA 1PXNA 2PHKA 3AC1A 2WQBA 3IGGA 5EW9A 1OIQA 5FEDA 4K33A 4GU6A 3O8UA 4OBOA 5EYDA 1DS5A 2X8IA 1RW8A 4HYUA 3VC4A 3DDPA 2Y0AA 2X1NA 4KWPA 4UMUA 3FUPA 2C69A 3ZRMA 4H39A 3VUIA 4FKSA 4IVCA 3SX9A 3ZDIA 4K2RA 2Y4IB 3Q04A 4GS6A 5KE0A 4E5AX 3FLNC 4KINA 4IDVA 4UV0A 3TJDA 2RSVA 5LQFA 5FP5A 4JDIA 4CVAA 4FKLA 2VV9A 3UIUA 4E4LA 5T6KA 4CKRA 2R5TA 4DEAA 2BZJA 4O7VA 2UW3A 5EHLA 4GKHA 1BUHA 2R0UA 3F69A 2QKRA 3HP2A 3D15A 2I40A 3GU4A 4BDBA 4FNXA 4ZOGA 5K4JA 4D0WA 4GCJA 2BHHA 2OIQA 1ZOGA 4MF1A 4BHZA 5HNIX 4FEQA 1MQBA 3V8SA 2GHGA 1NA7A 4X0MA 5CEIA 5TO8A 3VBXA 1PMNA 3E8DA 1OPKA 3BE9A 2VWVA 3E8EA 3EWHA 5I9UA 5C01A 4BL1A 3ZMMA 3O7LB 4IBMA 3R7IA 2O8YA 2XMYA 2VTAA 3TL8A 3W2RA 2BPMA 4KBCA 3SRVA 4O27B 4CXAA 5BVOA 5FEEA 1V0PA 5E91A 1Q8YA 1O6LA 4CMOA 5ANOA 3UP2A 4CKJA 2XK3A 2XKDA 3WE8A 4O1OA 5DMZA 3VS4A 4A4LA 4RQVA 5DI1A 1OB3A 3VBVA 3H9RA 5HORA 5CU6A 4OW8A 3NS9A 4U3ZA 1OKVA 4GT3A 3I6WA 3KXZA 1QPJA 4M69A 2Q0BA 2YABA 3PJ8A 3WF8A 1BL7A 3ITZA 4F9AA 1DI8A 3GXLA 2A2AA 3KULB 4YSJA 4LOQA 4FV5A 3ORTA 5CAVA 5E8UA 2UZWE 3QHRA 4KB8A 5AP4A 4BIBA 3LFQA 4PTEA 4L42A 3E3BX 4PDSA 1ZY4A 1REKA 1WVYA 5IUIA 2H6DA 2W4OA 2ITPA 2XKEA 4PL4A 4EYMA 4G5PA 4C37A 4MD9E 4LMUA 2C3IB 4CRLA 4XBUA 5F94A 5CVHA 5I9WA 5DLSA 3B8QA 1XQZA 4QMPA 4NTSA 4ZTNA 2ZM4A 4A9UA 3EZRA 4N70A 4JIAA 4AOTA 1Y91A 5ACBC 3ATSA 3BPRA 4EWHA 3Q52A 4V05A 4BYIA 1FVVA 2C6LA 4U42A 1OVEA 3C4FA 4CFFA 3C7QA 3WI6A 2Q0NA 4IAYA 1PMVA 1KE9A 1KE5A 4XNEA 3QZFA 4XG7A 2IW9A 2BMCA 1J7IA 4CSVA 4EOPA 1J7UA 2WAJA 2QO9A 1BYGA 1ZYJA 2A1AB 1PYEA 2EU9A 4YJUA 5GJFA 2WOTA 5LCKA 3E93A 2BZIB 2PL0A 3QF9A 1P2AA 2PWLA 1XH8A 4RLKA 5D7VA 4DH7A 5KMIA 3QQKA 1B39A 3I79A 5EM5A 3PWDA 3TTJA 4DYMA 3BV3A 2PSQA 3CKXA 4FNWA 5IMEA 5ITAA 1CTPE 3H0YA 3OMVA 4FV1A 5AUVA 5GZAA 1S9JA 2FYSA 4FTUA 2AC5A 4I24A 4YC6A 1JWHA 4IEBA 3NAXA 3TNPC 4R5SA 2NPQA 3KL8A 4D4RA 4C33A 4C3PA 1HCKA 2GSFA 1JLUE 4J1RA 2VD5A 4ZLYA 5BVWA 4E6QA 5CSPA 2XIYA 4FVQA 3E62A 3UQGA 4FL2A 3CGOA 3R8UA 1U5RA 3EFKA 3MI9A 3RAKA 4UYNA 4I5CA 3ULIA 3MDYA 4XG3A 3T9IA 2IZSA 2W1GA 2PVFA 4NUSA 4C38A 5EOBA 4YTHA 4R3CA 5AA9A 1PMEA 1ZOEA 4YJSA 5IPJA 2ITTA 2QD9A 3I5NA 4O7ZA 1OGUA 4DFYA 2GU8A 2PE0A 4AW2A 3PXKA 5BMSA 3WE4A 2YIRA 3CGFA 3ET7A 4MBJA 4ZSGA 