2YCRA

Crystal structure of checkpoint kinase 2 in complex with inhibitor pv976
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
282
Chain Sequence
VYPKALRDEYIMSKTLGSGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTAKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structural Characterization of Inhibitor Complexes with Checkpoint Kinase 2 (Chk2), a Drug Target for Cancer Therapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 282
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ycrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ycrA01
3DNEA 4KRDA 1WCCA 2ETKA 3WF7A 1VJYA 3B2TA 4GVAA 3HAMA 4O81A 4DE4A 5FM3A 2ERKA 3E8NA 1XH8A 3F82A 4AOJA 4Z16A 3H30A 3NW6A 1H28A 3ZRKA 5GJDA 5DOSA 2XIRA 4CFWA 4YTCA 2WMAA 4EHZA 2X4ZA 2IG7A 3S4QA 4DFXE 4JX3A 4FNZA 3U9NA 3EQCA 5CZHA 2UZBA 1H00A 3LXPA 3ZFMA 4DH1A 3WYYA 4L53A 5IU2A 1OPJA 2HZIA 3G51A 3LLTA 5TOZA 5DN3A 5EM5A 2PUNA 4EWQA 5E4HA 4IWQA 3TV4A 1R1WA 2FSTX 4J71A 3ZEWA 4BHZA 4IHPA 5LCJA 4JOAA 4YJPA 2XNEA 4NM3A 5T3QA 4F65A 3QKMA 3SOAA 1UU7A 5FP5A 4CZUA 3CD8A 1KE7A 4C4JA 3VBQA 3SDJA 5BVKA 5DEWA 1SZMA 4G31A 5KMKA 2VX3A 1WBPA 2YM7A 3NYVA 4CLIA 2PL0A 4U41A 4QMWA 1XQZA 2R3LA 3FHIA 4I5PA 2QLQA 3KCKA 4FF8A 4ASDA 2VWBA 2Z7RA 3FLNC 1H26A 1HCKA 5BMSA 5IH5A 3GQIA 3CTJA 4XEYA 1JSVA 2ITNA 4JT3A 5FEDA 3NZ0A 1DAWA 5M57A 3PJCA 3UNJA 2GNJA 3A7JA 2WMXA 4DTAA 3NVMB 3QTRA 4QT1A 3ZBFA 3NUYA 4W8DA 3IW4A 4JBOA 4DA5A 4CD0A 5L8KA 2ESMA 2WQOA 2J7TA 2UVXA 3A7HA 1J1BA 3E62A 2ACXA 2ETRA 4GG5A 5G6VA 5LJJA 1SYKA 2VTLA 5A6NA 3Q52A 3DAJA 4JAIA 4QRCA 3WILA 3WZEA 3R7UA 4AGCA 3W10A 4EBWA 3PYYA 4FK6A 4C3PA 3TEIA 3TV6A 1B38A 2B54A 2WTIA 4KKEA 5EM6A 4IDVA 3ZOSA 4NW5A 4S31A 1E9HA 2XNGA 3R01A 4RA5A 3O7LB 3V5PA 3AMBA 4EOKA 2YLFA 5FEQA 2QQ7A 4C8BA 4I0SA 3RAHA 4BCOA 2JBPA 4DBXA 2X8EA 3V8SA 4IVCA 2GPHA 3QGYA 4R78A 3COKA 3CJFA 4ZLOA 3AGLA 4JX7A 5IDPA 2OJIA 3F5XA 1S9IA 2CCIA 4O7TA 4IDTA 5FWKK 4M69B 3UIBA 4C59A 3COMA 2VWUA 3E63A 1TQPA 3W2OA 4OTGA 3R1NA 3BYSA 3KN6A 2VO3A 1H24A 4RQKA 4X0MA 3V8WA 4F1OA 5M4FA 3SC1A 4ZSJA 3VHEA 5H9BA 5C4LA 3BLQA 3T9TA 4IVDA 4AS0A 3IW5A 5FP6A 3L1SA 5JZNA 3FMMA 3R9HA 3LJ2A 2F4JA 3O96A 2ZMDA 3QRIA 3FYJX 1UKHA 2HW7A 4ZS0A 4DEBA 3UIUA 4AQCA 2A2AA 3TJCA 4QOXA 4YO6A 5ETAA 2PYWA 2PVNA 3EHAA 3P7AA 4BKJA 3VRZA 2CN5A 3D2IA 3AD5A 3NCZA 3SG8A 4ANOA 3MA3A 2I0VA 4HGLA 2OLCA 4MXYA 4FNXA 2BRBA 2V55A 3R8ZA 2VX1A 4C37A 3KXGA 3TN8A 4D4VA 4IZ5A 2VO0A 3GOKA 3KXZA 1NVSA 2GQSA 3KK9A 4C7TA 3ZS5A 4EK4A 3VS0A 3PY1A 2WKMA 2QC6A 4EH3A 2J0MB 3KY2A 2BR1A 1WMKA 4HGEA 1GNGA 2QU6A 4XV2A 2UZEA 2A19B 3SQQA 4OTDA 3Q9ZA 3D7ZA 5A3XA 3KQ7A 3OXIA 5LWNA 5IQEA 3LHJA 5HTBA 1PMUA 2OZOA 4JQ7A 3E3BX 4X7QA 3A7GA 3ZEPA 4DINA 5CSVA 4TT7A 1YDRE 3JY0A 4CMOA 3BV2A 3AT2A 5HU9A 4QO9A 5CNOA 5HCXA 4E6QA 3OOGA 3OTUA 2B0QA 1IASA 4IZ7A 3CS9A 3ORKA 4JR3A 4FYOA 5L2TA 3Q2MA 5CEOA 3NAYA 4YJUA 5HKMA 1FOTA 3R7IA 5A6OA 4DFLA 5F4NA 4BDIA 2CLXA 3IKAA 4J7BA 2XNNA 4XOYA 4Z9LA 1W83A 5EW8A 5LCKA 5IISA 4EWHA 2GTMA 4RT7A 1FGKA 4MXOA 4FT3A 5HTIA 4J99A 4CFXA 1TQIA 4MAOA 3R04A 4A4LA 4WNMA 4QP9A 4BDJA 4YSJA 4BCPA 2W4JA 2Y4IC 3MY0A 4KKHA 4FG7A 3HMIA 2DS1A 2FUMA 4QPAA 2UVYA 3EFWA 4I6QA 4RVTA 4FTOA 2FYSA 4MD7E 5F1ZA 1YOLA 5J7HA 5LMKA 5DR6A 5CEKA 5EQYA 3FQHA 5C9CA 3I7BA 4IM0A 2R3HA 4S32A 3BEGA 1OKZA 3MSSA 4J96A 1G8SA 2JFMA 4JIKA 1RE8A 2XK3A 4DCEA 2PMNX 4FV6A 3TTJA 3OG7A 1OPKA 4G1WA 3QA0A 2ETMA 2OZAB 4TPTA 3UG1A 4ZTMA 1H1WA 4C2VA 3EKNA 3CSVA 3RAWA 4E93A 3ATTA 1A9UA 5B2MA 4GS6A 5I9UA 3DBEA 4HVDA 3UPZA 3C0IA 3FY0A 2PZRA 2XCKA 4C62A 3ZU7A 1ZOEA 2X9FA 3PSBA 2W1EA 3V01A 3DDQA 5B7VA 3ULZA 5D10A 3Q2JA 4F63A 3OCSA 3EWHA 2WTKB 3QQFA 2QG5A 3AOXA 3IS5A 3W2SA 4J8MA 4W4WA 4MXAA 3QD2B 4MCVA 3GFEA 4DEIA 4E4NA 4EH6A 2VNYA 4PMMA 3UE4A 3UP2A 5AEPA 4FKWA 4APCA 2UZNA 4ZSLA 1ZLTA 4QMMA 5CI6A 4FGRA 3ZLSA 2JKQA 1U5RA 2F9GA 2C6TA 2PUPA 3DGKA 4D55A 1XBAA 4EKLA 5E91A 4D2WA 2P0CA 5IA1A 3GUBA 4HYHA 3RPVA 5JFSA 4LOOA 4NFNA 4CYIA 3JVSA 4FSRA 5AUWA 2QODA 3LVPA 3RPRA 4U5JA 4B99A 5CLPA 3DXPA 2EB2A 5BYYA 2B4SB 4LOPA 3I79A 2WTJA 5BYZA 3BLHA 4D9UA 5ANJA 5HO6A 4YNOA 5HG9A 2XYUA 4RRVA 3GU7A 1UWJA 1SM2A 3DJ5A 4G5JA 1UNGA 4K0YA 4Y83A 3C51A 4FSYA 4EL9A 3IECA 3HEGA 3CP9A 3QTWA 4FT0A 3KULB 4FZ6A 3IW7A 4XRLA 5AP4A 2P55A 1Q8YA 3UIXA 2O2UA 2QO7A 5C4KA 4NEUA 1ERKA 4HPTE 4XNEA 2UVZA 3VUIA 2UZWE 4PWNA 2VZ6A 4QMVA 4MXZA 4O0TA 4RX5A 3PLSA 4AE9A 4Y5HA 5J1WA 4IC8A 4MF0A 4ZJJA 5DR9A 2BRNA 3QUEA 4LMUA 4M3QA 4AX8A 1H0WA 1AGWA 2IZTA 3ALOA 4PTCA 1K2PA 3ROYA 4EKKA 3FI4A 1WBSA 3GCQA 2X7OA 4DH5A 3CQEA 4JLCA 5F94A 2OH4A 2VU3A 3QL8A 4FIGA 3UOJA 4L45A 2CGXA 4CVAA 5J8IA 5AP6A 2C68A 2IN6A 2BCJA 3RAKA 4FT5A 3FBVA 5BUJA 2Y8OA 4JG7A 2X4FA 4E6AA 3LXLA 1ZAOA 3R28A 4UALA 2JIUA 3DTWA 3MTLA 2ZVAA 1UWHA 4G9RA 3HV4A 4DEGA 4AN3A 1GZNA 3Q60A 4ZTRA 2IW8A 4AA5A 2CNUA 1KOAA 3KMUA 2OJJA 5AWMA 3VQUA 3DXQA 4I0RA 2GQRA 5DBXA 4RVKA 3FL5A 3F9NA 3PXZA 5ETFA 4MBLA 2GHMA 3TIYA 2X6EA 4FTUA 4BBMA 4O0XA 2X8DA 5E8XA 2CLQA 2VN9A 1IA8A 3A8XA 3W32A 4BF2A 2BRMA 3S95A 4AZSA 3BYOA 3HX4A 4K1BA 3ZXZA 4GK4A 3SW7A 2XIXA 3GCPA 3PPJA 3V8TA 2WMSA 4N4SA 4FE2A 3O71A 2EXMA 4DG3E 