3BRBA

Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
260
Chain Sequence
NKLEDVVIDRNLLILGKILGEEFGSVMEGNLKQEDGTSLKVAVKTMNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase MER
publication title Structural insights into the inhibited states of the Mer receptor tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 260
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3brbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3brbA01
3UP7A 3VBVA 2VO7A 3TZ8A 4Z3VA 4DH5A 1YHVA 3HV4A 3SRVA 3PPZA 4E7WA 4GU9A 4R6VA 2JDOA 4X3JA 2PVMA 4OAVB 4XG6A 3SXFA 4RIOA 3EQDA 3GU8A 3JYAA 3FC2A 4X21A 4K9YA 5DLSA 3V8TA 4EH9A 2JIVA 3QD2B 1G8AA 2IJMA 4YSJA 3WZKA 4O0TA 1Z57A 3FDNA 4HYUA 2IZRA 4MX9A 1L8TA 2XMYA 3A8XA 2ZV7A 2GNFA 2C5XA 3NNUA 3S4QA 4O7YA 4IVCA 5EI8A 1O6KA 2W06A 5L8LA 2HY81 1YOLA 4PWNA 4XP0A 3F69A 3FL4A 2ZDUA 4FZFB 4QQJA 3FUPA 3RZBA 3R9OA 2PUIA 2W7XA 4J96A 2ETKA 4FKQA 2VU3A 5FBNC 3G33A 4IZYA 5K3YA 1ERKA 2OXDA 2ZJWA 2QO9A 3NNWA 3GNIB 2PZ5A 1M2QA 4K1BA 1NVRA 1OIYA 3LQ3A 4Q2AA 3MB6A 1YXXA 1NT2A 1GZOA 4NM0A 1U4DA 1J91A 2C6EA 3GQLA 3FMEA 3VUTA 2WQBA 1PXJA 5B2LA 3TDWA 4A4XA 3ZRKA 4I94A 4C3PA 3R8ZA 3MH1A 2BIKB 3R1SA 4MD8E 4O7WA 5D12A 5DHJA 5K4IA 4WNPA 4FK3A 4XLIA 4DA5A 2DWBA 4ZIMA 4BBMA 5IQFA 4JQEA 1BL6A 4NCTA 3HV6A 3SLSA 4ANSA 3ORTA 5J9LA 2W05A 2X7OA 5AP7A 3TL8A 4GK3A 3OBGA 5FD2A 2WTDA 1FQ1B 5AV3A 2XNPA 3ZSHA 3PTGA 3UVPA 2ITUA 3REPA 5AP1A 3D7ZA 4TYHA 4DCEA 2VWWA 4E6QA 1H27A 5JFWA 5LQFA 4BY9E 3NS9A 1YI3A 3ITZA 4GH2A 3DFCB 4IFCA 4U7ZA 2QQ7A 1UVRA 4X2GA 5CU4A 3LQ8A 4HZSA 4K0YA 2H9VA 5TKDA 4N70A 4JL9A 3OW3A 3HX4A 4AZSA 5DGZA 4GG5A 4AXAA 2X8EA 2PPQA 1KE6A 2PWLA 4GT5A 5ICPA 4UX9A 2BZJA 3KFAA 4O0UA 1CMKE 2ERZE 2XK8A 5H9BA 3H10A 5BMMA 4JBOA 3F3VA 3D7TB 4D9UA 4XBRA 4KUJA 2F9GA 2W5BA 2NRUA 2VWVA 5CZIA 2JAVA 4BI0A 3VF8A 3QLFA 3TNIA 3QCYA 2GMXA 4IX3A 4D58A 4FG8A 2HELA 3ALNA 3E7OA 3FXXA 3SA0A 2XK6A 4P90A 2QU5A 1WAKA 3UG1A 5HORA 2CNVA 3CJGA 3QU0A 4FKRA 3AD6A 3FLQA 4RFYA 1FVVA 5D7VA 3O8PA 3ORMA 4YTIA 4YR8A 5AAEA 4G31A 4D0WA 3KCKA 3A7JA 5CEOA 2C6DA 1U5QA 4UZDA 5CS6A 5J1VA 3UDBA 1H1WA 5IZFA 3MY5A 4GIHA 3NR9A 3EZRA 5AX9A 4R5YA 3VS5A 4XX9A 2B53A 3KRRA 4ACHA 2CCIA 3AMYA 2PHKA 5DR2A 4C4FA 2C6KA 3MWUA 4P7EA 4K77A 3ZLSA 3LVPA 4FL1A 4FVPA 4L53A 1E9HA 2HIWA 3QZHA 2GQRA 2IWIA 1IEPA 4Y73A 3VW6A 2HENA 2ITQA 4MF0A 2OI4X 3OTUA 2BCJA 2ZB0A 3DJ5A 4ZP5A 4AACA 4DT9A 1Q24A 2W1CA 5IA0A 4W8EA 2HZ4A 1O6YA 1H8FA 3PA5A 4UYAA 3EKKA 2XBJA 3EB0A 4GYIA 5AP4A 5KE0A 3ZUTA 5BUEA 3PSDA 4C58A 3DKGA 5F20A 5BVEA 3ZONA 5I9XA 2ERKA 2VO6A 4M8TA 4EOQA 4XG3A 3KRJA 4IIRA 4WBBB 3Q9XA 2QO2A 2ITNA 3FZRA 4DTKA 4EOIA 3QTZA 1OL6A 2JD5A 3BV3A 3WF9A 4C2VA 3HMOA 3JXWA 3Q2MA 1I09A 3LFCA 4KKGA 4E4MA 4F7SA 4FC0A 4IX4A 3BU3A 5JRSA 4HGTA 4DH7A 3BQRA 4U6RA 3ZZEA 1MUOA 2EVAA 2BZHB 4IX5A 2OJJA 3KULA 3PXKA 1KE5A 4EBWA 2CGWA 4OT6A 4IJ9A 4Q9ZA 4FOBA 5M09A 2JFLA 3L8PA 3NUXA 2IN6A 3AT4A 5BPYA 2WU6A 5JKGA 4ZTMA 3RGFA 1YXVA 4NK9A 3F3ZA 4RIXA 5DRBA 4F9BA 5C1QB 3KREA 3GCVA 1BYGA 3KK9A 1QPDA 3HP2A 5IQAA 4QQTA 3ZM4A 4TYEA 4FV5A 5IPJA 5AM7A 1NXKA 4XOYA 5J9YA 2Q0NA 4AFEA 3SHEA 3EIDA 1U54B 2ZMDA 5CF6A 2QLUA 2QOLA 4PPAA 4WG3A 3R8PA 4RZVA 2OU7A 4TZRA 3AT2A 4L01A 4N6YA 3A60A 4QMPA 4RX7A 3BELA 3LOKA 4UWYA 4ZSLA 4XG7A 2X81A 4D28A 5FM2A 5I0BA 5HEZA 5FXSA 2HWOA 4OTFA 4BICA 