2YCRA

Crystal structure of checkpoint kinase 2 in complex with inhibitor pv976
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
282
Chain Sequence
VYPKALRDEYIMSKTLGSGEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTAKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structural Characterization of Inhibitor Complexes with Checkpoint Kinase 2 (Chk2), a Drug Target for Cancer Therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 282
sequence length 300
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ycrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ycrA01
3VHEA 3QQLA 3F3WA 3GT8A 4Q2AA 1ZYCA 3QQKA 2E9OA 2XCKA 1I44A 4ITJA 3QD4A 4D9UA 4AA4A 3R8PA 3C5UA 2Q0BA 2C6MA 4BYIA 2GHMA 4FIGA 2YZLA 5DT0A 4NIFA 2W7XA 4PPCA 4PMSA 3VW8A 2QC6A 1G5SA 3FQHA 3V6SA 4UEUA 3LFQA 4CFUA 3PLAE 4UWBA 2VNYA 4IB3A 3NW7A 1FOTA 3VBYA 4P5ZA 3UYTA 4EH5A 3UIXA 5CVGA 4NM3A 4ARKA 3RJCA 5C26A 4APPA 3O50A 3R04A 3SOAA 4U80A 4NW5A 4FV3A 2I0EA 1Q8UA 5AP5A 2ERZE 2W1ZA 4BICA 3OCTA 2V55A 4YPSA 1J1BA 4GVJA 3RNIA 1J7LA 4OT5A 2QCSA 3OT3A 2PVKA 5EOLA 4FV5A 4AT4A 4L00A 3GUBA 1OL2A 4RPVA 4EBVA 4EOLA 3E8DA 4FV8A 4O96A 4YBKA 4EOQA 2RIOA 3KMUA 2VD5A 5L6PA 1Q5KA 5E9EA 2C3KA 2XIZA 2WTJA 2JDSA 4I0TA 3ODZX 4I0RA 4K1BA 4X3FA 3CIKA 3E62A 2QKWB 4Q5EA 3SXSA 4FNZA 4WUAA 3RAWA 3Q32A 2GNGA 3H9OA 2EWAA 3QBNA 4GVAA 4HGLA 3OHTA 3ORPA 2QI8A 4NJ3A 2GCDA 4AZVA 2P0CA 3CC6A 3DJ7A 5L4QA 2BZJA 3I0QA 2KTYA 2R3MA 2IO6A 4HYUA 1OL7A 4BDBA 4O7TA 3V51A 3SW7A 4BB4A 4DAWA 2XRWA 3CKWA 1OIYA 4ACMA 5L2TA 5LCJA 2I0VA 2PZIA 4MXOA 1Q41A 2YA9A 2BZHB 4CFXA 3AOXA 3WF5A 5FLFA 4PDSA 5IA0A 5CT0A 4E1ZA 2OZAA 2Z60A 2X7OA 2OH4A 2VTAA 5CNNA 3RAHA 3V5JA 5JSMA 1Y8YA 3QCXA 3E3PA 3MH3A 5TO8A 1K9AA 4EOOA 2BFYA 1V0PA 2XKCA 3LQ8A 5F1ZA 4FKWA 3POOA 5HG8A 4B7TA 4LG4A 3A8XA 2J7TA 4KSPA 4XP2A 5CYIA 5D41A 3MSSA 3TV6A 3DAEA 4APCA 4CKRA 4DT8A 4G6NA 4BDAA 1F5QA 1SNXA 3H9FA 2VTOA 4RSSA 3CEKA 3W2PA 4FSWA 4S34A 4C4IA 5HE1A 4FIFA 3IS5A 2HXLA 2PZ5A 2VTTA 3EN4A 3H9RA 5HG5A 3DXPA 3A60A 3ITZA 4L7SA 3FQSA 2F49A 3KULA 5K4JA 5AAEA 3IONA 4QTAA 4X7QA 4XRLA 4ZY5A 2PE0A 2J51A 1CM8A 2YAKA 3K5UA 3LIJA 3TV4A 4FGRA 2BAJA 5JGBA 3E64A 2VTRA 2ZV9A 3KVXA 1LP4A 2R3NA 3FZRA 3BU5A 4FKQA 2HY81 2DWBA 4BBFA 3CSVA 5DMZA 4O7VA 3MFTA 4ZJVA 4M13A 3S3IA 3QD0A 5LCKA 3SW4A 4WRGA 1OPLA 2OF4A 4YO6A 3NR9A 4YZBA 1XKKA 2R3PA 4AAAA 3C13A 4ENYA 5IQHA 4M68A 1KOBA 3GB2A 3MESA 3G6HA 4UB7A 1RDQE 4D1SA 2VTQA 3ZRLA 3FYJX 5CEKA 2W5BA 3RINA 3MH1A 3TKIA 5KCVA 4DBXA 1JVPP 4NK9A 5GZ8A 4CG9A 4MD8E 3KK9A 4CZTA 5M06A 4FVRA 2R64A 5HNGA 3E5AA 4BR3A 1Q8TA 1FINA 4O0TA 1OBGA 4IZ7A 4K0YA 2ITPA 2QR7A 2FUMA 3EFLA 4RC2A 3VUIA 3DNDA 4AT5A 2A19B 1SMHA 1YW2A 4FTMA 2FB8A 3ERKA 1IA8A 3DOGA 5I3OA 1APME 3CE3A 3TJCA 1E9HA 4AFJA 4FSUA 1ZYDA 4X6QC 3MH0A 3RZBA 3ZS5A 4FOBA 4QQTA 3V6RA 4HCVA 3BX5A 1GZNA 4ITHA 4C62A 3VRYA 5AFVA 2YJSA 2C5VA 3BIZA 2CJMA 4UY9A 4IWDA 4DH7A 5DYJA 3V8SA 4GG7A 4H1MA 5L6WL 3VBVA 3F88A 5CU4A 3MY0A 5CEIA 4FTQA 3WF8A 2YM7A 5E8WA 2BVAA 2WTCA 4K33A 1QPEA 2XKFA 2EB2A 3WE8A 4C34A 2W4KA 3UGCA 4O81A 3Q5IA 3ZXTA 1IRKA 4AE9A 1ZMUA 3K3IA 1UA2A 4AGCA 5CASA 3R7YA 1U5RA 4CMTA 2V5QA 4W9WA 5JH6A 3FLNC 4ACHA 1E1XA 3O2MA 1V0BA 4QP8A 4S33A 3P4KA 3F2AA 4NCTC 3HMMA 3R30A 4YJVA 3R83A 3HMIA 2JEDA 2YM5A 3KGAA 4O0UA 3OWLA 4QPAA 4J53A 2KULA 2R7BA 3D7TB 4KKHA 4TY1A 3FQEA 3UBDA 3BHVA 2C5YA 2WQNA 2X2LA 2PMOX 4EH4A 4GUEA 5LMKC 3CGFA 4Y72A 2GHGA 4P7EA 2XNMA 3U8WA 4AGUA 3PG3A 4MF1A 5ACBC 3SA0A 2R3HA 2XNPA 1OITA 3L8XA 1H1PA 1GZOA 3O8TA 4ZLOA 1NXKA 4W4YA 4D4VA 3RKBA 5J5SA 3GXLA 5HX8A 1H07A 4IX4A 3Q6UA 2OXDA 4JQEA 4PY1A 1NVRA 2XIXA 2ITUA 3BE2A 2BHEA 5HO6A 2IZUA 2WMRA 3HV4A 4YJOA 3VO3A 4AG8A 4IZ5A 5FUTA 4CKJA 1MQ4A 2GMXA 5ETCA 3IW4A 5KMOA 1NW1A 4E3CA 4R6VA 4D1XA 3PPZA 4MXZA 1O9UA 3AD5A 5I9UA 2WD1A 5AR4A 3K3JA 2WTKC 4D2PA 4IXPA 3G0FA 4RJ8A 4FSMA 2JIUA 3HA6A 1ZYLA 4IWQA 2Y4IC 4C4HA 4DLIA 3HRCA 4CFWA 4DGGA 5AA8A 4GKHA 1BX6A 3MWUA 4IDVA 3RK9A 3BQCA 4Q9SA 3CPCA 4QMNA 2XYUA 3UMWA 5LWMA 3WOWA 5L8LA 1ZMWA 4E4MA 3Q3BA 4J95A 5GJDA 3BQRA 4YP8A 4FK6A 2A1AB 4XX9A 1OM1A 1R0EA 4AN2A 3HZTA 4RVTA 3DB8A 2VWYA 3Q4ZA 1GY3A 2YLEA 4IB5A 4WG5A 4K77A 5CS6A 4CZYB 4E8AA 4EH9A 5LMBA 4BBMA 4BI0A 1W82A 4PUZA 3LXPA 4TT7A 4DEHA 2EU9A 4DEBA 4YTFA 3RALA 3QQFA 4RIYA 3KXNA 4X2GA 4WIHA 3DTCA 2H9VA 4KBAA 4XG3A 2PE2A 2VWWA 2WOUA 3M42A 4IM0A 2QD9A 4YJPA 4HYIA 3PDTA 5IDNA 4RFMA 4WHZA 2XM9A 2WTKB 4NZWB 4E4XA 3BV2A 4M15A 4TYIA 2J5FA 3W2OA 4DGNA 3NX8A 4EHVA 5BMSA 4O0WA 4FEWA 4DYMA 4HVIA 4KS8A 3TCPA 5CXHA 4CT1A 5AV1A 2X7FA 2GFCA 3HL7A 2ETKA 3E88A 5M09A 2OXYA 2PUUA 1CMKE 4HZRA 3QTIA 5F4NA 3TM0A 4C8BA 2UZEA 4EHEA 3OWKA 2XS0A 2GS7A 3QUDA 2C30A 3V8WA 4I22A 2JDVA 2LAVA 4BTMA 4NFMA 4EUTA 3AT2A 3PIYA 2XJ1A 4BKJA 4L52A 1T46A 4O0VA 1H1WA 4DE4A 2QOQA 2WELA 3T3UA 5IUGA 4LGDA 1UU9A 3HNGA 4XS2A 3G51A 1KWPA 4YTHA 5BVKA 2ACXA 3E8CA 5BUJA 3QZFA 4QMQA 4DHFA 2HZ0A 2VTLA 3SLSA 4FSTA 4DFUA 4CFNA 3TACA 2YACA 2JDTA 3CPBA 2BAQA 3VN9A 3E92A 4BIEA 2F4JA 2R9SA 1OUYA 4AZWA 4N57A 2UW9A 4DN5A 3F3TA 2YABA 4FUXA 3P78A 5KHWA 3PY3A 5I9YA 4XV3A 3BZ3A 5EW3A 4I5CA 3FI2A 3NW6A 2P4IA 