3FSFA 3D94A 4M15A 4RMZA 5FXSA 2Z8CA 2I7QA 3OVVA 4ZTHA 1CSNA 3AC1A 4UEUA 2IW6A 5E1EA 1EH4A 4G6NA 4AE6A 2KTYA 3DBCA 4PP7A 5LWMA 3UG2A 2R3FA 4FTRA 5EYMA 2UW0A 4F0GA 4DG0E 4RFZA 2BZJA 2UW3A 3DFAA 3HA8A 4ASEA 2PVYA 4IWPA 4AGDA 4BCNA 2W9ZB 4J97A 5E92A 3FMHA 4AFJA 5DA3A 3T3VA 2CSNA 4GRBA 2B55A 3OY1A 4U40A 3HMNA 2WMUA 3V5LA 5JFVA 3SRVA 4BGHA 4O7SA 3U87A 3RTPA 2W7XA 2Q0BA 5CALA 3D9VA 5J79A 3NUPA 3VVHA 5HD4A 2R0UA 4BCKA 3V6RA 3DS6A 4I21A 1H0VA 5FG8A 4PNKA 2IVTA 3CQUA 4G3CA 2RF9A 2HY0A 5EI8A 5EDRA 4MXXA 4TWPA 3VWAA 3AMYA 2XK8A 3BV3A 4YJRA 4DH8A 2V5QA 4R8QA 4QMOA 4TNBA 3W2CA 4J8NA 4GJ3A 4HNFA 5DGZA 3SXRA 4NT4A 5CF8A 3PJ3A 1F0QA 3QTXA 4FEQA 5L2WA 3LFCA 5AP5A 3DAEA 4I4EA 4M14A 5A14A 2XNBA 5AUTA 5DFPA 2J2IB 3KL8A 5EG3A 3MFUA 5M4IA 3SAYA 5AIKA 3NR9A 5KMNA 2XUUA 2QCSA 1FMOE 2FSLX 2GS2A 3PXRA 4BWPA 2YJRA 4H39A 2PU8A 2XM9A 2BZIB 1BUHA 4BCIA 2WNTA 3TUDA 4K8AA 4G16A 4YMJA 3AT4A 5AUYA 1PXOA 5BQ0A 1ZMUA 3OW3A 5T6KA 3Q9XA 2WTDA 5AJQA 4DH7A 5AFVA 2OXXA 2YWVA 3H10A 4I24A 3SKCA 5I9VA 2XYNA 4DFYA 1NA7A 3RCDA 3R7EA 4EOLA 3CY2A 5DYJA 4DFUA 4O7LA 1Q4LA 3PP1A 1J1CA 4CT1A 4OLIA 1ATPE 4FNWA 2ZB1A 3MN3A 3UYTA 3BKBA 2DYLA 2WTVA 3EFLA 3KU2A 4IACA 5K5NA 3VF9A 3R30A 1XH7A 4MQ1A 2UW6A 4H3BA 3VS4A 2ITXA 1U5QA 2VTOA 4UZDA 3EQPA 1OKYA 5K0KA 4NKSA 4XH6A 1U46A 2V62A 1PYXA 5GJFA 2PHKA 5F9EA 3NGAA 4JNWA 3V3VA 2C30A 2ZM3A 3BRBA 4C2WA 5CEIA 4FKGA 3B2WA 3RK7A 1RJBA 3HRCA 3ORMA 2WMQA 3VHKA 4DGGA 4D2PA 3T8OA 3W1FA 1M14A 4YLJA 3Q4TA 4AWIA 3A7IA 4JRVA 2VRXA 1ZYJA 3EN4A 3L8VA 2VTSA 3U9CA 5KX8A 3LCDA 4NIFA 4X6QC 4C58A 4MF1A 3MTFA 3PSCA 2C5NA 2R0IA 4BTJA 2OG8A 1YI4A 3R22A 3HL7A 4YZNA 3LM0A 1AQ1A 2CPKE 4PQNA 3G6GA 4FR4A 4RIXA 4S33A 4XV9A 4WRSA 3SHEA 4M13A 2BPMA 3QZIA 3ZO4A 3PA4A 3DLSA 4JBPA 1B39A 4UB7A 1OB3A 3GGFA 3AD6A 4IBMA 2WEIA 4Z3VA 5G1XA 1O6KA 4ZTLA 1YOJA 3R21A 3NS9A 5CWZA 5HNIX 3HMOA 4QQCA 3VJOA 5JFXA 2ONLA 4JQ8A 2YM4A 4GT3A 1FMKA 4UMRA 1QMZA 4AW2A 3A2CA 3D5UA 4FK3A 4P4CA 5IQGA 2WHBA 3WZUA 3UC3A 3FC2A 2WQMA 2YM6A 3S0OA 4ZZMA 4O7WA 3CD3A 4D1ZA 4BDKA 2GNHA 3QWKA 3WYXA 2BZHB 4P5QA 3L9NA 4RJ5A 1W98A 4FV9A 3RHKA 3QD4A 2HZNA 3CXWA 3FMNA 3SVVA 3CGFA 4YBJA 3GQLA 3CKXA 2P2IA 3CTQA 3K5UA 3IQ7A 4TXCA 3TNPC 2CCHA 3UO6A 2WTWA 5HE0A 3FMEA 1GZ8A 4X3FC 4RFYA 3PXYA 5IEYA 1LEZA 4JQEA 3ORNA 5AR4A 2UZOA 3GC9A 3MFTA 4G2FA 5ANOA 4BYJA 4EOQA 1ZOHA 3F3ZA 3F5PA 4M0YA 2I1MA 1GOLA 2XK9A 4R3CA 4XCUA 4CCBA 3FLZA 3VIDA 4IX4A 4XBUA 5CU2A 3FSKA 2F7EE 2H34A 2BHHA 3IDBA 3PIYA 4O6EA 3E87A 4B9DA 4EK5A 4A9YA 4BCGA 2CNQA 3OBGA 5ACKA 4FOCA 1Q8UA 4I94A 2WMRA 3P23A 5IZFA 4IAKA 3DAKA 3RINA 5KHWA 3H4JA 1WZYA 4K9YA 4U9AA 4YZBA 4QTCA 4EHVA 2J0JA 3MVHA 1M17A 3OXZA 3TZMA 4FIJA 3DB6A 3WZDA 2ITOA 4RJ8A 3HDMA 3TTIA 5M07A 3ZSGA 4EZ7A 5LVPA 5KKRC 4YZCA 2O64A 5CS6A 3UP7A 2QI8A 3FL4A 3RM6A 2CN8A 2CKEA 5T68A 4D4YA 4DGNA 4YNEA 5D12A 3M11A 3W2RA 2VWIA 3EQDA 2OO8X 2RFSA 4YHJA 4NYEA 3LXKA 3GU4A 1BLXA 4XYFA 5AAFA 3TIZA 3FPQA 1OL5A 3UMWA 4EH8A 5KMJA 3HMPA 2CHLA 3R2BA 4QMQA 4FUYA 4D1SA 1VZOA 3FLQA 3G0EA 3F66A 5AIRA 3ODZX 5K4IA 4IJPA 1REKA 3EFKA 4YLKA 3EQBA 4USDA 1OBGA 4G3EA 1PXIA 4BDEA 4PF4A 2ZM4A 4IWOA 1XH6A 3OWLA 4O1PA 3PG3A 4ANLA 5BYLA 4YTIA 1W7HA 4KAOA 5IUHA 4HVGA 3RPYA 5HIEA 5L3AA 3MVJA 3R1QA 3ZBXA 1CKIA 2CKOA 4ACCA 2XNMA 3R1YA 3T9IA 3FEGA 3ID6C 4MEDA 3KRRA 3MPAA 3Q5ZA 3CPBA 2QVSE 2YAKA 4IE9A 2O3PA 5LMKC 2BKKA 2PVFA 2IVUA 3BYUA 2YCFA 4L3JA 4OUCA 2E9PA 2VGOA 4U42A 3SD0A 3VBVA 5CAVA 5AR2A 2W1FA 4X2NA 2BZKB 3ZDIA 3BQRA 2YJSA 5I9WA 3HAVA 2PZYA 4AN9A 5KNJA 2C1BA 4A4OA 1IAHA 4BZNA 5BPYA 3W2QA 4FVPA 2W1GA 3QGWA 2YCSA 1ZYLA 4D2SA 3CEKA 3NPCA 4O91A 1OZ1A 3TNQB 3G5DA 4QP7A 2YISA 1ZMVA 3EQFA 3R6XA 1QPJA 4IVBA 4JBQA 1FINA 3OMVA 4XP0A 1JKLA 3HZTA 4GIIA 2C3LA 1MQBA 1V0BA 4RZVA 3IDPA 4D28A 4KIKB 4UMPA 2YERA 2WMBA 4IAAA 4XLIA 2HWOA 5DRDA 2IPXA 2QO2A 2XIZA 4X6RA 3ZFYA 4EH7A 3F7WA 2I6LA 3IOKA 1YI3A 3GP0A 4XG7A 4NCTC 4QMTA 3GU8A 3F3TA 4KS8A 4U7ZA 1JBPE 4D4SA 4EH9A 3UZPA 2ZDUA 4NM7A 3AGMA 3QKKA 3I60A 3P79A 3E8EA 4EZ3A 1LR4A 3AC8A 4FTNA 2LGCA 4JDHA 4ANBA 1PXKA 3LCSA 2XK6A 4F7JA 1JWHA 4RIWB 2OXYA 1NVQA 2QOIA 2WTCA 3UOHA 5FBNC 5FTQA 4E4MA 5FTGA 2HELA 3KK8A 5EM8A 5HE2A 1T45A 4O22A 3PFQA 5CF6A 4NFMA 3VN9A 1P4FA 2HW6A 3QLGA 5M51A 4JDKA 3QTUA 1ZRZA 3FLWA 3EH9A 4I93A 4YC3A 5IH4A 2E9NA 3QRJA 4FL3A 4FVRA 4Y46A 4EQUA 4DHFA 4FKRA 3CCNA 2IVSA 3FV8A 4HZRA 4GKHA 2RIOA 3E8CA 2OIDA 1REJA 3PWDA 3R8MA 5AV2A 3QCQA 3ZUVA 4BIEA 5CAQA 1KV1A 1H07A 4O0SA 5CASA 2P3GX 3RI1A 3ETAA 1L8TA 2JDTA 2PZ5A 4ACHA 4EOOA 3GXLA 4PL5A 3BE2A 3TKHA 1Z57A 4X2KA 3GU5A 4WNPA 4XV1A 4RQVA 4YR8A 2F2UA 3MB6A 2ITPA 1W0XC 4CV8A 4FV0A 4D9TA 3GC0A 4JG6A 4XV3A 2PE2A 5EDPA 5JGBA 2YACA 2OFVA 2DQ7X 2VWWA 1Y6AA 3RZBA 2I0HA 4C3RA 5EQEA 3JVRA 2WQNA 3ZZWA 5CU6A 2YCRA 1L3RE 4U3ZA 4ZXTA 1J7UA 1MQ4A 3PXFA 4D5KA 4YPDA 5KBQA 5E90A 4DLJA 2VAGA 2VO7A 3V5WA 4DLIA 4FG9A 2BIKB 2JGZA 2RL5A 3QRKA 4DFZE 5E8UA 5CQUA 3HMMA 3U6HA 2WU6A 2E9OA 3VS5A 4PMTA 4TZRA 3PP0A 3R02A 2C3IB 3QALE 3OWJA 2YM3A 5IQCA 1YHSA 3AXWA 3FI2A 2VD5A 2PVJA 1ZXEA 4BN1A 4LL0A 2WU7A 3BWFA 3I0OA 2QD9A 4FL2A 1O9UA 5LARA 4ACDA 2P4IA 4DTBA 5H3QA 5DI1A 5J5SA 2XK4A 