3MVHA 4PDYA 2H8HA 3ZFXA 4G6LA 3BYVA 3COMA 4BZNA 4WG4A 5T68A 4J8NA 4JR7A 4DGOA 4BCHA 4RQVA 2XYUA 2JDVA 4YJOA 5DT3A 2J5EA 5F1ZA 4O7LA 2OJFE 5C26A 2GHLA 4D4VA 1YXUA 5EI6A 3ROYA 1W83A 3LCOA 4I22A 2ZV8A 4NL0A 3CGFA 5IEVA 2QG7A 1TQIA 5CEKA 2VTPA 4ORKA 3M2WA 4U97A 2E9NA 4BCFA 3OT8A 3U4WA 4FICA 3UBDA 2PSQA 4C38A 3VJOA 3P0MA 2X8DA 4IWPA 5IH6A 4ACMA 4IB0A 4EJ7A 3QXPA 3PWYA 4ZOGA 5IUIA 4H05A 5AADA 1QPCA 3DJ7A 3QTSA 5CSHA 3QRIA 5BVDA 2X7FA 1U5RA 1UWJA 2PZPA 1OVEA 3A7FA 1PMEA 5CXHA 2JGZA 1JKLA 3I79A 2HCKA 3ZUVA 3GOKA 4CKRA 4EH8A 5M53A 4U41A 2O0UA 4DFBA 3QHWA 1B38A 4L44A 4MQ1A 4WNOA 4RFMA 1S9JA 1URCA 4MNEB 2ITTA 5EYMA 5HNBA 1NW1A 4QP8A 3TUBA 3OEFX 5KHXA 1XH6A 3Q4TA 4YZMA 1YDTE 4ZK5A 4FNZA 4YC6A 5E8WA 1DI8A 3ZU7A 3R02A 2I1MA 4S30A 3WZDA 3LMHA 3AC2A 4D2SA 4JG7A 5IUGA 4WBOA 1ZXEA 2HK5A 3WF6A 1A9UA 4ZY5A 4UN0C 3BIZA 1M2PA 3SKCA 2XCHA 4BVUA 4DHFA 4AT3A 3C4WA 4G16A 4F4PA 3I5ZA 4ACDA 5FEEA 4XRJA 2UZLA 3BLHA 3NPCA 1UKIA 2VTQA 3CTJA 4JR3A 4Z55A 2X2MA 3ZFYA 3FLYA 2XIZA 3F82A 1OMWA 3KMWA 3LMGA 3PVGA 4UEUA 4YTHA 3W10A 4FTNA 5C8KA 2OXYA 4I24A 3AC3A 4FT3A 1OBGA 2WZJA 4C33A 3QGWA 3R9NA 5A46A 4JDHA 4EK5A 4ERWA 2F4JA 3Q9ZA 4F6SA 5I9WA 2QURA 3S2PA 2Y6MA 3COKA 5JN2A 3OXZA 4QPAA 4X6RA 2YJSA 2FA2A 5FEDA 4UMPA 2ITWA 4PL4A 4FG7A 3I81A 4G6NA 4BDCA 5HIBA 1J3HA 3FKLA 1J7IA 4E6AA 5I4NA 4WOVA 3D9VA 5KMLA 2C1BA 2J4ZA 4LOOA 5EI2A 3FI3A 5E92A 3SQQA 4CLIA 4DFNA 1DS5A 3PG1A 3NMUF 2WMUA 1W8CA 5AX3A 4C4IA 2B55A 4BIBA 4EH4A 4FIHA 3QUEA 3CQWA 4NEUA 4WIHA 2PZIA 3C4CA 3IDCA 5AUXA 3CCNA 4QP7A 5CZHA 4TL0A 2V55A 3KEXA 4LUEA 4U44A 5HE3A 2JAMA 5CX9A 4DGGA 5DT0A 3LM5A 3HV5A 5BVOA 2QOOA 3ORLA 3DJ6A 5AR2A 4LMUA 3W32A 1YVJA 4HVIA 4UMUA 3TV7A 1YOJA 3U51A 2C1AA 4IAAA 5EYCA 2PYWA 3BX5A 4Y85A 5EQYA 1V0BA 3CQUA 5AR3A 2WHBA 4BN1A 3RINA 2YIXA 2YWVA 5IQBA 3W55A 4QYFA 2OIBA 5AFVA 3BYMA 5FQDC 5L8JA 3PY0A 3QKMA 3V6RA 3MTLA 4ZXTA 4DEIA 2JEDA 2C47A 5FP5A 5HG7A 4ALUA 4EZ3A 1MRVA 2JBPA 2G01A 4DBXA 4MKCA 1JVPP 1IR3A 3QUDA 3VRZA 4D5HA 5LMKA 4FEUA 4WA9A 3IDPA 2UW8A 4Z7HA 2X4FA 2BKZA 3R83A 1PJKA 2OSCA 2J5FA 4HJOA 4RIWA 3HDMA 4IFGA 4XCUA 2IVUA 4H36A 4PL3A 5CI7A 2W4OA 4MXYA 5CSWA 5CTPA 4FIEA 3L9LA 4YHJA 3G2FA 4YNOA 3V5JA 5DBXA 4CZTA 4DINA 2C3IB 3SXSA 2R9SA 5M4UA 5LCJA 4P2KA 4D1ZA 4E4LA 5IISA 4PF4A 4EZ7A 3RAIA 3F2RA 3EFKA 4AW5A 1OKYA 3FAAA 4XG4A 5CT0A 4CFWA 3NUSA 4L46A 4PRJA 1W7HA 2EXMA 3C7QA 3I4BA 4UWCA 4USDA 4D55A 2JITA 2VV9A 4KIKB 2PVNA 1WFCA 3VS4A 3KB7A 4AW2A 5CF8A 5KBQA 3C13A 4QTCA 2GU8A 5LJJA 5A4LA 5BYLA 3RNYA 4QPSA 4UXQA 3V04A 3R7GA 3WZJA 5AR5A 1PMNA 3OWJA 4GVAA 3RI1A 3HGKA 3OW4A 4ID7A 5JRQA 3R7OA 1QPJA 4U9AA 3DK3A 2LGCA 3AC8A 4BCPA 1STCE 1KE8A 4AP7A 4BKYA 1I44A 1ZMVA 1Q8UA 2IVVA 2VD5A 3P23A 4APPA 4A4LA 3OHTA 3VUIA 5AP2A 5EOBA 2PUPA 4EONA 2UW0A 5D1JA 4FV8A 5EDRA 1ZY4A 2BAQA 3BGZA 2WMXA 2PUNA 3LFBA 2UZVA 5AV1A 3VUHA 3TTIA 3PJ2A 3QRJA 3W18A 3PSBA 4CRLA 5M4IA 5EW9A 1ZLTA 2FH9A 3FZTA 4FTMA 4H39A 4II5A 2GTMA 1K2PA 1JWHA 3UOKA 4AA0A 4IB5A 5LWNA 1KV1A 2GDOA 4IVAA 2IZSA 3MN3A 4NTTA 1ZYCA 3RKBA 2WTJA 4ZTNA 4JOAA 4YO6A 3UIBA 5C4LA 4IAKA 4C4HA 4XP2A 4NW6A 1YXTA 4A9SA 1UNGA 4C4JA 1W84A 4K2RA 5LCKA 4ZJIA 3FMJA 5LVLA 3HA6A 3C4ZA 3A8WA 3FEGA 4PQNA 4EWHA 4AGCA 5DN3A 5HU9A 4G1WA 4YZDA 1LEWA 3CR0A 3PIYA 5AR7A 2JIUA 2AC5A 3EZVA 3PA3A 4IB1A 2WQOA 4IM0A 4JIAA 4EQUA 4D5KA 3U55A 