4FSQA 4LUEA 1QPJA 2RSVA 5EYDA 3MFSA 3O7LD 4C59A 4JBQA 3MJ1A 3ZU7A 4XG9A 1JPAA 3IQ7A 2ZV7A 3AMYA 3TWJA 3K54A 4A4OA 5BVNA 3UQGA 3ANQA 2C6DA 1M7QA 2W1EA 3HV5A 2YLFA 3ACKA 5IH4A 4O83A 1H24A 5HIBA 4I94A 3FBVA 2PUIA 3TEIA 3MY5A 5AR8A 4C33A 1S9JA 5L8JA 4YZDA 2XK9A 2G15A 3FMHA 4NW6A 2QG7A 3ZSGA 1H0VA 2VTMA 4BWKA 3IKAA 5M51A 1YKRA 3PE1A 1PHKA 2R2PA 4TYHA 5CU3A 4C4EA 4CG8A 2DS1A 4QMPA 3R7VA 4DFLA 3CJFA 2R3GA 4NTTA 4CV8A 4U40A 3SXFA 4A4LA 4QT1A 3BHYA 5DGZA 3KXXA 4L6QA 3CR0A 4PP7A 3D5VA 4K11A 3I81A 5HTCA 5CT7A 2XH5A 4AGDA 3MA6A 3QC9A 1JLUE 4CD0A 5B2MA 3COIA 2J0MB 3UP7A 5IEYA 3GCSA 4MXXA 5KMJA 4O7ZA 5CLPA 3ZSHA 4ASXA 5H2UA 4EHZA 2WKMA 4UXLA 1NY3A 2G01A 4O0XA 5L2SA 3V01A 1YI4A 3LFAA 4G3GA 4I1ZA 2ERKA 4JDHA 4ALWA 2VTPA 1V1KA 3R9HA 5LJJA 4TYGA 2B9JA 3FLZA 3P9JA 3EWHA 4F4PA 3V5LA 4E4NA 4RJ7A 2OIDA 5K0XA 4HJOA 4UWYA 4CLJA 3LCTA 5JQ5A 1H01A 3P7BA 4YGAA 2VRXA 1UVRA 3VUKA 3CLYA 3DZQA 1YDSE 1GZ8A 5A4CA 4MEDA 3G0EA 4QMWA 2Y9QA 3BGZA 2RL5A 2WEIA 3FJQE 2W4OA 2J0JA 5FM3A 5A14A 3QWJA 3Q9WA 3JUHA 3QTSA 3HEGA 1CKPA 2VTJA 5M4UA 4MNFA 4EC9A 4C3RA 3LCSA 4L3PA 3VS0A 3T9IA 3PJ3A 4Z16A 5EDRA 3V5TA 3R7GA 3MPMA 2YEXA 3EMGA 2JC6A 3R2YA 2LGCA 4B8MA 3FL4A 5FXRA 4AOIA 5AM6A 4BTKA 4D5KA 4BKYA 4EK6A 2YZAA 3PPKA 1Y6AA 4J52A 3MI9A 3FMLA 5EFQA 5EKOA 3TUDA 3FI4A 4GT5A 4M69B 3DDQA 4NWMA 5FEEA 5GJGA 2DUVA 3E93A 2CHLA 4NFNA 3WF9A 1FMKA 4GH2A 4O86A 2UW0A 1XH4A 4QQJA 3O8PA 2C6OA 5HNBA 5JFWA 5AV2A 4Y8DA 2JFLA 2W05A 2BUJA 2VV9A 4CFVA 1YDRE 1FGIA 2UZDA 2WZJA 2XJ0A 3EFKA 3HV7A 2OIBA 3UVRA 5A54A 5ANDA 3D5UA 3QZHA 4GIIA 4C02A 3EQPA 4FKRA 1F0QA 4L3LA 3ALNA 2JAVA 4QP2A 3PJ1A 3UPZA 4HPUE 4LL0A 2WTDA 1RE8A 3MN3A 3OY3A 3NUYA 4D2TA 4U6RA 2R0IA 2QG5A 1LPUA 5BYZA 3QCYA 4ANMA 5IA2A 3KRWA 1OL1A 2Y0AA 3VBQA 5EDQA 2WMQA 2YIYA 1YXUA 2WXVA 4FZ6A 5GHVA 4D2VA 4E5AX 3R8UA 4CV9A 4UMPA 1P2AA 3EQRA 4O7LA 2OU7A 1CTPE 3QCSA 3QHRA 5EYCA 2C5OA 1JOWB 4KSQA 3RI1A 2P2IA 4IAYA 2XNGA 2YCQA 3NUUA 4I6HA 2BDFA 5KHXA 5AUUA 5TOZA 4Y46A 4USFA 3RHKA 3DAJA 5TF9A 3A99A 3MW1A 4WNMA 2OGVA 3KFAA 4YC3A 3UJGA 4OBOA 3UC3A 1DS5A 5JGAA 5EQEA 1H27A 2Z7LA 1JKKA 3P86A 4GT3A 1BUHA 4KWPA 5IF1A 4ZJJA 2R5TA 4MBIA 4G6OA 4ZTLA 3VS7A 4Y83A 4QMZA 2HENA 2YM6A 3C51A 4WG4A 3KF7A 4GRBA 4EK4A 5FD2A 3LZBA 3OY1A 5HLPA 3SOCA 3G6GA 4YJQA 4BCJA 3GU5A 3CKXA 2HW7A 4YPDA 3PG1A 5J1VA 4TZRA 3I5NA 2P2HA 3OXIA 1EH4A 3PZHA 4H3PA 3BYUA 4O1PA 4TWCA 3SDJA 5CI7A 1PXKA 4FC0A 3KF4A 2PZRA 4C4GA 2QR8A 2RFNA 4JNWA 2JLDA 5EK7A 3PWDA 3SRVB 4YLKA 3PIXA 3VS3A 4E6QA 1UWJA 2AYPA 4U43A 4IX3A 3A7GA 3D94A 1Q97A 2EXMA 3ODYX 4DEDA 5J7BA 2EVAA 3GNIB 3PWYA 4PTCA 3OOGA 2IPXA 5EQPA 1M17A 1H08A 3KL8A 1E1VA 3UNZA 4AA5A 5EHYA 2GDOA 1R3CA 4S30A 3LFSA 2G2IA 3NYVA 4YC6A 5CVFA 5CWZA 4FBXA 2ZYBA 4WNOA 4M97A 4C4FA 2E9NA 4D0WA 2ITWA 2ONLA 4Y85A 5DH3A 4CYIA 3HGKA 4GFGA 3PTGA 4KIKA 2C3IB 4A9UA 5A6NA 2YCSA 2C6KA 3V3VA 4IFCA 1SYKA 2IN6A 4XG8A 3IECA 4RQKA 3G9LX 5L3AA 3O71A 5H8GA 3PSBA 3KREA 5CI6A 4YJSA 2JGZA 3E63A 5CX9A 3ZM9A 2PSQA 2YITA 1UNHA 4WT6A 5B2KA 3DA6A 3EL7A 3FLWA 4V05A 4YSJA 2ZB1A 3DXNA 2VO3A 3BYVA 3ZONA 4ZSEA 3LLAA 3PA5A 4O21A 3GVUA 2OICA 5FRIA 2O2UA 3C4CA 3VWAA 4EYMA 3VUDA 4U0IA 3REPA 5EKNA 3C50A 3CS9A 3D0EA 4RWLA 3N51A 3P1AA 2PHKA 1XHAA 4AU8A 4FYNA 3MIYA 4J8NA 4UMTA 4OTWA 4E4LA 3IW5A 5HE2A 3WIGA 3A7IA 3DBQA 3QXPA 3LQ5A 3PP0A 3U87A 4DH3A 4KD1A 3FV8A 3RPVA 3T9TA 3TNPC 2XK8A 4I6FA 5EOBA 1BLXA 3F82A 3U9CA 4FIJA 2XZSA 3NNXA 3AD4A 3NAXA 4U45A 4EBWA 1GIJA 3MYGA 4O0YA 4BI1A 3KC3A 4P90A 3R9NA 5A46A 5CSVA 4O27B 3VJNA 5J9ZA 2UUEA 3FL5A 3OS3A 4FTAA 4C57A 3TDVA 3DDPA 3UG2A 5E1EA 4WA9A 1K2PA 3GBZA 1CKIA 2I0YA 4MD7E 4R8QA 4BCMA 4CLIA 2VX3A 2BMCA 4EQMA 5FP5A 2R7IA 2O5KA 3PJ2A 2B0QA 2RFSA 5I3RA 3DK7A 4IAFA 4XOZA 1J7IA 5CALA 3CQEA 4XLIA 4FT9A 2XIYA 3DXQA 2QO9A 3QQUA 3PA3A 4ANBA 3QKKA 4RVMA 4G9CA 1YI6A 3MB6A 4FKGA 4MNEB 1PXMA 4BCGA 2QODA 2OLCA 3R8LA 4GJ2A 1XR1A 2UW4A 3UC4A 4JT3A 2OIQA 3C0HA 3JY0A 1WBTA 4GT4A 5A9UA 1L8TA 3MJ2A 4MWHA 3RNYA 4NEUA 2GPHA 2HXQA 2XIKA 3O51A 1YVJA 3FMEA 3HRFA 4HPTE 2BRMA 4P5QA 4ZY6A 4GJ3A 2BCJA 2NPQA 2YIQA 4WBOA 3AD6A 1ZY5A 5AMNA 5F9EA 1A48A 1ZAOA 4BWPA 4EL9A 4JJRA 2IJMA 3CBLA 1PXNA 3BU6A 3LJ1A 4QNAA 4V04A 4BCOA 5J79A 4XYFA 3EQDA 1TKIA 3K2LA 4CCBA 4PF4A 3GCVA 4JXFA 3RWPA 3AC2A 3QGWA 4Z7HA 2PU8A 3QF9A 5BX0A 4JDJA 4RBLA 3KN5A 4S2ZA 3WE4A 5I9VA 3W2CA 2PVFA 2PYWA 3RM7A 2V0DA 3CJGA 3Q52A 3EN7A 3PVGA 4X3JA 3MDYA 4XBRA 3TNWA 2X2KA 1NA7A 4U79A 1FVVA 3PVUA 4AZSA 3NYNA 4O6LA 3SAYA 5DNRA 1BKXA 3F66A 2YAAA 3D9VA 3DKOA 3OTUA 3FMJA 4MHAA 5CY3A 3ZO3A 3ACJA 3IW7A 5FDXA 3OVVA 2XK7A 4E73A 4F1OA 3P5KA 4UZHA 4RVKA 3QRKA 5L2QA 4EOKA 3W8LA 4FKOA 3BEGA 4RWKA 5LVNA 4TWNA 3A4OX 3W55A 4RX5A 1FBNA 5LVPA 4FIEA 1YWVA 3TUCA 4EOPA 3L8VA 3FEGA 4LUDA 3R28A 4IFGA 3KU2A 4G31A 3QTWA 3ZO4A 4A9YA 4ENXA 2VUWA 5DLSA 3UVQA 3E7OA 5F20A 1M14A 5E8SA 3SQQA 3ENHA 5KBRA 4MCVA 4B8LA 4QO9A 4Y5HA 5M55A 5G1XA 4AXAA 1IAHA 2PK9A 1BI7A 4DLJA 1DAYA 1ZWSA 4PV0A 4AS0A 4C37A 4L68A 3N9XA 2CDZA 3VS6A 4BGGA 3F7ZA 5JFVA 3CY3A 4LQMA 2UW6A 1PY5A 1PKDA 3ORTA 2C3JA 2OJFE 2WAJA 2C6LA 4LFIA 4LV8A 4PRJA 4ACGA 4PWNA 4FA2A 3DGKA 1ND4A 2JDOA 3N4UA 2CNVA 