4XRLA 2PVMA 3SDJA 2XNOA 4HCTA 4NSTA 3OXTA 4IZ5A 4FIGA 4I6FA 4FF8A 3BCEA 5EKOA 2GS2A 1K9AA 2YHVA 4YZDA 5LARA 3RP9A 3PA5A 5HLPA 2ETRA 2WIHA 4FSTA 2WTIA 5E8XA 3DV3A 1UU9A 4NJ3A 3QU0A 4L67A 1O6YA 4EK6A 5L8LA 4S2ZA 4AT3A 2Y4IC 2F7ZE 3A7HA 2JGZA 4QNAA 2XM8A 4NIFB 4RIXA 3EMGA 1IASA 2NRUA 4I6QA 3C0IA 4X3JA 2VWWA 4OTWA 4WKQA 4Y5QA 4ENYA 1ZYSA 4FV7A 2B54A 2C0OA 4NEUA 2IZUA 5KHXA 3ELJA 4QP7A 2EB2A 2QURA 3LLTA 3W10A 1NW1A 3ACKA 4BGGA 4FOBA 4EH9A 5AUUA 2Q83A 4N57A 4GIHA 2QONA 3R9DA 3SXRA 5EG3A 3AT4A 3V5QA 4U6RA 2QR7A 3BWFA 2PUIA 2XP2A 1NXKA 2WNTA 3N51A 4ALWA 4F99A 4KKEA 1PXOA 4IH8A 3K3IA 2BRBA 3PDTA 3PSDA 4JRNA 2O5KA 3U9CA 4BBFA 4M8TA 2XYNA 5DEWA 4KIKA 5A4QA 1V0OA 5LVLA 4QP3A 4RIYB 2W17A 2GNIA 1WBPA 4YR8A 3ZLXA 2GHLA 4TW9A 3IW5A 2PVRA 2VNWA 3V01A 4YJTA 2FB8A 2B9FA 4EK3A 5LMKC 4RIWB 3GC7A 4O0VA 4BCHA 3VVHA 4FKGA 2JIIA 3GFEA 5H8BA 3FL4A 4FT0A 4FG9A 4F9YA 5AV4A 4DE4A 4TT7A 3ORIA 1M2PA 4BDKA 4I4FA 4L68A 4OTQA 3PSBA 2B52A 3WIKA 4DF3A 2W5AA 4YU2A 3Q6WA 2V62A 3I7CA 5TE0A 5J1WA 2RFDA 5AUYA 3Q2JA 1Q3DA 2YCQA 3D0EA 3V5LA 3L1SA 4IWQA 4CCBA 4EH8A 2X6EA 3V04A 2WMUA 4F1OA 4B7TA 4AN2A 4QPAA 2W7XA 3E3PA 4K8AA 3HYHA 2GMXA 2FGIA 4PX6A 4AE9A 5CANA 3KRJA 3QD2B 4USDA 3NIZA 4EH5A 3BWJA 4O2ZA 2I1MA 1H26A 4FT7A 2X2LA 3ZUVA 4L45A 1O9UA 4FKRA 2Y6MA 4HYIA 4CCUA 5FG8A 3RAWA 1XH7A 2JBPA 3KK8A 5M4IA 1A06A 3S00A 2GS6A 5BYLA 2DUVA 4ALVA 4KS7A 2XZSA 2X4FA 3KMMA 4E3CA 3I0OA 3Q4TA 1ATPE 1PXKA 3L8VA 4PQNA 2WFYA 4FTNA 1XJDA 2XNPA 1XH9A 3AQVA 3LFNA 2QO7A 3UDBA 4AN3A 4CFWA 2BRMA 4R78A 1GZ8A 1J1BA 2I7QA 3NIEA 3FZOA 2PU8A 1WBSA 2XCHA 3QXPA 5JGAA 4HVIA 2E9NA 4XV3A 5GINE 5IA3A 3U51A 4M15A 1M7NA 2ETKA 5FXSA 4AA5A 1Q99A 1TQMA 4RC2A 3I60A 1KE6A 3BX5A 4BC6A 3QTZA 4HNIA 4IWDA 2E9OA 3UTOA 3VULA 5JT2A 1K2PA 2EXEA
chains in the Genus database with same CATH superfamily
5KZ0A 4FTLA 2YDKA 3BQCA 2EUFB 4ZTQA 4EONA 3CKWA 2PE2A 4O21A 4DEDA 3CD8A 3MVMA 2NYAA 4DGGA 4RFMA 2JDRA 2Z7LA 2JIVA 3GFWA 3HMPA 2ZMCA 4GRBA 1JSUA 3F82A 1TZDA 1TVOA 1H8FA 2VGPA 3ZBXA 3C4XA 5G1XA 1W98A 3RM7A 4JRVA 1OL1A 1M7QA 5I9YA 4TYHA 3QQFA 2REIA 4D5KA 3Q9YA 4KUJA 3SV0A 4D2WA 5CT0A 5BX0A 5TOZA 2FSLX 2QU6A 5IH6A 2J50A 4FOCA 2UZNA 4QP8A 3G0EA 5AIRA 1CKPA 1Q5KA 2XK4A 