4MKCA 4CFFA 4Y5QA 1Q8TA 5H2UA 2BAQA 2VUWA 4WO5A 3COIA 5JK3A 4KUJA 1XWSA 4L00A 1DM2A 5CVFA 4JG8A 2X2KA 3PVBA 4BL1A 3R83A 4ZSGA 3PRFA 4GYGA 4OT5A 2XF0A 3OWKA 2HZ4A 3S00A 5FXRA 2R4BA 1YXXA 4P5ZA 3MVMA 1PHKA 3TXOA 2AC5A 2GNIA 4ID7A 4E6CA 4DGOA 2JBOA 3ZLWA 5E8WA 3U55A 2W5BA 3KXNA 2QHNA 3QYWA 4YTHA 1JOWB 3OT8A 1OM1A 2JAVA 5DR2A 2XNOA 2YAAA 4AW1A 4BICA 4FTLA 1RQQA 2YM5A 4KIQA 3OCTA 2NRYA 4GU6A 1MP8A 4L8MA 4K2RA 5KZIA 4AA0A 1IR3A 4U43A 4MTAA 3SLSA 3HECA 2F7XE 2X2MA 4F7SA 2ZV7A 3EZVA 3OBJA 3LCOA 3ZTXA 3CR0A 4MK0A 4E20A 3EN5A 5CQWA 2HXLA 4X3FA 1XBCA 3GB2A 5TO8A 1YVJA 4IVAA 3Q4ZA 5A4EA 2R5TA 3EMGA 4QYEA 2CGUA 2XRUA 5K4JA 1Q3WA 2HENA 4O0VA 3W18A 3UQCA 3PXKA 2W99B 3GC8A 3R63A 4TYIA 3LJ1A 4FYNA 3RK9A 3ZSIA 5LQFA 4X21A 1DS5A 1Z5MA 1H4LA 1OKVA 5CF4A 3NUSA 4IB0A 4CQEA 2HIWA 4O86A 3HA6A 4MD8E 2R7IA 5E8ZA 1ZWSA 2Z60A 1GJOA 3F5UA 3C5UA 4MNEA 4FV7A 1IRKA 2E2BA 4RJ6A 4XBRA 5H8BA 2XBJA 4OTWA 5L8JA 1U54B 2PSQA 3CKWA 4CXAA 5LVNA 3BGQA 3KEXA 3OUKA 3L9PA 1Q41A 3MVLA 5IPJA 3C5IA 2R3RA 3EL8A 2BMCA 5IEVA 3Q96A 3CTHA 3LOKA 1KE9A 5CY3A 4EONA 4RWKA 3NLBA 2EB3A 3POOA 4QMZA 4NTSA 2UZUE 4YLLA 5HNGA 5CZIA 4I5MA 5TKDA 4UWCA 5LMBA 1UVRA 3H3CA 4WSQA 1ZARA 4C3FA 3N9XA 4ITJA 1RW8A 1Z9XA 2PVRA 4FT7A 1OL1A 4ZIMA 4MD9E 3FPMA 4E7WA 3IDCA 4FIEA 4ZEGA 4LRMA 1KWPA 5EM7A 4BCMA 4BI2A 2XJ2A 3DBDA 3GI3A 2R2PA 4B8LA 4OBQA 2UZLA 4B0GA 4D1XA 3LFFA 3D7TA 2W17A 4MWIA 5FTOA 1CKJA 2R3NA 4K11A 1P14A 4EK3A 1F5QA 3O51A 2OKRA 2PVMA 2X81A 3H0ZA 1G8AA 3UVRA 1TQMA 5CF5A 1PRYA 3BHYA 4BZOA 3U4WA 2Y6MA 5B0XA 4YJOA 3PE2A 4FX3A 4ANMA 1QPDA 1CTPE 3SV0A 4A9RA 4LFIA 5CVHA 4FZDB 4CQGA 5TE0A 3A4PA 4OAUC 2VX0A 2YWPA 2GHGA 3CQWA 5CX9A 1GIIA 3D4QA 3U4UA 5M06A 3O8UA 4V04A 1V0OA 4DYMA 4AZTA 2GQGA 3ALNA 2I0EA 4USEA 3G15A 4O38A 4C4IA 4P90A 4LL5A 2OH0E 4FMQA 4QMXA 5I0BA 2PTKA 4YJTA 1LPUA 3GVUA 2GDOA 4L6QA 4IANA 2B9FA 3KF7A 1H1PA 2PMIA 3BHTA 3L8XA 3PUPA 2CNVA 1WBTA 2ONLC 4XRJA 5HIBA 4GSBA 2Y4IB 5CENA 2H9VA 2YZAA 3QCYA 4XHKB 3SG9A 3II5A 1PMVA 3RALA 3TNHA 5IA2A 5EFQA 2OJFE 3Q5IA 2C4GA 4FTMA 2BHEA 2B52A 3LQ5A 2GTNA 3GFWA 2WO6A 1YXUA 4ZY5A 4IAZA 4QMNA 3DLZA 3HYHA 5L2IA 1STCE 4EOMA 4V05A 1Q8ZA 5DWRA 5IA0A 2ZV9A 4ANSA 2YZLA 1GIJA 3LW0A 4F9YA 2F2CB 3FWQA 3I1AA 4JXFA 4RVLA 1XH5A 3EKKA 3QTQA 4WSYA 5AP1A 4EJ7A 2XP2A 4EHEA 3DCVA 3KC3A 2I40A 3UPXA 1P2AA 4OBPA 4NCTA 4L52A 5AM7A 4TRLA 3W33A 5HZNA 2W1DA 5BVDA 3ENMA 2X7GA 3N4VA 4OTPA 2XB7A 2C6KA 3MPTA 3QZHA 3NSZA 4BKZA 5EK7A 4FGBA 3RJCA 5AR8A 4QNYA 5BVFA 4BDHA 3LCKA 3MFSA 2YIRA 3OFMA 4O83A 4V0GB 3KXMA 3NIEA 3NYNA 5D11A 3SX9A 2F57A 4LGGA 4MYGA 3RPOA 5A54A 3AD4A 3BU3A 5HGIA 3ZH8A 2WD1A 2WAJA 3O2MA 2BDFA 2FB8A 4XG3A 3UBDA 2ITWA 2VTJA 2PUUA 4EUTA 3QXPA 5A9UA 2IW9A 4ALWA 5DVRA 2R3QA 5JQ5A 5M56A 4C61A 3CIKA 2BAJA 3FDNA 4FSNA 4H36A 3TT0A 3LMIA 1BI8A 2HY81 1WFCA 2PZPA 3A8WA 4OTHA 1OIUA 4WNOA 4GCJA 2NNWB 3IW6A 1ZYSA 3DDPA 5C03A 4AW0A 3CY3A 4KBAA 3VBYA 3HV3A 3VJNA 4YZ9A 2JD5A 2J90A 5C01A 4JR7A 3BHHA 2Y4PA 3E7OA 2BROA 3FMDA 4JAJA 4O1OA 3QX4A 4RIYB 3RZFA 4DC2A 2W1HA 3MIYA 3QQGA 3DK6A 1OIQA 3KVWA 2FSMX 5C8NA 1V1KA 2PVHA 3P7BA 3QZGA 5E8TA 2KULA 3U6JA 4BIBA 1OGUA 4FTQA 2QR7A 2XMYA 4I6HA 3OWPA 2EXCX 4D2RA 4F0IA 5L2SA 2J0IA 4KS7A 4N6ZA 2R64A 4BTFA 1J3HA 4L68A 5IQDA 4OTRA 3VS7A 2CGWA 3QRTA 4S30A 3QHWA 4UMQA 2HAKA 2YIYA 5HO7A 3HRFA 3DA6A 3LXNA 2FGIA 4X2JA 5J87A 3AQVA 4XLVA 5KMLA 3MWUA 2QURA 3NW7A 4EJNA 1G3NA 1PMNA 4Q9SA 4ZTSA 3SXFA 4CZYB 4XOZA 4BDFA 5BVOA 2XIYA 4Z7HA 3UVPA 4E5AX 4FSTA 4GFGA 2GCDA 2HOGA 2R3JA 4NJDA 2G9XA 3S3IA 1YXVA 4IW0A 1OUKA 1PXPA 5HORA 4BI0A 4LM5A 4NH1A 2DUVA 1PF8A 3QTIA 4DF3A 3UOLA 2BRGA 2GNGA 1XHAA 1KE6A 1XBBA 3KXXA 3UJGA 5D7AA 5IUIA 2J50A 4BBFA 3WIKA 2E9UA 3KMWA 1H25A 3VF8A 3VUTA 5JEBA 4UXQA 5DHJA 2B9IA 4O7VA 4QTAA 2BALA 3FKLA 1GIHA 2RSVA 3DU8A 3DJ6A 4XG8A 5CSHA 3R7OA 4IJ9A 3WF8A 4MBIA 3P86A 5I4NA 3TM0A 4NK9A 3GCSA 3TL8A 3LFBA 2V0DA 3VNTA 2HK5A 3CLYA 3GOPA 3WI6A 1RDQE 1UV5A 5HLPA 3I5NA 3WOWA 3PSDA 3VULA 3D5VA 3BYMA 2BVAA 2PMOX 3A4OX 3R2YA 3R9DA 1Q5KA 1URCA 2W4KA 5HD7A 3LAUA 3DJ7A 4FNYA 4BCJA 2OU7A 2HYYA 4HZSA 5KBRA 5M4CA 4ENYA 4AF3A 4RG0A 3LLAA 3C0GA 5L2QA 4UX9A 1KUTA 3UO4A 5DPVA 3TNWA 3GNIB 3BI6A 4OBOA 3MJ2A 4PL3A 5GZAA 3DNDA 3HLLA 3OCBA 3U8WA 3R73A 4M69A 5CSWA 2WZJA 1OKWA 1ZYDA 4QYGA 4BDGA 4FV1A 3K3JA 4KWPA 4E26A 4CCUA 4F70A 2VTIA 2J5FA 3NIZA 4FTJA 2F7ZE 2O63A 3H9FA 3O7LD 5AR5A 4Z7GA 2QOKA 2PMLX 1JQHA 3REPA 3K54A 4QMYA 3HNGA 2R7BA 3PY0A 4EEVA 5C8MA 4QMLA 4YO4A 2V7AA 2XKCA 3KN5A 3ZC6A 2CKQA 4K18A 4I23A 1X8BA 2G15A 2H96A 5CTPA 4CSVA 3S1HA 4CZTA 4R7BA 2HCKA 2J9MA 4AACA 4QTEA 4ZZNA 3H9RA 5AADA 3SW4A 4CTCA 1R0PA 3TZ9A 5EKOA 4FOBA 2YIXA 2CJMA 5GJGA 4ZY4A 1U59A 4CRLA 4XP3A 3ZXTA 2W06A 2VTRA 4FICA 1BL6A 4IWDA 3VW6A 1BX6A 1UNLA 4KD1A 2GNFA 4DBNA 4DGMA 2WMTA 3LE6A 4OTQA 2ZV8A 3RP9A 2JDOA 3V04A 3KRLA 4AP7A 3QF9A 1UU3A 5AX9A 3DBQA 1NXKA 4PDOA 1W84A 5HBEA 4GMYA 4XG4A 4A07A 2ZAZA 2XJ0A 4N70A 4ZK5A 3QYZA 3W55A 2R3KA 4OTIA 1YWNA 5JFWA 2WMVA 3LFAA 4WIHA 2QOHA 2VGPA 5IQAA 4X2FA 1M2PA 5CT0A 3O17A 1KE8A 5FQDC 4F6UA 4Z55A 5AM6A 2A0CX 2BRHA 2G01A 3C4XA 2B53A 2BDJA 4U81A 4UXLA 4R77A 3H0YA 4AT5A 