3R1QA 3BRBA 4ANOA 3AQVA 4ZJIA 1OZ1A 2B52A 2YDJA 1OL5A 3NVKI 4W8DA 4QMVA 3UP2A 5BVDA 4FK3A 3QQHA 4FKIA 4I23A 3DTWA 5HOAA 2FSLX 1IA9A 5CQUA 3HMPA 4H36A 1W98A 3QTQA 5C03A 2IW9A 4G6LA 5EHOA 3L9NA 2F9GA 4HGSA 4XP0A 3PVBA 4FTNA 4DG3E 4ZY4A 5CQWA 1OMWA 1PJKA 2JKMA 3A7JA 3WZUA 3N4VA 5FBNC 2C69A 2ZMDA 4EUUA 4F1TA 1XO2B 1Y6BA 3ROYA 4I6QA 3ZLYA 5FEDA 3QD2B 4ZTHA 1WZYA 2OK1A 4LMNA 3VS4A 3SG8A 2XJ2A 2J6MA 2WMVA 5J9LA 5AJQA 2I0HA 2X9FA 1FVTA 2CGXA 3HA8A 3HP5A 2FYSA 3EKNA 5DWRA 4C3PA 2XUUA 3LCOA 4EH6A 2JIVA 3DKCA 4CRLA 2YWVA 3QRTA 1RJBA 1G8AA 4LI5A 4A07A 5EW8A 3NRMA 1GAGA 4ZMEA 4FV2A 5JEBA 3LXLA 2JIIA 5BVEA 5M07A 2YWPA 4FTIA 5FQDC 5F94A 2VZ6A 2OJJA 4UMQA 3UOHA 4O7RA 3FY2A 2PL0A 3QUEA 3DY7A 2UV2A 5CZIA 3I79A 5K3YA 2XVDA 2H34A 4JG6A 2BZIB 1JBPE 2PTKA 2UZVA 1Q8WA 3QRIA 5DR9A 3R8VA 3WYXA 2HIWA 2WPAA 5LARA 3ELJA 4FTJA 3Q5ZA 5E91A 3LFDA 5DE2A 2W9FB 2RG5A 3O0GA 5AR5A 3HP2A 3U6IA 4KRCA 3V5PA 3R6XA 2YFXA 4R5SA 3GU8A 4YO4A 4FTKA 5BUIA 4OAUC 2GQGA 5IQAA 1YWRA 1ZOEA 1GIIA 3R00A 2OXXA 3BHHA 4DFNA 5CAUA 4K9YA 3H0YA 2JITA 2HWPA 3ZSIA 5K0KA 2OFVA 4OW8A 5DVRA 3TN8A 3OC1A 4GYGA 4ZP5A 2G2FA 2X6DA 4ERKA 2Z2WA 2QVSE 5FTOA 3FZOA 4IIRA 3SHEA 2UVYA 2CSNA 3F3ZA 3GC0A 4YHTA 2OI4X 4HZSA 3W8QA 2DQ7X 5BYLA 3UO4A 2FH9A 4DEIA 5HBEA 3TNIA 3DAKA 2J0LA 1PXPA 1XH6A 2BRBA 3ORKA 4QPSA 4RGJA 3ZUTA 2RGPA 3VQUA 1NVSA 5B2LA 2OBJA 3R7OA 4QTDA 3FI3A 4BWXA 4O7WA 2QO7A 1U46A 4IAZA 4RX9A 3C0IA 1PYEA 4X6RA 4C3FA 3K5VA 4QRCA 4FL2A 4IACA 4QQ5A 4FODA 4IH8A 4WD5A 4UV0A 3EJ1A 3GOPA 4M7IA 1KV2A 4Z7GA 1WAKA 5M44A 3KCFA 2QU6A 4I5HA 4R1YA 5ANEA 3L8PA 4CXAA 4FEVA 3GCUA 4EJ7A 1NVQA 5AUZA 3FZSA 4WSYA 3UQCA 3UO6A 2PUPA 3DK6A 3DBEA 4EKKA 1YXVA 2EXCX 2X39A 4LGGA 3COKA 2E9PA 4X3FC 3G9NA 4W9XA 4UX9A 4QMUA 4BI2A 2E9VA 4NIFB 5EM6A 3GENA 3QLFA 4I93A 3ZM4A 1Z5MA 2A0CX 2BDJA 2WQMA 5D9HA 5IU2A 3CTQA 1NT2A 2YERA 3MH2A 3OROA 1OPJA 1IG1A 5DA3A 3JVSA 2B1PA 5FGKA 4DFYA 5AEPA 5BNJA 2O65A 4BCKA 4G5PA 3IDCA 3BWJA 4FKJA 5JKGA 5AP7A 4R7BA 2A2AA 2ZAZA 4ZTSA 4CZUA 1M7NA 4E6AA 2C5NA 4IDTA 4XHKB 4CMOA 2QNJA 4FR4A 1MQBA 5M4FA 3UDBA 1UKHA 2B9HA 4N70A 3OW3A 4O91A 5E8ZA 4B4LA 3LXNA 4GK2A 3ZC6A 5TE0A 3V8TA 3ZFXA 1GNGA 4YNEA 4BHZA 3PRFA 3A4PA 4BTFA 3C7QA 4X3FB 3FXWA 1STCE 1U54A 4FT0A 3G5DA 4GUBA 3LLTA 4O1OA 4YSMA 4NL0A 3MGYA 5IKWA 1Q62A 1O6KA 2QOBA 4R3RA 3NAYA 4E93A 3DU8A 4MXAA 5E90A 5CEPA 3UNKA 4H3BA 5HG9A 3MFUA 2I6LA 4EH3A 4Q9ZA 1JAMA 2OSCA 1H4LA 1ZY4A 3BBTB 2GNHA 3RMFA 1FVRA 1MUOA 1SM2A 4I6BA 4FTOA 1PXOA 2Z7RA 4M0ZA 2OH0E 4RA4A 3UMXA 3O17A 5ACKA 4YUQA 4ACDA 4ZIMA 4L45A 4TXCA 4FVQA 3HAVA 3NGAA 4GS6A 3FXZA 4C7TA 3GEQA 4CMUA 4F0GA 3ORMA 5H9BA 5ICPA 2OZAB 3UZTA 4ZS4A 3E7VA 5CZHA 1TQIA 4FNYA 2GS2A 4YMJA 3A8WA 3ZLSA 3CTJA 2C3LA 4DEEA 1XH7A 3KVWA 4G3EA 4QOXA 4BVUA 5HU3A 4ALVA 3GFEA 4HVGA 4FZFB 3NS9A 3F69A 4FV4A 3B2TA 4XEYA 3OUNB 4UN0C 2VU3A 3EZVA 3R02A 3WBLA 3AXWA 3QRJA 2H96A 4JIAA 3ZDIA 3NUSA 4S32A 4EKLA 5JQ8A 4QYFA 2Y4IB 3FHIA 4EJNA 5B0XA 4QTBA 4XJ0A 4KIOA 4AQCA 3KULB 2B55A 3FXXA 5FXSA 2BRGA 3FKNA 5TKDA 4CSVA 2BIKB 4EQCA 2YDKA 1VYWA 3TIYA 1KE5A 4L01A 3RHXA 4AE6A 4ZTMA 4DCEA 4RFZA 5ETAA 3ZYAA 1Q3DA 4FKPA 5KZ0A 4C38A 3L9LA 2G2HA 2ZM1A 4AUAA 3VBXA 3F61A 4U8ZA 4BDCA 1XH8A 4O7NA 3I0OA 4O6EA 2ZV2A 2ZVAA 2PMIA 4TNDA 1URWA 3QZGA 4EZ5A 2W1CA 2G9XA 3IDBA 1X8BA 4TNBA 4UMRA 1Y8GA 3WZDA 3LOKA 3L9MA 3EKKA 2QOCA 2I40A 4PL3A 2QO2A 2ZM3A 1ZZLA 4I92A 4MAOA 2Z7SA 4EHGA 4DG0E 4L8MA 3OWPA 4BF2A 3IDPA 2O64A 4QPMA 4JDKA 1MRVA 2ITZA 3FZPA 4KAOA 3B8RA 2WMXA 4RC4A 2PVHA 4RX7A 4WUNA 1OUKA 2PZYA 4YLJA 1QCFA 5ETIA 1OL6A 4IBMA 1UV5A 3HDMA 3W16A 5KO1A 4XOYA 1MP8A 3TJDA 4IM2A 3QHWA 4S31A 4AN3A 3EFJA 3R8ZA 4O2PA 2J2IB 1B38A 3OD6X 2F57A 4FT5A 2PZPA 2FSTX 1WBPA 3HLLA 4AP7A 1H28A 4AGWA 4AOJA 5C8NA 5IMEA 4FIHA 1H26A 3TNHA 3NCGA 3OXTA 3ATTA 4DEAA 4ASDA 3EQFA 3VUGA 2ETMA 4IMYA 3R9DA 4EWHA 5HE3A 2E9UA 4X21A 3FI8A 3QGYA 4D55A 2ITXA 4L7FA 3DS6A 3G90X 3O23A 4E20A 5CEMA 3O7LB 4GK4A 4YJUA 4YHFA 2FO0A 4JRVA 4OBPA 5AUXA 3QRUA 3OT8A 3KRLA 5TR6A 1YDTE 1YOJA 2PVJA 4GEOA 4QYHA 5HO8A 4LM5A 2F7XE 4D1ZA 5M53A 2GFSA 4HVHA 4X2JA 5IA4A 2VX1A 3ORZA 3BYOA 4FV9A 3POZA 4G3FA 5CNOA 3SKCA 2BFXA 3PIZA 5CENA 3U54A 1H00A 5AAFA 3LPBA 4AW1A 1PXJA 4KIPA 3NVMB 4RIWA 4IAIA 4QMTA 2PVRA 1YXXA 2CLXA 3DCVA 1YXSA 4RFYA 4ERWA 3QQGA 4PDPA 1TQPA 4TN6A 3LMIA 4PDOA 3WZKA 5KMLA 4GIHA 4KUJA 5GIOE 2Y6OA 4IM3A 4U9AA 3ZBXA 4OAVB 4F65A 2RKUA 2VO0A 3HV6A 5HD7A 3U4WA 2AC5A 3FUPA 5J7HA 5G6VA 3LE6A 2CKEA 4MD9E 2R3OA 2CGUA 1RQQA 3BEAA 4G16A 4ONAA 2GHLA 4RVLA 5E8UA 4D5HA 5I5ZA 2WU7A 2QOIA 3NIEA 4PMTA 2F7ZE 3C4EA 4UMUA 1TVOA 1CDKA 3VS2A 1OKZA 2OO8X 1OKVA 4F9BA 2BRNA 5CEOA 1FQ1B 1H1QA 4G1WA 4EEVA 4AX8A 4I41A 5JGDA 4AW0A 1UWHA 4HCTA 4ZK5A 1OPKA 4PQNA 3AG9A 4FKSA 4I5MA 3QU0A 4XG7A 4ZSGA 4FTTA 3ZO1A 4YJTA 3FE3A 2IW8A 1KOAA 4OTFA 3SV0A 3F5XA 5JZJA 4DFZE 3RCJA 5AP0A 3UPXA 2HY0A 3QCQA 4FNWA 3VUHA 3HUCA 4N6ZA 4QP9A 3QA8A 3FZTA 3ORXA 2ZM4A 3NCZA 4F63A 2FSOX 4ZLYA 2W96B 3PY0A 1PKGA 4FNXA 1U5QA 2HOGA 2W1DA 3F3UA 2R3RA 3TV7A 2XEYA 3P79A 4OLIA 3EQCA 3QX4A 2GQRA 4F99A 3Q4CA 5I0BA 1XBAA 2IZRA 2XM8A 5BQ0A 2JD5A 3LFEA 4IVBA 3GC7A 3AT4A 3ZUVA 