3BRBA

Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
260
Chain Sequence
NKLEDVVIDRNLLILGKILGEEFGSVMEGNLKQEDGTSLKVAVKTMNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase MER
publication title Structural insights into the inhibited states of the Mer receptor tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 260
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3brbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3brbA01
4ERKA 4LOPA 5DFPA 4NYEA 4G3CA 1WBTA 2RIOA 5DGZA 2H96A 2GQGA 3PJCA 1KWPA 4TKSA 2OXYA 4GK4A 1VYWA 2HY81 2C5NA 4DT9A 4IFCA 5EFQA 5HBEA 5EM5A 5JN2A 3F3UA 3ULIA 1WAKA 4K9YA 3W16A 1YWNA 5CS6A 4CTCA 4TWNA 4IM0A 1PXIA 2YA9A 3QHWA 2FSMX 4GFGA 4DCEA 2X7GA 3Q6UA 3Q9YA 2YLFA 4EJ7A 5IQCA 3MSSA 3ZLXA 1WBOA 1XWSA 3BIZA 2QOHA 2J0KA 3PE1A 4FTOA 4Z7GA 4AW2A 3T9IA 2OXDA 4QYFA 3RK7A 5BUEA 5HCXA 4C4HA 4TL0A 2I40A 4BBFA 3LXPA 4AW1A 2NO3A 4JQEA 4L00A 5M06A 1ZY5A 3ATTA 4MNEA 4JQ7A 3UIMA 3VBTA 2PU8A 2VGOA 4WBOA 5IUGA 2WO6A 3E63A 4G5JA 4I6HA 2PZYA 4GRBA 4HNFA 2J51A 4MNFA 1DI9A 3K3IA 1S9IA 3PG1A 4J1RA 2G01A 4H58A 3TIZA 3UIXA 4BI0A 4DN5A 2IVVA 4FL2A 4DGOA 4O84A 4O7ZA 5D7VA 2UV2A 3QALE 3NYXA 1YXTA 4HVGA 5DH3A 4ZZNA 3KU2A 3ZU7A 5LJJA 3U51A 3ZM9A 2W1CA 3NUPA 3Q2JA 4RIYA 4K2RA 4IX3A 3D7TA 4JXFA 4MBLA 3D15A 3CS9A 5L6PA 2VZ6A 4ANMA 2UZLA 3MFTA 3BBWA 2R3QA 3PIXA 3FDNA 4D55A 4GVAA 1FMOE 3BRBA 5K0KA 1Q8WA 3V04A 4FNYA 3WF6A 5IZFA 4O27B 5HBHA 3DB6A 4QYHA 3S0OA 3SW7A 4U42A 3SX9A 2PE0A 4MXOA 3U4UA 4BYIA 3R21A 2YM4A 1ERKA 5M57A 2J50A 1ZZLA 5FG8A 3DBFA 3MPAA 4KS7A 1PXPA 4R3PA 4TNBA 5BNJA 5EKNA 2HCKA 4C02A 3TV4A 2W1ZA 1XH9A 4TXCA 5KNJA 5CI7A 2J0JA 2BRGA 3R22A 2B53A 1YOMA 2O3PA 4ZSJA 3CP9A 3E8NA 1SMHA 4E6QA 2UZEA 2OWBA 3OT8A 4L53A 3MH3A 5IDPA 3DDPA 3VBXA 1YW2A 3R00A 3MB7A 5J1WA 1YKRA 4C2VA 4DEGA 2W1EA 1H28A 4GJ2A 5IUIA 1AGWA 4UMQA 2OF4A 3QTIA 4KNBA 3PVUA 3LFSA 2HY0A 2ZV8A 2OH0E 4U8ZA 4ZTNA 3F5PA 3MBLA 4DTAA 2OZAB 3GT8A 2HZIA 3FQSA 5CU2A 2C0IA 3FQEA 3WZJA 3G2FA 3QBNA 5CQWA 2X9EA 4BWXA 1ZWSA 4QQJA 1OIYA 5D11A 1I09A 1L8TA 3NAYA 1MQ4A 4GT5A 3WZUA 4MKCA 4ANLA 4O7SA 4QNAA 3OCSA 4QMXA 5HHWA 4EQCA 3NUXA 3MFRA 2PL0A 3R1QA 5KZIA 2IW9A 4DLIA 4LRKA 4FIHA 4NK9A 5DWRA 4D2VA 3SG8A 1EH4A 2JFMA 2UZOA 4EH6A 4YU2A 2C6DA 4AW5A 4YJRA 5FEQA 4U0IA 4BDFA 3UZRA 5JKGA 3EOCA 4XG2A 4FGBA 5JT2A 3TXOA 4IAIA 1R0EA 3EQGA 3F9NA 3FI4A 3QTQA 3ZDIA 2VO6A 4F7SA 1ZLTA 3ETAA 1E9HA 1U46A 2J0MB 3FLYA 5EH0A 3VRZA 5I0BA 3F61A 2RFEA 4F9YA 5EHOA 1UU7A 4GMYA 2IWIA 1RE8A 1YI4A 4G5PA 1XH6A 4WKQA 5LOHA 4DE4A 5E1SA 5CAQA 1A06A 3O23A 2EXEA 2QLQA 5T6KA 1K2PA 3Q2MA 5BQ0A 4D0XA 2HXLA 2C6TA 3KVWA 4G17A 4GYIA 4JR3A 2XS0A 4IQ6A 4M67A 4NU1A 4PDSA 4DFLA 5J7BA 5JMSA 2OI4X 2YDJA 4I41A 3IG7A 1JKSA 4C34A 1YRPA 3WI6A 4M15A 4BICA 1XKKA 5AM7A 2W1HA 4I4FA 1SM2A 3BI6A 4UALA 3PJ3A 3UDBA 2BUJA 3O71A 5HIBA 5KMOA 1BX6A 1ND4A 1GZKA 4F1TA 3I5NA 3NNUA 3EFWA 5DRBA 1GZOA 1P4OA 2XZSA 5K4JA 3PJ8A 3MTFA 5CEQA 3JPVA 3C4CA 1X8BA 3ENMA 4E20A 4F65A 4ACGA 2A19B 2ZDTA 2WMWA 1TQPA 4F7JA 3FLQA 2P55A 4D5KA 3U55A 3GCUA 4G1WA 4GK2A 4DGNA 4Q9SA 4X6RA 4PPAA 4BIDA 4M0YA 4BI1A 3IOPA 3QRIA 3IQ7A 3R30A 3WARA 1WVYA 4NL0A 4FKLA 3ZEWA 3ATSA 2OG8A 1BI8A 3BHUA 3HVCA 4EOMA 3KXHA 1UNLA 1CTPE 4U44A 2PZPA 2ZYBA 2C1AA 5HG8A 5DRDA 3BHYA 2Q83A 2VNWA 5BYYA 3LJ1A 2ITWA 4UXLA 3UIUA 4D2PA 2QO2A 4IB3A 2W1GA 2DUVA 4I5PA 5LMAA 4RX8A 4AA5A 4QT1A 1F0QA 1KV1A 4EONA 2XIKA 2JAMA 5M55A 4DGGA 5DLSA 4OTGA 4J7BA 4NTSA 3BE9A 2I0EA 2CDZA 3VN9A 5AWMA 4E4NA 3B2WA 3FXXA 2IPXA 2F57A 5CF5A 3VUKA 3DK3A 1OL6A 1YXSA 3DTCA 2QOFA 1QPDA 2ITVA 2X6EA 1P14A 3RINA 3HL7A 5JFWA 4Y8DA 4F6SA 3A7HA 3QQJA 1PHKA 3QRJA 3HLLA 3Q9ZA 2YFXA 4RWIA 2XNOA 2HW7A 5AR7A 4O22A 2VTAA 3Q52A 3TJCA 4D4RA 3UQFA 4ASDA 1P4FA 3HV3A 4DT8A 3O7LD 4L68A 3IONA 3BU5A 5H3QA 3VUIA 4UN0C 1DS5A 5BUIA 3PDTA 4BR3A 3Q4ZA 4P90A 4M13A 4KAOA 1OUKA 4LL5A 3SW4A 4I22A 3NYOA 3VULA 4BF2A 2C69A 3SD0A 3PZHA 1K9AA 3NUYA 2CKEA 4MBIA 4OAVB 4ZZMA 2XBAA 2CHLA 2XEZA 1PXNA 3MVHA 4L9IA 4IDVA 5BVFA 4FK3A 5KBQA 3RNIA 2PMIA 5I3RA 4CZUA 3EKKA 4E7WA 5A6OA 3C4XA 4BRXA 5IMEA 3LQ3A 5CANA 3WF7A 4HGEA 2YZAA 4C57A 4X3FA 3ZDUA 1OGUA 3GFEA 2JKQA 3FMLA 4S2ZA 5AP0A 3F66A 3FAAA 4LI5A 4OAUC 4S33A 4L45A 4FV5A 5CX9A 3E92A 4HYSA 3ZO3A 4FVPA 3VJNA 4M68A 1UNHA 3RBWA 3WIKA 4NCTA 2BALA 1GOLA 3VBVA 3L8XA 3T8OA 4F0FA 2QG7A 2R4BA 3ITZA 4KS8A 4O2ZA 4RT7A 2A2AA 1XH4A 3HUBA 4PF4A 5C03A 3NNWA 4RJ3A 2GMXA 3R7EA 3Q4UA 3VUTA 2W9ZB 3A7IA 3F82A 3PRIA 3FSFA 4DEEA 1KOAA 2VTMA 5AV1A 2YM6A 3GCQA 2HIWA 2CGUA 3F3WA 3U4WA 4YTFA 3ZFYA 4RLLA 4YZ9A 1WZYA 4Y5HA 3R2BA 5FTOA 2JIVA 5HE0A 2QU5A 3S2PA 1NVSA 3FSKA 4BDIA 3W2CA 5L2SA 2ITTA 3FMKA 3MFUA 2UW7A 3ZCLA 4IBMA 1GIIA 1Q3WA 4FC0A 4CFXA 3KQ7A 4FIIA 4DH3A 2V22A 5EDPA 3F5UA 3LCKA 5FP5A 4G6OA 4HCVA 4EOIA 2WMBA 4ITIA 2ONLC 2BKZA 3HRFA 2X7OA 2GNFA 4IB0A 4TY1A 2W1IA 4BHZA 2CKQA 5IQAA 2W4OA 1FVTA 2O5KA 3QD4A 3LMIA 4A06A 1ZOHA 2QOOA 5TO8A 1J3HA 2ZB1A 5ETAA 1O6KA 1YHWA 4PMSA 1WBSA 5HGIA 5IA4A 2VWYA 3LXNA 1OIUA 3F3VA 3OG7A 3UPXA 5AAEA 4GCJA 4EZ7A 2CNUA 3CBLA 2CMWA 4HCUA 5HIEA 3LHJA 3ORXA 4FSYA 3D2IA 3O96A 3HDNA 3P78A 4L3JA 2PVNA 