4GEOA 1Y8YA 4GG7A 3HP5A 1WVWA 3NNVA 3DK7A 4I6FA 3DBFA 5FGKA 3FQSA 4DN5A 2C5YA 4I1ZA 2C6EA 3IOPA 2XRWA 1SVEA 4R3PA 5HBHA 3E3PA 2BKZA 4A9TA 5ANEA 4UYAA 4MQ2A 5HIDA 5HLNA 5KCVA 2PK9A 5HE3A 5I9YA 4BCQA 3AC2A 4AT4A 4HNIA 3E8DA 3HV5A 5GZ9A 3Q6UA 3TCPA 3ZRLA 5CEMA 3OF0A 3D14A 2W1IA 4FTCA 4RX9A 3LFDA 4YJQA 3SOCA 2A4LA 4RA4A 3UTOA 3VC4A 4DFBA 5HEZA 3PXQA 4FTTA 4BVUA 2YABA 3FZSA 3KKVA 3OC1A 3NVKI 5ANKA 4O0RA 3MV5A 3F6XA 4HPUE 4GU9A 2UW5A 1W8CA 1UNHA 3AMAA 3MB7A 5GNKA 3O8TA 4FV3A 4AAAA 5HLWA 3LM5A 5HE1A 1BYGA 4NTTA 5HOAA 5AV4A 3QQKA 4ZSEA 5E9EA 3OT3A 4TYGA 5EQPA 5IUGA 3ENHA 1YDTE 2B1PA 4M84A 4HYUA 3PG1A 5C1QB 2OF4A 4FSQA 2BDWA 2GNLA 3Q53A 1T46A 5CEPA 5DEYA 4KKGA 3PA3A 4Y8DA 4LI5A 2YA9A 1CDKA 3SGCA 3F2RA 1K9AA 4YPSA 3R7YA 3V5JA 4M66A 5IA3A 4J53A 4EYJA 3MPMA 3BE9A 4QQ5A 2QNJA 5ANIA 1MUOA 4UN0C 4AFEA 4Q5EA 2RGPA 3UYSA 1V0PA 3KF4A 4R3RA 4G17A 1HCLA 1ZZLA 3HP2A 3TZ8A 2PPQA 4J98A 2EWAA 4ZP5A 4WA9A 5ANDA 5LVOA 3N4TA 3NUAA 3RNYA 3ET7A 5HG8A 2WOTA 4AZVA 1R39A 4O84A 3DB8A 3GENA 2C6LA 1SNXA 2R3IA 3HUCA 3QLFA 3R1SA 4B4LA 2ITZA 1M52A 2QO9A 3HDNA 4PP9A 3VS1A 3FMJA 4G3DA 3RAIA 3QBNA 1PW2A 4C38A 1OL2A 3M1SA 5FDPA 3FHRA 4WD5A 3WE4A 4ZS4A 1WAKA 3KFAA 1LEWA 1YXSA 2UW7A 3KULA 4IAYA 4BB4A 4Q9ZA 5KKRB 4JL9A 4CFMA 5I3RA 4ALUA 5CNNA 4GT4A 3V5TA 2WQBA 4FL1A 2OWBA 4MXCA 1SNUA 4RX8A 5EYKA 3VS6A 4CMTA 3E88A 3QA8A 5KUPA 4QMUA 3ZYAA 3OZ6A 4AZEA 4I22A 4PY1A 3GT8A 4BGQA 5HCZA 3CC6A 3LMHA 3R71A 3GU6A 1FQ1B 2VTTA 2OFUA 2V7OA 3DQWA 2PWLA 4I41A 4IB3A 4XG6A 4H1MA 3RVGA 4HVHA 4QYYA 2VNWA 2XCHA 2ERZE 3BCEA 5HTCA 4WNKA 1H8FA 1WBOA 3F69A 3LPBA 5M44A 4PRJA 5IF1A 5L4QA 1FBNA 4FZAB 3VS2A 4W9XA 4LG4A 5J95A 4J95A 5J5TA 1SVHA 2ZM1A 1OECA 4L46A 5E8YA 5EYCA 4EZ5A 3EQGA 4FEVA 3KXHA 4KA3A 2JDVA 2G2FA 5AUVA 3UODA 4IC7A 4FA2A 5HI2A 4CKRA 3OW4A 1Y57A 1CKPA 3P1AA 4AG8A 5ACBC 5AP7A 5A4QA 2J4ZA 4DEAA 2LAVA 4BDCA 2BFYA 4C33A 5M08A 4AUAA 3U6IA 2JDRA 2OK1A 2XKFA 3MYGA 4TWCA 3B8QA 3EN6A 3HUBA 3NNXA 5DH3A 4FTIA 3BGZA 4UBAA 5F20A 5J9ZA 1IA9A 3RBWA 4DT9A 3QUPA 3DK3A 3IGGA 3RM7A 3ZO3A 3G9NA 3DV3A 4EC8A 4ERWA 5J9LA 3BU6A 4RGJA 4FIFA 2BTRA 3N4UA 3FYKX 4R5YA 3NNWA 5TF9A 3AT3A 4IEBA 2QKRA 4CEGA 1A06A 3TNIA 1BI7A 1Q99A 5E7RA 5JGDA 1I09A 3KRXA 5GHVA 4XP2A 4ALVA 4TW9A 4ENXA 5CYIA 2IZUA 2VTHA 1UU9A 3BELA 1H08A 2OGVA 3DKOA 2IVVA 4M7IA 4MWHA 4TKSA 5AUXA 2YITA 4W8EA 3DOGA 5CSXA 2WFYA 3MFRA 3W8LA 1B6CB 4QP3A 4BDAA 4MHAA 2P2HA 4G3FA 4L67A 3UDBA 3FMKA 4BGGA 3C0HA 2VO6A 2OJGA 4KSQA 4KRCA 2W1ZA 3FLSA 4AA4A 1H1SA 1G5SA 3A99A 3C4FA 4UY9A 4FEUA 5HVYA 3F2AA 4DITA 3I5ZA 4O0YA 3OS3A 4EOPA 3V5QA 3IGOA 4ITIA 3EL7A 3WIGA 1OMWA 4TNDA 2C0IA 3BQCA 4NU1A 1DAYA 4IFGA 2B9JA 2UUEA 4P2KA 3THBA 4FKUA 2O65A 4KIOA 4R7IA 3P08A 2OF2A 2QOBA 1S9JA 3IPHA 1OIRA 3OHTA 3CBLA 3W8QA 3QCSA 1WBNA 4QMPA 5M09A 3L8SA 4GYIA 5EDQA 4QTDA 4FIIA 1Q3DA 2XEZA 4D4RA 4MH7A 4O7YA 4W9WA 4BY9E 3D5XA 4PDYA 4I20A 2A27A 2YEXA 3BWJA 4IMYA 4JBVA 2CGVA 4U80A 3R9NA 4B8MA 4JJRA 2ZJWA 3EQIA 4L01A 4LQMA 3NX8A 5KMMA 3SA0A 1UA2A 3K5VA 4WG3A 4KABA 4LMNA 1JKKA 3EQRA 3BPRA 2JC6A 2CDZA 2CMWA 5I9XA 5C27A 3GC7A 4BWXA 1JLUE 2IZSA 2W9FB 1P4OA 3K2LA 5AV0A 4C4HA 3FE3A 3TUCA 3A61A 5IG1A 4RC3A 1H1QA 4RJ4A 3RNIA 1TVOA 3QD3A 4DCAA 4O7RA 1BMKA 3QD0A 3BX5A 3TG1A 2Z2WA 5I3OA 1OUYA 3MH3A 3FKNA 1FGIA 2C6OA 3F3WA 4DEHA 5A4TA 2JITA 2J0LA 3DKCA 3F2NA 3FZ1A 4RWJA 3JR1A 3I7CA 5A46A 4IAIA 5CU4A 3WARA 3AG9A 3TACA 4A9SA 2YDJA 3FUPA 3TDWA 3LQ8A 4PMSA 2PULA 1ZOGA 2FA2A 4HVSA 5LXMA 5HX6A 4EOSA 1FVVA 2EUFB 5GZ8A 5GINE 3V51A 1H1RA 3ORZA 4HCUA 4DGLC 5AR7A 4DT8A 2OSCA 3NMUF 3R8VA 4TYHA 3TV7A 2RG6A 1GZKA 5CXHA 2VTPA 5EHLA 3UOKA 3R9OA 3ZCLA 4ASZA 4RSSA 1PXMA 3ZUUA 4WBOA 1APME 3PZHA 1ZZ2A 4XUFA 3LFSA 4BTMA 4QP2A 4EOIA 4F6WA 5IMEA 3VAPA 4PNIA 4D58A 5EH0A 5HBJA 5D41A 4FKTA 4C0TA 1ND4A 4CFVA 3LJ0A 4HCVA 4OTFA 1YOMA 4D0XA 2C6MA 4E6DA 4CRSA 4FZ7A 5BUIA 1QPEA 2RFEA 1XH9A 4EK6A 1QL6A 1ZYCA 2ZB0A 3ANQA 3MGYA 4RX7A 1KV2A 5CI7A 3QKLA 3FXZA 4OT6A 3Q9YA 3ZSHA 3C4ZA 4NW6A 5LMAA 4XG9A 5L8LA 3TUBA 4PMPA 5HVKA 3QHRA 3WF5A 4CV9A 3DZOA 1R0EA 1PMEA 3QTSA 3VBWA 4G9CA 4FBXA 4U0IA 3AC4A 4BKYA 4TL0A 1FPUA 5IQIA 5LVLA 3ORXA 1JVPP 3EZRA 3G9LX 3IO7A 3DPKA 4LYNA 5FRIA 3SRVB 4F99A 4GW8A 4WRGA 4E1ZA 2C1AA 1FVRA 1H01A 4HJOA 2ZDTA 5IKWA 3NYXA 1LUFA 5J7BA 2OW3A 4FUXA 5BVWA 2RG5A 2C6DA 3KRWA 4I92A 4F64A 4F7NA 4FZFB 2UW8A 1J7LA 4BR3A 3PRIA 1YW2A 4J1RA 5ANGA 3L9MA 4F08A 5ICPA 3ZFXA 4C4EA 5IQHA 3ZM9A 4YTFA 4GH2A 4O2PA 5JRSA 1Y8GA 3OCGA 1W82A 3D0EA 2J0KA 3FXXA 3FJQE 4MBJA 4U8ZA 4EH2A 4EUUA 3UO5A 4R6VA 1ZY5A 3MDYA 2VTAA 2EXEA 3C50A 3OUNB 4LGDA 4WUAA 4D2VA 2OI4X 3P5KA 3RWQA 2QONA 2G1TA 4FEXA 4R1YA 3Q9WA 4FV4A 4FV5A 4F9CA 2VTMA 4UWBA 3UC4A 3PJ1A 4MX9A 2Q83A 3IONA 4I4FA 1OI9A 3RGFA 2YDKA 3EIDA 4NZWB 3WBLA 3C13A 3TDVA 2F49A 3F88A 4YBKA 2G2IA 5JMSA 3IW8A 4M8TA 3OEFX 4Q2AA 4QD6A 2XM8A 4QPMA 5FXQA 5JT2A 1QPCA 5E8SA 2NRUA 3ZO2A 4EORA 5IA4A 2X0GA 3QQUA 3W2PA 3RHXA 3ZZEA 3DKGA 5EYDA 4RWLA 3TKIA 3TZ7A 4BBEA 4AGUA 4I5HA 2EU9A 1Y91A 3MH0A 3T3UA 4A7CA 5M53A 5HCYA 1Q8WA 1VEBA 1KOBA 1KE5A 3QUDA 5CAUA 1WBWA 2X7FA 3OOMA 4PPCA 3FQEA 4H1JA 3ZLXA 1XJDA 5EI6A 3FAAA 3P78A 