2R3KA 1VYZA 1KE6A 4EWQA 4BFMA 4BDHA 5ANKA 5DRDA 1TQMA 2E2BA 2ITTA 2VX0A 3WYYA 3VAPA 2JKOA 5DR6A 4RT7A 5GINE 4I4FA 4MF0A 3EQGA 5K4IA 1Q8ZA 4Q5HA 4EOMA 4K2RA 5HIEA 3QYZA 3LJ2A 3UOKA 3JR1A 3F5GA 3OOMA 4RIOA 3KB7A 3RBWA 1CSNA 1W0XC 2UZBA 3ZLXA 5HCYA 2X7GA 4XH6A 3EN6A 4MWIA 4RIYB 5JRQA 4BDGA 4AW2A 2WMTA 5E8VA 3W10A 5LWNA 3AC8A 5AP3A 4V0GB 4G9RA 2AUHA 2Q0NA 5IA3A 4H1JA 4J96A 3QTXA 4N4SA 1Q99A 5I9ZA 3S1HA 2VO7A 2XRUA 2CN5A 5A6OA 5C01A 4FL3A 4BL1A 2ITNA 5LXMA 1REKA 5E8TA 3TL8A 4RRVA 4O38A 3W1FA 5BVWA 5IQDA 3R7EA 2O0UA 1ZOHA 5KMKA 4RLLA 4USEA 5HESA 4YBJA 4GL9A 4ZAUA 1GZKA 1Q61A 5CSHA 4QTEA 3E8EA 3OTVA 1ZYSA 2Y8OA 2WMUA 4BHNA 3VUMA 3E3BX 5AAGA 1UKIA 5J1WA 2IVSA 5GNKA 3ZFYA 3VS5A 2R4BA 4M67A 3DB6A 2H6DA 3NPCA 4I3ZA 4J7BA 4L9IA 3I6UA 3LFFA 4M66A 5ANIA 5EI8A 5AV4A 1VZOA 5ANJA 3RPYA 1J91A 3VF8A 4D4SA 4TTHB 4TWPA 1P4FA 5EYKA 5IEXA 1JQHA 3KMWA 3SVVA 4OBQA 5IQIA 2IWIA 3NMUF 4HYHA 4ITIA 1UU7A 2XK3A 4UZDA 3LM5A 5HTIA 3MIAA 4AA0A 2ZDTA 3U6HA 2YN8A 5C8KA 4WKQA 1ERKA 1DAWA 4ZEGA 4DTBA 4LRKA 3KXHA 3WF7A 1Q4LA 1JSVA 4ANQA 1ZLTA 2QOLA 3UYSA 4GU9A 5IG1A 4IAAA 3MPTA 3R2BA 4IANA 5CXZA 4BDJA 1Y91A 3IOPA 3R9OA 4XG6A 4ANNA 2W1IA 3CQWA 2Z8CA 3PXRA 1BI8A 2VTIA 2B53A 3MB7A 4M8TA 1MRUA 5T68A 4IVDA 4J99A 2CCIA 1BL6A 3OP5A 4OTGA 5EM5A 4FT3A 4YTIA 3RCDA 4HW7A 4ZTNA 4BGQA 4F7SA 4PL4A 3Q9ZA 2EUFB 3DV3A 2X4ZA 5CAOA 1J7UA 5HVKA 3UZRA 1ZXEA 3WZEA 5HLNA 2VWUA 1H0WA 4F70A 4CFFA 4BYJA 2C5XA 3C4ZA 3F5PA 4I5PA 4IQ6A 2J9MA 3R9RA 3LFNA 3GU7A 5CANA 4TYHB 1W8CA 5DFPA 2CLQA 5EI6A 4BDDA 4EK5A 4QP7A 2WMWA 3I4BA 3JY9A 3QTUA 3FKLA 1LR4A 2BKZA 4IB1A 1UU3A 3OBJA 5KX8A 4W8EA 4CTBA 1SVEA 3PXQA 3P23A 4IVCA 1ZYJA 4D2RA 1KE9A 4TWOA 3WIKA 5AA9A 2Y6MA 5HZNA 3IO7A 3LFCA 1PMNA 4IE9A 4RZVA 1GOLA 4ZXTA 4BRXA 5CAVA 3CD8A 4FTCA 3D5XA 4J1RA 3TKUA 1WBWA 3GFWA 4C2VA 2VN9A 2C68A 2UZWE 4FMQA 3VC4A 4U5JA 2XF0A 3GQIA 1OGUA 3QXOA 1A06A 4KKEA 3DBFA 4JQ7A 3T8OA 4FE2A 2B9IA 2VO6A 3PLSA 3PYYA 2CMWA 4B99A 4BGHA 3W18A 1KSWA 3NLBA 4MBJA 4YC8A 2WU6A 3F2NA 4CT2A 2NNWB 4A7CA 3ZZWA 5LOHA 2HAKA 2B9FA 2XNEA 4DGMA 3CD3A 4C4JA 3C4WA 5FG8A 4RIXB 5A4LA 1URCA 3LVPA 3MY1A 4C58A 4QP4A 1PXIA 1ATPE 3FLQA 4FSYA 3S2PA 2VTNA 2QLUA 3VF9A 3GU6A 3HYHA 3JPVA 5M56A 3UQFA 3COMA 2OJ9A 3LXKA 4NM7A 1M2QA 2XEZA 4K8AA 4WSQA 5D7VA 4DITA 2J90A 2WNTA 4G5JA 4FZDB 4USDA 1W7HA 4DH1A 1R0PA 4RWIA 4I4EA 3SX9A 2JDRA 2GQSA 3ALOA 4D4RA 3VS1A 5IISA 1Q8YA 1Z57A 3QC4A 2OZOA 2YISA 2C0OA 4JIKA 4QP6A 1I09A 1UNLA 4TPTA 3RPRA 2VWIA 5I4NA 1UNGA 2BROA 4AW5A 2P33A 4DGOA 2W5AA 4U7ZA 1OI9A 3B2WA 1HCKA 5T3QA 1JKTA 3EQHA 3II5A 4QMLA 3UIBA 4W4XA 4Z3VA 5BVOA 5EM8A 3KXMA 5E7RA 3HX4A 3DQXA 4MQ1A 3H4JA 3AGLA 3PUPA 2QKRA 3BU3A 3KY2A 3H3CA 4KINA 1OB3A 4HVDA 5JFSA 4FI1A 3TUBA 2I1MA 1IEPA 3ANRA 1YHWA 4W4WA 4FV0A 1SNUA 2NRUA 2QOOA 2IG7A 3BELA 2CNQA 3PY1A 2NO3A 4FG8A 5M4IA 3M11A 5B7VA 4D4YA 5HHWA 2OF2A 4F9YA 4OT6A 5CSWA 1V0OA 2PVYA 2BRHA 3L8SA 2BPMA 4HVSA 2F2UA 1QMZA 3DQWA 1U59A 3A62A 4M12A 1XH9A 4MKCA 3CGOA 4NT4A 2X0GA 3A2CA 3KK8A 3QTRA 1VEBA 3R21A 4DEGA 5HLWA 2YHVA 3CXWA 3P7AA 4BDEA 4I24A 4KRDA 5HVJA 5HTBA 3IPHA 2WQBA 4DTAA 4ZSAA 3OCBA 4I0SA 3MVJA 5KKRC 3CTHA 2BHHA 5T6KA 1JWHA 2J0KA 3PVWA 1KV1A 4ALUA 4AZFA 4MXYA 4JBPA 2RF9A 3PFQA 3VUTA 3AGMA 3OFMA 3D7TA 5JMSA 2PVMA 2JAMA 5M57A 3BHTA 4E6CA 3MS9A 2W1HA 1L3RE 2GTMA 4HGTA 4IX5A 4RJ6A 4QYGA 5K5XA 1J1CA 4KBKA 1WFCA 4H3QA 2IVVA 4PX6A 5KE0A 4CFMA 4DA5A 3MBLA 4RC3A 4EH7A 5IEVA 3A61A 5HO7A 2ONLC 4QYYA 4GW8A 5D12A 3ZEWA 4D2SA 4UALA 4C0TA 2PUNA 2PULA 1WVYA 4F9WA 4ZMFA 3EYGA 3P0MA 3C5IA 3D5WA 2B54A 3IW8A 3R73A 2WOTA 4EOIA 2UZLA 5HVYA 5D1JA 4Y95A 3ID6C 3L9PA 2B4SB 3FSFA 3ORIA 3UTOA 4A4XA 3V5WA 3ZOSA 2REIA 2C6EA 2ITVA 4PNIA 5KKRB 5C4KA 4PMMA 1QL6A 5H8BA 4QP3A 1XQZA 4GG5A 1JSTA 4NCTA 4EK3A 4F0IA 1OKYA 4AF3A 1WBOA 3FPMA 1PXLA 4WOVA 2X1NA 3EL8A 4RMZA 2PWLA 4W4VA 5FDPA 5EYMA 3EIDA 3DBCA 3VBWA 3C4XA 3BLHA 3COHA 3QX2A 4FVPA 5LMKA 4FL1A 5DPVA 3F9NA 1P5EA 1OIQA 2VAGA 3Q6WA 3G2FA 4DFXE 3MTLA 4GFMA 4XP3A 4ZZNA 5A4QA 3BHUA 3R0TA 3ZRMA 3I6WA 3ZUUA 4BCPA 5FXQA 2ITYA 5BUEA 4M14A 4FZAB 4JG7A 2HWOA 2OJGA 3D2KA 4U3ZA 3ZFMA 4BDIA 3LKMA 1REJA 2J50A 4N6YA 4KIKB 4ANSA 4XUFA 1RW8A 4C35A 3BKBA 3EYHA 3KRJA 4RWJA 4FSNA 4XV2A 3LJ0A 3C9WA 3QA0A 3FMMA 4KIQA 3WF6A 4CQEA 4HCUA 2WGJA 3OCSA 3ORLA 3TG1A 4U44A 3PP1A 4GKIA 3FHRA 3Q2JA 3BLQA 5AUVA 2XK4A 2F7EE 5AWMA 2WB8A 3LCDA 5IH5A 4FGBA 3ZEPA 4OTPA 2WO6A 2ZB0A 2ITOA 1OBDA 1BMKA 1B6CB 2CPKE 4FV1A 4M0YA 3TNQB 3Q53A 5HICA 5EG3A 4BBEA 2NRYA 3IG7A 3LW0A 4DTKA 3KXGA 2XB7A 4J8MA 3MVLA 3RTPA 3FC2A 5AP1A 1SVGA 4G2FA 1K3AA 2VGPA 5AIRA 2Z7QA 4LL5A 2UVZA 2BTSA 2HZ4A 5LVLA 5DN3A 5HORA 2ZDUA 4H05A 2VTHA 3FLYA 3PXYA 4EONA 3DZOA 5FEQA 5JFXA 4L44A 5L2WA 3QKMA 3P08A 4L53A 4WNKA 4QD6A 4C36A 3OXZA 2BDWA 4LYNA 4DINA 2A4LA 4O0RA 2WMAA 1Q24A 2IZSA 2PVNA 5E1SA 3IW6A 4O2ZA 4QYEA 3M2WA 5AUYA 4F7JA 4Y73A 5AR7A 3AC3A 4YZCA 5HD4A 5L6OA 3ULZA 3QWKA 3UG1A 3C0GA 1B39A 4JI9A 1KE8A 4CNHA 1T45A 4F6SA 1AGWA 1JKLA 4E6DA 4RX8A 3GCPA 2BR1A 2J4ZA 5IUHA 2GNFA 3UE4A 1PMUA 2AC3A 3OCGA 2BALA 4IJPA 2ZV8A 3MTFA 3OBGA 3TXOA 3C4FA 3GU4A 5FTGA 4F9AA 4JR7A 5AX9A 4EZ3A 4MTAA 