2PMIA 1WMKA 5HO8A 1GNGA 4E1ZA 3EH9A 3G0FA 2VX0A 2HZNA 3ZC5A 5KX8A 3NSZA 4U3YA 1M2RA 2I0YA 3GXLA 1JQHA 4YNEA 4DTAA 4B4LA 2F57A 2FSMX 4TWOA 4ANQA 1H1QA 4R3PA 2BILB 4PMTA 2AYPA 3RALA 4I92A 4MWHA 2WTCA 3GCQA 4RRVA 5E8VA 3UO4A 3PVUA 4HCUA 4J99A 5DNRA 2X9FA 4AOJA 2HWPA 2V7AA 5TF9A 4HVGA 3LFDA 2HAKA 5AUYA 3TCPA 4AE6A 4I6BA 2B52A 3LM0A 4RVTA 4YU2A 3VO3A 1P4OA 4MYGA 2NO3A 3IONA 4D1SA 4AOTA 5LWMA 1J7UA 2X4ZA 2ONLA 5CQWA 1TVOA 4FTJA 2YDKA 4BDGA 4GJ3A 3I0QA 4ITIA 2JDTA 2PMNX 3DBQA 4ZZNA 4MHAA 3RCDA 3O8TA 3VUGA 3W2RA 4QMQA 2BKKA 1GAGA 2Y0AA 3HNGA 3ZXTA 4EC9A 4NIFB 4C57A 4M69A 4D2VA 5HLNA 5LXMA 2X8IA 2XZSA 2YCRA 4R78A 3C9WA 1SNXA 1FMOE 4C36A 2VWZA 4NM5A 3IS5A 3WZUA 4DEBA 1QMZA 1HOWA 1KOBA 2I0HA 2XK9A 2W1GA 4QMYA 4F65A 5E9EA 5EQPA 3P7AA 3UO6A 3VS3A 2OF2A 5AJQA 2XNMA 2JKOA 4FG9A 4GSBA 4WD5A 4E6CA 3GCPA 3MVMA 4NKAA 3UC4A 2WTKB 4RJ4A 4O2PA 5KMKA 3BPRA 4AX8A 3HYHA 4GRBA 4KBAA 3OVVA 2BRNA 4Q5HA 1PXNA 4ANNA 1X8BA 4CV9A 2QOHA 4CFMA 2J0KA 3F5GA 2PE2A 5GJDA 3COIA 4LL5A 3VHEA 4S33A 1GZ8A 2BIYA 2W1EA 5IH4A 1PYEA 3E5AA 4CFXA 3R22A 5E91A 4BDIA 1JSTA 2ETMA 1H25A 2B54A 4D4RA 5JK3A 3QXOA 3I7CA 3VS1A 2QOBA 4JX3A 3QALE 3VHKA 2ZM1A 1H28A 2R2PA 4PTCA 3VBYA 4BTMA 4MNFA 3IPHA 3DKCA 4IW0A 3LJ1A 3Q9YA 4P5QA 4AWIA 3P9JA 4E5WA 4F9WA 2OJGA 4LRJA 4PMMA 5FLFA 3DBFA 3NIZA 4ZZMA 4BCNA 3FHIA 1H01A 1OKWA 3Q5ZA 3Q4UA 3TV4A 3FJQE 3WE8A 2BPMA 2O64A 3QC4A 4ZTRA 3AD5A 3QKLA 5HCYA 5FM3A 1L3RE 1SZMA 2QKRA 4NFNA 4RWIA 3T3UA 3TJDA 4BCOA 4RVKA 4KS8A 4CYIA 2RFNA 2HZIA 1QPEA 3EN4A 3ATTA 5CY3A 4HYIA 3DLZA 2C0TA 5ACBC 1BMKA 3EFWA 3MIAA 4YLJA 2XIRA 3SRVB 1Y91A 3KXXA 3QD0A 2XP2A 2RIOA 4O0YA 4ZS4A 4ZSEA 5CVGA 1V0PA 2W0JA 5HQ0A 2P33A 3QX2A 4CSVA 1OECA 3UC3A 1RE8A 2QONA 4DG3E 4KSPA 5CAUA 4C62A 3MI9A 3F7ZA 3F2AA 4CKJA 1WVYA 4ANLA 5A4CA 4OTHA 3FY0A 3R73A 4EK8A 2VNYA 3LQ5A 4A9TA 2ITVA 2YM4A 3I0OA 4GG7A 4X3FA 5M55A 4YC3A 3W2PA 3NYOA 4A9RA 5I3RA 2XB7A 4EZ5A 4ASXA 4ASEA 1H00A 3FZSA 5GZAA 3SG9A 5HI2A 4FTLA 2I7QA 2QR8A 2O5KA 4G5JA 5TE0A 3BGPA 1GY3A 4QMOA 4FEVA 1OL5A 3FKOA 1ZY5A 2YM3A 5CT7A 5HVYA 3SW7A 2WTKC 3A62A 3OCGA 3F88A 1A48A 3IGGA 1SVEA 4I23A 4FI1A 3SOCA 4R3CA 4Z9LA 3RPVA 4F0FA 3QQKA 5CEPA 5ANEA 4IAFA 2W5AA 3BLRA 5CAVA 4B7TA 4BKZA 3EQRA 1IASA 3BHTA 2VO3A 1FGKA 5HBJA 5GNKA 3W2OA 4LG4A 3U8WA 3UP2A 3Q96A 2V7OA 3C4FA 3POZA 3QA0A 3CJFA 4MBJA 4FEXA 5M08A 2GNJA 4K33A 4GK4A 3E64A 3NNVA 3QRUA 3VC4A 2ITXA 3PP1A 5M4FA 2PY3A 3EHAA 2XRUA 3OMVA 4RWJA 4K18A 3QWJA 3RPRA 2ITZA 4IVBA 3VS2A 3HEGA 3DQWA 3QTWA 3RK9A 4XV3A 5FEQA 5A4QA 3LMIA 3FMHA 4FGBA 3KY2A 4X0MA 4LGGA 2ZM4A 3SD0A 4AN2A 2VAGA 3F2NA 5CENA 1IA9A 3D4QA 4V0GA 4PV0A 2UZWE 3ATSA 4RWLA 4I6QA 1Y8YA 4I5PA 4C37A 1ZZ2A 4IZ7A 5CU6A 4PMPA 4IDVA 3TG1A 5E7RA 3OF0A 2ZDTA 4FR4A 4KIOA 4RT7A 5HGIA 1J7LA 3G51A 3D14A 2QC6A 4F1OA 1R39A 2O3PA 5DA3A 1B39A 4AW0A 5E4HA 4DG2E 5DE2A 4FSZA 5C9CA 1F0QA 1NVQA 3D5VA 4K6ZA 2J6MA 4D0XA 4D4YA 2JKKA 3T9TA 1P5EA 2O2UA 3BCEA 3N4UA 4FSWA 2IO6A 2OIDA 5DH3A 5BVNA 2G2FA 4FTUA 4HPTE 3FI4A 2Z60A 4M67A 2R3IA 3IK3A 2RL5A 4XV1A 3ZRMA 4ERKA 3OEZA 2FSOX 5IEYA 2XNBA 3FLSA 2PMOX 4MAOA 5JFVA 3QF9A 3ZM9A 4EQCA 5BQ0A 1REKA 1PKGA 3H9RA 4RVLA 5HZNA 4DF3A 3QTQA 4LGDA 3ZH8A 1VYWA 3MESA 1PRYA 3LPBA 2IW9A 3ROCA 4UZHA 4QP1A 5JEBA 3UPZA 2C5YA 3DXNA 3KN6A 3UOLA 5CQUA 4USEA 3Q6WA 2O65A 3LFEA 5HHWA 4JVGA 4NW5A 