5CEKA 3P86A 3QRTA 5ANIA 3NNXA 3O17A 5E9EA 3P79A 3PA4A 3SC1A 5JGBA 5CWZA 3W2PA 4UX9A 4O6EA 5EQEA 3BCEA 5ACBC 3U9NA 3C4EA 5I9UA 4ACCA 3I0QA 4XP0A 3NRMA 4PPBA 4AA4A 1W83A 2UZBA 2QKWB 3R73A 2OSCA 4X2FA 1URWA 4E26A 4NT4A 3VS7A 3RTPA 2QHNA 2UW8A 5IQDA 2OIBA 3A7GA 1FBNA 5J1VA 2BILB 5CXZA 3F3TA 2PVRA 4TWPA 1UVRA 1YI6A 2X39A 3RKBA 3HV4A 5FM2A 3T3UA 3UPZA 3N4UA 3F5GA 4AU8A 4RZWA 1GAGA 3EQBA 4K11A 3RCJA 4USEA 4XCUA 4EEVA 2VN9A 4MH7A 4OTQA 4RJ8A 4U7ZA 4IWQA 2I6LA 3QYZA 4D1SA 4F9BA 5IMXA 4L3LA 3VQUA 4AOIA 2CKOA 4LYNA 4WA9A 5LXMA 3AC2A 3K2LA 4TYEA 4O7LA 2YIRA 4GUEA 1OBGA 4W4XA 4DH8A 4YPSA 5AUTA 3TTIA 5E1EA 2OIQA 4QMPA 5FRIA 4HGLA 1Q97A 2J7TA 2YJRA 4BYJA 4CLIA 2VWUA 5FLFA 3EIDA 2XYUA 3WF5A 5TE0A 3RVGA 2ZMDA 3CY2A 3G5DA 4G3DA 3Q4TA 3FZTA 3GGFA 3HGKA 3I60A 4J95A 3MH0A 5E8UA 4EOPA 4WRSA 2GFSA 2Q0NA 4GJ3A 1XR1A 2VTPA 4FZ6A 3QQUA 4CFVA 2QR7A 5AR4A 3V8SA 4OBQA 4IAKA 5B7VA 2WB8A 1PKDA 2NP8A 4FNWA 3RK5A 2HXQA 4I0SA 2JDRA 5E4HA 2C30A 5CTPA 5A4CA 4LGHA 4ZTQA 4JIKA 4FKVA 4DGMA 5H8EA 4RWJA 3QZIA 1XBBA 2YERA 4DG2E 3DXPA 1OPLA 4KIKB 3FLNC 4QP3A 4O82A 1Y6BA 2AYPA 4ZSGA 4L3PA 3DXNA 4OR5A 3ZUUA 2R3HA 4ZK5A 4EOSA 4OTWA 2OICA 2QLUA 3ENHA 3MVJA 3QUEA 3RHXA 5I9WA 1IAHA 3NLBA 5CAPA 2REIA 4DHFA 3BYSA 3DZQA 3BV2A 4D2RA 1APME 3DY7A 3VO3A 4JBVA 4A9TA 4B4LA 4JDJA 4F6UA 1FOTA 4JL9A 2RKUA 3ALOA 4O1OA 2DWBA 3RAHA 4YJPA 3NW7A 2RG5A 3NGAA 4EORA 3TDVA 5JRQA 2HELA 5BVDA 3KF7A 3QQKA 4AP7A 5M07A 3R9NA 3LCSA 4RC2A 3JUHA 4QTDA 3GCPA 4ZJVA 1STCE 3LPBA 4PX6A 5HCZA 5IISA 2UW6A 4EBWA 3HKOA 3L9LA 4BCIA 3NR9A 5KHXA 2O64A 3A7JA 4RJ7A 3T3VA 3SVVA 2OK1A 2FH9A 3VS0A 4U81A 4H3BA 4H1JA 1J91A 2B52A 4JDKA 4KA3A 2X9FA 4WOVA 3SLSA 3HX4A 4XG6A 3ERKA 5CYIA 3TNWA 4JRNA 4CD0A 4CT1A 4TZRA 3OROA 5DOSA 3FQHA 4BCNA 3FI3A 2IZSA 2GTNA 2GPHA 3ZBFA 4BDHA 3BYOA 5F95A 4I6QA 3KULA 4C37A 3PIZA 4G16A 4N4SA 1PJKA 2LAVA 2PMOX 2ZAZA 4RA5A 4FIFA 1Y57A 3LFFA 2XRWA 3OBJA 2FA2A 2OH4A 3H3CA 3BWJA 3ZTXA 3OXTA 5LVPA 4ZEGA 3L9NA 4R1YA 5EYMA 2CCHA 4K1BA 4AN9A 3MPTA 5GJDA 2BIKB 2F4JA 4WUNA 2F2CB 3OFMA 4NH1A 5A46A 4C3RA 2BTRA 3QCQA 4BCJA 3ORKA 4PL3A 2NPQA 3KXNA 2PK9A 4D5HA 4W8EA 4D2WA 3D5UA 4O0RA 5DEWA 3KXZA 4BDGA 3ZO4A 3DS6A 3QQHA 3FZ1A 4RIWA 3HP5A 4MBJA 4I5CA 5HICA 3P7AA 5FGKA 4XS2A 4A9UA 2B54A 2HZ4A 2VTNA 3HEGA 5AMNA 1J7LA 4CV8A 2QI8A 2C6MA 4M7IA 2GFCA 5J9YA 4RRVA 3CJFA 3ZRMA 3TIYA 2OKRA 2RGPA 3BX5A 4LMNA 2OJ9A 1QPJA 3SV0A 4UMRA 2IZTA 1Q5KA 4GFMA 3GC7A 4W4WA 3RPSA 3E3PA 2KULA 2UZUE 3RWQA 4IJPA 3W55A 4C33A 1TQMA 1W82A 2NNWB 2YM7A 1KE5A 4I92A 2BZKB 3PJ1A 1GNGA 1WBNA 1Y8YA 4O96A 4BDBA 3QTRA 5DR2A 3POZA 2ITQA 2WU7A 3GVUA 3G0FA 5DG5A 4YJOA 3E3BX 5IH4A 3R83A 5FTQA 1H1WA 3LZBA 3V6RA 2UW0A 3NEWA 4AF3A 3QTSA 1QPCA 5IEYA 3DCVA 5LQFA 4X2JA 2XIXA 3ZC6A 2ZOQA 4CVAA 3FV8A 3ORZA 4MQ2A 3RAWA 4BKJA 5IQHA 2ZV7A 4D28A 3VBWA 1FVVA 2GNGA 4FKOA 3W1FA 5HU3A 2WMXA 4FTTA 4QMZA 2CJMA 2BPMA 4PL5A 1URCA 3RHKA 3TCPA 4CFFA 2C5OA 2QO9A 4L44A 2ZDUA 4MXYA 4CFNA 3BYMA 5LMKC 3R6XA 1OL7A 4IMYA 3NMUF 3GOPA 4X6QC 4MXAA 4O7NA 3NIZA 4IANA 3LJ2A 5FM3A 4G6LA 3KCKA 3KMUA 3KY2A 3QTWA 5J9LA 4ZS4A 4V0GB 3TKIA 3PA3A 3FUPA 4RGJA 4J96A 2B1PA 1H1RA 3EQCA 2CSNA 3FLSA 3NPCA 3JVRA 4IWPA 4O38A 3MY1A 3WE4A 2ERZE 3LQ8A 3PYYA 3LQ5A 3LFQA 4E6AA 1OBDA 4I20A 2YCSA 4MXZA 3TN8A 2GNHA 2PE1A 5D7AA 2ITNA 4C4JA 4C7TA 2QC6A 2RFNA 3P08A 4YHJA 1OL2A 5EM8A 1WCCA 3LMGA 5FWKK 2ZV2A 1H07A 2FSLX 3H30A 4YSJA 4UB7A 4XH6A 3IOKA 4GVJA 4D2SA 4F7LA 4JVGA 3B8QA 4AFEA 2PUNA 4IX5A 4J8NA 5E8SA 5EQYA 2O0UA 1UWJA 5FDXA 5J5SA 2VWWA 4IXPA 1DAWA 3AGLA 2VTHA 4ANOA 4WBBB 3OUKA 4I21A 4CT2A 3LLAA 2B4SB 3V8TA 3SXSA 2EXCX 2GNIA 4IFGA 4FR4A 4ITJA 5EHLA 5EM6A 3CPBA 5HQ0A 5K5XA 3QLFA 4E4MA 1R78A 4BWKA 5ICPA 1UA2A 4QP2A 4M69B 4XX9A 4I0TA 4XG3A 4MAOA 3O0GA 4EH8A 3P7BA 4QPSA 3Q6WA 3QRUA 4OT6A 4BCGA 1IEPA 4MWIA 3ANQA 4LG4A 3LE6A 2VTJA 3LOKA 5E8XA 5EYKA 2Y8OA 5KUPA 4UZHA 3EJ1A 3KMMA 3MGYA 4JS8A 4FV6A 1IG1A 4BGGA 3HDMA 3C1XA 4KKHA 4QMNA 1SVEA 3IECA 4K8AA 3S1HA 2HK5A 2QCSA 2YM8A 4J99A 4XEYA 5CAVA 3UNJA 3MIYA 4DFXE 4YURA 4MXXA 4K33A 4YBJA 5HNIX 4MXCA 4GKIA 5AV4A 3JY9A 1H01A 1GJOA 3EWHA 3FC1X 2WOTA 3LM5A 2HENA 3NCZA 4I5MA 4E5BA 4YGAA 4XYFA 4NSTA 4FEVA 2BCJA 2E9UA 5HD7A 5GNKA 4JLCA 4CRLA 1Q61A 3PIYA 4FSWA 1UKIA 3F7WA 2XNBA 3LFCA 2OFUA 3DPKA 3IW4A 4W9XA 5JZJA 1H1PA 5DT0A 2C6EA 2P2IA 4CSVA 1FVRA 2Z7QA 2J90A 2JBPA 1KE8A 2WTKB 2NRYA 2R3IA 3MH2A 4ANSA 5HZNA 4BY9E 1QL6A 4GT4A 2WHBA 4L46A 3VS1A 1OB3A 3CSVA 4IB1A 2R3LA 2A4LA 3C9WA 1PMUA 4NZWB 5EKOA 5BYZA 1OL1A 3ZLWA 4CYIA 5HTBA 4PMTA 4JR7A 4FKQA 1H26A 2BTSA 2W1FA 3DNEA 2JKMA 5GIPE 2XK7A 4JT3A 4E5AX 3ZO2A 1H25A 3DZOA 3CXWA 4IVDA 4TYHA 5T3QA 1GZNA 3AGMA 4FKSA 5AP4A 5DI1A 3C51A 2W5BA 1YVJA 1U54A 2B0QA 4JG8A 5ETFA 4U3YA 2G2IA 5ANDA 3KRWA 4RVLA 4EKLA 3PG3A 1S9JA 1JSUA 4QMVA 5HE2A 4ENXA 3KRXA 2BRMA 4AOTA 4DINA 4IE9A 3AQVA 4F0IA 4AAAA 3KC3A 3GCSA 3HNGA 4QMUA 2JDOA 3F2NA 4P2KA 3NX8A 4AZWA 4QMYA 4XOZA 3OT3A 3AOXA 3H9FA 3EMGA 2RFDA 4FF8A 2GU8A 2W5HA 4N6ZA 4BCHA 5CU6A 2UW5A 3E8DA 5LWNA 4F70A 4D0WA 3PSDA 4XUFA 4I23A 3W8LA 4MK0A 2G9XA 2Y7JA 4Y95A 3KXGA 5IA3A 4CG9A 3UC3A 5AM6A 3CQUA 3PSCA 1M52A 