4QQCA 5AV0A 3VRZA 3C1XA 4FKLA 4G3CA 4MQ2A 5AP4A 5HX6A 3Q04A 2R3IA 5EHLA 5DHJA 3LQ3A 2PMNX 4FTUA 3RPSA 4D9TA 2GNIA 3ZH8A 5C27A 1WMKA 4QMSA 5CU2A 3D14A 3GCQA 4L67A 2V62A 1GIHA 3DFAA 5LVMA 4RJ3A 3HRBA 4YNOA 2QURA 5IDPA 5DEWA 3I7BA 3QZIA 4F1MA 2XBAA 1XWSA 3N4TA 3LFBA 3ET7A 3IGOA 4O7SA 1AD5A 3ZMMA 4O84A 2X8IA 2ZOQA 4R3PA 3D2IA 3R71A 5I9XA 5CF4A 3VVHA 2XIRA 4YTCA 4FICA 4R78A 2EXEA 4EI4A 4A9SA 3KEXA 4PP9A 5F95A 2V7OA 4F7LA 4D28A 3B8QA 5CF8A 3AC4A 3U55A 4XG4A 4ZLZA 1LEZA 5EH0A 4QMMA 4NM0A 4R7HA 4TRLA 3FY0A 2CKOA 2YM4A 4LRMA 1MRYA 4J97A 3NW5A 5JK3A 4LRJA 4NU1A 5IH6A 2QOHA 4ZSLA 4ZZMA 3UO5A 2PMLX 2WEVA 3GI3A 2ESMA 2O63A 2UZTA 3U4UA 1R39A 4E5WA 1P4OA 1JKSA 5A4TA 3BYSA 4FKTA 3I7CA 3PXFA 4YHJA 3NNVA 2O3PA 5DT3A 1G8SA 3DFCB 4WBBB 3RZFA 2HCKA 2UW7A 3GC9A 3QALE 4FSZA 4GMYA 3RAIA 3UZPA 4DG2E 4KBCA 4O22A 4PNKA 3DK3A 2BIYA 3D83A 4NM5A 1YQJA 3KRRA 3NZ0A 2OW3A 3TI1A 4F64A 1YOLA 4NUSA 1JSUA 2BILB 4ASEA 2GNJA 4ZOGA 4CTCA 3KXZA 2WIPA 4OGRA 3SG9A 4TYJA 5AR2A 1LUFA 1YRPA 4LV5A 4MK0A 3CCNA 4X2FA 3ZCLA 1FPUA 3F5UA 3W33A 3SXRA 2YIWA 2PVLA 4CEGA 1IASA 5LQFA 5KBQA 4YJRA 3L1SA 1GJOA 2WIHA 3G15A 3FWQA 3F2RA 3BBWA 4EC8A 1OVEA 4U81A 2X6EA 4IVAA 5KUPA 2JBPA 4BY9E 1XBBA 3EHAA 3RK7A 4YLLA 5A3XA 3HKOA 4HNIA 5L8KA 4ANLA 3NUXA 3VIDA 4R3CA 3ZLWA 4E7WA 4QMYA 1R1WA 3AC5A 4NKAA 5JZNA 4AZEA 4PDYA 5E8XA 4DF3A 1G3NA 4M69A 3EB0A 5ITAA 3U6JA 3EQBA 2F2CB 4F6UA 5JRSA 5IA5A 1M2RA 3LM0A 4RA5A 1UU8A 2X2MA 1W84A 2YCFA 2OKRA 3BGQA 3QD3A 4XRJA 3RAKA 4NH1A 3H10A 5J5TA 3HMOA 3KKVA 4BKZA 5DOSA 5D10A 3ENMA 1PMVA 3NYOA 2YIXA 4HGEA 3D7ZA 3ZHPC 4NKSA 3DPKA 3V04A 4H39A 3R1YA 1YHSA 3I5ZA 2HYYA 4KB8A 2I7QA 5IQGA 3FMDA 3EZRA 5DI1A 3EFWA 1A9UA 3R1NA 4QMXA 2UZUE 4BZDA 3LHJA 5AIKA 3QLGA 2ZMCA 3A7HA 4FT7A 5E8YA 2C0IA 2W4JA 4V0GA 1M52A 4FV7A 4K18A 4FEUA 4XNEA 4FG9A 2ITQA 3NIZA 5EM7A 1O6YA 3KRXA 4OTRA 4R5YA 3IOKA 4RJ4A 4IZYA 3RP9A 4PTGA 2HW6A 5EI2A 1Q3WA 3ZDUA 3NWWA 5DR2A 5AV3A 4MH7A 4PMPA 2XKEA 5AR3A 4YU2A 3WILA 3MA3A 4NYEA 1F3MC 1XJDA 3QYWA 4IADA 3UOJA 3JVRA 4RQVA 5J8IA 5IQFA 4QNYA 2UZOA 2P3GX 4BC6A 1OIRA 2YDIA 2QQ7A 5HEZA 4AZTA 4EZ7A 2PE1A 2CGVA 4JR3A 5KMNA 2YCRA 2WTVA 2X8DA 3NYXA 2UW8A 4JBVA 4KABA 3ATSA 4XV1A 4OTQA 3LCKA 1YI3A 4BCNA 2JFMA 1IAJA 4FUYA 2R3FA 2FVDA 4RLKA 1ZMVA 4X2KA 3OF0A 2JBOA 5C8MA 3PJCA 4F9CA 2CGWA 1LEWA 5IZFA 1PMEA 4JBOA 4DH8A 3E87A 3PSDA 4GK3A 4EOSA 3AMAA 4HNFA 4QMOA 4WRSA 3VNTA 2Q83A 2W99B 3PRIA 3RVGA 4FYOA 4KA3A 5KMIA 4E5BA 5H3QA 5D11A 5E92A 5C1QB 1W83A 3NUNA 3FPQA 4B9DA 5IQBA 3SRVA 4FF8A 5FTQA 2XA4A 1P14A 4FSRA 3QAME 2R0UA 2VGOA 4JVGA 2CKPA 4FX3A 5HBJA 1SVHA 3R8MA 4EH2A 3NUPA 5CU6A 5GJFA 3FMKA 2R3LA 5J9YA 1AQ1A 5CF5A 4MVFA 2WFYA 4ZS0A 4CYJA 1YOMA 4FEQA 1R78A 4FKUA 3OG7A 1YWNA 3Q4TA 2VNWA 3Q2MA 4XCUA 4F09A 3DKFA 3TTJA 5GZAA 3H30A 2QOKA 3PZEA 2EB3A 2C47A 4LOPA 4M84A 4CGAA 4C2WA 3PPJA 3KCKA 3LMGA 4LGHA 4A9RA 3HVCA 3MFRA 4BDFA 2IVUA 2UW5A 3KA0A 2HZIA 4A06A 3PSCA 4BDKA 1PF8A 1DI9A 2VWZA 2YM3A 3OW4A 4EQUA 5IQCA 4IC7A 1HOWA 5HI2A 3F3VA 4UYNA 3DJ5A 2FSMX 2DYLA 3TZ7A 2OJIA 2GS6A 1DM2A 4P4CA 3VBTA 3EH9A 3VW6A 2W06A 5CEQA 2V7AA 3DJ6A 3HUBA 3M1SA 3NNUA 4EOJA 4IB0A 4GFOA 2X8EA 3S0OA 3R01A 4HYSA 3QUPA 5DG5A 4E26A 3BGPA 5E4HA 3HMNA 4UXQA 3OMVA 3FLSA 3O96A 5LMAA 4G17A 1BYGA 5CAQA 3O8UA 3EN5A 4U42A 5I9WA 4DGLC 4WNPA 4O0SA 4O82A 4XV9A 4LMUA 5KZIA 1OECA 2RG6A 3PJ8A 5CSPA 4OTIA 4JQ8A 4XG2A 2PPQA 4JAIA 2X9EA 4IAKA 3R22A 3ZRKA 4NTSA 1O6LA 1WBVA 4B6LA 3S00A 5CAPA 4ZTQA 3ZZEA 5HNIX 3UIUA 4I20A 4FTLA 4P2KA 1U54B 1Y57A 1U4DA 4FIIA 3TZ8A 5HU9A 4BCFA 2J5EA 4J98A 3TT0A 2HELA 2GTNA 2QONA 4U3YA 5CSXA 5IQEA 4RIXA 1YHVA 3BWFA 3TTIA 2BAKA 3BI6A 5BPYA 3BCEA 3FAAA 4YJNA 3OWJA 5A4EA 2HZNA 4D2WA 4X0MA 2J0IA 2QHMA 4AFEA 4DCAA 3RGFA 4DBNA 2B7AA 4YZNA 2C6TA 3NSZA 5J87A 3F7WA 2OG8A 3BV3A 4BZNA 3S4QA 4JLCA 2CCHA 1VR2A 1ZOGA 1FMOE 4MNEA 3EOCA 3I60A 2VWVA 4R1VA 5FWKK 5HIDA 1QPCA 4GSBA 3Q9XA 3CP9A 5AUTA 1SZMA 3H0ZA 4O7YA 4BCHA 2QOFA 3I1AA 4WO5A 4XMOA 3FDNA 4AWIA 5AP2A 3F6XA 4F0FA 5GIPE 1PRYA 3DKGA 3WARA 3MPAA 3PE2A 3ZTXA 4BCIA 4BN1A 4A9TA 3JYAA 4XLVA 3SD0A 2UZNA 4EH8A 3KMMA 3IK3A 1DI8A 3THBA 4ZSJA 1IR3A 2HK5A 4EORA 5CU0A 2GSFA 3Q96A 2W5HA 4FOCA 5DIAA 2WQEA 4FG7A 2FA2A 3QQJA 3S95A 4PPBA 3ULIA 5AADA 5JT2A 2VWBA 5M08A 2QU5A 3GP0A 3TDWA 4YURA 2XKDA 2WTIA 2R3QA 5M4CA 3FC1X 5HQ0A 4IEBA 2WMBA 3AC1A 2BKKA 3D4QA 3DLZA 3TIZA 4QTCA 2VWXA 4F7NA 3W2QA 4CVAA 3Q9YA 2XNOA 4L46A 3QTZA 5C9CA 2GU8A 3VQHA 3DLSA 3R1SA 5BVFA 2W17A 5KMMA 2QLQA 1FGKA 3PXZA 4FKVA 5K5NA 2YJRA 5H8EA 2C1BA 3T3VA 4R7IA 4OR5A 4ASZA 2R3JA 3PXKA 1KE7A 3R63A 4H58A 4NSTA 5HE0A 4IX6A 5LVOA 3AT3A 4PL5A 4V01A 2C1AA 4JX7A 4CQGA 3HECA 3NDMA 3UOLA 3WZJA 3PA4A 3UIMA 5HGIA 4IJ9A 2FGIA 3OUKA 3OZ6A 4OUCA 4YZ9A 4B0GA 4IC8A 4ID7A 1H8FA 2GNLA 3EQIA 5HCZA 1WBSA 4DT9A 2W9ZB 4JAJA 5D7AA 4YR8A 4D58A 5HKMA 2ETRA 4EK8A 2CNUA 2XMYA 2IW6A 3Q60A 3QKLA 5DT4A 5FM2A 4II5A 3TZ9A 4FV6A 3UVPA 4JG8A 2BTRA 5CF6A 4I21A 3V5QA 5HG7A 1XH5A 2XP2A 3SGCA 2SRCA 4BTJA 1ZZ2A 3VHKA 3TZMA 4OTHA 3RM6A 1PYXA 4JRNA 2QHNA 1KUTA 3G33A 4LOOA 4DFBA 3VJOA 4UYAA 4Z9LA 5BYYA 2XK6A 1YXTA 2RFDA 2W1GA 3SC1A 2OFUA 4TKSA 1QPDA 4IWPA 