3ZSHA 3A4OX 4TPTA 4F78A 5B2MA 2X7OA 4YZMA 1CSNA 2VWYA 2PZ5A 4QMWA 2V55A 5TR6A 1YI3A 5H3QA 4FK3A 3R83A 3FJQE 2VTJA 4YPSA 5TF9A 4IM0A 2UVZA 2XAOA 3F2AA 2Z7SA 3IW4A 5BUEA 5KKRB 3BGQA 3L8PA 4NFNA 4DINA 3GC8A 1SVHA 2V7AA 1ZLTA 2QNJA 3HEGA 1VYWA 3JPVA 3FZTA 3FQSA 4EH3A 4EJ7A 4F7NA 3TUCA 2ITOA 5BUJA 4IAAA 3TIYA 3VUDA 2PY3A 4LV5A 3BLRA 1H0VA 5HG7A 3ZXTA 5ANKA 1KWPA 3AC2A 4ZXTA 3SQQA 3TACA 4O7WA 3R00A 5H9BA 4BWPA 5CQUA 4K9YA 2HXQA 4QNYA 4A9RA 3RNYA 4P5QA 5BMMA 2CLQA 2QOKA 2VRXA 4FSNA 4K77A 1QMZA 3SLSA 4XBRA 1G8JA 5EI2A 2PZIA 4BDCA 2UVXA 1VLRA 3QRKA 2ACXA 5IA5A 5HNGA 4IDTA 4BCIA 3P7BA 3AC5A 3BQRA 3KXHA 2C6OA 2PVKA 4YO4A 5M56A 3LJ0A 3KXMA 4AXDA 4EEVA 2JFMA 4LGDA 3Q5ZA 2R2PA 4IVDA 4PP9A 5HBHA 3RMFA 4ANMA 4S34A 3ORMA 3QYWA 4KSQA 4MXYA 1QPEA 2I0HA 2YIYA 3BHTA 5AR3A 2VWBA 2CMWA 4IQ6A 3W2CA 4BCGA 4BDIA 3L8XA 2OIDA 4MF0A 2JD5A 2O65A 3FZSA 3O17A 4MD7E 3FYJX 2HK5A 3IO7A 4EI4A 1KUTA 4UMTA 3FL5A 3QX2A 4FL3A 1YXSA 5C9CA 3B8RA 5L2SA 3ANQA 2I0VA 3RPVA 5IZFA 4F7SA 3UNZA 4FT9A 4XG8A 4FBXA 2J2IB 3LJ1A 2J90A 4MK0A 2XEZA 2OH4A 3DBDA 3FKOA 2BZHB 1YHVA 2QOFA 2VO3A 3OCGA 2IJMA 3OBJA 4C7TA 4DEEA 4E4NA 3CSVA 3EQGA 5CI6A 2GHMA 2BKKA 3TIZA 1YOLA 3EQBA 4ZJIA 4NT4A 2XRWA 3UE4A 3CPCA 3JS2A 3RBWA 3S95A 5K5NA 4PTGA 4R8QA 3UO5A 4A9TA 2X9FA 3R63A 5J9ZA 3HAVA 1E1VA 3ZO4A 4NW6A 4E4XA 5K4IA 3ZO1A 4OTDA 5CF5A 4O7RA 2WTDA 4L52A 4AAAA 4IJ9A 3PLSA 4XV2A 3W32A 4FSZA 3T3VA 3KMUA 4O0SA 1WZYA 1MP8A 2IF8A 3Q9XA 1OKZA 1XWSA 1FINA 2PVLA 2RF9A 4YZBA 2CCHA 3PWYA 1OL5A 1JKLA 4XG2A 1P4OA 3QYZA 3TKIA 4AWIA 5LJJA 1OUYA 2VTPA 5FP6A 1MQ4A 3ZTXA 4WOVA 3ZEPA 3HV5A 5BVEA 1W83A 2RL5A 3IECA 4JR3A 4MQ1A 1GY3A 3FXZA 4PDPA 1YDRE 3KXXA 4RSSA 4I1ZA 3MVHA 4LOOA 3C5IA 4ZTLA 3AD5A 4NL0A 3ZZWA 4AGUA 3PXRA 2W1HA 5DR2A 2W06A 4JMQA 1W2CA 2OIBA 1RQQA 5I9ZA 3PPJA 4G17A 4QP6A 3GOPA 3WOWA 4EOKA 2ZV9A 4WNOA 4YHTA 2OXYA 5CEMA 1JVPP 4Q9SA 3NYXA 3P7CA 5LXMA 3FMMA 3L9MA 1IA8A 5FBOA 1YW2A 4QTEA 3OY1A 2R7BA 2CGUA 2IZRA 1OMWA 1W82A 2H8HA 2WQOA 2YISA 4OBPA 4CMUA 5BVNA 2Y9QA 1GZNA 1R0EA 2C5YA 3FLZA 3MY1A 2F2UA 2VUWA 4FC0A 4BCFA 4D5HA 4DEGA 4YLJA 4DITA 4HCUA 4RZVA 3E8CA 2JKOA 4BWXA 3G90X 4OTIA 1UKHA 2HWOA 1BL6A 4XJ0A 2FVDA 3DXQA 5EKNA 3EN5A 4AQKA 4X2KA 