4CQEA 3O71A 5FXRA 3F7WA 5F9EA 4RBLA 4WHZA 5M07A 4R5SA 4BTJA 4CFVA 1ZOGA 4EORA 5HNIX 1H0WA 4HW7A 4IANA 2BRHA 4OR5A 5CU3A 4RQKA 2A0CX 1SVHA 2ZMCA 3A4OX 1YW2A 3NEWA 5DR9A 3U9CA 5CAQA 4CVAA 4IZAA 3DK6A 4M7IA 4FT9A 4GV1A 4C02A 4NM3A 1QCFA 4RG0A 1ZYJA 2BTSA 4A9UA 2OGVA 3Q6UA 2C4GA 2PVKA 4WNMA 4DBNA 3FXWA 4G9CA 3VBTA 4FMQA 2W5HA 4PNIA 4ZY6A 4PTGA 5FXQA 4JLCA 3K5VA 5J8IA 5KMIA 1YRPA 3F5UA 3MPTA 1Q8YA 3R21A 3MA6A 3UYSA 3PIXA 4FKSA 4FOCA 2CGUA 3FLWA 4GIIA 1Q3WA 4I6FA 4KKEA 3DK7A 1OIUA 4JQ7A 2PVYA 3QKKA 3ZHPC 3SGCA 4GL9A 5FDXA 3K3JA 3I1AA 4QNYA 3HMIA 3IW6A 4EQMA 3G9NA 4FV9A 4O96A 3ZO4A 4CCUA 4D2WA 4CMTA 2E2BA 5IF1A 4O1PA 4EYMA 5KMNA 4OTPA 3KXHA 4BCIA 3NRMA 4O83A 5L2WA 2YISA 3MBLA 4QP3A 3DS6A 3GQIA 3QX4A 4FE2A 5AWMA 3O7LD 3FMDA 1OGUA 1XR1A 3PFQA 2XK7A 3AOXA 3E7VA 3VVHA 1FVRA 4FL2A 3HRBA 2I0VA 3KULB 2J9MA 3UZTA 1Y6AA 3RHKA 1H07A 4RIXB 3CKWA 2W1HA 1T46A 5TT7A 3HA8A 3MDYA 5AUUA 2WD1A 3KF7A 4U45A 2XIKA 4NFMA 3RK7A 3UMWA 3PZEA 4KABA 4OUCA 2VTSA 3MPAA 5DEYA 3MFRA 5H8EA 2BRBA 3RWPA 4DH1A 3OXIA 3ZDIA 4O7VA 5EHYA 4XHKB 3C0IA 3SW4A 4O38A 2BALA 3MGYA 1OKZA 2PVRA 3R1YA 3D83A 1FVTA 2EB3A 3LJ0A 5DOSA 3W16A 1H08A 4JRNA 1PMUA 2XBAA 4HVHA 2J90A 3ZS5A 4CCBA 1TQPA 3NCGA 4AQCA 5LMAA 3W8LA 3VJNA 5J5SA 5KKRB 3R8MA 3AGMA 2R3RA 3GP0A 2R3MA 3ZTXA 5K0XA 2C6OA 1WVWA 2WXVA 3PVWA 4L7SA 3DA6A 2NP8A 3NUNA 3OCSA 4KNBA 4YPDA 2C6IA 3LXKA 5HE2A 1IRKA 1UU9A 3R00A 4N57A 1LP4A 3ZDUA 3DBCA 3JY0A 5FGKA 4WSQA 2JFMA 5A3XA 5IKWA 4EWQA 2B9FA 4CMUA 4L43A 4XOZA 5DFPA 4EBVA 4YTFA 4UY9A 2X2KA 3BRBA 3H9FA 3NX8A 2XKEA 3S95A 1KE9A 3VUMA 3W2CA 2Y7JA 3D5XA 3G9LX 4FKIA 3LXNA 4O22A 4U43A 4O0XA 5EHOA 3AQVA 4FSUA 4I0RA 1NY3A 3W2QA 4TW9A 1YWNA 1ZMWA 4HZRA 2WEVA 4AA5A 2XJ0A 4BIDA 3F3WA 2GQSA 3RNIA 1OUYA 3LCTA 5I9ZA 4CV8A 3KU2A 3DAKA 4C3FA 1ZYLA 5L2IA 4QYYA 3P08A 4U8ZA 3CKXA 3ZLXA 3R9HA 2R7IA 3MVJA 1DM2A 4M14A 3F3TA 2YACA 5H8BA 5ACKA 3G15A 4JG6A 3NZ0A 2UV2A 2ETRA 4W4VA 3UZPA 4FTTA 4U5JA 2ITPA 3NW6A 2OH4A 1NA7A 2RG6A 3GEQA 4CZUA 2GNLA 4BZOA 3QD3A 3UNZA 4TYIA 3W2SA 3EMGA 3LLTA 4JXFA 4YJSA 4YHFA 5FRIA 5HNGA 3LW0A 4FL3A 3OWPA 4YHTA 3MSSA 5CYIA 4N0SA 4FV3A 2UVYA 2F2UA 1EH4A 1P2AA 2H96A 5IQHA 5E1EA 5AP5A 2IPXA 4QQCA 4TYGA 4FBXA 5IMEA 4O7NA 4RJ7A 4D1XA 3TWJA 3MH0A 1GIJA 3IECA 3G90X 3DKFA 2GPHA 3A4PA 2GFCA 3RPYA 4CFNA 3V5QA 4ZTHA 4WRSA 1Q62A 3DAEA 2AC3A 3ORPA 5HX8A 4WT6A 1WBVA 2Q83A 3V5LA 3EKNA 4IWDA 4BHZA 2XKFA 3O0GA 4QYGA 5CVHA 3QWKA 2F49A 1GZKA 4PNKA 1YWRA 3GUBA 4FTAA 2OZOA 4ANMA 4E26A 4WUNA 2XH5A 4AU8A 4QTEA 2QOCA 3R1NA 4NWMA 4O21A 5GINE 4FYOA 4YUQA 2CNUA 4FEQA 2YCFA 5HD4A 2PE0A 4BWKA 4TY1A 4CZYB 4FVQA 4PDPA 4HVSA 5BNJA 3R8UA 4FTCA 1CTPE 2CLQA 4YSMA 1ZRZA 3UNJA 1TQMA 4FV4A 5I9YA 2WTVA 3BE2A 3ULIA 5KUPA 4QMVA 4G9RA 1Q99A 3PUPA 3MY1A 3DXPA 2WU7A 2OJIA 5BYYA 4BCKA 2PULA 4O81A 4KRDA 4V04A 2VN9A 3QQHA 2CGVA 5L6WL 5E8SA 3A7IA 3QCXA 2G2HA 1CSNA 4W4YA 4EOOA 1YHSA 4CD0A 3DLSA 3CP9A 3QCSA 3FZ1A 4JDIA 3MPMA 4EK3A 3MA3A 4MWIA 5DMZA 3MFUA 4BDAA 3DTCA 4IBMA 5KMMA 3E92A 3VWAA 4RSSA 3TT0A 2V22A 5DG5A 4KAOA 2OKRA 5BX0A 4G3CA 3PXQA 2PK9A 3KMUA 2IW8A 2PU8A 3R2YA 3II5A 4IJPA 2WKMA 3R0TA 1NVSA 4KA3A 4XH6A 4CKIA 3S1HA 4IE9A 3R7YA 3E8EA 3QLGA 1Y6BA 3ORKA 2W96B 4N4SA 3SVVA 4X6QC 1XH7A 4FTQA 4IQ6A 3M42A 2JIIA 2BFXA 1OL7A 3S0OA 3MJ1A 3LIJA 3BI6A 3BE9A 3R1QA 3AGLA 3QQGA 1ZYDA 