2YM8A 4K6ZA 4UBAA 5HCXA 4BIDA 2C4GA 4ZTRA 5ETFA 4GU6A 2X81A 4Y5QA 5IMXA 4CCUA 1H1SA 4ZZOA 5HBHA 2CKQA 2BZKB 5DEYA 5CVHA 4JDIA 1WCCA 5EQYA 4C61A 3MVHA 3BLRA 3WI6A 2Y7JA 3QFVA 4AACA 3R7IA 3RK5A 4EYJA 2W0JA 5TT7A 3LMHA 3UNJA 4FTRA 4PTEA 3VULA 4JS8A 3W2RA 4IW0A 2XNNA 2A27A 1XBCA 3BE9A 1ZARA 3BYMA 4MX9A 1OKWA 3GQLA 3QL8A 1VJYA 5K9IA 1J3HA 2C6IA 2CN8A 3GOKA 4RIWB 4F08A 3P7CA 2WTWA 3ETAA 1H1RA 4U97A 3FZ1A 4GV1A 2C0TA 3CY2A 4TYEA 2V22A 4GYIA 5C4LA 3ZXZA 3HAMA 5AM7A 4Z55A 3D15A 5JN2A 1WVWA 4MXCA 1OIUA 4TW9A 5BMMA 5AP6A 3A7FA 4FEXA 1S9IA 4RJ5A 3W2SA 2UVXA 3W32A 4IWOA 4X2NA 4JOAA 5IA1A 1M2PA 4IZAA 5FBOA 5IUIA 2RFEA 3RPOA 3KN6A 4RG0A 4RZWA 5ANGA 1WVXA 4N0SA 3OEFX 2Z02A 1H25A 2UW3A 4BIBA 2WHBA 3FKOA 3U9NA 4KS7A 4TL0A 5IPJA 2ZJWA 4CRSA 5DRBA 3HV3A 4U41A 4WG3A 3LAUA 3ZC5A 4IHPA 3AMBA 2X4FA 3BPRA 3ROCA 5CTPA 4G34A 5AUWA 4L42A 4KKGA 5KNJA 4R77A 4L3JA 3DNEA 3U51A 4OTDA 3EN9A 3RWQA 3ZO2A 3GGFA 3NNWA 1Z9XA 3JS2A 1HCLA 2VTSA 2XNBA 3NEWA 4UWCA 5J95A 4ORKA 2NP8A 1WBNA 4NJDA 2XCHA 1BL7A 4M3QA 4BZOA 1ZRZA 4QP1A 5GZ9A 4AN9A 4DH5A 4L43A 3IGGA 3FMNA 3KQ7A 4XBUA 5FP6A 2P55A 3DT1A 3MV5A 4J71A 4AOTA 4G3DA 4MBLA 3Q4UA 4YZMA 3GC8A 3FYKX 3UODA 2Y4PA 4D0XA 3OEZA 3MVMA 5DBXA 2G1TA 1CKJA 4LOQA 1PW2A 2H8HA 2PY3A 4JX3A 3JXWA 2XBJA 3TKHA 4DC2A 4CKIA 1JNKA 4GCJA 4HOKA 5EW9A 5AX3A 4AT3A 2W1FA 2YIRA 2XYNA 3FSKA 4JL9A 2IZTA 3DBDA 4PPAA 4KNBA 3ZBFA 2O8YA 3CQUA 2IVTA 2JKQA 2OWBA 3NUAA 4ACCA 3HDNA 3ORNA 2WQOA 4MYGA 3R7UA 4F6WA 5ANOA 4FZ7A 5EDPA 2WMSA 4BCQA 5L2IA 3E8NA 2JKKA
chains in the Genus database with same CATH superfamily
3VHEA 3QQLA 3F3WA 4AQKA 3GT8A 4Q2AA 1ZYCA 3QQKA 2E9OA 2XCKA 1I44A 4ITJA 3QD4A 4D9UA 4AA4A 3R8PA 3C5UA 2Q0BA 2C6MA 4BYIA 2GHMA 4FIGA 2YZLA 5DT0A 4DDIA 4NIFA 2W7XA 4PPCA 4PMSA 3VW8A 2QC6A 1G5SA 3FQHA 3V6SA 4UEUA 3LFQA 4CFUA 3PLAE 4UWBA 2VNYA 4IB3A 3NW7A 1FOTA 3VBYA 3P5JC 4P5ZA 3UYTA 4EH5A 3UIXA 5CVGA 4NM3A 4ARKA 3RJCA 5C26A 4APPA 3O50A 3R04A 3SOAA 4U80A 4NW5A 4FV3A 2I0EA 1Q8UA 5AP5A 2ERZE 2W1ZA 4BICA 3OCTA 2V55A 4YPSA 1J1BA 4GVJA 3RNIA 1J7LA 4OT5A 2QCSA 3OT3A 2PVKA 5EOLA 4FV5A 4AT4A 4L00A 3GUBA 1OL2A 4RPVA 4EBVA 4EOLA 3E8DA 4FV8A 4O96A 4YBKA 4EOQA 2RIOA 3KMUA 2VD5A 5L6PA 1Q5KA 5E9EA 2C3KA 2XIZA 2WTJA 2JDSA 4I0TA 3ODZX 4I0RA 4K1BA 4X3FA 3CIKA 3E62A 2QKWB 4Q5EA 3SXSA 4FNZA 4WUAA 3RAWA 3Q32A 2GNGA 3H9OA 2EWAA 3QBNA 4GVAA 4HGLA 3OHTA 3ORPA 2QI8A 4NJ3A 2GCDA 4AZVA 2P0CA 3CC6A 3DJ7A 4QDVA 5L4QA 2BZJA 3I0QA 2KTYA 2R3MA 2IO6A 4HYUA 1OL7A 4BDBA 4O7TA 3V51A 3SW7A 4BB4A 4DAWA 4JMQA 2XRWA 3CKWA 1OIYA 4ACMA 5L2TA 5LCJA 2I0VA 2PZIA 4MXOA 1Q41A 2YA9A 2BZHB 4CFXA 3AOXA 3WF5A 5FLFA 4PDSA 5IA0A 5CT0A 4E1ZA 2OZAA 2Z60A 2X7OA 2OH4A 2VTAA 5CNNA 3RAHA 3V5JA 5JSMA 1Y8YA 3QCXA 3E3PA 3MH3A 5TO8A 1K9AA 4EOOA 2BFYA 1V0PA 2XKCA 3LQ8A 5F1ZA 4FKWA 3POOA 5HG8A 4B7TA 4LG4A 3A8XA 2J7TA 4KSPA 4XP2A 5CYIA 5D41A 3MSSA 3TV6A 3DAEA 4APCA 4CKRA 4DT8A 4G6NA 4BDAA 1F5QA 1SNXA 3H9FA 2VTOA 4RSSA 3CEKA 3W2PA 3TYKA 4FSWA 4S34A 4C4IA 5HE1A 4FIFA 3IS5A 2HXLA 2PZ5A 2VTTA 3EN4A 3H9RA 5HG5A 3DXPA 3A60A 3ITZA 4L7SA 3FQSA 2F49A 3KULA 5K4JA 5AAEA 3IONA 4QTAA 4X7QA 4XRLA 4ZY5A 2PE0A 2J51A 1CM8A 2YAKA 3K5UA 3LIJA 3TV4A 4FGRA 2BAJA 5JGBA 3E64A 2VTRA 2ZV9A 3KVXA 1LP4A 2R3NA 3FZRA 3BU5A 4FKQA 2HY81 2DWBA 4BBFA 3CSVA 5DMZA 4O7VA 3MFTA 4AAYA 4ZJVA 4M13A 3S3IA 3QD0A 5LCKA 3SW4A 4WRGA 1OPLA 2OF4A 4YO6A 3NR9A 4YZBA 1XKKA 2R3PA 4AAAA 3C13A 4ENYA 5IQHA 4M68A 1KOBA 3GB2A 3MESA 3G6HA 4UB7A 1RDQE 4D1SA 2VTQA 3ZRLA 3FYJX 5CEKA 2W5BA 3RINA 3MH1A 3TKIA 5KCVA 4DBXA 1JVPP 4NK9A 5GZ8A 4CG9A 4MD8E 3KK9A 4CZTA 5M06A 4FVRA 2R64A 5HNGA 3E5AA 4BR3A 1Q8TA 1FINA 4O0TA 1OBGA 4IZ7A 4K0YA 2ITPA 2QR7A 2FUMA 3EFLA 4RC2A 3VUIA 3DNDA 4AT5A 2A19B 1SMHA 1YW2A 4FTMA 2FB8A 3ERKA 1IA8A 3DOGA 5I3OA 1APME 3CE3A 3TJCA 1E9HA 4AFJA 4FSUA 1ZYDA 4X6QC 3MH0A 3RZBA 3ZS5A 4FOBA 4QQTA 3UDSA 3V6RA 2X0PA 3BX5A 4HCVA 1GZNA 4DDGA 4ITHA 4C62A 3VRYA 5AFVA 2YJSA 2C5VA 3BIZA 2CJMA 4UY9A 4IWDA 4DH7A 2XAMA 5DYJA 3V8SA 4GG7A 4H1MA 5L6WL 3VBVA 3F88A 5CU4A 3MY0A 5CEIA 4FTQA 3WF8A 2YM7A 5E8WA 2BVAA 2WTCA 4K33A 1QPEA 2XKFA 2EB2A 3WE8A 4C34A 2W4KA 3UGCA 4O81A 3Q5IA 3ZXTA 1IRKA 4AE9A 1ZMUA 3K3IA 1UA2A 4AGCA 5CASA 3R7YA 1U5RA 4CMTA 2V5QA 4W9WA 5JH6A 3FLNC 4ACHA 1E1XA 3O2MA 1V0BA 4QP8A 4S33A 3P4KA 3F2AA 4NCTC 3HMMA 3R30A 4YJVA 3R83A 3HMIA 2JEDA 2YM5A 3KGAA 4O0UA 3OWLA 4QPAA 4J53A 2KULA 2R7BA 3D7TB 4KKHA 4TY1A 3FQEA 3UBDA 3BHVA 2C5YA 2WQNA 2X2LA 2PMOX 4EH4A 4GUEA 5LMKC 3CGFA 4Y72A 2GHGA 4P7EA 2XNMA 3U8WA 4AGUA 3PG3A 4MF1A 5ACBC 3SA0A 2R3HA 2XNPA 1OITA 3L8XA 1H1PA 1GZOA 3O8TA 4ZLOA 1NXKA 4W4YA 4D4VA 3RKBA 5J5SA 3GXLA 5HX8A 1H07A 4IX4A 3Q6UA 2OXDA 4JQEA 4PY1A 1NVRA 2XIXA 2ITUA 3BE2A 2BHEA 5HO6A 2IZUA 2WMRA 3HV4A 4YJOA 3VO3A 4AG8A 4IZ5A 5FUTA 4CKJA 1MQ4A 2GMXA 5ETCA 3IW4A 5KMOA 1NW1A 4E3CA 4R6VA 4D1XA 3PPZA 4MXZA 1O9UA 3AD5A 5I9UA 2WD1A 5AR4A 3K3JA 2WTKC 4D2PA 4IXPA 3G0FA 4RJ8A 4FSMA 2JIUA 3HA6A 1ZYLA 4IWQA 2Y4IC 4C4HA 4DLIA 3HRCA 4CFWA 4DGGA 5AA8A 4GKHA 1BX6A 3MWUA 4IDVA 3RK9A 3BQCA 4Q9SA 3CPCA 4QMNA 2XYUA 3UMWA 5LWMA 4AXEA 3WOWA 5L8LA 1ZMWA 4E4MA 3Q3BA 2X0QA 4J95A 5GJDA 3BQRA 