3OF0A 2WTKC 4A07A 4HYHA 5M44A 2GHLA 4DEDA 1LUFA 3H9RA 4R7HA 3OZ6A 4JBQA 5IEXA 3PVBA 5CEOA 3G90X 3COHA 4PP7A 3BE2A 1H27A 5HG5A 3RAIA 3TZ8A 2WU6A 3IDCA 4E6CA 5EOBA 4C35A 3OY3A 3PWYA 4F1MA 3KEXA 3F2RA 3KMWA 2QKRA 2E9VA 1Q8UA 3QLGA 4IDTA 4D4VA 4FV9A 4CXAA 4OTDA 1WFCA 4YJQA 1VR2A 4C3FA 4AX8A 2C5XA 3QGWA 4G34A 3PFQA 4FL3A 3UO4A 3GU8A 4CYJA 4YLKA 5AUYA 4FV7A 4FVRA 1IRKA 4AUAA 4DG0E 2PMNX 3EL8A 5HEZA 3V3VA 5CALA 3UZPA 3TNQB 4C36A 4FZDB 2PVMA 1XO2B 4MQ1A 1DI8A 1CDKA 3GQIA 4IVAA 4I4EA 2I0HA 2WQEA 2YZLA 4GS6A 1IASA 3COIA 4MTAA 4D1ZA 2BR1A 3VF9A 1F5QA 1U5QA 2OO8X 1U59A 3EN9A 4K0YA 4YC3A 5C27A 3S00A 3OOGA 3SDJA 3EB0A 3HV6A 2C6IA 3D2KA 3ZBXA 3MTLA 4DEIA 4DFNA 4C4FA 5B2LA 3EYGA 2GQSA 2BDJA 4QD6A 2GQRA 5GZAA 2QR8A 4B8MA 1JNKA 4QQTA 1JPAA 3PPKA 4N70A 3ZYAA 4HOKA 4UZDA 4X0MA 1PF8A 4C2WA 1TVOA 3II5A 4YHTA 3UE4A 1QMZA 5L6WL 4Z3VA 2UW4A 5IA2A 2Z7RA 4AN2A 4C4IA 2UVYA 2JDSA 2G2FA 4FV3A 4K6ZA 4TTHB 2PZ5A 1FINA 2WQOA 4YJSA 4C58A 3BLHA 4UYNA 1CMKE 3POOA 5EOLA 2ITXA 3FKOA 5KMLA 3FEGA 5KKRB 4KRCA 4R77A 2XYNA 4IVCA 2F7ZE 4NW6A 2C3KA 5AUVA 2CCIA 3SHEA 2IZRA 3A62A 3FMHA 4C38A 1NY3A 3DBDA 4WNOA 2WQMA 3DJ6A 4FE2A 3DKOA 2ETRA 2B9IA 2CKPA 5ETIA 2A1AB 2W96B 4X2GA 2Q0BA 2R3JA 4XG9A 1YXVA 2XP2A 4YHFA 4FSRA 1UWHA 4IC8A 5F4NA 1H0WA 3EN7A 2PVKA 3QKMA 1Q4LA 4BGHA 4DLJA 2XCHA 2QO7A 2ZVAA 4O0XA 2CNQA 1JQHA 1ZYDA 3G33A 5D9HA 3VW6A 4FZFB 5E8VA 3OTUA 4BBEA 4NIFA 4WG3A 4BDJA 4U80A 5IUHA 3ORIA 4V05A 3NAXA 3R1NA 4FTIA 5EK7A 2H8HA 4ZTRA 3TZMA 4MYGA 4FNXA 3UOHA 3ZOSA 4XNEA 3P23A 3QCYA 4BFMA 3UGCA 4O0TA 3GBZA 1SZMA 4QQCA 2DQ7X 5AR5A 4F1OA 4CRSA 1MUOA 4JQ8A 1UU9A 4U97A 4DFZE 3VVHA 2Y6OA 4PL4A 5BVNA 2PMLX 1T45A 1HOWA 3RNYA 2XJ0A 4M12A 5JFVA 5KKRC 5IQBA 1Q99A 3KK8A 4IAZA 2I0VA 4RSSA 3PXZA 5EYDA 3C50A 2W99B 4QP6A 2C6OA 2F7EE 3PJ2A 2E2BA 4FZ7A 2DYLA 5M53A 2G2HA 4CMOA 4Y83A 5JGDA 4LGDA 4CV9A 5M4CA 2XNPA 3BGQA 3ZLSA 2C3IB 3PE2A 4FKGA 5IU2A 5HX8A 1BYGA 1PY5A 2QURA 3DDQA 3KFAA 4MEDA 2XKCA 3BEAA 1H24A 2X2KA 2YCFA 3EQIA 4FG8A 4KB8A 1Q41A 2YJSA 2OU7A 3I1AA 1M17A 2QOBA 5L6OA 2VTTA 1ZZ2A 2OZOA 3FPMA 5B2KA 3TNHA 3QXOA 4RWLA 4O21A 3R63A 4XG7A 5HORA 3GCVA 3P1AA 4EQMA 2H6DA 5L2WA 2UZVA 3D5XA 5L2IA 5CAUA 2UVZA 4LL0A 2JKKA 5J87A 2XKEA 2E9OA 4J52A 3E7OA 5GZ8A 2O65A 2QOKA 4U41A 4ZIMA 3R7YA 4DF3A 2WMQA 2R3MA 4JBOA 4UV0A 3VHEA 4IHPA 5FXSA 2CPKE 3DK7A 5H8BA 4NCTC 3U87A 5ANJA 1A9UA 4S31A 1W8CA 4H36A 3FJQE 4C62A 3FXWA 3HRBA 2PWLA 4JG6A 4K18A 2VWXA 4MD9E 4YJUA 3ZONA 4A9SA 4BN1A 3ZRLA 4ZMFA 2VWVA 1HCKA 3ZXTA 2VX0A 3QCSA 1P5EA 4E1ZA 5JEBA 4PP9A 4DG3E 4DITA 4ARKA 4OT5A 4F7NA 5HTCA 3MDYA 4H05A 3TL8A 3SXRA 3R9OA 2J9MA 5JZNA 3VQHA 2QD9A 2VTQA 5DIAA 4I0RA 1BMKA 3DU8A 1M7NA 5HBJA 2GS7A 3P7CA 5I9ZA 5CSXA 3QUDA 2QQ7A 1ZAOA 2CGVA 2BDFA 4I3ZA 3JXWA 5CI6A 5AV3A 3BGZA 2HYYA 3SRVA 4FV2A 1PXMA 4JJRA 5IKWA 5L8JA 5J5TA 2IVTA 4EK8A 4F9AA 2J0IA 2UW3A 2WFYA 4NKAA 4S32A 3HMOA 3TUBA 2P2HA 1ZMVA 2XUUA 3Q9WA 4PPCA 4KIQA 3UG2A 1E1VA 4FIGA 3GB2A 3ORMA 5DEYA 3QZGA 2PZRA 2XH5A 3D83A 5DN3A 1H8FA 2PSQA 4A9YA 5I9XA 1W7HA 2PYWA 3QTXA 5KBRA 5DPVA 4MF1A 3TG1A 2JIIA 2XM8A 5HVJA 5LCJA 3EHAA 4LOOA 3FMDA 3BHTA 3ROCA 4WIHA 4DH7A 3PSBA 3RP9A 4ZP5A 1RW8A 2BRNA 2YIWA 3CLYA 4BZNA 3NCGA 4ONAA 3Q96A 2WTJA 1ZOEA 2Z2WA 3B8RA 4I5HA 5EG3A 2AC5A 2QOIA 4RFZA 5ITAA 4CKJA 2HZNA 3OWLA 2X4ZA 4IZAA 1Q8TA 4OW8A 1OKZA 4KBKA 4O0VA 4EH9A 2W4KA 3E88A 4IB5A 4NJ3A 3KRLA 2FUMA 5CZHA 4IZYA 3LCTA 4YMJA 3DBQA 4G2FA 5I5ZA 4R7BA 2RFSA 5H9BA 4YLLA 3H9OA 4EYMA 3KREA 3DKCA 3EN5A 3C4ZA 4C4GA 3UOJA 3SOCA 3UVRA 2VTLA 2FO0A 3QXPA 3LFNA 3R7VA 5DR6A 5HVYA 4BBMA 2XJ2A 5TOZA 4AACA 3GP0A 2ETMA 3SA0A 3BYVA 2JLDA 4D4YA 1LEZA 2JFLA 2UZWE 4F9CA 1PYEA 5A4LA 2P33A 4GG5A 2B55A 2O8YA 2XB7A 5ANKA 2IJMA 2R3GA 2OGVA 4KSPA 4XG4A 5IH6A 2PE2A 3I5ZA 4NKSA 5EDQA 3WF8A 5GIOE 2F49A 4E93A 2E9PA 4M66A 5H2UA 5E8WA 4ZJIA 4W9WA 4F63A 5KMJA 2IW8A 1I44A 1Y8GA 5HESA 3PA5A 3CPCA 3KXXA 2GS2A 4RJ6A 3AMBA 4YJTA 2JIUA 5LVNA 1LR4A 2R3PA 2YITA 4MCVA 5AAFA 3N4TA 4EUTA 4BVUA 4FNZA 4FTCA 3HUCA 1NW1A 4YUQA 2CGWA 1ZYSA 5GINE 4RJ5A 2X2LA 5JH6A 3QA8A 2CN5A 4XG8A 3V5PA 4AZEA 4GU6A 4TYIA 3DNDA 1OI9A 3GU6A 3ZFXA 3UMWA 4ANNA 4BCMA 1NVQA 5FD2A 4EH3A 1Q8YA 4YTCA 5IH5A 2WELA 3D94A 4GU9A 5M51A 3WE8A 1MQBA 3DKGA 4UXQA 4CMUA 1JWHA 3NVMB 1YDTE 2YCQA 3CQWA 3M1SA 4FV0A 4X7QA 3EN6A 5HE1A 2VUWA 4UEUA 1BL6A 1OIRA 1ZXEA 2R7IA 4AA0A 4CEGA 3RZFA 5A14A 5C8KA 3PPZA 2QOQA 5AIKA 2V62A 5CXHA 3CQEA 3FHRA 4KBCA 3R01A 5CF8A 4FICA 5L8KA 4MF0A 3DQWA 5D12A 1H1QA 1H1SA 4UMTA 4FK6A 4U5JA 5K5NA 5AX9A 1ZY4A 2ONLA 3PP0A 4EJNA 3MYGA 3DFAA 5M56A 4RIWB 1NA7A 3OVVA 4GL9A 4FEQA 4O2PA 2QOLA 3QRKA 2XKFA 2YM3A 3LLTA 4FUXA 2C5YA 4L7FA 4AN3A 3D14A 5M4IA 3ZS5A 3OD6X 4B99A 2OIDA 5DT4A 5DMZA 4FV8A 4X2NA 5F94A 5HCYA 2VD5A 3UP7A 4ALUA 5JQ5A 4A4LA 4ZTHA 2GSFA 2C3JA 3GEQA 2BFYA 2JC6A 3D5WA 4DC2A 4O0SA 4H39A 2WQNA 4XP3A 3TJDA 5HTIA 3CEKA 3L8VA 1KOBA 3GENA 3B2TA 4FKTA 4IJ9A 4AQCA 4BCKA 2YABA 3VS2A 3ZHPC 2OJIA 3BEGA 3IO7A 4OTRA 5BVWA 3A4PA 4E73A 2JITA 4EL9A 5K0XA 2YISA 4RBLA 4RX7A 4WRGA 5C1QB 3GXLA 4I1ZA 1E1XA 3AXWA 3MS9A 3LAUA 3CE3A 2I0YA 2FYSA 1WVXA 2GHGA 3DOGA 3OHTA 4IX6A 