2ZYBA 3E5AA 3RWPA 3VUDA 3PVUA 4EYMA 3VO3A 4W4XA 2J51A 4NSTA 2FSOX 5AP0A 4GVJA 2OXDA 3JUHA 3JPVA 2QR8A 4C34A 3PY3A 4O7ZA 4TN6A 4EH4A 1XO2B 4XMOA 5TR6A 3BEAA 4R7HA 4YJNA 1YI6A 2BIYA 5E1SA 4AT3A 2QOQA 2AUHA 5CU3A 3NCGA 3EYHA 5K0XA 2HZ0A 2PE1A 2W05A 3K3IA 4OR5A 4NIFB 2X9EA 3C4WA 3IG7A 4IXPA 3KRJA 2PVLA 3CJGA 5DT0A 5DT3A 5CXZA 2VTQA 5DRBA 5B2LA 1YXTA 4RIXB 2BAKA 4QYFA 2QLUA 1CMKE 3U54A 4LUDA 2QOFA 1IEPA 4LRKA 2E9VA 3PPZA 3SXSA 2FH9A 4KB8A 4GFMA 4FODA 4W4VA 3P0MA 4IFCA 5EOLA 4FKOA 5AAGA 2X2LA 3OXTA 4M12A 1BL7A 4EQMA 4QQJA 4ZMEA 2B7AA 4BZDA 3HV7A 4I3ZA 1IAJA 3R8PA 1OL7A 4JDJA 3MW1A 4DFNA 2YM8A 4UYNA 3ERKA 4YSMA 4AN2A 3D83A 1QCFA 2H8HA 2Y9QA 2FO0A 3ZUTA 5J9YA 1J7IA 5EOBA 3FZTA 2VWZA 2X6DA 3JYAA 4OAVB 2C0TA 4C35A 2PZIA 3FZOA 4O21A 5JH6A 3PA5A 5JGAA 5LOHA 4UZHA 3HRBA 3H9OA 2IJMA 3DKFA 4OW8A 5FM2A 4ASXA 2C47A 2UW9A 3G2FA 3HGKA 3PJ8A 4I5CA 4C57A 5CSPA 5K5XA 2RFDA 2QOLA 3FY2A 5EI2A 4DEDA 4EI4A 4WG4A 4LV8A 3LZBA 5AUZA 3Q32A 1R78A 3KGAA 1YQJA 4KIKA 4QP1A 4BCHA 4C4FA 4MNFA 3FMLA 2WTKC 4FV2A 4HYSA 4OGRA 4WG5A 4N0SA 4GKIA 4N57A 4FT9A 4L3PA 3DTCA 3DFCB 3TJDA 2WOUA 1PXLA 4IIRA 4FKIA 4RC2A 5ETIA 5AX3A 1U4DA 3I6UA 5H8GA 3OD6X 3A60A 3COHA 3HVCA 4ACMA 4AU8A 3N51A 4AXAA 3L8PA 1VR2A 3A7FA 3OTVA 1XR1A 4UMUA 3P7CA 4IAFA 1LP4A 2WMWA 5BMMA 4HYIA 4L9IA 4E4LA 5IQBA 4RIWA 4CKJA 4U45A 5F95A 3FI3A 3R7VA 3QZFA 2PE0A 3ORTA 4TY1A 5BVEA 4BTKA 4GFOA 3QQJA 1GAGA 1PY5A 2JFLA 3FXWA 5K3YA 4BCFA 2Z02A 4TYJA 3R9RA 5GIOE 1DI9A 3LIJA 1E1VA 5GIPE 3NDMA 4FSUA 3WZKA 4JVGA 2Y0AA 1JKSA 1UU8A 2O0UA 3TWJA 3BBTB 4G5PA 5AP3A 5BVNA 4RPVA 4W4YA 3MESA 4ARKA 2YHVA 5HO8A 4A06A 2X1NA 3QQHA 4O27B 1HOWA 2XK7A 4PV0A 1M7NA 5IH6A 4HOKA 5C26A 4FSMA 4ERKA 4YURA 3FLYA 4PL4A 1OL6A 4C36A 2YFXA 4EQCA 5DMZA 4U44A 2WIPA 4RJ7A 4FKQA 4IX5A 4LUEA 5CVGA 5CAOA 4K33A 1OPLA 3UGCA 5FLFA 2C3KA 1M2QA 2ITTA 5AA9A 3R8UA 3LFQA 4GUBA 5K9IA 3D5WA 1VYZA 4RLKA 2C3JA 4Y72A 4DEEA 5AA8A 3NYOA 1PXJA 4H05A 1XH4A 4U6RA 4WUNA 5FDXA 4NM0A 4BIDA 4NL0A 3OEZA 1NY3A 3BHVA 1KSWA 4QYHA 3I0QA 1Q24A 3F7ZA 3VRYA 5CANA 5DNRA 4F9BA 4I6BA 2XNPA 4IH8A 4ZZOA 2W5AA 4GT5A 4M0ZA 3F3UA 3ZHPC 3QRUA 1BKXA 4M97A 4AOIA 4BI1A 3ORLA 2YDIA 2H6DA 3BHUA 3EFJA 3GCUA 1E1XA 3NUXA 3ODYX 4P7EA 2W5HA 4FKSA 4H58A 5DG5A 3UVQA 3EJ1A 3I81A 4CTBA 5E8VA 3PZEA 4DAWA 3CPCA 4Y73A 3VUKA 3JS2A 4UMTA 4JRNA 1P5EA 2WGJA 2Y6OA 4CT2A 1ZMWA 4WT6A 3E7VA 4O0UA 1I44A 4R5SA 2BUJA 2ITYA 3FZRA 1CM8A 2PVKA 2YLEA 3ORPA 4H3QA 4J52A 4Y85A 4ZLYA 5IMXA 2ITQA 1JSUA 4ZMFA 4BFMA 2O8YA 3MI9A 3D15A 3A62A 3O50A 3VBTA 4DG2E 2YN8A 2Z7LA 3BIZA 3G90X 4R1VA 5AR3A 3VS3A 4EK8A 5HU3A 4O7NA 5IQFA 4WKQA 3C1XA 2XEYA 1OITA 4IB1A 2UW4A 4F7LA 4TTHB 3MY1A 2JIIA 4TWOA 4YU2A 5HESA 4ZLZA 3Q04A 2X39A 1NVRA 4C4GA 4GUEA 3QXOA 4G34A 3VUHA 3Q6WA 3RMFA 4EC9A 4L44A 3NUUA 3AC3A 3PPKA 5KMIA 5HG7A 2QG7A 3C4CA 4IX3A 1GZOA 3JY9A 3ZLYA 5J1VA 4QPSA 4GK3A 3POZA 2VWYA 3F61A 4IM2A 3FC1X 2GS7A 5ITAA 4X3JA 5EHOA 1J91A 2VWXA 3NAXA 3PE1A 2OJ9A 3GEQA 4E8AA 5JN2A 5D9HA 2C5VA 3DY7A 5HICA 5JRQA 4PDPA 5HNBA 3NRMA 3QU0A 4LRJA 2EVAA 5AV1A 5ETCA 1WVXA 3UQFA 2HXQA 2VWVA 4I0TA 1NT2A 1PYEA 3KREA 3ANRA 4JIAA 1NW1A 4NUSA 5FBOA 5I9ZA 1U54A 4FKJA 1WBVA 4L7SA 3QWJA 3MH1A 3EB0A 4D2TA 4BDDA 1MRUA 4U97A 4FC0A 4ZY6A 2XH5A 3Q3BA 4GIHA 4HW7A 1O6YA 3HKOA 4AGWA 4IX6A 3MH2A 2OBJA 4IQ6A 5HG5A 3RPSA 2YCQA 4FSWA 4IADA 4L3LA 2FVDA 2WB8A 2R3MA 4C02A 4EOJA 2A1AB 3R7GA 2Z7SA 1A48A 2J6MA 4GL9A 3LQ3A 3NEWA 5DE2A 3BBWA 4ITHA 5D1JA 5A4CA 2WXVA 4K77A 4KIPA 3R0TA 5B2KA 4QP6A 4F1TA 2OIQA 4KBCA 2X8IA 4ZAUA 2JEDA 2CKPA 5BUEA 3EOCA 4WHZA 3ZRMA 2XS0A 3NUNA 1YDSE 2UV2A 1MRVA 2QKWB 4PTGA 1OVEA 4WBBB 1AD5A 3B8RA 4DTKA 1PKDA 4B6LA 2XA4A 5CT7A 2QHMA 4CGAA 3VBXA 1UKIA 3W16A 3FI8A 1PKGA 1YHVA 3QC9A 4FKPA 2GSFA 4F6SA 5HX8A 4RC4A 3UNZA 2GHLA 4RLLA 4FTKA 4HCTA 3DXNA 3O0GA 4ONAA 4FKLA 3ZC5A 1DI8A 2G2HA 2QU5A 2WQEA 4D0WA 4PPAA 4DH3A 1JKTA 1YKRA 2WPAA 3BGPA 4O82A 2P33A 3PWYA 4X2GA 1XKKA 4TYHB 4YGAA 2I0YA 3E64A 4O96A 2Y7JA 2C69A 3KA0A 4QTBA 5HHWA 4FV8A 4GJ2A 4HVIA 4ZOGA 5C8KA 5IDNA 3PLAE 2BILB 2W0JA 4KBKA 4PPBA 5A4LA 2IO6A 2ZMCA 3HV6A 3WF9A 4YC8A 2OIBA 2UZVA 4CNHA 1WVYA 4H3PA 5LVMA 2XIKA 5D7VA 3OY3A 4BRXA 5KZ0A 2XKDA 1JPAA 1GY3A 4AOTA 5DLSA 2OZAA 2VTNA 4M67A 4YP8A 3ACKA 5KE0A 1Q62A 1URWA 1Q97A 1SMHA 3LMGA 4LOQA 5M55A 4D5HA 3GBZA 2NPQA 2IWIA 3PVGA 4NKAA 5L6PA 5EW3A 4B7TA 2QOOA 3ZO1A 1JSTA 3C7QA 2PY3A 5BX0A 1PJKA 5CAPA 4BYIA 2PUIA 3RK5A 4CFNA 2JLDA 3CGOA 3ZM4A 4RVMA 5IA5A 3DQXA 2XZSA 4X3FB 3F3VA 2NO3A 2GU8A 2OICA 2XKEA 3MIAA 4QMSA 3VW8A 4A9UA 3MA6A 4KSPA 3LKMA 4E3CA 1M7QA 3D2KA 3WF6A 3MS9A 4YHFA 4F0FA 3JXWA 2REIA 3ITZA 4XS2A 4CKIA 2O5KA 5AAEA 3BZ3A 3L9LA 3M2WA 4XX9A 3OROA 3KB7A 1FVTA 2SRCA 4Q5HA 4EH5A 3WZJA 2UZDA 2GMXA 5TT7A 2UZTA 3MJ1A 4PUZA 3RKBA 4MNEB 4JDIA 4NJ3A 4E5BA 4V0GA 4N6YA 5AUUA 3C9WA 5EHYA 4ANNA 4F9WA 5HQ0A 2JAMA 1PXNA 4O6LA 5I5ZA 2BFXA 3QX2A 4U3YA 5JZJA 2NP8A 2GFCA 3BLRA 2WELA 2V22A 3AC5A 4QNAA 3TI1A 3UMXA 2W96B 4CG9A 3ULIA 3FZPA 2Z7QA 3PJ2A 4IZYA 4FI1A 4S2ZA 1F3MC 2ITVA 2QOCA 4YC6A 2JKKA 3EQHA 3KVXA 1YRPA 4RIOA 4AZWA 4LGHA 4AW5A 2RKUA 2XBAA 4FVQA 4TWNA 4GV1A 3R00A 4IB5A 1R3CA 