4YP8A 4FK6A 2A1AB 4XX9A 1OM1A 1R0EA 4AN2A 3HZTA 4RVTA 3DB8A 2VWYA 3Q4ZA 1GY3A 2YLEA 4IB5A 4WG5A 4K77A 5CS6A 4CZYB 4E8AA 4EH9A 5LMBA 4BBMA 4BI0A 1W82A 4PUZA 3LXPA 4TT7A 4DEHA 2EU9A 4DEBA 4YTFA 3RALA 3QQFA 1G8JA 4RIYA 3KXNA 4X2GA 4WIHA 3DTCA 2H9VA 4KBAA 4XG3A 2PE2A 2VWWA 2WOUA 3M42A 4IM0A 2QD9A 4YJPA 4HYIA 3PDTA 5IDNA 4RFMA 4WHZA 2XM9A 2WTKB 4NZWB 4E4XA 3BV2A 4M15A 4TYIA 2J5FA 3W2OA 4DGNA 3NX8A 4EHVA 5BMSA 4O0WA 4FEWA 4DYMA 4HVIA 4KS8A 3TCPA 5CXHA 4CT1A 5AV1A 2X7FA 2GFCA 3HL7A 2ETKA 3E88A 5M09A 2OXYA 2X0OA 2PUUA 1CMKE 4HZRA 3QTIA 5F4NA 3TM0A 4C8BA 2UZEA 4EHEA 3OWKA 2XS0A 2GS7A 3QUDA 2C30A 3V8WA 4I22A 2JDVA 4O4BB 2LAVA 4NFMA 4BTMA 4EUTA 3AT2A 3PIYA 2XJ1A 4BKJA 4L52A 1T46A 4O0VA 1H1WA 4DE4A 2QOQA 2WELA 3T3UA 5IUGA 4LGDA 1UU9A 3HNGA 4XS2A 3G51A 1KWPA 4YTHA 5BVKA 2ACXA 3E8CA 5BUJA 3QZFA 4QMQA 4DHFA 2HZ0A 2VTLA 3SLSA 4FSTA 4DFUA 4CFNA 3TACA 2YACA 2JDTA 3CPBA 2BAQA 3VN9A 3E92A 4BIEA 2F4JA 2R9SA 1OUYA 4AZWA 4N57A 2UW9A 4DN5A 3F3TA 2YABA 4FUXA 3P78A 5KHWA 3PY3A 5I9YA 4XV3A 3BZ3A 5EW3A 4I5CA 3FI2A 3NW6A 2P4IA 4FSQA 4LUEA 1QPJA 2RSVA 5EYDA 3MFSA 3O7LD 4C59A 4JBQA 1W2CA 3MJ1A 3ZU7A 4XG9A 1JPAA 3IQ7A 2ZV7A 3AMYA 3TWJA 3K54A 4A4OA 5BVNA 3UQGA 3ANQA 2C6DA 1M7QA 2W1EA 3HV5A 2YLFA 3ACKA 5IH4A 4O83A 1H24A 5HIBA 4I94A 3FBVA 2PUIA 3TEIA 3MY5A 5AR8A 4C33A 1S9JA 5L8JA 4YZDA 2XK9A 2G15A 3FMHA 4NW6A 2QG7A 3ZSGA 1H0VA 2VTMA 4BWKA 3IKAA 5M51A 1YKRA 3PE1A 1PHKA 2R2PA 4TYHA 5CU3A 4C4EA 4CG8A 2DS1A 4QMPA 3R7VA 1VLRA 4DFLA 3CJFA 2R3GA 4NTTA 4CV8A 4U40A 3SXFA 4A4LA 4QT1A 3BHYA 5DGZA 3KXXA 4L6QA 3CR0A 2NYAA 4PP7A 3D5VA 4K11A 3I81A 5HTCA 5CT7A 2XH5A 4AGDA 3MA6A 3QC9A 1JLUE 4CD0A 5B2MA 3COIA 2J0MB 3UP7A 5IEYA 3GCSA 4MXXA 5KMJA 4O7ZA 5CLPA 3ZSHA 4ASXA 5H2UA 4EHZA 2WKMA 4UXLA 1NY3A 2G01A 4O0XA 5L2SA 3V01A 1YI4A 3LFAA 4G3GA 4I1ZA 2ERKA 4JDHA 4ALWA 2VTPA 1V1KA 3R9HA 5LJJA 4TYGA 4DHZA 2B9JA 2XALA 3FLZA 3P9JA 3EWHA 4F4PA 3V5LA 4E4NA 4RJ7A 2OIDA 5K0XA 4HJOA 4UWYA 4CLJA 3LCTA 5JQ5A 1H01A 3P7BA 4YGAA 2VRXA 1UVRA 3VUKA 3CLYA 3DZQA 1YDSE 1GZ8A 5A4CA 4MEDA 3G0EA 4QMWA 2Y9QA 3BGZA 2RL5A 2WEIA 3FJQE 2W4OA 2J0JA 5FM3A 5A14A 3QWJA 3Q9WA 3JUHA 3QTSA 3HEGA 1CKPA 2VTJA 5M4UA 4MNFA 4EC9A 4C3RA 3LCSA 4L3PA 3VS0A 3T9IA 3PJ3A 4Z16A 5EDRA 3V5TA 3R7GA 3MPMA 2YEXA 3EMGA 2JC6A 3R2YA 2LGCA 4B8MA 3FL4A 5FXRA 4AOIA 5AM6A 4BTKA 4D5KA 4BKYA 4EK6A 3TMOA 2YZAA 3PPKA 1Y6AA 4J52A 3MI9A 3FMLA 5EFQA 5EKOA 3TUDA 3FI4A 4GT5A 4M69B 3DDQA 3NFFB 4NWMA 5FEEA 5GJGA 2DUVA 3E93A 2CHLA 4NFNA 3WF9A 1FMKA 4GH2A 4O86A 2UW0A 1XH4A 4QQJA 3O8PA 2C6OA 5HNBA 5JFWA 5AV2A 4Y8DA 2JFLA 2W05A 2BUJA 2VV9A 4CFVA 1YDRE 1TFFA 1FGIA 2UZDA 2WZJA 2XJ0A 3EFKA 3HV7A 2OIBA 3UVRA 5A54A 5ANDA 1ST0A 3D5UA 3QZHA 4GIIA 4C02A 3EQPA 4FKRA 1F0QA 4L3LA 3ALNA 2JAVA 4QP2A 3PJ1A 3UPZA 4HPUE 4LL0A 2WTDA 1RE8A 4BJJB 3MN3A 3OY3A 3NUYA 4D2TA 4U6RA 2R0IA 2QG5A 1LPUA 5BYZA 3QCYA 4ANMA 5IA2A 3KRWA 1OL1A 2Y0AA 3VBQA 5EDQA 2WMQA 2YIYA 1YXUA 2WXVA 4FZ6A 5GHVA 4D2VA 4E5AX 3R8UA 4CV9A 4UMPA 1P2AA 3EQRA 4O7LA 2OU7A 1CTPE 3QCSA 3QHRA 5EYCA 2C5OA 1JOWB 4KSQA 3RI1A 2P2IA 4IAYA 2XNGA 2YCQA 3NUUA 4I6HA 2BDFA 5KHXA 5AUUA 5TOZA 4Y46A 4USFA 3RHKA 3DAJA 5TF9A 3A99A 3MW1A 4WNMA 2OGVA 3KFAA 4YC3A 3UJGA 4OBOA 3UC3A 1DS5A 5JGAA 5EQEA 1H27A 2Z7LA 1JKKA 3P86A 4GT3A 1BUHA 4KWPA 5IF1A 4ZJJA 4FJVA 2R5TA 4MBIA 4G6OA 4ZTLA 3VS7A 4Y83A 4QMZA 2HENA 2YM6A 3C51A 4WG4A 3KF7A 4GRBA 4EK4A 5FD2A 3LZBA 3OY1A 5HLPA 3SOCA 3G6GA 4YJQA 4BCJA 3GU5A 3CKXA 2HW7A 4YPDA 3PG1A 5J1VA 4TZRA 3BL9A 3I5NA 2P2HA 3OXIA 1EH4A 3PZHA 4H3PA 3BYUA 4O1PA 4TWCA 3SDJA 5CI7A 1PXKA 4FC0A 3KF4A 2PZRA 4C4GA 2QR8A 2RFNA 4JNWA 2JLDA 5EK7A 3PWDA 3SRVB 4YLKA 3PIXA 3VS3A 4E6QA 1UWJA 2AYPA 4U43A 4IX3A 3A7GA 3D94A 1Q97A 2EXMA 3ODYX 4DEDA 5J7BA 2EVAA 3GNIB 3AKLA 3PWYA 4PTCA 3OOGA 2IPXA 5EQPA 1M17A 1H08A 3KL8A 1E1VA 3UNZA 4AA5A 5EHYA 2GDOA 1R3CA 4S30A 3LFSA 2G2IA 3NYVA 4YC6A 5CVFA 5CWZA 4FBXA 2ZYBA 4WNOA 4M97A 4C4FA 2E9NA 4D0WA 2ITWA 2ONLA 4Y85A 5DH3A 4CYIA 3HGKA 4GFGA 3PTGA 4KIKA 2C3IB 4A9UA 5A6NA 2YCSA 2C6KA 3V3VA 4IFCA 1SYKA 2IN6A 4XG8A 3IECA 4RQKA 3G9LX 5L3AA 3O71A 5H8GA 3PSBA 3KREA 5CI6A 4YJSA 2JGZA 4O4EA 4AXDA 3E63A 5CX9A 3ZM9A 2PSQA 2YITA 1UNHA 4WT6A 5B2KA 3DA6A 3EL7A 3FLWA 4V05A 4YSJA 2ZB1A 3DXNA 2VO3A 3BYVA 3ZONA 4ZSEA 3LLAA 3PA5A 4O21A 3GVUA 2OICA 5FRIA 2O2UA 3C4CA 3VWAA 4EYMA 3VUDA 4U0IA 3REPA 5EKNA 1G8KA 3C50A 3CS9A 3D0EA 4RWLA 3N51A 3P1AA 2PHKA 1XHAA 4AU8A 4FYNA 3MIYA 4J8NA 4UMTA 4OTWA 4E4LA 3IW5A 5HE2A 3WIGA 3A7IA 3DBQA 3QXPA 3LQ5A 3PP0A 3U87A 4DH3A 4KD1A 3FV8A 3RPVA 3T9TA 3TNPC 2XK8A 4I6FA 5EOBA 1BLXA 3F82A 3U9CA 4FIJA 2XZSA 3NNXA 3AD4A 3NAXA 4U45A 4EBWA 1GIJA 3MYGA 4O0YA 4BI1A 3KC3A 4P90A 3R9NA 5A46A 5CSVA 4O27B 3VJNA 5J9ZA 2UUEA 3FL5A 3OS3A 4FTAA 4C57A 3TDVA 3DDPA 3UG2A 5E1EA 4WA9A 1K2PA 3GBZA 1CKIA 2I0YA 4MD7E 4R8QA 4BCMA 4CLIA 2VX3A 2BMCA 4EQMA 5FP5A 2R7IA 2O5KA 3PJ2A 2B0QA 2RFSA 5I3RA 3DK7A 4IAFA 4XOZA 1J7IA 5CALA 3CQEA 4XLIA 4FT9A 2XIYA 3DXQA 2QO9A 3QQUA 3PA3A 4ANBA 3QKKA 4RVMA 4G9CA 1YI6A 3MB6A 4FKGA 4MNEB 1PXMA 4BCGA 2QODA 2OLCA 3R8LA 4GJ2A 1XR1A 2UW4A 3UC4A 4JT3A 2OIQA 3C0HA 3JY0A 1WBTA 4GT4A 5A9UA 