4AE6A 4B6LA 4EK4A 3KA0A 4TYGA 2BMCA 2WEVA 2EB2A 5BMMA 3E64A 4W4YA 3FI8A 3K3JA 3TV6A 5AIRA 3AC4A 2VWBA 3DFCB 5C4LA 3PXRA 2BRBA 5M09A 2YHVA 2QG5A 4PTGA 4YJVA 2R5TA 2F2UA 3L9MA 2OF2A 3EN4A 4F09A 4BDAA 1Y91A 4FYOA 5DA3A 2BIYA 1OECA 5HD4A 3LW0A 4XV9A 4Q5EA 5LCKA 4JX7A 2VO3A 2VU3A 1YHVA 3LXLA 3VNTA 3HZTA 1JKTA 5AV0A 2B7AA 5G1XA 4FV4A 3VUGA 3FMEA 4KIOA 4BCQA 3H0YA 3WIGA 1PXLA 1RDQE 5BX0A 4L52A 1JLUE 3JYAA 3WILA 3FLZA 1M14A 4EKKA 4DCAA 4M3QA 5HO8A 3BELA 2IVSA 4NM0A 3TTJA 4BTMA 4FSMA 1WVWA 2R3KA 3O8TA 4P4CA 4YTHA 1U5RA 2Z7LA 3OOMA 3AC8A 2GTMA 1JBPE 4J8MA 4F0GA 3ALNA 1CKIA 4RG0A 3FL5A 5EHYA 2PVLA 3I79A 3FPQA 2ITUA 3ELJA 3OCTA 3Q60A 3R7GA 4HVHA 4ASEA 3BQCA 5CVGA 1PMEA 1PXOA 2ZM1A 3A2CA 4KIPA 1UV5A 3UIBA 3UVQA 2VNYA 3PY1A 4HW7A 3I7BA 3ZRKA 3CD8A 3PRFA 5CEIA 4BL1A 5I9VA 5FQDC 3G0EA 3W10A 3FKNA 1LPUA 3F2AA 4FT3A 2YWVA 1OM1A 4XRJA 4F99A 3R04A 5B0XA 2W1DA 3M11A 5A4QA 4BDKA 2W05A 1B39A 5A4TA 3S95A 1Q8ZA 4DTBA 2BZJA 2WIHA 4L8MA 3C4WA 4FODA 2EXMA 4H1MA 5TF9A 3RWPA 4DEAA 3MVLA 3ANRA 4IEBA 5IA0A 5CNOA 2XA4A 2PVJA 3D5VA 3R9HA 5EW9A 4EHEA 2G1TA 5HLWA 4O0UA 3RPRA 1G3NA 5A3XA 3TT0A 4I93A 3ET7A 2JAVA 4FKRA 1XH7A 4QNYA 3GFWA 4WNMA 4RA4A 1YWRA 4EH7A 3PVWA 4O81A 4HCTA 3UBDA 2XK4A 2V7AA 1JVPP 4H3QA 5KZ0A 3DK6A 2IZUA 4FTQA 4M0ZA 3UC4A 3GC8A 5AUUA 1J7IA 3RAKA 2QNJA 4ALVA 4PNKA 1J1BA 2C6KA 4OGRA 4ZXTA 3GUBA 1KUTA 4DBXA 5C9CA 2JEDA 5HO7A 5I3OA 2G15A 4A4XA 1UU3A 4HGSA 3E5AA 5IA5A 4ZZOA 2BAKA 3I6UA 4YJNA 2UVXA 2X81A 3GC0A 3MY5A 3FMJA 4JG7A 4WSYA 4ORKA 4OTFA 3BHHA 3LFAA 5CZIA 4ZLZA 1KE6A 4TNDA 3DGKA 3R7IA 3KL8A 4LQMA 1M2PA 4YPDA 4HYIA 1QCFA 4L01A 3BLQA 4FGRA 3MI9A 5BVOA 3EQRA 4FUYA 2FB8A 5GJFA 3UVPA 1H4LA 4BB4A 4USFA 4S30A 4CCUA 3U9CA 5D41A 5K4IA 2HAKA 3R8LA 4CFMA 4CKIA 2VO0A 3VS5A 3NNVA 4FT9A 4YZBA 5D1JA 4BDDA 4DA5A 1SNXA 4FSNA 4AT3A 5AR3A 3EQFA 4LRJA 5KMIA 2W0JA 4D9UA 5E8ZA 2EU9A 3F6XA 3CTJA 2C4GA 3G51A 4MNEB 4YZCA 3V5QA 3ZUVA 5IQEA 3O51A 4MD8E 4B7TA 3EFJA 1ZRZA 5FDPA 4O6LA 3L9PA 3WF9A 4ACHA 2ZM4A 3EL7A 3NYVA 3FY0A 2PVFA 5CEPA 4ZLYA 3Q9XA 2YWPA 4J97A 5AUXA 3DJ5A 1CKPA 3IS5A 3SXFA 4YTIA 3I0OA 3UODA 3W32A 5FXQA 3R8VA 1O6LA 4FKPA 3R0TA 3LVPA 3QAME 3VF8A 4YNOA 2F9GA 4AOJA 4XV2A 3QWKA 2VTSA 3TKHA 5L4QA 5DE2A 3PXYA 5ANOA 5HVKA 2YAAA 3R28A 3NYNA 3ZEPA 3ZXZA 3CIKA 3A7FA 3QTZA 4O7VA 3KRJA 3RM7A 1V1KA 3DXQA 5L3AA 4RIYB 5K3YA 4AG8A 4BKYA 3D7TB 4YP8A 5KMKA 2YIYA 5FBNC 3NVKI 4OTIA 3TI1A 3S3IA 1B6CB 3A4OX 5EW8A 1BKXA 3W18A 2YACA 4F6WA 4HZRA 4EH2A 4KBAA 4A9RA 4FT7A 4JDHA 1TKIA 3LFBA 3H10A 3BQRA 3PP1A 4XLIA 4AGDA 3CC6A 2XK6A 1YQJA 4GG7A 4U79A 5AA8A 1R0PA 5EDRA 3ZC5A 4IX4A 4TN6A 3EH9A 4CLJA 4IAFA 2VAGA 5AJQA 4O7RA 3BPRA 4AZTA 4R8QA 5E7RA 4XHKB 2PHKA 4FV1A 3ULZA 1UU8A 2PVYA 3K54A 4FTUA 4PDOA 4QO9A 5LMKA 1YDRE 3R8MA 4FI1A 4I94A 4TW9A 1ZMWA 3Q53A 4YC6A 1OMWA 4ID7A 2C0OA 5E91A 1XQZA 4FZAB 3AD4A 4Q2AA 4FYNA 2BDWA 3L8PA 4IW0A 2WTDA 5HNGA 3OXIA 3QQLA 3PY0A 4B9DA 1MRUA 3H0ZA 5JQ8A 4IAAA 3ZFMA 5GZ9A 5CNNA 1QPEA 4O7WA 4FSUA 5DT3A 3NW5A 3THBA 5F9EA 1JSVA 4X21A 2QU6A 1UKHA 4HJOA 4BWPA 4DFBA 1FPUA 5LVLA 3PPJA 3G6GA 4ZY4A 3NIEA 5CEMA 3HA6A 4YNEA 3QGYA 4EK6A 2P0CA 3SOAA 2PPQA 5IA1A 2QOCA 4Y5QA 3ZZWA 1PMVA 2XMYA 3ACKA 3KKVA 3P5KA 4L6QA 4MD7E 1PYXA 4RVKA 2P3GX 3HP2A 3SAYA 4LMUA 4UY9A 4EC9A 4QMWA 4F4PA 4PMPA 3A61A 2W9FB 5IQGA 3QL8A 4BIBA 5AR2A 1DM2A 1W98A 1WMKA 3QKKA 3MW1A 4UMUA 4FIJA 4GEOA 4BCFA 4E4XA 5BMSA 4ZJJA 4QP9A 5TR6A 4BZOA 1H0VA 2GS6A 3ZH8A 4Y46A 4AFJA 1ZYLA 1OVEA 3ORLA 3Q5ZA 1YHSA 5HLPA 3FXZA 4YR8A 4RVTA 4IVBA 4BIEA 5FP6A 2XNMA 4II5A 5J9ZA 1O6YA 5HI2A 3NSZA 4V0GA 1XHAA 2OFVA 3BZ3A 3SKCA 3GOKA 2OXXA 2FSTX 3HV7A 3ODZX 3R1YA 5ANEA 4BGQA 3LKMA 3UOLA 5I9YA 2HWOA 3QC9A 2F7XE 3O2MA 3I81A 4NIFB 4OTHA 4C8BA 5CAOA 3U54A 2HW6A 4XRLA 3LXKA 4CZYB 4YSMA 3P9JA 4HNIA 4HYUA 3VW8A 5J79A 5FXRA 2Y4PA 3PXKA 2YIXA 4R78A 2XNGA 4ZTSA 2X8EA 2XF0A 4G6NA 4YO6A 4RIXA 4EK3A 3FY2A 3N51A 4FKJA 4GFOA 2H9VA 4RMZA 5AX3A 4GV1A 5M08A 2WNTA 5AP6A 5CU0A 3LMHA 2C3LA 3IGOA 2XK9A 3FZOA 3UZTA 4W8DA 5E8YA 4TPTA 3DBEA 5FEEA 3UYSA 3W2QA 4PY1A 4P5ZA 4ENYA 4DH5A 2WZJA 3PY3A 3F3ZA 5HOAA 2GDOA 2JDTA 3HMIA 4EHZA 2IW6A 4KWPA 2PUPA 4MX9A 4EH4A 4DEHA 4USDA 2A27A 4I24A 3OW4A 1YXXA 5TKDA 4M69A 5EI8A 2WQBA 5AV2A 2R2PA 3NUUA 5CVHA 3RJCA 5E92A 1P2AA 3QCXA 3VRYA 4AW0A 3ZZEA 3HRCA 3QX4A 2PY3A 1Z9XA 4LOQA 2YLEA 4QYYA 3E93A 4E5WA 4CGAA 3FZSA 3O7LB 3DTWA 3OEFX 1FGIA 3EQHA 4GH2A 2WIPA 4Y72A 3O8PA 3WZKA 2J0LA 2WTCA 4NM3A 2Z60A 1OPKA 2O63A 4UMPA 5CU4A 5LVOA 3OS3A 3OWPA 1YOJA 2CLQA 3CKXA 4TWOA 4U45A 4O1PA 4FVQA 3MN3A 4KRDA 4OBPA 4MVFA 3TUDA 2WEIA 4DBNA 3QZFA 3RCDA 3FZRA 5CSVA 4D9TA 3EKNA 2YN8A 3QWJA 4EWQA 4AGWA 3R02A 4EC8A 3QF9A 3GC9A 3MPMA 3N9XA 3W2RA 3KN6A 2AC3A 1Z5MA 2C5VA 5CENA 4Z7HA 2ITYA 2WKMA 5ANGA 4XBRA 4EOKA 5B2MA 4X3JA 4ASZA 4QTEA 4QMSA 5IF1A 5CY3A 1OL5A 1KSWA 3QD2B 4RC4A 4XP2A 2GHMA 1MRYA 3REPA 3AMYA 5L2QA 3DJ7A 1NVRA 2EB3A 4LGGA 5DBXA 3EZVA 4RX9A 3R7UA 4APCA 3C13A 3CR0A 2JKOA 3GI3A 3FWQA 4QOXA 4DTKA 1L3RE 2Z02A 4O7YA 1PXKA 4WG5A 4LV8A 2VRXA 4Y85A 1OUYA 3WZDA 1PXJA 1XBCA 4FKIA 3WBLA 4IM2A 3SRVB 3CTHA 4C3PA 3ZSIA 4RWKA 2EWAA 3OC1A 1Y6AA 