3NMUF 1DI9A 4X3FA 5HI2A 3EN9A 4JDKA 5HG8A 3PIZA 1WVWA 4RT7A 2OJ9A 4WIHA 2C5VA 2GNGA 5E4HA 3DKGA 4TWCA 2UW0A 5FDPA 4II5A 3VBQA 3LMHA 3BGZA 5HO8A 3FZRA 3S2PA 3LHJA 3PVGA 4CFMA 2HYYA 5CU4A 4B6LA 3UVPA 4M97A 4E8AA 3PA3A 3PYYA 3PVBA 3QD4A 3KF4A 5CAUA 4GW8A 3I6UA 4FG8A 1ZMWA 4M12A 2OG8A 4DHFA 3MPAA 2E2BA 3QHWA 3WZKA 4USFA 3TDVA 3QBNA 5AIKA 3ZXZA 4ASZA 4FKIA 1PXPA 5IQDA 5M4FA 3U6IA 4KAOA 3CC6A 4M69B 2X39A 1UU3A 1H1SA 3D5WA 4QQ5A 5T68A 5HQ0A 1BKXA 4GH2A 3P5KA 4MWHA 4WNMA 1GIJA 4I5HA 3OWKA 4BCNA 4JBOA 1OKWA 2WGJA 4CD0A 2YN8A 1DAYA 4TWNA 5J7BA 2G01A 2ZM1A 4X2GA 3VS1A 4WHZA 1Z5MA 5HEZA 1OL6A 3RK7A 3FPMA 4J71A 4F6SA 2QKWB 2IVVA 3D7TB 4KIOA 4RPVA 2UUEA 3R9RA 3DQWA 4OBQA 4CKIA 4YGAA 4O82A 5AP7A 2P55A 3NUXA 3NW5A 4EHEA 4MAOA 1Q24A 1CMKE 3GU7A 4PMPA 5AR7A 4PWNA 2R3IA 4PMTA 3CBLA 2BAJA 2XNNA 2R3GA 1XH4A 3DDQA 2ZVAA 1V0BA 2EVAA 4QD6A 4QYEA 5AM6A 4BFMA 4O81A 1ZY5A 3R7UA 3CY2A 2QG7A 1URWA 2VWUA 3DAKA 1KE7A 3DS6A 3KN6A 3RZFA 2IWIA 4E7WA 2VTRA 4IX5A 2UW9A 2W5BA 4Z9LA 5FBNC 5KUPA 3ZM4A 3HECA 3NSZA 2BAKA 1KV2A 3BBTB 3QA8A 2X4ZA 5K0XA 5AR8A 5HHWA 5KMOA 4IC7A 4H1JA 4KKHA 4GIIA 3FXWA 3FKLA 2J51A 3EQCA 1W2DA 5TT7A 4HVGA 3BV2A 4R7IA 4O7SA 1YI6A 4G9CA 5D11A 3FEGA 3O2MA 2XCKA 3UVQA 4XCUA 2PVHA 4G34A 3AMYA 3CCNA 2PVNA 2J4ZA 1QCFA 4UX9A 4ZZOA 5DR6A 3VQUA 1U5QA 3TNWA 3V6RA 2X7FA 5JZNA 3BE2A 2OFVA 3OS3A 3UQCA 2YJSA 4UY9A 5K5XA 5M53A 3BEGA 3QALE 4LYNA 4FIJA 1ZYCA 3PUPA 1JSTA 4O38A 3NFFB 2GQGA 4JDHA 4GT4A 3FI4A 4A4XA 2KTYA 4G3CA 3DBCA 4MXCA 4U44A 4ZS0A 4W8EA 1WVXA 3G6HA 4BDAA 4QMNA 2XNBA 1W8CA 4HYHA 3U55A 4DLJA 1NVRA 3H0ZA 5AP2A 3TNIA 4JJRA 4UEUA 3ZDUA 5EDRA 4D1ZA 2ZAZA 4IMYA 2QOIA 1JOWB 3I5ZA 2G1TA 2XBAA 3DZOA 1VEBA 4U3YA 2VWIA 3MFSA 3P86A 5E90A 3PG3A 2I6LA 4CZUA 2H9VA 3DAJA 3DTWA 5AWMA 1Y8YA 3E8NA 4ZEGA 3VBYA 3LJ2A 4CZYB 3CJGA 3W8LA 4QQTA 2Z7RA 4H3BA 3ROYA 4G5JA 4OAVB 3AOXA 2RKUA 3BZ3A 3KQ7A 3CR0A 4BDEA 3WZJA 4FK6A 4H3PA 4UMQA 3LCTA 3F3VA 5A4LA 3JXWA 4IADA 4B4LA 5AJQA 3A60A 3S4QA 3VHKA 4F64A 4GFGA 3R22A 4ASDA 4WSYA 2XVDA 2E9VA 4Q5EA 4YLKA 3FSKA 4G6LA 4MQ2A 2OU7A 2VZ6A 4XG4A 2F57A 2JIUA 3ODZX 5F95A 3AKJA 1FGKA 3CPBA 1IA9A 2CGVA 1NVSA 3QA0A 3POZA 1YRPA 3W0NA 4ZTMA 4CMTA 3C4WA 4QP1A 5LVOA 3D2IA 1VR2A 