1L8TA 3MJ2A 4MWHA 3RNYA 4NEUA 2GPHA 2HXQA 2XIKA 3O51A 1YVJA 3FMEA 3HRFA 4HPTE 2BRMA 4P5QA 4ZY6A 4GJ3A 2BCJA 2NPQA 2YIQA 4WBOA 3AD6A 1ZY5A 5AMNA 5F9EA 1A48A 1ZAOA 4BWPA 4EL9A 4JJRA 2IJMA 3CBLA 1PXNA 3BU6A 3LJ1A 4QNAA 4V04A 4BCOA 5J79A 4XYFA 3EQDA 1TKIA 3K2LA 4CCBA 4PF4A 3GCVA 4JXFA 3RWPA 3AC2A 3QGWA 4Z7HA 2PU8A 3QF9A 5BX0A 4JDJA 4RBLA 3KN5A 4S2ZA 3WE4A 5I9VA 3W2CA 2PVFA 2PYWA 3RM7A 2V0DA 3CJGA 3Q52A 3EN7A 3PVGA 4X3JA 3MDYA 4XBRA 3TNWA 2X2KA 1NA7A 4U79A 1FVVA 3PVUA 4AZSA 3NYNA 4O6LA 3SAYA 5DNRA 1BKXA 3F66A 2YAAA 3D9VA 3DKOA 3OTUA 3FMJA 4MHAA 5CY3A 3ZO3A 3ACJA 3IW7A 5FDXA 3OVVA 2XK7A 4E73A 4F1OA 3P5KA 4UZHA 4RVKA 3QRKA 5L2QA 4EOKA 3W8LA 4FKOA 3BEGA 4RWKA 5LVNA 4TWNA 3A4OX 3W55A 4RX5A 1FBNA 5LVPA 4FIEA 1YWVA 3TUCA 4EOPA 3L8VA 3FEGA 4LUDA 3R28A 4IFGA 3KU2A 4G31A 3QTWA 3ZO4A 4A9YA 4ENXA 1W2DA 2VUWA 5DLSA 3UVQA 3E7OA 5F20A 1M14A 5E8SA 3SQQA 3ENHA 5KBRA 4MCVA 4B8LA 4QO9A 4Y5HA 5M55A 5G1XA 4AXAA 1IAHA 2PK9A 1BI7A 4DLJA 1DAYA 1ZWSA 4PV0A 4AS0A 4C37A 4L68A 3N9XA 2CDZA 3VS6A 4BGGA 3F7ZA 5JFVA 3CY3A 4LQMA 2UW6A 1PY5A 1PKDA 3ORTA 2C3JA 2OJFE 2WAJA 2C6LA 4LFIA 4LV8A 4PRJA 4ACGA 4PWNA 4FA2A 3DGKA 1ND4A 2JDOA 3N4UA 2CNVA 3R1QA 3BRBA 4ANOA 3AQVA 4ZJIA 1OZ1A 2B52A 2YDJA 1OL5A 3NVKI 4W8DA 4QMVA 3UP2A 5BVDA 4FK3A 3QQHA 4FKIA 4I23A 3DTWA 5HOAA 2FSLX 1IA9A 5CQUA 3HMPA 4H36A 1W98A 3QTQA 5C03A 4LV7A 2IW9A 4G6LA 5EHOA 3L9NA 2F9GA 4HGSA 4XP0A 3PVBA 4FTNA 4DG3E 4ZY4A 5CQWA 1OMWA 1PJKA 2JKMA 3A7JA 3WZUA 3N4VA 5FBNC 2C69A 2ZMDA 4EUUA 4F1TA 1XO2B 1Y6BA 3ROYA 1XMLA 4I6QA 3ZLYA 5FEDA 3QD2B 4ZTHA 1WZYA 2OK1A 4LMNA 3VS4A 3SG8A 2XJ2A 2J6MA 2WMVA 5J9LA 5AJQA 2I0HA 2X9FA 1FVTA 2CGXA 3HA8A 3HP5A 3W0MA 2FYSA 3EKNA 5DWRA 4C3PA 2XUUA 3LCOA 4EH6A 2JIVA 3DKCA 4CRLA 2YWVA 3QRTA 1RJBA 1G8AA 4LI5A 4A07A 5EW8A 3NRMA 1GAGA 4ZMEA 4FV2A 5JEBA 3LXLA 2JIIA 5BVEA 5M07A 2YWPA 4FTIA 5FQDC 5F94A 2VZ6A 2OJJA 4UMQA 3UOHA 4O7RA 3FY2A 2PL0A 3QUEA 3DY7A 2UV2A 5CZIA 3I79A 5K3YA 2XVDA 2H34A 4JG6A 2BZIB 1JBPE 2PTKA 2UZVA 1Q8WA 3QRIA 5DR9A 3R8VA 3WYXA 2HIWA 2WPAA 5LARA 3ELJA 4FTJA 3Q5ZA 5E91A 3LFDA 5DE2A 2W9FB 2RG5A 3O0GA 5AR5A 3HP2A 3U6IA 4KRCA 3V5PA 3R6XA 2YFXA 4R5SA 3GU8A 4YO4A 4FTKA 5BUIA 4OAUC 2GQGA 5IQAA 1YWRA 1ZOEA 1GIIA 3R00A 2OXXA 3BHHA 4DFNA 5CAUA 4K9YA 3H0YA 2JITA 2HWPA 3ZSIA 5K0KA 2OFVA 4OW8A 5DVRA 3TN8A 3OC1A 4QDEA 4GYGA 4ZP5A 2G2FA 2X6DA 4ERKA 2Z2WA 2QVSE 5FTOA 3FZOA 4IIRA 3SHEA 2UVYA 2CSNA 3F3ZA 3GC0A 4YHTA 2OI4X 4HZSA 3W8QA 2DQ7X 5BYLA 3UO4A 2FH9A 4DEIA 5HBEA 3TNIA 3DAKA 2J0LA 1PXPA 1XH6A 2BRBA 3ORKA 4QPSA 4RGJA 3ZUTA 2RGPA 3VQUA 1NVSA 5B2LA 2OBJA 3R7OA 4QTDA 3FI3A 4BWXA 4O7WA 2QO7A 1U46A 4IAZA 4RX9A 3C0IA 1PYEA 4X6RA 4C3FA 3K5VA 4QRCA 4FL2A 4IACA 4QQ5A 4FODA 4IH8A 4WD5A 4UV0A 3EJ1A 3GOPA 4M7IA 1KV2A 3BLAA 4Z7GA 1WAKA 5M44A 3KCFA 2QU6A 4I5HA 4R1YA 5ANEA 3L8PA 4CXAA 4FEVA 3GCUA 4EJ7A 1NVQA 5AUZA 3FZSA 4WSYA 3UQCA 3UO6A 2PUPA 3DK6A 3DBEA 4EKKA 1YXVA 2EXCX 2X39A 4LGGA 3COKA 2E9PA 4X3FC 3G9NA 4W9XA 4UX9A 4QMUA 4BI2A 2E9VA 4NIFB 5EM6A 3GENA 3QLFA 4I93A 3ZM4A 1Z5MA 2A0CX 2BDJA 2WQMA 5D9HA 5IU2A 3CTQA 1NT2A 2YERA 3MH2A 3OROA 1OPJA 1IG1A 5DA3A 3JVSA 2B1PA 5FGKA 4DFYA 5AEPA 5BNJA 2O65A 4BCKA 4O4CA 4QEBA 4G5PA 3IDCA 3BWJA 4FKJA 5JKGA 5AP7A 3KIOC 4R7BA 2A2AA 2ZAZA 4ZTSA 4CZUA 1M7NA 4E6AA 2C5NA 4IDTA 4XHKB 4CMOA 2QNJA 4FR4A 1MQBA 5M4FA 3UDBA 1UKHA 2B9HA 4N70A 3OW3A 4O91A 5E8ZA 4B4LA 3LXNA 4GK2A 3ZC6A 5TE0A 3V8TA 3ZFXA 1GNGA 4YNEA 4BHZA 3PRFA 3A4PA 4BTFA 3C7QA 4X3FB 3FXWA 1STCE 1U54A 4FT0A 3G5DA 4GUBA 3LLTA 4O1OA 4YSMA 4NL0A 3MGYA 5IKWA 1Q62A 1O6KA 2QOBA 4R3RA 3NAYA 4E93A 3DU8A 4MXAA 5E90A 5CEPA 3UNKA 4H3BA 5HG9A 3MFUA 2I6LA 4EH3A 4Q9ZA 1JAMA 2OSCA 1H4LA 1ZY4A 3BBTB 2GNHA 3RMFA 1FVRA 1MUOA 1SM2A 4I6BA 4FTOA 1PXOA 2Z7RA 4M0ZA 2OH0E 4RA4A 3UMXA 3O17A 5ACKA 4YUQA 4ACDA 4ZIMA 4L45A 4TXCA 4FVQA 3HAVA 3NGAA 4GS6A 3FXZA 4C7TA 3GEQA 4CMUA 4F0GA 3ORMA 5H9BA 5ICPA 2OZAB 3UZTA 4ZS4A 3E7VA 5CZHA 1TQIA 4FNYA 2GS2A 4YMJA 3A8WA 3ZLSA 3CTJA 2C3LA 4DEEA 1XH7A 3KVWA 4G3EA 4QOXA 4BVUA 5HU3A 4ALVA 3GFEA 4HVGA 4FZFB 3NS9A 3F69A 4FV4A 3B2TA 4XEYA 3OUNB 4UN0C 2VU3A 3EZVA 3R02A 3WBLA 3AXWA 3QRJA 2H96A 4JIAA 3ZDIA 3NUSA 4S32A 4EKLA 5JQ8A 4QYFA 2Y4IB 3FHIA 4EJNA 5B0XA 4QTBA 4XJ0A 4KIOA 4AQCA 3KULB 2B55A 3FXXA 5FXSA 2BRGA 3FKNA 5TKDA 4CSVA 2BIKB 4EQCA 2YDKA 1VYWA 3TIYA 1KE5A 4L01A 3RHXA 4AE6A 4ZTMA 4DCEA 4RFZA 5ETAA 3ZYAA 1Q3DA 4FKPA 5KZ0A 4C38A 3L9LA 2G2HA 2ZM1A 4AUAA 3VBXA 3F61A 4U8ZA 4BDCA 1XH8A 4O7NA 3I0OA 4O6EA 2ZV2A 2ZVAA 2PMIA 4TNDA 1URWA 3QZGA 4EZ5A 4I6LA 2W1CA 2G9XA 3IDBA 1X8BA 4TNBA 4UMRA 2ZFYA 1Y8GA 3WZDA 3UDTA 3LOKA 3L9MA 3EKKA 2QOCA 2I40A 4PL3A 2QO2A 2ZM3A 1ZZLA 4I92A 4MAOA 2Z7SA 4EHGA 4DG0E 4L8MA 3OWPA 4BF2A 3IDPA 2O64A 4QPMA 4JDKA 1MRVA 2ITZA 3FZPA 4KAOA 3B8RA 2WMXA 4RC4A 2PVHA 4RX7A 4WUNA 1OUKA 2PZYA 4YLJA 1QCFA 5ETIA 1OL6A 4IBMA 1UV5A 3HDMA 3W16A 5KO1A 1ST4A 4XOYA 1MP8A 3TJDA 4IM2A 3QHWA 4S31A 4AN3A 3EFJA 3R8ZA 4O2PA 2J2IB 1B38A 3OD6X 2F57A 4FT5A 2PZPA 2FSTX 1WBPA 3HLLA 4AP7A 1H28A 4AGWA 4AOJA 5C8NA 3W0NA 5IMEA 4FIHA 1H26A 3TNHA 3NCGA 3OXTA 3ATTA 4DEAA 4ASDA 3EQFA 3VUGA 2ETMA 3ML1A 4IMYA 3R9DA 4EWHA 5HE3A