2VWZA 4RX5A 3NUNA 2XCKA 3BU3A 3DLSA 4N0SA 4X3FB 4GSBA 4NTTA 4ZAUA 5HX6A 3FI2A 4NFMA 2YAKA 2V0DA 4LV5A 1BL7A 2R0UA 3FZPA 3MWUA 4ANQA 3OXZA 3AG9A 4WNKA 2JGZA 3PVGA 5IEVA 3BV3A 4DEBA 2JBOA 3ZSGA 5F20A 2ITOA 3HV5A 1YI3A 3IKAA 3UYTA 3PTGA 2C6LA 3WOWA 3T9TA 5AUZA 4NJDA 3V01A 3AD6A 2YDIA 2WGJA 4D4SA 1WBWA 1G8AA 2XBJA 4BDCA 4ALWA 1J1CA 3W33A 3FMMA 4IACA 3AC5A 3H4JA 3LFEA 4YZMA 3CKWA 5HIDA 3V5WA 4ERWA 3R1SA 5M4FA 1MP8A 2Y0AA 1O9UA 4XJ0A 3S4QA 4ASXA 4O0YA 4BHNA 5AAGA 1YOLA 3ORNA 3QZHA 3RM6A 5L2TA 4R5YA 2CGXA 3AC1A 3COKA 1NT2A 4J53A 3OBGA 4HVIA 3ZO1A 1KE7A 2X0GA 4QMTA 4GUBA 4PUZA 4JI9A 3ZM4A 5EM7A 4NW5A 4XMOA 4PDYA 3VHKA 2YEXA 3QC4A 5JGAA 3F69A 4X3FC 5E90A 2OJFE 4XV3A 3GU5A 3SG9A 3C4FA 3Q32A 1F3MC 4IADA 3WYXA 4OUCA 2BZIB 4G9CA 2WMTA 3DQXA 3Q5IA 3IGGA 4J98A 4O0WA 3DAKA 4LM5A 3C5UA 4FTLA 2VX3A 3DA6A 3KVXA 2X8DA 4C59A 4BDEA 2WXVA 2X1NA 3MV5A 4FKUA 4UWYA 5AP2A 3UQGA 5DNRA 2WMUA 3PXFA 1AQ1A 1KE9A 3MVMA 3QQFA 3R71A 4Y73A 4D2TA 3U8WA 4YZNA 4BI2A 4X2KA 5IPJA 1BLXA 3KB7A 5BUJA 3DB8A 4GKHA 4FEUA 4AWIA 4EK5A 4EQUA 4N6YA 4L67A 3U6HA 3DBCA 3ODYX 4D58A 2OZAA 4GW8A 4B8LA 4U9AA 5EYCA 4C61A 3DAEA 3W8QA 4K77A 2ETKA 3MA6A 3RPYA 4ANBA 4ZMEA 4EH5A 1WBPA 3MJ1A 4JAJA 1VZOA 3AD5A 3JY0A 4AT5A 1SNUA 2H34A 3QQGA 2KTYA 3BLRA 2QODA 2ZJWA 4GT3A 5LMBA 1W0XC 1XH5A 5CVFA 3RALA 4HZSA 3UTOA 2QONA 2UZNA 5CSWA 1TQIA 4YC8A 3KGAA 4QMMA 5D10A 4BKZA 2X7FA 4HVSA 2BROA 2GCDA 5CT0A 4IZ7A 3CD3A 4PV0A 3N4VA 1R1WA 4R7IA 3DV3A 4TYJA 4YLJA 5AA9A 1IA8A 4EHGA 3OP5A 4P7EA 4QP4A 5J8IA 4JIAA 2PZIA 3CJGA 1W84A 3FC2A 1Q3DA 3R8UA 4PDPA 3V51A 5C8MA 1XBAA 3UP2A 2J5FA 5C26A 5A9UA 2HWPA 1IR3A 4J71A 4IM3A 3R9DA 3PLAE 3IW6A 1LP4A 3ZUTA 1M2RA 4AT4A 3F88A 3G15A 4BTKA 1Q24A 3G9NA 3TDWA 2J4ZA 2PULA 1FMKA 4DAWA 1R39A 4G31A 3BBTB 2JD5A 3TWJA 2R0IA 2WTIA 3VIDA 3HMPA 5JK3A 1M2QA 2OJGA 3NZ0A 5IQIA 3R9RA 1JSTA 3DKFA 3PXQA 4H3PA 4L42A 4TWCA 3R8ZA 2VWIA 3V5TA 2BHEA 5A54A 3U6JA 4G3GA 2ZB0A 1IAJA 4AGUA 4Z9LA 1A48A 3ID6C 4UYAA 3QTUA 3TZ7A 1OKWA 4CQEA 3NUAA 3R8PA 2WPAA 5J95A 5HE3A 3TKUA 1U4DA 2VGPA 4GIIA 3U6IA 4ZY6A 4KUJA 2IO6A 3HAMA 4DFUA 4HPTE 3DT1A 3AMAA 4YO4A 3I4BA 1CSNA 4EBVA 2ERKA 4RVMA 2X8IA 3C7QA 3V5LA 1ZMUA 2BAQA 3L1SA 3UMXA 3SQQA 2YIQA 4E6DA 1Q62A 2RL5A 4UWCA 2XKDA 3UJGA 4IZ5A 4QQ5A 4BTJA 3DLZA 4QMOA 5BVKA 5AADA 3MY0A 4NM7A 4RFMA 4AS0A 3UG1A 4CCBA 2C47A 4I6BA 3Q3BA 4HVDA 4ZSLA 2AUHA 4OLIA 4M14A 4ZLOA 4DGLC 2PUIA 4ITHA 1ATPE 4FTJA 3OCBA 5AP7A 3ZMMA 1YXUA 1PMNA 2J5EA 3TACA 5JRSA 3JS2A 4QRCA 4O83A 5HU9A 3FYJX 2XM9A 4QTCA 1H00A 4JRVA 4U40A 3EQDA 5BYLA 3QUPA 4C4EA 3MH1A 2XEYA 3BWFA 4CG8A 3RPOA 1JKLA 3DAJA 3E8EA 3OWJA 5KE0A 3HMNA 3TV7A 3WZEA 2CNVA 1OKYA 2VTIA 2VX1A 3KULB 1XJDA 4FSQA 4G3FA 2BVAA 3QA0A 3V8WA 4LUDA 3ROYA 3D7ZA 4RLKA 1OKVA 3AT4A 3KF4A 3UOKA 4JNWA 3MJ2A 5BVEA 5FBOA 4Z55A 4IAYA 4PQNA 4EOLA 4N57A 5KCVA 3NS9A 4R3RA 3PWDA 2OW3A 3D4QA 1UNGA 3FL4A 3E8CA 5AP1A 2BFXA 2XNNA 3JR1A 2YM5A 4QMLA 4OTPA 1HCLA 4LFIA 5ACKA 2ACXA 2BAJA 3HA8A 3F7ZA 3UQCA 4JDIA 4Q9ZA 3MA3A 1OZ1A 1OIQA 2IVUA 4AZFA 2HZ0A 1M7QA 5FUTA 3TNIA 5EI6A 1REKA 4D1XA 1J7UA 3TZ9A 4W4VA 4F9WA 3EFKA 3C0GA 2VO7A 2R3FA 3C0IA 3EZRA 5T68A 2PVHA 2V7OA 3CY3A 2RF9A 2OLCA 4ZY5A 3E7VA 4L7SA 4NFNA 3IDPA 4M97A 5CSHA 1SVHA 1OPJA 1GZ8A 5FTGA 3RGFA 4M8TA 5KMNA 2ESMA 3A60A 5H8GA 5HKMA 1ZARA 4UBAA 3PUPA 2A0CX 3L8SA 5DR9A 2ZM3A 3NDMA 4CFWA 4FG7A 3MESA 5AUWA 4WUAA 4I6FA 5AR8A 5KHWA 1H08A 2P4IA 5BPYA 4DYMA 3VBQA 1OITA 3UO6A 3RPVA 2QHMA 3VWAA 1YWVA 2WMSA 5CU3A 3LCDA 3M2WA 2XNEA 3HECA 4GYGA 4UWBA 4AZSA 5A6NA 2WTWA 5DVRA 2BZHB 4CNHA 3CCNA 3BHVA 4FG9A 4R3CA 1RQQA 3AC3A 3OCGA 4ZOGA 1R3CA 5GHVA 4NUSA 4EZ5A 4O7TA 2Y6MA 4FOBA 3D9VA 5C4KA 4QTAA 2B9HA 3W2SA 4ACMA 2WMRA 2YCRA 4QYEA 3QD0A 5CF4A 3CTQA 4ZSAA 2CN8A 2OJJA 4CQGA 4RIOA 4BC6A 2LGCA 2W17A 4YZDA 1V0OA 4FA2A 4LRMA 3FBVA 1VEBA 2WAJA 3LIJA 4IH8A 4QTBA 3P0MA 2Y9QA 3GQLA 1AD5A 3HAVA 4RJ4A 5CSPA 2R9SA 3C0HA 5KMMA 4WT6A 4ACDA 4Q5HA 4IWDA 2IN6A 3OMVA 3TNPC 4FSZA 5IG1A 2WD1A 3IW5A 3OY1A 3A99A 5CLPA 2C1BA 2YDKA 2ZMCA 3VJOA 4YBKA 4RQKA 3W2OA 4EUUA 3C5IA 5LVMA 2E9NA 2FGIA 4GK3A 5DHJA 3IW8A 1BI7A 4KKGA 4Z16A 5KO1A 3MB6A 2JDVA 2NRUA 4QP7A 4FEXA 2BHHA 3G9LX 5HNBA 4M84A 3V6SA 1LEWA 3PZEA 1BUHA 4FTKA 3RI1A 4ZSEA 5EW3A 3VAPA 3Q04A 4RC3A 4QMQA 3KXMA 3ORTA 3FMNA 3RMFA 3P4KA 3QHRA 2R3NA 2WOUA 4XV1A 4FT0A 2W5AA 1JKKA 1CKJA 2EUFB 2Y4IB 4PNIA 4RZVA 5I4NA 5DYJA 5F1ZA 5JFXA 4WD5A 4WNPA 4PRJA 4G3EA 4R1VA 4XOYA 3UNKA 5C01A 4FT5A 4B0GA 4NM5A 1GY3A 2C68A 4O86A 4FL1A 4IIRA 2R64A 1T46A 4JX3A 5E8TA 3TM0A 4FTMA 5K9IA 4PTCA 3OWKA 4EWHA 1ZYJA 3QD3A 4RFYA 3E62A 3ACJA 3VUMA 4IWOA 5C8NA 4FEWA 2VV9A 5CT7A 3IK3A 5TT7A 3OUNB 3COMA 3TUCA 5CASA 1KV2A 3CGOA 4P5QA 4ZTLA 2R3OA 5JFSA 3OTVA 2ITPA 2OBJA 5FEDA 3GU4A 5CF6A 1JOWB 1Z57A 2R3RA 3WYYA 3ZSHA 1NXKA 4CMTA 4F64A 1SVGA 5G6VA 3AT2A 3V5JA 2UZTA 2GNJA 2Z8CA 3LM0A 3R2YA 1V0BA 4U3ZA 4APPA 4E4LA 5A4EA 3HYHA 3NUSA 4QPAA 2XRUA 4QP8A 3VBYA 2I1MA 3MIAA 4JBPA 5AFVA 3FKLA 5KX8A 4LUEA 3I6WA 3QX2A 2CLXA 3OEZA 2VTOA 4KABA 4U43A 4WG4A 2O2UA 2X2MA 5LWMA 1K3AA 4KD1A 3BU6A 2XK8A 3BYUA 4WHZA 4O91A 3NW6A 4PTEA 2Y4IC 4KIKA 3QFVA 1PW2A 