1YOMA 2HAKA 4WBBB 3LQ3A 3C4EA 2WMWA 3E64A 3MPTA 4JNWA 2ONLA 3RPYA 4KRDA 4S33A 4JAJA 5IQIA 5HVYA 3V3VA 4QMTA 1I09A 4H1MA 4FE2A 3P1AA 3MA3A 5JMSA 2ZV2A 2UZUE 3ROCA 3VUKA 1SNXA 2GNLA 5F1ZA 1M2RA 5J5SA 4OTRA 2ITVA 4BCMA 5D9HA 2VX1A 3O23A 5DFPA 5DR9A 2JDVA 1M2QA 5ANJA 2ITNA 2CGXA 3Q5IA 3V6SA 4AGWA 3R0TA 4OR5A 1VJYA 1ZZLA 4MNFA 1XHAA 3MH3A 1PKGA 4NJDA 2UW6A 2YCFA 3I1AA 4QTCA 2OW3A 4FKUA 4TNBA 3FY2A 5CQWA 4O0RA 2UZOA 5ETAA 5CXZA 3GC0A 5FD2A 4QMOA 3BYSA 4YNEA 5CY3A 3FBVA 3HX4A 3OCSA 3ZRLA 3SG8A 3M42A 3PJ1A 5HOAA 4MBLA 3OFMA 3LZBA 4D1SA 4OUCA 3UO4A 4J7BA 4NM0A 1DAWA 3QAME 3D9VA 4R1YA 5B2KA 4EK4A 3NVMB 3OWLA 4YP8A 4BTKA 2WELA 4L00A 2R64A 4UN0C 4BICA 4RRVA 4H58A 5C4KA 4QQJA 3VW6A 4LV7A 1AQ1A 4FICA 5H8GA 3A99A 4G3EA 2RG6A 2C68A 3ORNA 4ID7A 1YDSE 4USEA 5FTGA 1U54A 4JOAA 3GP0A 5EFQA 5HGIA 4Z7GA 4J53A 5AAGA 3PPKA 3O7LD 3HRCA 3BYUA 5DIAA 3R8VA 3TNQB 5HIEA 5EM7A 3EOCA 4IZ7A 4L6QA 4LI5A 4EKLA 1UU7A 4YZ9A 4BHNA 4AZWA 3TZMA 1A48A 3WF5A 3E88A 4BVUA 2A4LA 2PMOX 2X0GA 3EIDA 2DS1A 4I92A 4YURA 3DJ5A 2YCRA 2WMXA 2J5EA 4F70A 4QDEA 2YWVA 2BFYA 3HLLA 2RFSA 3NNUA 5CT7A 3UOHA 3ZCLA 3ZFYA 2YZAA 3QZGA 3OY3A 2WD1A 4AXEA 4JL9A 3TTIA 4BZNA 4LRJA 5CEQA 3DAEA 1NY3A 4NZWB 4MKCA 4XLVA 3R02A 2C6IA 2WOUA 3R8ZA 4FNZA 3R9OA 2C5OA 4FTJA 3HL7A 4O0XA 5C8MA 4GJ2A 1E9HA 5LMBA 3QTXA 4ANSA 3HA6A 3BELA 2J0JA 5CSXA 4XLIA 5IDPA 1IEPA 5CZIA 4GU9A 5CNOA 4PRJA 2XIRA 3ZLWA 3R01A 3WZEA 3I4BA 1F5QA 4G16A 4FKVA 4JBQA 5AP5A 3S0OA 4EH4A 4I41A 3BGPA 1SYKA 3L9PA 4GVJA 3VRZA 5A6NA 3OWJA 3AT3A 4CQGA 4BR3A 3H4JA 3RHKA 3THBA 4FMQA 4M66A 4FGBA 2CJMA 2ERZE 4FTAA 5DH3A 4AP7A 4ZP5A 3MFRA 2BCJA 3BRBA 3TV6A 4JVGA 4R3RA 3LM5A 1MRUA 4C57A 1OPJA 3ACJA 5EW8A 5JFSA 2SRCA 3A61A 3RGFA 5IQGA 1J91A 4LMNA 3KRRA 4C3FA 5AP3A 5EQEA 4V01A 3U4UA 5M44A 3PXQA 2XEYA 4I4EA 4RGJA 4Y8DA 5CVFA 4CT2A 5K0KA 4D2TA 4EWQA 2R3LA 3LMIA 3BU6A 3LFCA 4CFVA 5CVGA 2UVYA 4AXAA 4C3RA 5CF8A 4FV9A 2HZNA 4QP4A 4LUEA 4TYHB 5ANEA 3LM0A 3Q4ZA 3RI1A 2WXVA 4WSQA 4ZTHA 3MH1A 3QRTA 1FMKA 3SOAA 2YM8A 3V51A 4AZTA 4BF2A 4EL9A 3D5VA 3R9NA 4BCOA 4BTJA 4DFNA 4EORA 3NNXA 2YACA 3K5UA 3HP5A 4LQMA 1KOBA 3C0GA 4E93A 3ALOA 3K5VA 5I9VA 2W1DA 4NM7A 4F1MA 3EL7A 3H9FA 2XARA 3UPZA 2VWZA 3H9OA 4NW5A 