4A4XA 4HGSA 3TKUA 4RIYA 1JAMA 5H8EA 3E93A 4EHGA 3I6WA 4YZMA 2HWPA 4NWMA 4O0WA 2R3OA 4ZTNA 3D7TB 5AV3A 4USFA 3BYVA 3PVWA 4HGTA 4BHNA 2J5EA 1YWRA 2VV9A 5FEEA 3VUGA 3QC4A 3QTZA 3EN7A 4FSZA 3ROCA 4V01A 4G6LA 4GK2A 4L43A 1OIYA 3M42A 5AMNA 2AC3A 4UWYA 2JKOA 4U79A 4CG8A 4L42A 3VQHA 1OBDA 3QFVA 4F4PA 5DT4A 3P4KA 1O6LA 2ITUA 2RFNA 4IM3A 4F09A 4IZAA 2XJ1A 3IK3A 4K6ZA 3R8LA 3QQLA 5EKNA 2YIQA 2W4OA 3OP5A 3S2PA 5HVJA 3MBLA 3G33A 3G0FA 5KMOA 2R3GA 4ACGA 4L7FA 2WIHA 5BNJA 3C4EA 3NNUA 4ZJIA 4CFUA 4XG2A 4F1MA 5KHXA 5DIAA 3UZTA 4E73A 2C6IA 3KCFA 4RFMA 5EW9A 5JQ8A 3ZONA 2R9SA 2W1CA 2Q0NA 2JIVA 3NW5A 4RJ3A 3WE8A 5AP2A 4BWKA 4LV5A 2C5XA 4YJVA 4FEWA 1M2RA 5M4UA 4WOVA 4PTEA 4APPA 3ORIA 4JI9A 4QQTA 2ZOQA 4FTAA 4ZTQA 4BDBA 4ZJVA 3PIXA 3ZDUA 3U51A 1JNKA 3ZMMA 4FKVA 4NM5A 1SVGA 1ZY4A 3ACJA 3BU5A 3Q4UA 4UV0A 3QCXA 4BC6A 3MY5A 5JKGA 2C5OA 3LFNA 4KINA 5JSMA 3ELJA 3LCTA 3O8PA 4PDSA 3DZQA 4QP8A 3VUMA 3ATSA 4G3GA 2BTSA 3UZRA 1Y6BA 1YHWA 4RBLA 2DWBA 3NWWA 2R3PA 4M68A 3LFEA 2XVDA 1K3AA 5CEQA 4YHTA 4E4XA 3I4BA 4O2ZA 2GFSA 4S34A 3PIZA 4RZWA 4MVFA 4Y95A 3DT1A 3GCVA 2AYPA 4CYJA 4F9AA 3UIMA 2WEVA 3E92A 4AZFA 3UNKA 4KNBA 5CU0A 1IG1A 1TKIA 5FUTA 1VYWA 3F5GA 2JKMA 3CE3A 5L6WL 4ANQA 2C0OA 1H27A 2IZRA 3UQGA 3V6SA 4YJSA 4YUQA 3PDTA 3KMMA 3O23A 4G6OA 4E5WA 1MRYA 5KO1A 4CMUA 5FD2A 1YWVA 4FG8A 3PTGA 4II5A 2B9HA 4TYEA 1Q61A 2JDSA 3G6HA 4FIHA 4ZSAA 5L6OA 3EN9A 4YZDA 4JS8A 4EBVA 4CLJA 2GS6A 3EYGA 4XJ0A 4ORKA 3P9JA 3FKOA 5IEXA 2YIWA 2ZV2A 4QP4A 3RCJA 4PX6A 4RWIA 3Q4CA 3QAME
chains in the Genus database with same CATH superfamily
3DNEA 4KRDA 1WCCA 2ETKA 3WF7A 1VJYA 3B2TA 4GVAA 3HAMA 4O81A 4DE4A 5FM3A 2ERKA 3E8NA 1XH8A 3F82A 4AOJA 4Z16A 3H30A 3NW6A 1H28A 3ZRKA 5GJDA 5DOSA 2XIRA 4CFWA 4YTCA 2WMAA 4EHZA 2X4ZA 2IG7A 3S4QA 4DFXE 4JX3A 4FNZA 3U9NA 3EQCA 5CZHA 2UZBA 1H00A 3LXPA 3ZFMA 4DH1A 3WYYA 4L53A 5IU2A 1OPJA 2HZIA 3G51A 3LLTA 5TOZA 5DN3A 5EM5A 2PUNA 4EWQA 5E4HA 4IWQA 3TV4A 1R1WA 2FSTX 4J71A 3ZEWA 4BHZA 4IHPA 5LCJA 4JOAA 4YJPA 2XNEA 4NM3A 5T3QA 4F65A 3QKMA 3SOAA 1UU7A 5FP5A 4CZUA 3CD8A 1KE7A 4C4JA 3VBQA 3SDJA 5BVKA 5DEWA 1SZMA 4G31A 5KMKA 2VX3A 1WBPA 2YM7A 3NYVA 4CLIA 2PL0A 4U41A 4QMWA 1XQZA 2R3LA 3FHIA 4I5PA 2QLQA 3KCKA 4FF8A 4ASDA 2VWBA 2Z7RA 3FLNC 1H26A 1HCKA 5BMSA 5IH5A 3GQIA 3TYKA 3CTJA 4XEYA 1JSVA 2ITNA 4JT3A 5FEDA 3NZ0A 1DAWA 5M57A 3PJCA 3UNJA 2GNJA 3A7JA 2WMXA 4DTAA 3NVMB 3QTRA 4QT1A 3ZBFA 3NUYA 4W8DA 3IW4A 4JBOA 4DA5A 4CD0A 5L8KA 2ESMA 2WQOA 2J7TA 2UVXA 3A7HA 1J1BA 3E62A 2ACXA 2ETRA 4GG5A 5G6VA 5LJJA 1SYKA 2VTLA 5A6NA 3Q52A 3DAJA 4JAIA 4QRCA 3WILA 3WZEA 3R7UA 4AGCA 3W10A 4EBWA 3PYYA 4FK6A 4C3PA 3TEIA 3TV6A 1B38A 2B54A 2WTIA 4KKEA 5EM6A 4IDVA 3ZOSA 4NW5A 4S31A 1E9HA 2XNGA 3R01A 4RA5A 3O7LB 3V5PA 3AMBA 4EOKA 2YLFA 5FEQA 2QQ7A 4C8BA 4I0SA 3RAHA 4BCOA 2JBPA 4DBXA 2X8EA 3V8SA 4IVCA 1G8JA 2GPHA 3QGYA 4R78A 4BJJA 3COKA 3CJFA 4ZLOA 3AGLA 4JX7A 5IDPA 2OJIA 3F5XA 1S9IA 2CCIA 4O7TA 4IDTA 5FWKK 4M69B 3UIBA 4C59A 3COMA 2VWUA 3E63A 1TQPA 3W2OA 4OTGA 3R1NA 3BYSA 3KN6A 2VO3A 1H24A 4RQKA 4X0MA 3V8WA 4F1OA 5M4FA 3SC1A 4ZSJA 3VHEA 5H9BA 5C4LA 3BLQA 3T9TA 4IVDA 4AS0A 3IW5A 5FP6A 3L1SA 5JZNA 3FMMA 3R9HA 3LJ2A 2F4JA 3O96A 2ZMDA 3QRIA 3FYJX 1UKHA 2HW7A 4ZS0A 4DEBA 3UIUA 4AQCA 2A2AA 3TJCA 4QOXA 4YO6A 5ETAA 2PYWA 2PVNA 3EHAA 3P7AA 4BKJA 3VRZA 2CN5A 3D2IA 3AD5A 3NCZA 3SG8A 4ANOA 4LDTA 3MA3A 2I0VA 4HGLA 2OLCA 4MXYA 4FNXA 2BRBA 2V55A 3R8ZA 2VX1A 4C37A 3KXGA 3TN8A 4D4VA 4AXFA 4IZ5A 2VO0A 3GOKA 3KXZA 1NVSA 2GQSA 3KK9A 4C7TA 3ZS5A 4EK4A 3VS0A 3PY1A 2WKMA 2QC6A 4EH3A 2J0MB 3KY2A 2BR1A 1WMKA 4HGEA 1GNGA 2QU6A 4XV2A 2UZEA 2A19B 3SQQA 4FJVA 4OTDA 3Q9ZA 3D7ZA 5A3XA 3KQ7A 3OXIA 5LWNA 5IQEA 3LHJA 5HTBA 1PMUA 2OZOA 4JQ7A 3E3BX 4X7QA 3A7GA 3ZEPA 4DINA 5CSVA 4TT7A 1YDRE 3JY0A 4CMOA 3BV2A 3AT2A 5HU9A 4QO9A 5CNOA 5HCXA 4E6QA 3OOGA 3OTUA 2B0QA 1IASA 4IZ7A 3CS9A 3ORKA 4JR3A 4FYOA 5L2TA 3Q2MA 5CEOA 3NAYA 4YJUA 5HKMA 1FOTA 3R7IA 5A6OA 4DFLA 5F4NA 4BDIA 2CLXA 3IKAA 4J7BA 2XNNA 4XOYA 4Z9LA 1W83A 5EW8A 5LCKA 5IISA 4EWHA 2GTMA 4RT7A 1FGKA 4MXOA 4FT3A 5HTIA 4J99A 4CFXA 1TQIA 4MAOA 3R04A 4A4LA 4WNMA 4QP9A 4BDJA 4YSJA 4BCPA 2W4JA 2Y4IC 3MY0A 4KKHA 4FG7A 3HMIA 2DS1A 2FUMA 4QPAA 2UVYA 3EFWA 4I6QA 4RVTA 4FTOA 2FYSA 4MD7E 5F1ZA 1YOLA 5J7HA 5LMKA 5DR6A 5CEKA 5EQYA 3FQHA 5C9CA 3I7BA 4IM0A 2R3HA 4S32A 3BEGA 1OKZA 3MSSA 4J96A 1G8SA 2JFMA 4JIKA 1RE8A 2XK3A 4DCEA 2PMNX 4FV6A 3TTJA 3OG7A 1OPKA 4G1WA 3QA0A 2ETMA 2OZAB 4TPTA 3UG1A 4ZTMA 1H1WA 4C2VA 3EKNA 3CSVA 3RAWA 4E93A 3ATTA 1A9UA 5B2MA 4GS6A 5I9UA 3DBEA 4HVDA 3UPZA 3C0IA 3FY0A 2PZRA 2XCKA 4C62A 3ZU7A 1ZOEA 2X9FA 3PSBA 2W1EA 3V01A 3DDQA 5B7VA 3ULZA 5D10A 3Q2JA 4F63A 3OCSA 3EWHA 2WTKB 3QQFA 2QG5A 3AOXA 3IS5A 3W2SA 4J8MA 4W4WA 4MXAA 3QD2B 4MCVA 3GFEA 4DEIA 4E4NA 4EH6A 1OGYA 2VNYA 4PMMA 3UE4A 3UP2A 5AEPA 4FKWA 4APCA 2UZNA 4ZSLA 1ZLTA 4QMMA 5CI6A 4FGRA 3ZLSA 2JKQA 1U5RA 2F9GA 2C6TA 2PUPA 3DGKA 4D55A 1XBAA 4EKLA 5E91A 4D2WA 2P0CA 5IA1A 3GUBA 4HYHA 3RPVA 5JFSA 4LOOA 4NFNA 4CYIA 1ST0A 3JVSA 4FSRA 5AUWA 2QODA 3LVPA 3RPRA 4U5JA 4B99A 5CLPA 3DXPA 2EB2A 5BYYA 2B4SB 4LOPA 3I79A 2WTJA 5BYZA 3ML1A 3BLHA 