5IDNA 4E3CA 1JAMA 2XJ1A 4JAIA 5JSMA 5IQFA 3FYKX 1VJYA 4NEUA 4E8AA 2WTVA 2XK3A 2WMAA 2ZV9A 3A8XA 3M42A 5AP3A 1B38A 1REJA 1WBVA 4KINA 4KKEA 4L43A 4TYHB 4ZS0A 1YDSE 2GNLA 4C0TA 3K5UA 5HG7A 5HG9A 3ZLYA 3SGCA 1U54B 3OW3A 3KK9A 3O50A 2ITZA 4CTBA 3EQPA 2V5QA 2PUUA 1ZYCA 3EYHA 2Z7SA 3LJ0A 4R5SA 3UNZA 2J6MA 3GNIB 4WSQA 5EQPA 3FE3A 5LARA 4FMQA 5HO6A 4FIEA 4EZ3A 2UUEA 4DH1A 2VTRA 3VS6A 3AT3A 4OBOA 3LFDA 3LCOA 4KSQA 4U6RA 1CM8A 3KCFA 3UO5A 3R7OA 3NWWA 4FTRA 4FKWA 3QU0A 4WO5A 5GJGA 3IW7A 4RPVA 1GIHA 4V04A 4AGCA 3VUHA 5EI2A 2W06A 4F08A 4HGTA 3KN5A 4AXAA 2I7QA 4EOQA 2FVDA 4CKRA 2UW9A 2B9JA 4QP1A 5ETCA 5L8LA 1XH8A 2RG6A 4TRLA 1PRYA 4IC7A 4FX3A 4QYGA 1ZOGA 2DS1A 2R7BA 5AP5A 4FSTA 4DFYA 1FGKA 3VC4A 4S34A 3RK9A 4RQVA 3EFLA 1FQ1B 4EI4A 2J2IB 3O8UA 3E87A 3MFSA 2IG7A 2UZDA 3A8WA 3HMMA 2FSOX 3IDBA 4TT7A 4JOAA 2EVAA 4RIXB 2XVDA 3RZBA 3D0EA 4FTNA 3VS3A 3FHIA 2WMVA 4AE9A 1MRVA 4BCOA 4CZTA 4EYJA 5M4UA 2RSVA 3BKBA 4BZDA 2QVSE 3PLSA 5CQUA 4BCPA 4HPUE 4AZVA 4MWHA 4NWMA 4R6VA 5AEPA 3GU7A 2V55A 3KRRA 2X4FA 3IPHA 4FBXA 3VUDA 5J7HA 1GIJA 4MHAA 4ZTMA 2W4JA 1VYZA 4QPMA 4XBUA 3QKLA 2XIYA 5HLNA 1IA9A 2HOGA 2BRHA 1G5SA 3Q4CA 3BGPA 3JVSA 1PKGA 3G6HA 4A4OA 4EHVA 4PWNA 1DAYA 2B9FA 2SRCA 3TEIA 4V01A 4CFUA 2C0TA 4EOOA 1V0PA 2XIRA 3QYWA 4FTAA 3CGFA 4FOCA 3VS4A 3F5XA 2BKKA 3ORPA 3K5VA 4PMMA 4EOJA 4A7CA 3I7CA 1G8SA 1RJBA 3FLWA 4BTFA 2XIZA 1SYKA 2X6DA 2PTKA 4XLVA 4G9RA 2W7XA 4GIHA
chains in the Genus database with same CATH superfamily
1TFFA 4ERKA 4LOPA 5DFPA 4NYEA 4G3CA 1WBTA 2RIOA 5DGZA 2H96A 2GQGA 3PJCA 1KWPA 4TKSA 2OXYA 4GK4A 1VYWA 2HY81 2C5NA 4DT9A 4IFCA 5EFQA 5HBEA 5EM5A 5JN2A 3F3UA 3ULIA 1WAKA 4K9YA 3W16A 1YWNA 5CS6A 4CTCA 4TWNA 4IM0A 1PXIA 2YA9A 3QHWA 2FSMX 4GFGA 4DCEA 2X7GA 3Q6UA 3Q9YA 2YLFA 4EJ7A 5IQCA 3MSSA 3ZLXA 1WBOA 1XWSA 3BIZA 2QOHA 2J0KA 3PE1A 4FTOA 4Z7GA 4JMQA 4AW2A 3T9IA 2OXDA 4QYFA 3RK7A 5BUEA 5HCXA 4C4HA 4TL0A 2I40A 4BBFA 3LXPA 4AW1A 2NO3A 4JQEA 4L00A 5M06A 1ZY5A 3ATTA 4MNEA 4JQ7A 3UIMA 3VBTA 2PU8A 2VGOA 4WBOA 5IUGA 2WO6A 3E63A 3AKJA 4G5JA 4I6HA 2PZYA 4GRBA 4HNFA 2J51A 4MNFA 1DI9A 3K3IA 1S9IA 3PG1A 4J1RA 2G01A 4H58A 3TIZA 3UIXA 4BI0A 4DN5A 2IVVA 4FL2A 4DGOA 4O84A 4O7ZA 5D7VA 2UV2A 3QALE 3NYXA 1YXTA 4HVGA 5DH3A 4ZZNA 3KU2A 3ZU7A 5LJJA 3U51A 3ZM9A 2W1CA 3NUPA 3Q2JA 4RIYA 4K2RA 4IX3A 3D7TA 4JXFA 4MBLA 3D15A 3CS9A 5L6PA 2VZ6A 4ANMA 2UZLA 3MFTA 3BBWA 2R3QA 3PIXA 3FDNA 4D55A 4GVAA 1FMOE 3BRBA 5K0KA 1Q8WA 3V04A 4FNYA 3WF6A 1OGYA 5IZFA 4O27B 5HBHA 3DB6A 4QYHA 3S0OA 3SW7A 4U42A 3SX9A 2PE0A 4MXOA 3U4UA 4BYIA 3R21A 2YM4A 1ERKA 5M57A 2J50A 1ZZLA 5FG8A 3DBFA 3MPAA 4KS7A 1PXPA 4R3PA 4TNBA 5BNJA 5EKNA 2HCKA 4C02A 3TV4A 2W1ZA 1XH9A 4TXCA 5KNJA 5CI7A 2J0JA 3AKLA 2BRGA 3R22A 2B53A 1YOMA 2O3PA 4ZSJA 3CP9A 3E8NA 1SMHA 4E6QA 2UZEA 2OWBA 3OT8A 4L53A 3MH3A 5IDPA 3DDPA 3VBXA 1YW2A 3R00A 3MB7A 5J1WA 1YKRA 4C2VA 4DEGA 2W1EA 1H28A 4GJ2A 5IUIA 1AGWA 4UMQA 2OF4A 3QTIA 4KNBA 3PVUA 3LFSA 2HY0A 2ZV8A 2OH0E 4U8ZA 4ZTNA 3F5PA 3MBLA 4DTAA 2OZAB 3GT8A 2HZIA 3FQSA 5CU2A 2XAOA 2C0IA 3FQEA 3WZJA 3G2FA 3QBNA 5CQWA 2X9EA 4BWXA 1ZWSA 4QQJA 1OIYA 5D11A 1I09A 1L8TA 3NAYA 1MQ4A 4GT5A 3WZUA 4MKCA 4ANLA 4O7SA 4QNAA 3OCSA 4QMXA 5HHWA 4EQCA 3NUXA 3MFRA 2PL0A 3R1QA 5KZIA 2IW9A 4DLIA 4LRKA 4FIHA 4NK9A 5DWRA 4D2VA 3SG8A 1EH4A 2JFMA 2UZOA 4EH6A 4YU2A 2C6DA 4AW5A 4YJRA 5FEQA 4U0IA 4BDFA 4QEBA 3UZRA 5JKGA 3EOCA 4XG2A 4FGBA 5JT2A 3TXOA 4IAIA 1R0EA 3EQGA 3F9NA 3FI4A 3QTQA 3ZDIA 2VO6A 4F7SA 1ZLTA 3ETAA 1E9HA 1U46A 2J0MB 3FLYA 5EH0A 3VRZA 5I0BA 3F61A 2RFEA 4F9YA 5EHOA 1UU7A 4GMYA 2IWIA 1RE8A 1YI4A 4G5PA 1XH6A 4WKQA 5LOHA 4DE4A 5E1SA 5CAQA 1A06A 3O23A 2EXEA 2QLQA 5T6KA 1K2PA 3Q2MA 5BQ0A 4D0XA 2HXLA 2C6TA 3KVWA 4G17A 4GYIA 4JR3A 2XS0A 4IQ6A 4M67A 4NU1A 4PDSA 4DFLA 5J7BA 5JMSA 2OI4X 2YDJA 4I41A 3IG7A 1JKSA 4C34A 1YRPA 3WI6A 4M15A 4BICA 1XKKA 5AM7A 2W1HA 4I4FA 1SM2A 3BI6A 4UALA 3PJ3A 3UDBA 2BUJA 3O71A 5HIBA 5KMOA 1BX6A 1ND4A 1GZKA 4F1TA 3I5NA 3NNUA 3EFWA 5DRBA 1GZOA 1P4OA 2XZSA 5K4JA 3PJ8A 2IF8A 3MTFA 3JPVA 5CEQA 4FJVA 3C4CA 1X8BA 3ENMA 4E20A 4F65A 4ACGA 2A19B 2ZDTA 2WMWA 1TQPA 4F7JA 3FLQA 2P55A 4D5KA 3W0QA 3U55A 3GCUA 4G1WA 4GK2A 4DGNA 4Q9SA 4X6RA 4PPAA 4BIDA 4M0YA 4BI1A 3IOPA 3QRIA 3IQ7A 3R30A 3WARA 1WVYA 4NL0A 4FKLA 3ZEWA 3ATSA 2OG8A 1BI8A 3BHUA 3HVCA 4EOMA 3KXHA 4LV7A 1UNLA 1CTPE 4U44A 2PZPA 2ZYBA 2C1AA 5HG8A 5DRDA 3BHYA 2Q83A 2VNWA 5BYYA 3LJ1A 2ITWA 4UXLA 3UIUA 4D2PA 2QO2A 4IB3A 2W1GA 2DUVA 4I5PA 5LMAA 4RX8A 4AA5A 4QT1A 1F0QA 1KV1A 4EONA 2XIKA 2JAMA 5M55A 4DGGA 5DLSA 4OTGA 4J7BA 4NTSA 3BE9A 2I0EA 2CDZA 3VN9A 5AWMA 4E4NA 3B2WA 3FXXA 2IPXA 2F57A 5CF5A 3VUKA 3DK3A 1OL6A 1YXSA 3DTCA 2QOFA 1QPDA 2ITVA 2X6EA 1P14A 3RINA 3HL7A 5JFWA 4Y8DA 4F6SA 3A7HA 3QQJA 1PHKA 3QRJA 3HLLA 3Q9ZA 2YFXA 4RWIA 2XNOA 2HW7A 5AR7A 4O22A 2VTAA 3Q52A 3TJCA 4D4RA 3UQFA 4ASDA 1P4FA 3HV3A 4DT8A 3O7LD 4L68A 3IONA 3BU5A 5H3QA 3VUIA 4UN0C 1DS5A 5BUIA 3PDTA 4BR3A 3Q4ZA 4P90A 4M13A 4KAOA 1OUKA 4LL5A 3SW4A 4I22A 3NYOA 3VULA 4BF2A 2C69A 3SD0A 3PZHA 1K9AA 3NUYA 2CKEA 4MBIA 4OAVB 4ZZMA 2XBAA 2CHLA 2XEZA 1PXNA 3MVHA 4L9IA 4IDVA 5BVFA 4FK3A 5KBQA 