3A7GA 4U43A 2QOOA 3PPZA 3LVPA 4IFGA 3RWQA 4I93A 4Y73A 3F3ZA 4YJVA 2QOBA 4FUYA 4R1VA 3PRFA 5FLFA 2WMSA 4FVPA 1ZARA 3ORZA 5C27A 4KKGA 3FQEA 5F9EA 3NUAA 4QDVA 2BRNA 3VS5A 4Z7HA 3OEFX 3VS6A 3FPQA 3CTQA 4RJ8A 1SMHA 4C58A 5IA2A 1OPLA 4FV0A 4JR7A 5ANDA 5EQYA 3BBWA 3GNIB 4ZY4A 5GZ9A 1Z57A 2GPHA 4E5WA 1NVQA 3FAAA 3VAPA 3HMIA 3WF6A 3MTLA 4P7EA 3GI3A 3MIYA 4RX5A 2HZ4A 3KVWA 4AW0A 4DT9A 4EC9A 5AEPA 3QRJA 4YNOA 3Q96A 2ITYA 4DA5A 1URCA 3UVRA 4YUQA 3IOPA 2F9GA 5L6WL 1LEZA 2JKMA 3COKA 3FC2A 3KXNA 4ANNA 3HUCA 3UYSA 3BL9A 4RC3A 5CU0A 3HRFA 3DY7A 1UU8A 4L9IA 1UWJA 3R1NA 3NUUA 4KS8A 2C3JA 2BVAA 2F4JA 4FL1A 1WMKA 4TYJA 3T3UA 3UOLA 4YJOA 3AMBA 5K3YA 4EBVA 1W84A 1XBAA 3OUKA 4JX7A 5F4NA 1U46A 3EN6A 3IW8A 4U0IA 2PMIA 5FWKK 2X2MA 5CENA 3A2CA 3UDZA 4B9DA 2WTWA 3O96A 1UNLA 1KOAA 4HVHA 4F63A 3HNGA 2E9PA 4ANLA 2J7TA 4YMJA 1YQJA 5CYIA 3VUTA 3A4PA 3FY0A 3O8TA 2HXLA 5HO7A 5KMLA 3IDBA 2X7GA 4FSUA 2JEDA 2X81A 4DGNA 1YXVA 5JRQA 4BTFA 2XA4A 2QVSE 3NYVA 3DBQA 1OKYA 2GNJA 1J1CA 3PTGA 3KEXA 2HENA 4XEYA 4O1PA 2PTKA 3K2LA 1ZMUA 2C47A 4IZAA 5EH0A 4C2VA 1TFFA 5M09A 4D4SA 4I0SA 5KBQA 3A7FA 5C1QB 3VS2A 4FR4A 3RJCA 3KIOC 5B0XA 3LXKA 4XRJA 4EZ3A 4EHZA 3BYMA 2QOCA 5CTPA 4PTCA 2W0JA 3QTIA 2C3KA 4P2KA 3DZQA 4GEOA 4QMUA 3SAYA 2BILB 2P3GX 4UWCA 4WUAA 4DH5A 4E6AA 2UZDA 4DDIA 2WEVA 1U4DA 4TN6A 4C4EA 4EYJA 3P0MA 3JVRA 3JY9A 4XG9A 4F08A 4O7NA 4S32A 3R30A 4FYOA 5DWRA 2C6DA 4D2PA 3TWJA 5DPVA 4M14A 2EWAA 3LPBA 5E1SA 5AP0A 4B99A 2PULA 3A8XA 1OUKA 2JC6A 1Y6AA 2J6MA 5BUIA 3DGKA 4UZHA 3NEWA 4PPAA 2HW7A 5IKWA 3RWPA 4AZVA 1OIUA 3GU5A 4FSRA 4IZYA 5EYKA 3U54A 2OZAB 3FLQA 4XHKB 4BRXA 4X2JA 1W2FA 2WMQA 3MBLA 3AGMA 3KULA 4NCTA 2J0MB 3MW1A 4WBOA 1FVRA 3DK7A 2VAGA 5IEVA 3BHUA 4O7TA 2CNVA 4PNKA 4FA2A 4DH1A 3EFWA 5AFVA 3O50A 4IB1A 5EYCA 5GJDA 1APME 4JQ7A 4ZTSA 3FLYA 5L6OA 3TMOA 2VTIA 2GNHA 2YERA 4BBEA 4UWBA 3DTCA 5I5ZA 1XH6A 3DKCA 4G31A 5KBRA 1UWHA 3W2QA 3KRLA 3PUFC 4DBNA 4G9RA 3PXZA 5BNJA 5HTBA 3OEZA 2C0TA 4D2SA 5GIPE 3IPHA 3REPA 4BI2A 4HVDA 3KK9A 4GK2A 4RJ4A 3CQUA 4AA0A 5JQ8A 2YWPA 5CSHA 2VTOA 2R3QA 2XK8A 4CFNA 4ZAUA 5HZNA 2ZOQA 3PJCA 4U9AA 4A9SA 4EBWA 2OWBA 3CLYA 1PXJA 5IU2A 3VN9A 4AX8A 3GVUA 1H4LA 4ZMFA 1L3RE 4P5ZA 3QC4A 3SW4A 