4D9UA 5ANJA 5HO6A 4YNOA 5HG9A 2XYUA 4RRVA 3GU7A 1UWJA 1SM2A 3DJ5A 4G5JA 1UNGA 4K0YA 4Y83A 3C51A 4FSYA 4EL9A 4DHZA 3IECA 3HEGA 3CP9A 3QTWA 4FT0A 3KULB 4FZ6A 3IW7A 4XRLA 5AP4A 2P55A 3W0SA 1Q8YA 3UIXA 2O2UA 2QO7A 5C4KA 4NEUA 1ERKA 4HPTE 4XNEA 2UVZA 3VUIA 2UZWE 4PWNA 2VZ6A 4QMVA 4MXZA 4O0TA 4RX5A 3PLSA 4AE9A 4Y5HA 5J1WA 4IC8A 4MF0A 4ZJJA 5DR9A 2BRNA 3QUEA 4LMUA 4M3QA 4AX8A 1H0WA 1AGWA 2IZTA 3ALOA 4PTCA 1K2PA 3ROYA 4EKKA 3FI4A 1WBSA 3GCQA 2X7OA 3NFGB 4DH5A 3CQEA 4JLCA 5F94A 2OH4A 2VU3A 3QL8A 4FIGA 3UOJA 4L45A 2CGXA 4CVAA 5J8IA 5AP6A 2C68A 2IN6A 2BCJA 3RAKA 4FT5A 3FBVA 5BUJA 2Y8OA 4JG7A 2X4FA 4E6AA 3LXLA 1ZAOA 3R28A 4UALA 2JIUA 3DTWA 3MTLA 2ZVAA 1UWHA 1W2DA 3HV4A 4G9RA 4DEGA 4AN3A 1GZNA 3Q60A 4ZTRA 2IW8A 4AA5A 2CNUA 1KOAA 3KMUA 2OJJA 5AWMA 3VQUA 3DXQA 4I0RA 2GQRA 5DBXA 4RVKA 3FL5A 3F9NA 3PXZA 5ETFA 4MBLA 2GHMA 3TIYA 2X6EA 4FTUA 4BBMA 4O0XA 2X8DA 5E8XA 2CLQA 2VN9A 1IA8A 3A8XA 3W32A 4BF2A 2BRMA 3S95A 4AZSA 3BYOA 3HX4A 4K1BA 3ZXZA 4GK4A 3SW7A 2XIXA 3GCPA 3PPJA 3V8TA 2WMSA 4N4SA 4FE2A 3O71A 2EXMA 4DG3E 3FSFA 3D94A 4M15A 4RMZA 5FXSA 2Z8CA 2I7QA 3OVVA 4ZTHA 1CSNA 3AC1A 4UEUA 2IW6A 5E1EA 1EH4A 4G6NA 4AE6A 2KTYA 3DBCA 4PP7A 5LWMA 3UG2A 4O4EA 2R3FA 4FTRA 5EYMA 2UW0A 4F0GA 4DG0E 4RFZA 2BZJA 2UW3A 3DFAA 3HA8A 4ASEA 2PVYA 4IWPA 4AGDA 4BCNA 2W9ZB 4J97A 5E92A 2AQXA 3FMHA 4AFJA 5DA3A 3T3VA 2CSNA 4GRBA 2B55A 3OY1A 4U40A 3HMNA 2WMUA 3V5LA 5JFVA 3SRVA 4BGHA 4O7SA 3U87A 3RTPA 2W7XA 2Q0BA 5CALA 3D9VA 5J79A 3NUPA 3VVHA 5HD4A 2R0UA 4BCKA 3V6RA 3DS6A 4I21A 1H0VA 5FG8A 4PNKA 2IVTA 3CQUA 4G3CA 2RF9A 2HY0A 5EI8A 5EDRA 4MXXA 4TWPA 3VWAA 3AMYA 2XK8A 3BV3A 4YJRA 4DH8A 2V5QA 4R8QA 4QMOA 4TNBA 3W2CA 4J8NA 4GJ3A 4HNFA 5DGZA 3SXRA 4NT4A 5CF8A 3PJ3A 1F0QA 3QTXA 4FEQA 5L2WA 3LFCA 5AP5A 3DAEA 4I4EA 4M14A 5A14A 2XNBA 5AUTA 5DFPA 2J2IB 3KL8A 5EG3A 3UDSA 3MFUA 5M4IA 3SAYA 5AIKA 3NR9A 5KMNA 2XUUA 2QCSA 1FMOE 2FSLX 2GS2A 3PXRA 4BWPA 2YJRA 4H39A 2PU8A 2XM9A 2BZIB 1BUHA 4BCIA 2WNTA 3TUDA 4K8AA 4G16A 4YMJA 3BLAA 3AT4A 4O4BB 1PXOA 5AUYA 1ZMUA 5BQ0A 3OW3A 5T6KA 3Q9XA 2WTDA 5AJQA 4DH7A 5AFVA 2OXXA 2YWVA 3H10A 4I24A 3SKCA 5I9VA 2XYNA 4DFYA 1NA7A 3RCDA 3R7EA 4EOLA 3CY2A 5DYJA 4DFUA 4O7LA 1Q4LA 3PP1A 1J1CA 4CT1A 4OLIA 1ATPE 4FNWA 2ZB1A 3MN3A 3UYTA 3BKBA 2DYLA 2WTVA 3EFLA 3KU2A 4IACA 5K5NA 3VF9A 3R30A 1XH7A 4MQ1A 2UW6A 4H3BA 3VS4A 2ITXA 1U5QA 2VTOA 4UZDA 3EQPA 1OKYA 5K0KA 4NKSA 4XH6A 1U46A 2V62A 1PYXA 5GJFA 2PHKA 5F9EA 3NGAA 4JNWA 3V3VA 2C30A 2ZM3A 3BRBA 4C2WA 5CEIA 4FKGA 3B2WA 3RK7A 1RJBA 3HRCA 3ORMA 2WMQA 3VHKA 4DGGA 4D2PA 3T8OA 3W1FA 1M14A 4YLJA 3Q4TA 4AWIA 3A7IA 4JRVA 2VRXA 1ZYJA 3EN4A 3L8VA 2VTSA 3U9CA 5KX8A 3LCDA 4NIFA 4X6QC 4C58A 4MF1A 3MTFA 3PSCA 2C5NA 2R0IA 4BTJA 2OG8A 1YI4A 3R22A 3HL7A 4YZNA 3LM0A 1AQ1A 2CPKE 4PQNA 3G6GA 4FR4A 4RIXA 4S33A 4XV9A 4WRSA 3SHEA 4M13A 2BPMA 3QZIA 3ZO4A 3PA4A 3DLSA 4JBPA 1B39A 4UB7A 1OB3A 3GGFA 3AD6A 4IBMA 2WEIA 4Z3VA 5G1XA 1O6KA 4ZTLA 1YOJA 3R21A 3NS9A 5CWZA 5HNIX 3HMOA 4QQCA 3VJOA 5JFXA 2ONLA 4JQ8A 2YM4A 4GT3A 4AXCA 1FMKA 4UMRA 1QMZA 4AW2A 3A2CA 3D5UA 4FK3A 4P4CA 5IQGA 2WHBA 3WZUA 3UC3A 3FC2A 2WQMA 2YM6A 3S0OA 4ZZMA 4O7WA 3CD3A 4D1ZA 4BDKA 2GNHA 2XARA 3QWKA 3WYXA 2BZHB 1XMLA 4P5QA 3L9NA 4RJ5A 1W98A 4FV9A 3RHKA 3QD4A 2HZNA 3CXWA 3FMNA 3SVVA 4DDIA 3CGFA 4YBJA 3GQLA 3CKXA 2P2IA 3CTQA 3K5UA 3IQ7A 4TXCA 3TNPC 2CCHA 3UO6A 2WTWA 5HE0A 3FMEA 1GZ8A 4X3FC 4RFYA 3PXYA 5IEYA 1LEZA 4JQEA 3ORNA 5AR4A 2UZOA 3GC9A 3MFTA 4G2FA 5ANOA 4BYJA 4EOQA 1ZOHA 3F3ZA 3F5PA 4M0YA 2I1MA 1GOLA 2XK9A 4R3CA 4XCUA 4CCBA 3FLZA 3VIDA 4IX4A 4XBUA 5CU2A 3FSKA 2F7EE 2H34A 2BHHA 3IDBA 3PIYA 4O6EA 3E87A 4B9DA 4EK5A 4A9YA 4BCGA 2CNQA 3OBGA 5ACKA 4FOCA 1Q8UA 4I94A 2WMRA 3P23A 5IZFA 4IAKA 3DAKA 3RINA 5KHWA 3H4JA 1WZYA 4K9YA 4U9AA 4YZBA 4QTCA 4EHVA 2J0JA 3MVHA 1M17A 3OXZA 4O4DA 4FIJA 3DB6A 3TZMA 3WZDA 2ITOA 4RJ8A 3HDMA 1TZDA 3TTIA 5M07A 3ZSGA 4EZ7A 5LVPA 5KKRC 4YZCA 2O64A 5CS6A 3UP7A 2QI8A 3FL4A 3RM6A 2CN8A 2CKEA 5T68A 4D4YA 4DGNA 4YNEA 5D12A 3M11A 3W2RA 2VWIA 3EQDA 2OO8X 2RFSA 4YHJA 2XAOA 4NYEA 3LXKA 3GU4A 1BLXA 4XYFA 5AAFA 3TIZA 3FPQA 1OL5A 3UMWA 4EH8A 5KMJA 3HMPA 2CHLA 3R2BA 4QMQA 4FUYA 4D1SA 1VZOA 3FLQA 3G0EA 3F66A 5AIRA 3ODZX 5K4IA 4IJPA 1REKA 3EFKA 4YLKA 3EQBA 4USDA 1OBGA 4G3EA 1PXIA 4BDEA 4PF4A 2ZM4A 4IWOA 1XH6A 3OWLA 4O1PA 3PG3A 4ANLA 5BYLA 4YTIA 1W7HA 4KAOA 5IUHA 4HVGA 3RPYA 5HIEA 5L3AA 3MVJA 3R1QA 3ZBXA 1CKIA 2CKOA 4ACCA 2XNMA 3R1YA 3T9IA 3FEGA 3ID6C 4MEDA 3KRRA 3MPAA 3Q5ZA 3CPBA 2QVSE 2YAKA 4IE9A 2O3PA 5LMKC 2BKKA 2PVFA 2IVUA 3BYUA 2YCFA 4L3JA 4OUCA 2E9PA 2VGOA 4U42A 3SD0A 3VBVA 5CAVA 5AR2A 2W1FA 4X2NA 2BZKB 3ZDIA 3BQRA 2YJSA 5I9WA 3HAVA 2PZYA 4AN9A 5KNJA 2C1BA 4A4OA 1IAHA 4BZNA 5BPYA 3W2QA 4FVPA 2W1GA 3QGWA 2YCSA 1ZYLA 4D2SA 3CEKA 3NPCA 4O91A 1OZ1A 3TNQB 3G5DA 4QP7A 2YISA 1ZMVA 3EQFA 3R6XA 1QPJA 4IVBA 4JBQA 1FINA 3OMVA 4XP0A 1JKLA 3HZTA 4GIIA 2C3LA 1MQBA 1V0BA 4RZVA 3IDPA 4D28A 4KIKB 4UMPA 2YERA 2WMBA 4IAAA 4XLIA 2HWOA 5DRDA 2IPXA 2QO2A 2XIZA 4X6RA 3ZFYA 4EH7A 3F7WA 2I6LA 3IOKA 1YI3A 3GP0A 4XG7A 4NCTC 4QMTA 3GU8A 3F3TA 4KS8A 4U7ZA 1JBPE 4D4SA 4EH9A 3UZPA 2ZDUA 4NM7A 3AGMA 3QKKA 