4QMSA 5EM7A 2E9PA 4AUAA 3PLSA 2PZYA 4FZ7A 3NYVA 3BBTB 2BR1A 4FTKA 4RX8A 4C2WA 3U6HA 2YN8A 3KK8A 3NUUA 4RIWB 2IW6A 2HXQA 3GB2A 4FKUA 5AV0A 4DCAA 4FSMA 3K5UA 2YLFA 4AW1A 2CKOA 2VX3A 4O2ZA 2PVLA 4CYJA 2Z2WA 5AR4A 2B0QA 1F3MC 5EM5A 2XYNA 3Q5IA 5HLPA 1VJYA 5J87A 5ANIA 2OG8A 5DR6A 4E6DA 1GIIA 2HY0A 3A7HA 4Q5EA 4TRLA 4EH3A 3BHYA 4FODA 3H9OA 4FSTA 4ZY4A 3VF9A 4HCTA 3E8DA 5E90A 5AP3A 2XIYA 5C8NA 1XQZA 3O8UA 4YPSA 2H34A 2LAVA 5KZ0A 3P4KA 1OUKA 2VTJA 3Q32A 3TIZA 3TV6A 4Y83A 2JBOA 4NKSA 3G5DA 3KRXA 3MY0A 4UMTA 3PLAE 4YMJA 4FT0A 1ZARA 4UXLA 5HG9A 2R3GA 3GFEA 3V5TA 4F08A 2G9XA 4ZS0A 2C5OA 3RMFA 5JGDA 3CTQA 4XNEA 1AD5A 4F9AA 4QTAA 3FL5A 5KO1A 3DNDA 3HV3A 4XG8A 4J8MA 5AUZA 1OIRA 3MV5A 2WTIA 4G17A 4B9DA 1FINA 2Y4IB 3GU4A 4U80A 4BCQA 4KKHA 5D7AA 3TN8A 2C5VA 4AS0A 4ZTSA 5IQGA 1R0EA 1R78A 4HGLA 2QI8A 3RAWA 3F6XA 3T9IA 3I60A 4GMYA 3TZ9A 4I20A 3JUHA 3BGQA 4JS8A 4OGRA 5E8XA 4DGNA 4UYNA 4JT3A 3FYJX 1XH5A 4F7JA 4IZ5A 4WRGA 3ULZA 3TDVA 3NNXA 4TPTA 2W1DA 1R0PA 3DTWA 2YAKA 4X2FA 2UUEA 3O96A 3QRKA 2BVAA 2W4JA 3KXNA 5CU2A 5HE0A 3VULA 2JDRA 3FPMA 3RK5A 5I5ZA 3GGFA 4ANOA 2UZNA 2YWPA 3E3PA 3VQUA 4CRSA 3OUKA 4P4CA 4ZSAA 4IM2A 4L67A 3T3VA 1Q5KA 3R6XA 2HXLA 4GUBA 4ITHA 3IW4A 3OWKA 2QO7A 3WYXA 1WBWA 1Z9XA 2X6EA 5JMSA 4ALWA 1JSVA 2E9OA 4C7TA 4PMSA 4QRCA 1OITA 3L8SA 5I9VA 3PXYA 1Q8TA 1ATPE 1Q61A 3PIZA 3JVSA 4OTRA 3NUYA 5CXZA 3NUAA 1Z5MA 3L8VA 1DAWA 4QMXA 4I93A 3FC1X 2Q0BA 2F2CB 2QVSE 3BYUA 3QGYA 4LRKA 5T6KA 3SXRA 3DT1A 5F94A 4EUTA 5J5TA 4U42A 4LI5A 3SAYA 4DLIA 4XG2A 2ZV2A 2GCDA 2BAKA 2GS6A 3MVLA 2GS2A 4QNAA 4ZAUA 3NAYA 4FIGA 3LFSA 4ZJJA 4E4XA 1OBDA 4TWNA 3N4TA 3PA4A 4BDBA 2EXCX 2B4SB 1UU7A 4YLLA 3HMMA 3Q52A 4CTBA 5JFSA 5ETCA 5C4KA 3EQPA 1JNKA 4FTIA 2V62A 5EKNA 4OBPA 4LM5A 3FMKA 4G3FA 3ZYAA 3VNTA 5J79A 4MBLA 2I6LA 4I5MA 2GHMA 5A4TA 4G3EA 2C5NA 3TKIA 4NJDA 3RJCA 4BWPA 3VRYA 4OTDA 1CDKA 4FKVA 3WF8A 3O51A 2EXEA 4FTOA 4BTKA 2QCSA 3M11A 3KA0A 3P1AA 4HGEA 3UNKA 3DXQA 2R3OA 3AC5A 4XBUA 2HW6A 5BVWA 3PZHA 1PMVA 5AV2A 4XMOA 4NYEA 4M69B 2B1PA 3DDQA 4OTQA 3F5XA 4E5BA 4RA5A 5HCXA 3MH3A 3UQGA 5HTCA 2OBJA 5KZIA 3GC9A 3WBLA 3PG3A 3U9NA 2BMCA 4KBKA 4PPCA 4W8DA 4PP9A 3OS3A 2W1ZA 3OY3A 4C61A 4EOKA 3C50A 3LFNA 3QUPA 4A7CA 3C5UA 4BYJA 4YBKA 2VNWA 4QP6A 4RC4A 5K5XA 3OG7A 3EYHA 3G6GA 4O0WA 1M17A 1OL2A 4GJ2A 3LCKA 4BDJA 3PSCA 3Q4CA 4KINA 5D9HA 4BRXA 5FTGA 2H6DA 3U6JA 3CPCA 4U0IA 4BBEA 4ENYA 1YI4A 5L8KA 2YHVA 4DG0E 3VN9A 1XH4A 3CQEA 4DEAA 2WMTA 3Q53A 4LMNA 3M1SA 3TACA 3VBWA 3OP5A 4F99A 4I0TA 3UO5A 4FA2A 3JS2A 2PZRA 3GFWA 3KN5A 4O0SA 4FSNA 4AOIA 3BV2A 5EM6A 3ENMA 4FKLA 3W8QA 5L6PA 5EM8A 4O0VA 3QAME 4TWCA 4EOMA 1YOMA 4W9WA 2J0IA 5LVNA 2XF0A 3DBEA 4IAYA 3UQFA 3NDMA 4S34A 4CLJA 3PP0A 4I41A 3QTIA 5IG1A 3IOKA 5AAGA 1ZOHA 4G3DA 3CSVA 4MXAA 4QPMA 2UW5A 1W98A 4BGGA 5EQEA 2KTYA 3LAUA 3EQIA 5E8TA 5CAOA 3SDJA 3ERKA 2FYSA 3PY3A 1OL1A 3KF4A 3RAKA 3N9XA 1WBNA 2ZYBA 2GTNA 4MCVA 5CI6A 3V51A 2RSVA 2OK1A 4BR3A 2UZDA 4MD9E 4BB4A 4RX9A 1R1WA 3PWDA 3UTOA 3VQHA 5J1WA 5F95A 1XBBA 3D0EA 4IB3A 4OTWA 4R8QA 2X9EA 2YJRA 3UIUA 2HZ0A 1XKKA 3AXWA 3R2BA 2X7GA 1G8SA 5E8YA 3R9DA 4P5ZA 4RJ8A 2GNHA 5LVPA 1R3CA 3H0ZA 4YZ9A 4YZBA 3FPQA 5HVJA 1JAMA 3ORNA 4LL0A 3EN5A 3WE4A 3O23A 5EKOA 1YWVA 2A4LA 4OLIA 3FXZA 1G5SA 3MH2A 5IU2A 4MBIA 2OLCA 3ZZWA 1ND4A 3R71A 2QOFA 4PPBA 3R7VA 1LR4A 