3RNIA 2PMIA 5I3RA 1XMMA 4CZUA 4DDIA 3EKKA 4E7WA 5A6OA 3C4XA 4BRXA 5IMEA 3LQ3A 5CANA 3WF7A 4HGEA 2YZAA 4C57A 4X3FA 3ZDUA 1OGUA 3GFEA 2JKQA 3FMLA 4S2ZA 5AP0A 3F66A 3FAAA 4LI5A 4OAUC 4S33A 4L45A 4FV5A 5CX9A 3E92A 4HYSA 3ZO3A 4FVPA 3VJNA 4I6LA 4M68A 1UNHA 3RBWA 3WIKA 4NCTA 2BALA 1GOLA 3VBVA 3L8XA 3T8OA 4F0FA 2QG7A 2R4BA 3ITZA 4KS8A 4O2ZA 4RT7A 2A2AA 1XH4A 3HUBA 4PF4A 5C03A 3NNWA 4RJ3A 2GMXA 3R7EA 3Q4UA 3VUTA 2W9ZB 3A7IA 3F82A 3PRIA 3FSFA 4DEEA 1KOAA 2VTMA 5AV1A 2YM6A 3GCQA 2HIWA 2CGUA 3F3WA 3U4WA 4YTFA 3ZFYA 4RLLA 4YZ9A 1WZYA 4Y5HA 3R2BA 5FTOA 2JIVA 5HE0A 2QU5A 3S2PA 1NVSA 3FSKA 4BDIA 3W2CA 5L2SA 2ITTA 3FMKA 3MFUA 2UW7A 3ZCLA 4IBMA 1GIIA 1Q3WA 4FC0A 4CFXA 3KQ7A 4FIIA 4DH3A 2V22A 5EDPA 3F5UA 3LCKA 5FP5A 4G6OA 4HCVA 4EOIA 2WMBA 4ITIA 2ONLC 2BKZA 3HRFA 2X7OA 2GNFA 4IB0A 4TY1A 2W1IA 4BHZA 2CKQA 5IQAA 2W4OA 1FVTA 2O5KA 3QD4A 3LMIA 3VONA 4A06A 1ZOHA 2QOOA 5TO8A 1J3HA 2ZB1A 5ETAA 1O6KA 1YHWA 4PMSA 1WBSA 5HGIA 5IA4A 2VWYA 3LXNA 1OIUA 3F3VA 3OG7A 3UPXA 5AAEA 4GCJA 4EZ7A 2CNUA 3CBLA 2CMWA 4HCUA 5HIEA 3LHJA 3ORXA 4FSYA 3D2IA 3O96A 3HDNA 3P78A 4L3JA 2PVNA 5CEKA 3P86A 3QRTA 5ANIA 3NNXA 1VLRA 3O17A 5E9EA 3P79A 3PA4A 3SC1A 5JGBA 5CWZA 3W2PA 4UX9A 4O6EA 5EQEA 3BCEA 5ACBC 3U9NA 3C4EA 5I9UA 4ACCA 3I0QA 4XP0A 3NRMA 4PPBA 4AA4A 1W83A 2UZBA 2QKWB 3R73A 2OSCA 4X2FA 1URWA 4E26A 4NT4A 3VS7A 1W2CA 3RTPA 2QHNA 2UW8A 5IQDA 2OIBA 3A7GA 1FBNA 5J1VA 2BILB 5CXZA 3F3TA 2PVRA 4TWPA 1UVRA 1YI6A 2X39A 3RKBA 3HV4A 5FM2A 3T3UA 3UPZA 3N4UA 3F5GA 4AU8A 4RZWA 1GAGA 3EQBA 4K11A 3RCJA 4USEA 4XCUA 4EEVA 2VN9A 4MH7A 4OTQA 4RJ8A 4U7ZA 1W2DA 4IWQA 2I6LA 3QYZA 4D1SA 4F9BA 5IMXA 4L3LA 1XMLA 3VQUA 4AOIA 2CKOA 4LYNA 4WA9A 5LXMA 3AC2A 3K2LA 4TYEA 4O7LA 2YIRA 4GUEA 1OBGA 4W4XA 4DH8A 4YPSA 5AUTA 3TTIA 5E1EA 2OIQA 4QMPA 5FRIA 4HGLA 1Q97A 2J7TA 2YJRA 4BYJA 4CLIA 2VWUA 5FLFA 3EIDA 2XYUA 3WF5A 5TE0A 3RVGA 2ZMDA 3CY2A 3G5DA 1ST0A 4G3DA 3Q4TA 3FZTA 3GGFA 3HGKA 3I60A 4J95A 3MH0A 5E8UA 4EOPA 4WRSA 2GFSA 2Q0NA 4GJ3A 1XR1A 2VTPA 4FZ6A 3QQUA 4CFVA 2QR7A 5AR4A 3V8SA 4OBQA 4IAKA 5B7VA 2WB8A 1PKDA 2NP8A 4FNWA 3RK5A 2HXQA 4I0SA 2JDRA 2X0OA 2C30A 5CTPA 5A4CA 5E4HA 4LGHA 4ZTQA 4JIKA 4FKVA 4DGMA 5H8EA 4RWJA 3QZIA 1XBBA 2YERA 4DG2E 3DXPA 1OPLA 4KIKB 3FLNC 4QP3A 4O82A 1Y6BA 2AYPA 4ZSGA 4L3PA 3DXNA 4OR5A 3ZUUA 2R3HA 4ZK5A 4EOSA 4OTWA 2OICA 2QLUA 3ENHA 3MVJA 3QUEA 4O4CA 3RHXA 5I9WA 1IAHA 3NLBA 5CAPA 2REIA 4DHFA 3BYSA 3DZQA 3BV2A 4D2RA 1APME 3DY7A 3VO3A 4JBVA 4A9TA 4B4LA 4JDJA 4F6UA 1FOTA 4JL9A 2RKUA 3ALOA 4O1OA 2DWBA 3RAHA 4YJPA 3NW7A 2RG5A 3NGAA 4EORA 3TDVA 5JRQA 2HELA 5BVDA 3KF7A 3QQKA 4AP7A 5M07A 3R9NA 3LCSA 4RC2A 3JUHA 4QTDA 3GCPA 4ZJVA 1STCE 3LPBA 4PX6A 5HCZA 5IISA 4BJJA 2UW6A 4EBWA 3HKOA 3L9LA 4BCIA 3NR9A 5KHXA 2O64A 3A7JA 4RJ7A 3T3VA 3SVVA 2OK1A 2FH9A 3VS0A 4U81A 4H3BA 4H1JA 1J91A 2B52A 4JDKA 4KA3A 2X9FA 4WOVA 3SLSA 3HX4A 4XG6A 3ERKA 5CYIA 3TNWA 4JRNA 4CD0A 4CT1A 4TZRA 3OROA 5DOSA 3FQHA 4BCNA 3FI3A 2IZSA 2GTNA 2GPHA 3ZBFA 4BDHA 3BYOA 5F95A 4I6QA 3KULA 4C37A 3PIZA 4G16A 4N4SA 1PJKA 2LAVA 2PMOX 2ZAZA 4RA5A 4FIFA 1Y57A 3LFFA 2XRWA 3OBJA 2FA2A 2OH4A 3H3CA 3BWJA 3ZTXA 3OXTA 5LVPA 4ZEGA 3L9NA 4R1YA 5EYMA 2CCHA 4K1BA 4AN9A 3MPTA 5GJDA 2BIKB 2F4JA 4WUNA 2F2CB 3OFMA 4NH1A 5A46A 4C3RA 2BTRA 3QCQA 4BCJA 3ORKA 4PL3A 2XALA 2NPQA 3KXNA 2PK9A 4D5HA 4W8EA 4D2WA 3D5UA 4O0RA 5DEWA 3KXZA 4BDGA 3ZO4A 3DS6A 3QQHA 3FZ1A 4RIWA 3W0RA 3HP5A 4MBJA 4I5CA 5HICA 3P7AA 5FGKA 4XS2A 4A9UA 2B54A 2HZ4A 2VTNA 3HEGA 5AMNA 1J7LA 4CV8A 2QI8A 2C6MA 4M7IA 2GFCA 5J9YA 4RRVA 3CJFA 3ZRMA 3TIYA 2OKRA 2RGPA 3BX5A 4LMNA 2OJ9A 1QPJA 3SV0A 4UMRA 2IZTA 1Q5KA 4GFMA 3GC7A 4W4WA 3RPSA 3E3PA 2KULA 2UZUE 3RWQA 4IJPA 3W55A 4C33A 1TQMA 1W82A 2NNWB 2YM7A 1KE5A 4I92A 2BZKB 3PJ1A 1GNGA 1TZDA 1WBNA 1Y8YA 4O96A 4BDBA 3QTRA 5DR2A 3BL9A 3POZA 2ITQA 2WU7A 3GVUA 3G0FA 5DG5A 4YJOA 3E3BX 5IH4A 3R83A 5FTQA 1H1WA 3LZBA 3V6RA 2UW0A 3NEWA 4AF3A 3QTSA 1QPCA 5IEYA 3DCVA 5LQFA 3TYKA 4X2JA 2XIXA 3ZC6A 2ZOQA 4CVAA 3FV8A 3ORZA 4MQ2A 3RAWA 4BKJA 5IQHA 2ZV7A 4D28A 3VBWA 1FVVA 2GNGA 4FKOA 3W1FA 5HU3A 2WMXA 4FTTA 4QMZA 2CJMA 2BPMA 4PL5A 1URCA 3RHKA 3TCPA 4CFFA 2C5OA 2QO9A 4L44A 2ZDUA 4MXYA 4CFNA 3BYMA 5LMKC 3R6XA 1OL7A 4IMYA 3NMUF 3GOPA 4X6QC 4MXAA 4O7NA 3NIZA 4IANA 3LJ2A 5FM3A 4G6LA 3KCKA 3KMUA 3KY2A 3QTWA 5J9LA 4O4BB 2NYAA 4ZS4A 4V0GB 3TKIA 3PA3A 3FUPA 4RGJA 4J96A 2B1PA 1H1RA 3EQCA 2CSNA 3FLSA 3NPCA 3JVRA 4IWPA 4O38A 3MY1A 3WE4A 2ERZE 3LQ8A 3PYYA 3LQ5A 3LFQA 3W0SA 4E6AA 1OBDA 4QDEA 4I20A 2YCSA 4MXZA 3TN8A 2GNHA 2PE1A 5D7AA 2ITNA 4C4JA 4C7TA 4O4DA 2QC6A 2RFNA 3P08A 4YHJA 1OL2A 5EM8A 1WCCA 3LMGA 5FWKK 2ZV2A 1H07A 2FSLX 3H30A 4YSJA 4UB7A 4XH6A 3IOKA 4GVJA 4D2SA 4F7LA 4JVGA 3B8QA 4AFEA 2PUNA 4IX5A 4J8NA 5E8SA 5EQYA 2O0UA 1UWJA 5FDXA 5J5SA 2VWWA 4IXPA 1DAWA 3AGLA 2VTHA 4ANOA 4WBBB 3OUKA 4I21A 4CT2A 3LLAA 2B4SB 2ZFYA 3V8TA 3SXSA 2EXCX 2GNIA 4IFGA 4FR4A 4ITJA 5EHLA 5EM6A 3CPBA 5HQ0A 5K5XA 3QLFA 4E4MA 1R78A 4BWKA 5ICPA 1UA2A 4QP2A 4M69B 4XX9A 4I0TA 4XG3A 4MAOA 3O0GA 4EH8A 3P7BA 4QPSA 3Q6WA 3QRUA 4OT6A 4BCGA 1IEPA 4MWIA 3ANQA 4LG4A 3LE6A 2VTJA 3LOKA 5E8XA 5EYKA 2Y8OA 5KUPA 4UZHA 