3I60A 3P79A 3E8EA 4EZ3A 1LR4A 3AC8A 4FTNA 2LGCA 4JDHA 4ANBA 1PXKA 3LCSA 2XK6A 4F7JA 1JWHA 4RIWB 2OXYA 1NVQA 2QOIA 2WTCA 3UOHA 5FBNC 5FTQA 4E4MA 5FTGA 2HELA 3KK8A 5EM8A 5HE2A 1T45A 4O22A 3PFQA 5CF6A 4NFMA 3VN9A 1P4FA 2HW6A 3QLGA 5M51A 4JDKA 3QTUA 1ZRZA 3FLWA 1TFFA 3EH9A 4I93A 4YC3A 5IH4A 2E9NA 3QRJA 4FL3A 4FVRA 4Y46A 4EQUA 4DHFA 4FKRA 3CCNA 2IVSA 3FV8A 4HZRA 4GKHA 2RIOA 3E8CA 2OIDA 1REJA 3PWDA 3R8MA 5AV2A 3QCQA 3ZUVA 4BIEA 5CAQA 1KV1A 1H07A 4O0SA 5CASA 2P3GX 3RI1A 3ETAA 1L8TA 2JDTA 2PZ5A 4ACHA 4EOOA 3GXLA 4PL5A 3BE2A 3TKHA 1Z57A 4X2KA 3GU5A 4WNPA 4XV1A 4RQVA 4YR8A 2F2UA 3MB6A 2ITPA 1W0XC 4CV8A 4FV0A 4D9TA 3GC0A 4JG6A 4XV3A 2PE2A 5EDPA 5JGBA 2YACA 2OFVA 2DQ7X 2VWWA 1Y6AA 3RZBA 2I0HA 4C3RA 5EQEA 3JVRA 2WQNA 3ZZWA 5CU6A 2YCRA 1L3RE 4U3ZA 4ZXTA 1J7UA 1MQ4A 3PXFA 4D5KA 4YPDA 5KBQA 5E90A 4DLJA 2VAGA 2VO7A 3V5WA 4DLIA 4FG9A 2BIKB 2JGZA 2RL5A 3QRKA 4DFZE 5E8UA 5CQUA 3HMMA 3U6HA 2WU6A 2E9OA 3VS5A 4PMTA 4TZRA 3PP0A 3R02A 2C3IB 3QALE 3OWJA 2YM3A 5IQCA 1YHSA 2NYAA 3AXWA 3FI2A 2VD5A 2PVJA 1ZXEA 4BN1A 4LL0A 4DHJA 2WU7A 3BWFA 3I0OA 2QD9A 4FL2A 1O9UA 5LARA 4ACDA 2P4IA 4DTBA 5H3QA 5DI1A 5J5SA 2XK4A 4MKCA 4CFFA 4Y5QA 1Q8TA 5H2UA 2BAQA 2VUWA 4WO5A 3COIA 5JK3A 4KUJA 1XWSA 4L00A 1DM2A 5CVFA 4JG8A 2X2KA 3PVBA 4BL1A 3R83A 4ZSGA 3PRFA 4GYGA 4OT5A 2XF0A 3OWKA 2HZ4A 3S00A 5FXRA 2R4BA 1YXXA 4P5ZA 3MVMA 1PHKA 3TXOA 2AC5A 2GNIA 4ID7A 4E6CA 4DGOA 2JBOA 3ZLWA 5E8WA 3U55A 2W5BA 3KXNA 2QHNA 3QYWA 4YTHA 1JOWB 3OT8A 1OM1A 2JAVA 5DR2A 2XNOA 2YAAA 4AW1A 4BICA 4FTLA 1RQQA 2YM5A 4KIQA 3OCTA 2NRYA 4GU6A 1MP8A 4L8MA 4K2RA 5KZIA 4AA0A 1IR3A 4U43A 4MTAA 3SLSA 3HECA 2F7XE 2X2MA 4F7SA 2ZV7A 3EZVA 3OBJA 3LCOA 3ZTXA 3CR0A 4MK0A 4E20A 3EN5A 5CQWA 2HXLA 4X3FA 1XBCA 3GB2A 5TO8A 1YVJA 4IVAA 3Q4ZA 5A4EA 2R5TA 3EMGA 4QYEA 2CGUA 2XRUA 5K4JA 1Q3WA 2HENA 4O0VA 3W18A 3UQCA 3PXKA 2W99B 3GC8A 3R63A 4TYIA 3LJ1A 4FYNA 3RK9A 3ZSIA 5LQFA 4X21A 1DS5A 1Z5MA 1H4LA 1OKVA 5CF4A 3NUSA 4IB0A 4CQEA 2HIWA 4O86A 3HA6A 4MD8E 2R7IA 5E8ZA 1ZWSA 2Z60A 1GJOA 3F5UA 3C5UA 4MNEA 4FV7A 1IRKA 2E2BA 4RJ6A 4XBRA 5H8BA 2XBJA 4OTWA 5L8JA 1U54B 2PSQA 3CKWA 4CXAA 5LVNA 3BGQA 3KEXA 3OUKA 3L9PA 1Q41A 3MVLA 5IPJA 3C5IA 2R3RA 3EL8A 2BMCA 5IEVA 3Q96A 3CTHA 3LOKA 1KE9A 5CY3A 4EONA 4RWKA 3NLBA 2EB3A 3POOA 4QMZA 4NTSA 2UZUE 4YLLA 5HNGA 5CZIA 4I5MA 5TKDA 4UWCA 5LMBA 1UVRA 3H3CA 4WSQA 1ZARA 4C3FA 3N9XA 4ITJA 1RW8A 1Z9XA 2PVRA 4FT7A 1OL1A 4ZIMA 4MD9E 3FPMA 4E7WA 3IDCA 4FIEA 4ZEGA 4LRMA 1KWPA 5EM7A 4BCMA 4BI2A 3UDTA 2XJ2A 3DBDA 3GI3A 2R2PA 4B8LA 4OBQA 2UZLA 4B0GA 4D1XA 3LFFA 3D7TA 2W17A 4MWIA 5FTOA 1CKJA 2R3NA 4K11A 1P14A 4EK3A 1F5QA 3O51A 2OKRA 2PVMA 2X81A 3H0ZA 1G8AA 3UVRA 1TQMA 5CF5A 1PRYA 3BHYA 4BZOA 3U4WA 2Y6MA 5B0XA 4YJOA 3PE2A 4FX3A 4ANMA 1QPDA 1CTPE 3SV0A 4A9RA 4LFIA 5CVHA 4FZDB 4CQGA 5TE0A 3A4PA 4OAUC 2VX0A 2YWPA 2GHGA 3CQWA 5CX9A 1GIIA 3D4QA 3U4UA 3W0QA 5M06A 3O8UA 4V04A 1V0OA 4DYMA 4AZTA 2GQGA 3ALNA 2I0EA 4USEA 3G15A 4O38A 4C4IA 4P90A 4LL5A 2OH0E 4FMQA 4QMXA 5I0BA 2PTKA 4YJTA 1LPUA 3GVUA 2GDOA 4L6QA 4IANA 2B9FA 3KF7A 1H1PA 2PMIA 3BHTA 3L8XA 3PUPA 2CNVA 1WBTA 2ONLC 4XRJA 5HIBA 4GSBA 2Y4IB 5CENA 2H9VA 2YZAA 3QCYA 4XHKB 3SG9A 3W0RA 3II5A 1PMVA 3RALA 3TNHA 5IA2A 5EFQA 2OJFE 3Q5IA 2C4GA 4FTMA 2BHEA 2B52A 3LQ5A 2GTNA 3GFWA 2WO6A 1YXUA 4ZY5A 4IAZA 4QMNA 3DLZA 3HYHA 5L2IA 1STCE 4EOMA 4V05A 1Q8ZA 5DWRA 5IA0A 2ZV9A 4ANSA 2YZLA 1GIJA 3LW0A 4F9YA 2F2CB 3FWQA 3I1AA 4JXFA 4RVLA 1XH5A 3EKKA 3QTQA 4WSYA 5AP1A 4EJ7A 2XP2A 4EHEA 3DCVA 3KC3A 2I40A 3UPXA 1P2AA 4OBPA 4NCTA 4L52A 5AM7A 4TRLA 4FRFA 3W33A 5HZNA 2W1DA 5BVDA 3ENMA 2X7GA 3N4VA 4OTPA 2XB7A 2C6KA 3MPTA 3QZHA 3NSZA 3W0NA 4BKZA 5EK7A 4FGBA 3RJCA 5AR8A 4QNYA 5BVFA 4BDHA 3LCKA 3MFSA 2YIRA 3OFMA 4O83A 4V0GB 3KXMA 3NIEA 3NYNA 5D11A 3SX9A 2F57A 4LGGA 4MYGA 3RPOA 5A54A 3AD4A 3BU3A 5HGIA 3ZH8A 2WD1A 2WAJA 3O2MA 2BDFA 2FB8A 4XG3A 3UBDA 2ITWA 2VTJA 2PUUA 4EUTA 3QXPA 5A9UA 2IW9A 4ALWA 5DVRA 2R3QA 5JQ5A 5M56A 4C61A 3CIKA 2BAJA 3FDNA 4FSNA 4H36A 3TT0A 3LMIA 1BI8A 2HY81 1WFCA 2PZPA 3A8WA 4OTHA 1OIUA 4WNOA 4GCJA 2NNWB 3IW6A 1ZYSA 3DDPA 5C03A 4AW0A 3CY3A 4KBAA 3VBYA 3HV3A 3VJNA 4YZ9A 2JD5A 2J90A 5C01A 4JR7A 3BHHA 2Y4PA 3E7OA 2BROA 3FMDA 4JAJA 4O1OA 3QX4A 4RIYB 3RZFA 4DC2A 2W1HA 3MIYA 3QQGA 3DK6A 1OIQA 3KVWA 2FSMX 5C8NA 1V1KA 2PVHA 3P7BA 3QZGA 5E8TA 2KULA 3U6JA 4BIBA 1OGUA 4FTQA 2QR7A 2XMYA 4I6HA 3OWPA 2EXCX 4D2RA 4F0IA 5L2SA 2J0IA 4KS7A 4N6ZA 2R64A 4BTFA 1J3HA 4L68A 5IQDA 4OTRA 3VS7A 2CGWA 3QRTA 4S30A 3QHWA 4UMQA 2HAKA 2YIYA 5HO7A 3HRFA 3DA6A 3LXNA 2FGIA 4X2JA 5J87A 3AQVA 4XLVA 5KMLA 3MWUA 2QURA 3NW7A 4EJNA 1G3NA 1PMNA 4Q9SA 4ZTSA 3SXFA 4CZYB 4XOZA 4BDFA 5BVOA 2XIYA 4Z7HA 3UVPA 4E5AX 4FSTA 4GFGA 2GCDA 2HOGA 2R3JA 4NJDA 2G9XA 3S3IA 1ST4A 1YXVA 4IW0A 1OUKA 1PXPA 5HORA 4BI0A 4LM5A 4NH1A 2DUVA 1PF8A 3QTIA 4DF3A 3UOLA 2BRGA 2GNGA 1XHAA 1KE6A 1XBBA 3KXXA 3UJGA 5D7AA 5IUIA 3W0OA 2J50A 4BBFA 3WIKA 2E9UA 3KMWA 1H25A 3VF8A 3VUTA 5JEBA 4UXQA 5DHJA 2B9IA 4O7VA 4QTAA 2BALA 3FKLA 1GIHA 2RSVA 3DU8A 3DJ6A 4XG8A 5CSHA 3R7OA 4IJ9A 3WF8A 4MBIA 3P86A 5I4NA 3TM0A 4NK9A 3GCSA 3TL8A 3LFBA 2V0DA 3VNTA 2HK5A 3CLYA 3GOPA