4KWPA 1JPAA 1PXPA 2UW4A 4JI9A 3W33A 3A99A 1Y8GA 4I5HA 4YLKA 3FE3A 3CEKA 2UZTA 4I21A 4X3FB 5CEQA 4BF2A 4HYHA 4YJUA 3V8SA 2VTTA 4NU1A 2R4BA 2XRWA 3IW8A 1OI9A 1VEBA 2WGJA 4KIPA 4AZFA 4CEGA 2JKMA 4D2RA 5I3OA 2R3HA 5C03A 5A4EA 3HRFA 5E1SA 5ANKA 4MF1A 4M15A 2ZB1A 1OKVA 2RFDA 3EOCA 3FQHA 4L68A 4RIYA 5AIKA 2CN8A 4E20A 4ARKA 4MQ2A 1IA8A 1BI7A 4AGUA 3I6UA 3C51A 5CSXA 3ZEWA 4FZ6A 4X2KA 4FSQA 3KQ7A 2QHMA 2YM8A 4L42A 3I5NA 4GEOA 4BDHA 4BCGA 4M12A 2GNGA 3PJ3A 1OPLA 3UG2A 2YLEA 3HV7A 4NM7A 4H58A 4M13A 3Q4ZA 4UMQA 1GIHA 4MH7A 5LARA 3CE3A 4EOSA 2YIRA 4FNWA 3NIEA 4S2ZA 5JGAA 2WMBA 2W9FB 3LXLA 3VBQA 2P4IA 3TZMA 3QTXA 4F9CA 3ALOA 4O86A 4QP4A 4DFUA 3IDBA 3SV0A 4M84A 3ZO3A 2YM6A 4GUEA 1PXMA 4PDOA 5FDPA 2VTIA 3Q04A 5BVKA 2CPKE 1Q4LA 5TOZA 4J97A 2CLXA 4OTIA 4X7QA 4F6WA 2FGIA 4JDJA 4AFJA 3EJ1A 2UZUE 3UYTA 3KVXA 3KKVA 4L52A 3NW5A 4Y95A 1OIQA 4QQ5A 4CT2A 2A2AA 2UZEA 3B8QA 4V0GB 4XV9A 2CKPA 2C3JA 1UU8A 3ZCLA 3HKOA 4JG8A 4M68A 4G3GA 5KNJA 2PUUA 2DUVA 3AG9A 2UW6A 2VWYA 2JKQA 3P78A 3K2LA 5DVRA 5C8MA 3GCUA 3FMLA 3OOGA 5G1XA 3IW5A 3AT3A 3F5PA 2EUFB 1FPUA 2CJMA 3MFTA 2RFSA 4FVRA 3CBLA 4J52A 4M3QA 5C27A 4A06A 2DS1A 4A9YA 4PX6A 4ZLZA 2C3KA 2WOTA 4I1ZA 2CKQA 1V0OA 1O9UA 3HMNA 4C35A 4RJ3A 5EFQA 4FX3A 3KRLA 2CCHA 3EN6A 4EK4A 2PVFA 1JKKA 4XRLA 3TNPC 1M7NA 2J0MB 5M56A 5EDQA 2BFYA 5HO6A 3F66A 1XBAA 2YIWA 4LFIA 4F0IA 3EQBA 4QTBA 4RGJA 4TNDA 4RFZA 5EW8A 1HCKA 4IAIA 4KBCA 5HCZA 1XWSA 2W1IA 2WIPA 1UNHA 4RWKA 2B9JA 2UW7A 3ZXZA 4F7NA 2GHGA 5CASA 2C6TA 4UB7A 3IKAA 4BI2A 3ZSIA 2I0EA 2OO8X 3O7LB 4YJTA 4EYJA 5IEXA 4IX6A 4C59A 3FI2A 3EQGA 4H3PA 4DH3A 5IUHA 3VS7A 3MB7A 4TYHB 1KSWA 2VRXA 2WMSA 2XIXA 3RVGA 4TWPA 4DITA 4F1MA 3V6SA 5JQ5A 4FEWA 1JLUE 3DB6A 5M44A 4EI4A 3GOPA 4B8MA 4ASDA 5JQ8A 4F9YA 2B9HA 4FV7A 4FV6A 4K8AA 5HE1A 2R3NA 5L2SA 3F3UA 4HPUE 5GZ9A 3UGCA 4YURA 5AUVA 3UODA 4G6OA 5KMJA 3HDNA 5DYJA 5CAPA 4AGDA 3R8VA 5AUTA 3MJ2A 3D2KA 3Q3BA 3OBJA 2WQNA 1XHAA 4M97A 5B7VA 4FSRA 3BZ3A 3CGOA 3BEGA 4WUAA 4MD7E 5IA1A 5KBRA 1URWA 2YERA 3TJCA 4FSYA 2G2IA 4C34A 5HTIA 3MFSA 5ANJA 4IC7A 4J98A 4PDSA 5EOLA 4IADA 5CNOA 3P5KA 3DCVA 4FNYA 5HIDA 3QYWA 2EB2A 4L00A 1F5QA 1U59A 3KRWA 3ORIA 3PXFA 3LFFA 5AP0A 3H0YA 3QYZA 4NUSA 1WBSA 3V3VA 2XK4A 3DZQA 3GCSA 2XUUA 4QP2A 4YJPA 3ZUUA 4MK0A 3FLZA 5HBEA 4QD6A 3H30A 3RWQA 5AMNA 5ETAA 3ZOSA 2B9IA 3HUBA 4F64A 4L8MA 3TXOA 2OZAA 3ETAA 1H24A 4KD1A 5A54A 4O6LA 5K9IA 3POOA 4JNWA 2X0GA 4MXCA 3E93A 4WSYA 5H2UA 3OT3A 5IH5A 3D5UA 3C0HA 3RCJA 3ZLWA 1OM1A 1Y57A 4OT5A 3BHHA 3PPKA 3QTRA 4YBJA 5D10A 5M51A 3HL7A 2J51A 2RF9A 3VS6A 2QG5A 3ZBFA 3NAXA 4DE4A 1H1RA 4AZWA 4E4NA 3UQCA 3GU7A 2R3KA 4APCA 4RLLA 3LJ2A 4MEDA 2XJ1A 2R0UA 4NCTC 3V01A 3CXWA 2XVDA 4EOPA 3L9PA 3OOMA 1Q8ZA 1SVGA 5K4JA 4MXXA 4DGLC 2E9VA 3QHRA 3ZMMA 5K5NA 2Z7QA 3PRIA 3TM0A 2Z7RA 1GJOA 3S3IA 3BWFA 1E1XA 2C30A 2WO6A 3FI8A 1OB3A 1FBNA 4YC8A 3CD3A 4ZTQA 4GFOA 1IG1A 3GI3A 3L9MA 1VYZA 2W9ZB 4E93A 3V5WA 4C4EA 5FG8A 5AM6A 3V8WA 4E8AA 2GFSA 2ESMA 4XLVA 1CKJA 1J1CA 4JAIA 4BGQA 5JZNA 3GENA 4O1OA 3KXGA 4FUYA 5FBOA 2J7TA 3ID6C 1H26A 2HW7A 4EHZA 4EL9A 2OFUA 3WOWA 2X6DA 2P55A 3BYSA 3UVRA 1IAHA 2EWAA 4BDKA 4D4SA 4JDKA 4RVMA 2UVXA 5B0XA 1LPUA 4GKHA 3UPXA 3FKNA 2WQMA 4DFYA 3HRCA 1QL6A 1DAYA 2NNWB 3TNWA 2ZV9A 3NGAA 4I4FA 3R04A 4FKGA 4U79A 3OCBA 4I5CA 4UMRA 2OW3A 4RC2A 3WIKA 3C5IA 