3EJ1A 3KMMA 3MGYA 4JS8A 4FV6A 1IG1A 4BGGA 3HDMA 3C1XA 4KKHA 4QMNA 1SVEA 3IECA 4K8AA 3S1HA 2HK5A 2QCSA 2YM8A 4J99A 4XEYA 5CAVA 3UNJA 3MIYA 4DFXE 4YURA 4MXXA 4K33A 4YBJA 5HNIX 4MXCA 4GKIA 5AV4A 3JY9A 1H01A 1GJOA 3EWHA 3FC1X 2WOTA 3LM5A 2HENA 3NCZA 4I5MA 4E5BA 4YGAA 4XYFA 4NSTA 4FEVA 2BCJA 2E9UA 5HD7A 5GNKA 4JLCA 4CRLA 1Q61A 3PIYA 4FSWA 1UKIA 3F7WA 2XNBA 3LFCA 2OFUA 3DPKA 3IW4A 4W9XA 5JZJA 1H1PA 5DT0A 2C6EA 2P2IA 4CSVA 1FVRA 2Z7QA 2J90A 2JBPA 1KE8A 2WTKB 2NRYA 2R3IA 3MH2A 4ANSA 5HZNA 4BY9E 1QL6A 4GT4A 2WHBA 4L46A 3VS1A 1OB3A 3CSVA 4IB1A 2R3LA 2A4LA 3C9WA 1PMUA 4NZWB 5EKOA 5BYZA 1OL1A 3ZLWA 4CYIA 5HTBA 4PMTA 4JR7A 4FKQA 1H26A 2BTSA 2W1FA 3DNEA 2JKMA 5GIPE 2XK7A 4JT3A 4E5AX 3ZO2A 1H25A 3DZOA 3CXWA 4IVDA 4TYHA 5T3QA 1GZNA 3AGMA 4FKSA 5AP4A 5DI1A 3C51A 2W5BA 1YVJA 1U54A 2B0QA 4JG8A 5ETFA 4U3YA 2G2IA 5ANDA 3KRWA 4RVLA 4EKLA 3PG3A 1S9JA 1JSUA 4QMVA 5HE2A 4ENXA 3KRXA 2BRMA 4AOTA 4DINA 4IE9A 3AQVA 4F0IA 4AAAA 3KC3A 3GCSA 3HNGA 4QMUA 2JDOA 3F2NA 4P2KA 3NX8A 4AZWA 4QMYA 4XOZA 3OT3A 3AOXA 3H9FA 3EMGA 2RFDA 4FF8A 2GU8A 2W5HA 4N6ZA 4BCHA 5CU6A 2UW5A 3E8DA 5LWNA 4F70A 4D0WA 3PSDA 4XUFA 4I23A 3W8LA 4MK0A 2G9XA 2Y7JA 4Y95A 3KXGA 5IA3A 4CG9A 3UC3A 5AM6A 3CQUA 3PSCA 1M52A 3OF0A 2WTKC 4A07A 4HYHA 5M44A 2GHLA 4DEDA 1LUFA 3H9RA 4R7HA 3OZ6A 4FRFA 4JBQA 5IEXA 3PVBA 5CEOA 3G90X 3COHA 4PP7A 3BE2A 1H27A 5HG5A 3RAIA 3TZ8A 2WU6A 3IDCA 4E6CA 4LDTA 5EOBA 4C35A 3OY3A 3PWYA 4F1MA 3KEXA 3F2RA 3KMWA 2QKRA 2E9VA 1Q8UA 3QLGA 4IDTA 4D4VA 4FV9A 4CXAA 4OTDA 1WFCA 4YJQA 1VR2A 4C3FA 4AX8A 2C5XA 3QGWA 4G34A 3PFQA 4FL3A 3UO4A 3GU8A 4CYJA 4YLKA 5AUYA 4FV7A 4FVRA 1IRKA 4AUAA 4DG0E 2PMNX 3EL8A 5HEZA 3V3VA 5CALA 3UZPA 3TNQB 4C36A 4FZDB 2PVMA 1XO2B 4MQ1A 1DI8A 1CDKA 3GQIA 4IVAA 4I4EA 2I0HA 2WQEA 2YZLA 4GS6A 1IASA 3COIA 4MTAA 4D1ZA 2BR1A 3VF9A 1F5QA 1U5QA 2OO8X 1U59A 3EN9A 4K0YA 4YC3A 5C27A 3S00A 3OOGA 3SDJA 3EB0A 3HV6A 2C6IA 3D2KA 3ZBXA 3MTLA 4DEIA 4DFNA 4C4FA 5B2LA 3EYGA 2GQSA 2BDJA 4QD6A 2GQRA 5GZAA 2QR8A 4B8MA 1JNKA 4QQTA 1JPAA 3PPKA 4N70A 3ZYAA 4HOKA 4UZDA 4X0MA 1PF8A 4C2WA 1TVOA 3II5A 4YHTA 3UE4A 1QMZA 5L6WL 4Z3VA 2UW4A 5IA2A 2Z7RA 4AN2A 4C4IA 2UVYA 2JDSA 2G2FA 4FV3A 4K6ZA 4TTHB 2PZ5A 1FINA 2WQOA 4YJSA 4C58A 3BLHA 4UYNA 1CMKE 3POOA 5EOLA 2ITXA 3FKOA 5KMLA 3FEGA 5KKRB 4KRCA 4R77A 2XYNA 4IVCA 2F7ZE 4NW6A 2C3KA 5AUVA 2CCIA 3SHEA 2IZRA 3A62A 3FMHA 4C38A 1NY3A 3DBDA 4WNOA 2WQMA 3DJ6A 4FE2A 3DKOA 2ETRA 2B9IA 2CKPA 5ETIA 2A1AB 2W96B 4X2GA 2Q0BA 2R3JA 4XG9A 1YXVA 2XP2A 4YHFA 4FSRA 1UWHA 4IC8A 5F4NA 1H0WA 3EN7A 2PVKA 3QKMA 1Q4LA 4BGHA 4DLJA 2XCHA 2QO7A 2ZVAA 4O0XA 2CNQA 1JQHA 1ZYDA 3G33A 5D9HA 3VW6A 4FZFB 5E8VA 3OTUA 4BBEA 4NIFA 4WG3A 4BDJA 4U80A 5IUHA 3ORIA 4V05A 3NAXA 3R1NA 4FTIA 5EK7A 2H8HA 4ZTRA 3TZMA 4MYGA 4FNXA 3UOHA 3ZOSA 4XNEA 3P23A 3QCYA 4BFMA 3UGCA 4O0TA 3GBZA 1SZMA 4QQCA 2DQ7X 5AR5A 4F1OA 4CRSA 1MUOA 4JQ8A 1UU9A 4U97A 4DFZE 3VVHA 2Y6OA 4PL4A 5BVNA 2PMLX 1T45A 1HOWA 3RNYA 2XJ0A 4M12A 5JFVA 5KKRC 5IQBA 1Q99A 3KK8A 4IAZA 2I0VA 4RSSA 3PXZA 5EYDA 3C50A 2W99B 4QP6A 2C6OA 2F7EE 3PJ2A 2E2BA 4FZ7A 2DYLA 5M53A 2G2HA 4CMOA 4Y83A 5JGDA 4LGDA 4CV9A 5M4CA 2XNPA 3BGQA 3ZLSA 2C3IB 3PE2A 4FKGA 5IU2A 5HX8A 1BYGA 1PY5A 2QURA 3DDQA 3KFAA 4MEDA 2XKCA 3BEAA 1H24A 2X2KA 2YCFA 3EQIA 4FG8A 4KB8A 1Q41A 2YJSA 2OU7A 3I1AA 1M17A 2QOBA 5L6OA 2VTTA 1ZZ2A 2OZOA 3FPMA 5B2KA 3TNHA 3QXOA 4RWLA 4O21A 3R63A 4XG7A 5HORA 3GCVA 3P1AA 4EQMA 2H6DA 5L2WA 2UZVA 3D5XA 5L2IA 5CAUA 2UVZA 4LL0A 2JKKA 5J87A 2XKEA 2E9OA 4J52A 3E7OA 5GZ8A 2O65A 2QOKA 4U41A 4ZIMA 3R7YA 4DF3A 2WMQA 2R3MA 4JBOA 4UV0A 3VHEA 3W0PA 4IHPA 5FXSA 2CPKE 3DK7A 5H8BA 4NCTC 3U87A 5ANJA 1A9UA 4S31A 1W8CA 4H36A 3FJQE 4C62A 3FXWA 3HRBA 2PWLA 4JG6A 4K18A 2VWXA 4MD9E 4YJUA 3ZONA 4A9SA 4BN1A 3ZRLA 4ZMFA 2VWVA 1HCKA 3ZXTA 2VX0A 3QCSA 1P5EA 4E1ZA 5JEBA 4PP9A 4DG3E 4DITA 4ARKA 4OT5A 4F7NA 5HTCA 3MDYA 4H05A 3TL8A 3SXRA 3R9OA 2J9MA 5JZNA 3VQHA 2QD9A 2VTQA 5DIAA 4I0RA 1BMKA 4AXFA 3DU8A 1M7NA 5HBJA 4AQKA 2GS7A 3P7CA 5I9ZA 5CSXA 3QUDA 2QQ7A 1ZAOA 2CGVA 2BDFA 4I3ZA 3JXWA 5CI6A 5AV3A 3BGZA 2HYYA 3SRVA 4FV2A 1PXMA 4JJRA 5IKWA 5L8JA 5J5TA 3O5AA 2IVTA 4EK8A 4F9AA 2J0IA 2UW3A 2WFYA 4NKAA 4S32A 3HMOA 3TUBA 2P2HA 1ZMVA 2XUUA 3Q9WA 4PPCA 4KIQA 3UG2A 1E1VA 4FIGA 3GB2A 3ORMA 5DEYA 3QZGA 2PZRA 2XH5A 3D83A 5DN3A 1H8FA 2PSQA 4A9YA 5I9XA 1W7HA 2PYWA 3QTXA 5KBRA 5DPVA 4MF1A 3TG1A 2JIIA 2XM8A 5HVJA 5LCJA 3EHAA 4DHJA 4LOOA 3FMDA 4AXEA 3BHTA 3ROCA 4WIHA 4DH7A 3PSBA 3RP9A 4ZP5A 1RW8A 2BRNA 2YIWA 3CLYA 4BZNA 3NCGA 4ONAA 3Q96A 2WTJA 1ZOEA 2Z2WA 3B8RA 4I5HA 5EG3A 2AC5A 2QOIA 4RFZA 5ITAA 4CKJA 2HZNA 3OWLA 2X4ZA 4IZAA 1Q8TA 4OW8A 1OKZA 4KBKA 4O0VA 4EH9A 2W4KA 3E88A 4IB5A 4NJ3A 3KRLA 2FUMA 5CZHA 4IZYA 3LCTA 4YMJA 3DBQA 4G2FA 5I5ZA 4R7BA 2RFSA 5H9BA 4AXDA 4YLLA 3H9OA 4EYMA 3KREA 3DKCA 3EN5A 3C4ZA 4C4GA 3UOJA 3SOCA 3UVRA 2VTLA 2FO0A 3QXPA 3LFNA 3R7VA 5DR6A 5HVYA 4BBMA 2XJ2A 5TOZA 4AACA 3GP0A 2ETMA 3SA0A 3BYVA 2JLDA 4D4YA 1LEZA 2JFLA 2UZWE 4F9CA 1PYEA 5A4LA 2P33A 4GG5A 2B55A 2O8YA 2XB7A 5ANKA 2IJMA 2R3GA 2OGVA 4KSPA 4XG4A 5IH6A 2PE2A 3I5ZA 4NKSA 5EDQA 3WF8A 5GIOE 2F49A 3KIOC 4E93A 2E9PA