3UBDA 3GU6A 2FSOX 4DTKA 3F88A 4E4MA 2HCKA 3TM0A 1EH4A 3FMKA 4IFCA 4ZTRA 3ZSGA 3C51A 3EYGA 5DT0A 4EOJA 2CN8A 3GOKA 4FIIA 3UOJA 4DAWA 4QMXA 3JYAA 4J8NA 4HNFA 3UP7A 2HELA 4E1ZA 5JEBA 2HY0A 5F20A 3WZUA 3M11A 4TTHB 4J8MA 5M4CA 3ID6C 3SKCA 3G6GA 2VTMA 4O91A 5HE3A 2JITA 4FKOA 4IE9A 5T3QA 3UZTA 5AUTA 5C4LA 3TT0A 4E6CA 2H96A 1G8SA 1QPDA 4IJPA 3ZZEA 5JZJA 5IISA 4WD5A 2DWBA 2WHBA 4YPDA 5CX9A 4RX9A 4JG7A 5HTIA 2JDTA 3AKLA 3OG7A 2YLEA 5AP6A 4M84A 5ETCA 1YWRA 2W9FB 2BFXA 4YO6A 3S1HA 3R71A 3TN8A 2HY81 2JDSA 4MWIA 2ZDUA 4IB3A 4O6EA 3Q53A 4GFOA 4QYGA 3IK3A 2UV2A 3HZTA 3NW7A 4ITIA 4ZY6A 5DA3A 3WARA 4MYGA 4F9BA 4J95A 1H1QA 4HGLA 4KA3A 5HD4A 3NZ0A 3PZHA 4G2FA 3QKMA 2GQSA 4DFBA 3F5PA 4BIEA 3P78A 3KC3A 5L2IA 2BALA 3OT8A 2R3MA 4FKTA 3ZYAA 4IXPA 2GQRA 2BTRA 4FTCA 4QMYA 4RJ5A 5CLPA 3DFAA 5A3XA 2C30A 2RG5A 5EM8A 3RTPA 4AU8A 2V0DA 2UW5A 1H00A 4R7BA 3P08A 3EQFA 4Q2AA 4BYJA 2X9EA 3UIMA 2ZDTA 1FGIA 4ASXA 1XMMA 4MHAA 4IHPA 2P0CA 1PXMA 5AUWA 4QMSA 1GIHA 4FODA 2ZB0A 3R7EA 4BCPA 4G3DA 3H10A 2WU7A 1PMUA 3Q4CA 3LXPA 1UNGA 2QODA 3CD3A 2WTJA 2JAMA 4BB4A 1TKIA 4NIFA 1ZWSA 4HZSA 2BZKB 3WZDA 3PFYA 3MY0A 4D55A 4RIOA 5IQBA 4C59A 4ANBA 3BYOA 5CXHA 1GOLA 2G9XA 3NR9A 5GHVA 3R7YA 3PVUA 2R3KA 3GCUA 5J8IA 4I94A 2NP8A 4UYAA 4IACA 1BI8A 4NU1A 3N9XA 4ANQA 4FTMA 2R3NA 4YBJA 4ZLZA 5A4CA 5CALA 2QLUA 2JBOA 3MJ1A 3ODYX 4W4VA 3HMOA 1JPAA 1R39A 4HZRA 5EYMA 3GCSA 4Z16A 4GK3A 3OTVA 3GQIA 2OXDA 2V22A 3UG2A 4BIDA 1H27A 5LWMA 3FE3A 3HMMA 4QMZA 3QQGA 3ZH8A 3W8QA 4FEUA 3F3WA 1PF8A 2W1IA 2XB7A 3HV7A 3FMJA 3R2BA 1PYXA 3ZLYA 2Z02A 4ZK5A 4IAFA 4RIYA 2B9JA 2CSNA 4L3LA 3U6HA 3BLAA 1GAGA 3UGCA 2XJ1A 4RIWA 3DLSA 5A4TA 5ANGA 4FTRA 2XIKA 4ZSLA 3F5UA 3LE6A 5CEPA 1FVTA 4DFUA 1QL6A 3AC3A 3VBWA 5IQAA 3TJCA 3SGCA 3RAIA 4FKWA 4NKSA 4MH7A 3L9NA 1CKIA 4IM3A 4WT6A 1JQHA 3W16A 3OXIA 1Q8TA 2PMNX 2X8DA 5ETFA 5C26A 4BJJA 4EJNA 3NLBA 4U7ZA 4E6DA 4ZZMA 4IAKA 3WYYA 3SA0A 4RWKA 1H1PA 2Z7QA 3R1YA 4LV8A 4F1TA 3GCQA 3VHEA 3UNKA 4AACA 2IPXA 2HW6A 4KSPA 4JLCA 2R3OA 3LW0A 2BDJA 3FI2A 4HGSA 4FIEA 3AT2A 3DPKA 2B4SB 2PZPA 5G6VA 3F9NA 1PRYA 2W96B 4LOPA 2XYUA 5EI8A 4YTFA 2G2IA 3FKNA 4U45A 4F09A 3RK9A 1P4FA 2UZLA 4DFZE 4CTCA 2JLDA 1JKSA 3BI6A 3DNDA 4X3FC 4JBVA 3QTRA 