4QMTA 3CY2A 3OD6X 4F63A 2OF4A 4TKSA 5CNNA 4LOQA 3PJ8A 4EKLA 2C69A 2QU6A 3CY3A 3QQFA 2BHHA 2YFXA 2Z8CA 5L4QA 3NLBA 2RKUA 3QBNA 2XCKA 4Z7GA 2XNNA 4PY1A 1YI6A 5HTBA 4IM3A 4F6UA 4ZZOA 2BTRA 1TKIA 3BQCA 3ELJA 4ZEGA 3EFJA 1P14A 1W82A 3MW1A 5LOHA 4PP7A 3FYKX 1O6LA 2B7AA 4HNFA 3FMNA 4LV5A 5CU0A 5M57A 4QMUA 3BKBA 3D2IA 3PYYA 1Q8WA 2EU9A 4A07A 3GC7A 4DGMA 1PYXA 4ASZA 4ACCA 4G34A 3OC1A 2J2IB 4I6HA 3PPJA 4O0RA 3E62A 4OW8A 2VWUA 2WELA 5FUTA 2XEZA 1OZ1A 4LGHA 4D2PA 3DOGA 4JBPA 3V5PA 1Q41A 3FY2A 2P0CA 3P86A 5HBHA 3WYYA 1SM2A 5AEPA 2PL0A 5BYZA 2R64A 3OTVA 2J0JA 2UVZA 4N6ZA 2OXXA 4KSQA 5CSVA 5HX6A 3FZPA 4H1MA 3BHUA 3PVBA 4DH8A 5LMBA 1PXLA 3NVMB 4CGAA 3AC1A 2I40A 5HIEA 4DEEA 3C0GA 2VTHA 2IZTA 2W1FA 5DWRA 3D7TA 4IVDA 4B8LA 1RQQA 1ZOEA 3NYNA 5JT2A 4IEBA 4GFGA 4W4XA 5IQEA 3GC8A 2R3LA 4YTCA 1UU3A 2J0LA 4WNKA 4TNBA 4FTRA 5BMSA 4FKOA 4FV0A 4E73A 4CNHA 5J7BA 5IA2A 4EOJA 1FGIA 4R1YA 4MTAA 5DPVA 1B6CB 2OH0E 5EW3A 4CT1A 2BAJA 4R3RA 1FOTA 3ODZX 5ETFA 2R3QA 2YAAA 4CXAA 2PE1A 4BC6A 3O50A 4JAJA 4XG9A 3AC4A 2WMRA 4DFZE 5FP6A 3GT8A 3UMXA 5IMXA 1AQ1A 4QMMA 3GC0A 1MQ4A 3CIKA 3BYOA 3L1SA 1OPKA 3DU8A 3OROA 3U87A 1BL7A 3KCFA 5BUJA 2XM9A 3QQUA 1KOAA 2HYYA 3N51A 4FZAB 4QOXA 4Y5QA 5JFXA 3JPVA 1JSUA 5EG3A 5L2TA 5IA5A 2P3GX 1XH9A 5CF4A 1JOWB 2X1NA 4UWBA 5KKRC 2VX1A 2YM7A 3TUCA 4ACGA 2CGXA 3R28A 3AD4A 4AZVA 4ENXA 3P79A 5CF5A 4XYFA 2HOGA 2OFVA 4EOLA 2V0DA 4AT5A 1PY5A 4D2TA 4H1JA 4WG5A 5ETIA 4IH8A 3DAJA 2R3PA 4L6QA 5A14A 4DN5A 3R01A 4J71A 2J50A 4RPVA 5AAFA 4U81A 4DLJA 3PDTA 5B2KA 2ZVAA 4CQGA 3CPBA 3L9NA 2R7BA 3I7BA 4I3ZA 2C6MA 3RBWA 3PXZA 2OWBA 5HG5A 3ZO1A 4S31A 4CFFA 5A6NA 2ACXA 2XNGA 4IMYA 5HG8A 2VTRA 5HKMA 5KCVA 3PRFA 4YP8A 2BUJA 3NUPA 3ODYX 5DEWA 4IHPA 1SYKA 4O7ZA 4I4EA 1LUFA 3LLAA 3HZTA 2GNIA 3R7EA 2YITA 4FF8A 4AT4A 3WF5A 2CHLA 4H3QA 3TKHA 4ALVA 4FV2A 3UIMA 4YJQA 2DQ7X 2C0OA 4M0ZA 4HVDA 2NPQA 1V1KA 2XKCA 4RMZA 4C8BA 4O7SA 3A7GA 5A6OA 2QODA 4QO9A 2RGPA 2Y9QA 3E87A 2FVDA 3BEAA 4LRMA 3R7UA 2UW3A 1U54A 1YDSE 1ZZLA 3LE6A 4KRCA 3TKUA 3TTJA 4EHEA 3RAHA 1ZMUA 5AP6A 4NTSA 3K3IA 3KVWA 3KC3A 5JGBA 2XM8A 3ENHA 4PL5A 1UWHA 3PJ1A 3HAVA 4J7BA 4CTCA 1K9AA 4YJNA 4M0YA 5IQDA 3JY9A 5K0KA 4QMNA 4F0GA 1ZAOA 5T3QA 5D11A 4OTGA 4O27B 3MIYA 2WAJA 5GHVA 3OXTA 2WEIA 5TO8A 1LEZA 4BYIA 4EHGA 5J9ZA 4JQ8A 3IG7A 3UJGA 2FB8A 1APME 2CN5A 3TIYA 1PHKA 2W99B 2PVHA 3EQFA 3H3CA 5FTQA 3UZRA 5HU3A 2W4KA 4R7HA 4GKIA 3IW7A 3SX9A 4W4WA 3FV8A 1BKXA 1M52A 4RX5A 4YJVA 2X2LA 4ZLOA 2VGOA 4M66A 5L6OA 3LFAA 1U46A 3NCZA 3WARA 4GYGA 4HOKA 3SG8A 3FQEA 4BCMA 3EL8A 4G2FA 4RJ5A 5EHLA 4DC2A 3HMPA 5BUIA 3LXPA 2G1TA 1W0XC 4AA4A 1RJBA 3QCQA 4D9TA 2UW9A 2V5QA 1WBTA 4EKKA 3PE1A 2YZAA 4AF3A 4DEDA 3FZOA 4XV2A 4LUDA 3ZSGA 1MRUA 2WTWA 2YA9A 5M4CA 3E3BX 3FLNC 4MNEA 4CFUA 4DFXE 5B2MA 1JKTA 4QYEA 5LVOA 1BUHA 3LCDA 5GZ8A 1H1PA 2C3LA 2QOQA 3FBVA 4EJNA 3QQJA 4RZWA 4B0GA 3KXZA 3OUNB 4DTBA 3PY1A 5AIRA 1YKRA 4TTHB 2C6LA 4LQMA 4B99A 4FT7A 3WIGA 3BHVA 3A2CA 2OICA 2WMQA 4W9XA 3UVQA 3ZRLA 3QZGA 4QP9A 4AAAA 4A4OA 2YCSA 5DI1A 4BTFA 3LZBA 1WBPA 4B6LA 5JZJA 1MP8A 3SC1A 5HO7A 5AA9A 1UV5A 3COHA 3LKMA 4EH2A 3FSKA 1IAJA 5L2QA 5TR6A 1YDRE 2F7XE 4F70A 5C01A 4GVJA 1REJA 4ZSGA 1BX6A 1ZYSA 1M7QA 4XEYA 4EUUA 3Q60A 4LOPA 3K54A 2YIYA 3DDPA 1YQJA 4UV0A 5LMKC 4O7RA 3CC6A 4DEGA 4LYNA 3EQCA 2R0IA 4YO4A 3IO7A 2XK3A 3R7IA 