3T8OA 4L8MA 2IVTA 4FT5A 5A9UA 3F2NA 1WFCA 1F0QA 4RVLA 4A06A 4MCVA 3UZRA 3ZUTA 5KHWA 3MYGA 4NYEA 3I0QA 4GVAA 3EQRA 2I0YA 3OCBA 3V5TA 4AT4A 4RVTA 3QQJA 4PNIA 3CEKA 5HTCA 3C4CA 5CSWA 4FSMA 4KNBA 5DBXA 2ZJWA 2C6EA 3FZPA 4K1BA 4XYFA 5CU2A 1JKKA 1JSVA 3KGAA 3FHIA 4YSMA 4QYYA 5CEKA 3SRVB 3TZ8A 4DT8A 2JFLA 3PE2A 3R04A 2KULA 4O0YA 5HU9A 3VUGA 3R2YA 5AV2A 1PXIA 3NX8A 4QMVA 4JI9A 2V7OA 3NVKI 4IANA 2ZM3A 3UDTA 2LAVA 1I44A 2W05A 3U8WA 1KV1A 3EH9A 2ITZA 4GL9A 1SNUA 4QP9A 4FRFA 5FTOA 1TQIA 4C0TA 1U54B 4DC2A 2BROA 4FV6A 4AA4A 3RPRA 4DH8A 4YJPA 3FI3A 2ESMA 4V0GA 1FOTA 4YZCA 2A27A 2QOLA 5FM3A 4ASEA 4QQCA 3SD0A 5GZ8A 3ZC6A 1LP4A 1ZYDA 5HD7A 3DA6A 1J3HA 3W0RA 2VTNA 3KRXA 2XRUA 2IVUA 3QZHA 1LEWA 3UJGA 4MXOA 3VF9A 4ZZNA 5IUHA 2CKOA 4J99A 3G5DA 4D28A 5IQFA 3AXWA 1XBCA 2YIQA 4ERKA 5IUGA 2WMRA 2QHNA 2AQXA 4HGTA 4EUTA 4EZ5A 3UPXA 1SVGA 2XIXA 3FQHA 4XS2A 5JN2A 4O86A 1AGWA 3OUNB 3LXNA 1Y57A 4G1WA 4YHJA 3PY3A 4ZSJA 3TI1A 4O84A 3EHAA 4RFYA 4RQKA 3VW8A 3WF9A 3C0HA 2VX0A 2QO2A 2BAQA 3QGWA 5I3OA 3ZO2A 5DGZA 1MRVA 4X2NA 1YXTA 2VTQA 1JNKA 5AADA 4O7LA 1YXXA 4RZWA 2QU5A 2A98A 3NPCA 4IC8A 5HCXA 2GFCA 1VZOA 3TUBA 1Y8GA 3NW6A 2B53A 3TKUA 5HLNA 5CF4A 4AN9A 4PDYA 3FSFA 3UC3A 4E73A 4IB0A 3R8LA 2NRYA 4O4DA 3IS5A 4PL5A 4EZ7A 3E7VA 3PXYA 2W1EA 3II5A 2HWPA 4HW7A 3BEAA 3GC9A 1QPCA 4UALA 3ZONA 2VO6A 3R7GA 3HV6A 2HZ0A 3P4KA 4L01A 1GIIA 3AG9A 3IDCA 5JRSA 4FZ7A 4ACCA 5IMXA 2OF4A 5JFVA 4Q9ZA 3V5JA 2PVJA 3KREA 1YWNA 5L4QA 2CPKE 3DK3A 3R9HA 3PP1A 4K18A 3E63A 2PZRA 5CSVA 5EI6A 4AZSA 2XUUA 3LAUA 5BVFA 2FH9A 2HOGA 2PZYA 4LUDA 5AR5A 3V5WA 3QUPA 2J0IA 1ZAOA 3VNTA 5IEXA 2AYPA 5HCZA 3SG9A 3F66A 4RVMA 4J98A 4QYFA 3RAHA 3NRMA 4MBIA 4C4HA 3BIZA 3LLAA 5CWZA 2OICA 3CE3A 3VS0A 5J7HA 4MTAA 4DBXA 3BU3A 4JS8A 4AGCA 4ARKA 2WQEA 5GNKA 1HOWA 1PKDA 4OTPA 4DHJA 3D14A 3K3JA 3ZC5A 2PK9A 5AAFA 1IRKA 3ORLA 3QTUA 4C4JA 3D5UA 4KBKA 3COHA 4L7FA 4H05A 2VO7A 3DB6A 4N0SA 4XUFA 5L3AA 1OZ1A 4KIPA 4X2FA 4G3FA 5ACKA 2XK9A 2ZV8A 4KD1A 4O4BB 4OGRA 3C50A 3PE1A 4ANOA 4D2RA 1GZKA 3NCGA 2ONLC 5E1EA 4DGLC 5BYZA 5J79A 3QRIA 4TRLA 1YVJA 5TKDA 3EZVA 3R7OA 5JK3A 5BVDA 3PFQA 3TXOA 3QLGA 1ST0A 1PXLA 3FMHA 2IEWA 1H07A 4RIXB 5IDNA 2VU3A 5AX3A 3G33A 1PW2A 5KCVA 3DXNA