2BDFA 2ITYA 3HECA 4QMZA 3WF7A 1PXOA 2VWXA 4Y72A 3RM7A 3RZFA 1GZNA 4HCVA 1H0VA 3ZO2A 3C4EA 1H4LA 3LCSA 4QTDA 5IA3A 4L45A 4QT1A 5CEMA 4IXPA 4G5PA 4S32A 3ET7A 3ZBXA 1UKHA 4O82A 4Q9SA 4NZWB 5KHWA 2JC6A 2BHEA 5CANA 2FSLX 2R3JA 4Y8DA 5ANGA 3UOHA 3FQSA 2SRCA 1UNLA 4FIFA 4ZJVA 5HESA 1PW2A 3D15A 4HYSA 3TZ7A 3QD4A 4IC8A 3TNQB 5HLWA 3TNHA 2VWIA 4FNXA 1H1SA 4TXCA 4KIQA 2F7EE 4RC3A 3ZC6A 1VR2A 3S00A 4I0SA 3TUDA 4H3BA 2YM5A 3FWQA 3LFQA 4BWXA 2A1AB 2VWBA 2O63A 4YJRA 3B2WA 1FMKA 2C0IA 2BDWA 4NSTA 3EWHA 2Z02A 3ANRA 3AMBA 1MRYA 3EQHA 5D41A 4R7BA 1DI9A 3U54A 4PTEA 1M14A 3DNEA 4R77A 5IDPA 3HAMA 1YHWA 2Y4IC 3O17A 2XNEA 3QL8A 4FYNA 5IQIA 3DZOA 5IQCA 2R3FA 2VO0A 4TT7A 5HOAA 3BU6A 4MXOA 1UA2A 4U40A 2IVTA 4GT3A 3EFLA 1YXSA 5CVFA 1PF8A 3N4VA 2VTLA 2BROA 4R1VA 2WMWA 4FKTA 4OBOA 3F9NA 3R30A 3L8XA 4BZDA 2IZUA 2OJ9A 3MTFA 3DB8A 3BU5A 5H8GA 2GSFA 3HP5A 3GU6A 3LHJA 1XO2B 4L9IA 3ANQA 3PE2A 4ANBA 2FO0A 4C3RA 3GU5A 4EEVA 3DQXA 3DKOA 4IWOA 4YGAA 4DFLA 4F1TA 5CSPA 4CG9A 4UALA 3RTPA 2X39A 4AE9A 4HNIA 4PUZA 2IG7A 1PXKA 1XBCA 5ANDA 5AA8A 2XNOA 5L3AA 3IOPA 4J1RA 3DY7A 2Y4PA 3OY1A 5HICA 4Y5HA 2ZOQA 4XP3A 3GVUA 5AUWA 4YZNA 3JR1A 3VS0A 5G6VA 4BHNA 3B8RA 3NW7A 3KMMA 3E8CA 4AN3A 2QOKA 4E3CA 2CDZA 2WQEA 4KIKA 2AUHA 2YDJA 1E1VA 3QFVA 4OBQA 4RIYB 5IA4A 1KUTA 5AV4A 1MQBA 1ZWSA 2GQGA 3SOAA 5E8ZA 4BL1A 3CTHA 5DRDA 2C68A 1JBPE 3NVKI 2REIA 3OFMA 4FZDB 5EK7A 4BGHA 5CWZA 3VAPA 3AMAA 2JDSA 1RW8A 2XA4A 4IACA 2XKDA 2VTOA 5HVKA 1JKSA 2RFEA 4J53A 4KB8A 2QOIA 5EYDA 3ORXA 3R63A 3U6IA 3TI1A 3QC9A 4E5AX 3HUCA 4WKQA 4L3PA 3C1XA 2NRYA 2DYLA 4FKJA 5JH6A 2P2HA 2Y6OA 3OCTA 2ONLC 1PKDA 4JBQA 3E8NA 3G6HA 4WO5A 3VW8A 2WFYA 1SMHA 4FUXA 4QYHA 3HVCA 5CEIA 4USFA 2Z7LA 2A27A 3WILA 2FSTX 2R5TA 3QZFA 2UZOA 2IVSA 4JRVA 4MXZA 4QMLA 4L3JA 3E63A 2O8YA 2WMVA 3FHRA 5EDPA 4L3LA 1S9IA 4FIJA 4FT5A 4UBAA 3DV3A 3QZIA 1P4FA 3ZFMA 5GJFA 4EH6A 2ZM3A 2F7ZE 3VBXA 1Q97A 4GK2A 4GFMA 4AGWA 4BFMA 1XH8A 3RP9A 4BCJA 3HLLA 4K11A 5FWKK 4CG8A 1CKPA 4OAUC 2QLQA 4C4GA 5LVMA 4EH5A 5ITAA 4ZMEA 2CKEA 3FSFA 3FMMA 4V01A 1WCCA 5I9UA 4ZLYA 4AZTA 3NYXA 3DFAA 1WBOA 1KWPA 4Z16A 4RLKA 4O91A 3ZEPA 5KMOA 3ZLYA 3BLQA 5GIOE 1AGWA 3T8OA 4EC8A 3IGOA 3RPOA 3A61A 2Y8OA 5HD7A 3D5WA 1A06A 3C4XA 4GS6A 5E8UA 4L7FA 4JBVA 4O6EA 3OZ6A 3PJCA 4EH7A 4F7LA 4JX7A 2YDIA 1KE7A 4JJRA 4XUFA 4FGRA 4O84A 3Q9WA 2BZKB 5CALA 2YEXA 2A19B 2YCQA 2YABA 4YZCA 5AR8A 2ITOA 3UOJA 5H3QA 3VIDA 4AZEA 3CD8A 3B2TA 4NH1A 4J95A 4GW8A 4IWQA 3Q2JA 1J1BA 2CSNA 3W1FA 1BLXA 4IAZA 2QKWB 3JVRA 3ORZA 4EHVA 2QNJA 2WNTA 1KV2A 3OWLA 4XS2A 4BDFA 3TEIA 2YZLA 2OIQA 3IQ7A 3CLYA 3MS9A 4U3ZA 2BRMA 3E88A 3PXRA 4X2NA 1GOLA 2P2IA 4DYMA 2PMLX 3H4JA 5CLPA 3EYGA 4TYJA 3BBWA 1HCLA 4NIFA 4F09A 4CMOA 2RG5A 3ACJA 3I6WA 1OPJA 4ONAA 3THBA 1WZYA 3QQLA 2QHNA 4FK6A 2XS0A 4BIEA 3EL7A 3R9RA 3NWWA 4FIIA 1K3AA 3D94A 1CKIA 2VTAA 1G3NA 2WB8A 2CMWA 4DT8A 2VZ6A 3UIXA 2W17A 4AG8A 2GS7A 2VTNA 5EYKA 3EN9A 3R8LA 2BZIB 2VUWA 3P7BA 3KGAA 3MYGA 4ZSJA 4RJ6A 2ZAZA 4X2JA 5BVFA 1XJDA 4R7IA 4X3FC 3DPKA 4C0TA 4RA4A 4FKWA 3QTUA 3DGKA 4IDTA 5FTOA 4DAWA 4DEHA 4MVFA 5ANOA 3U4UA 3G0EA 5F4NA 5DT4A 4GU6A 3QRTA 2OZAB 4FV1A 4GT4A 5A9UA 4O7TA 4JIKA 3CS9A 5GJGA 2WPAA 5J95A 3ACKA 1SNUA 3RHXA 2G15A 2E9UA 4BBFA 4EK6A 2WIHA 1WVXA 4V05A 5GIPE 2FUMA 4AN9A 3F61A 3GBZA 4NT4A 4FKPA 2VGPA 3KXMA 3WI6A 4BKJA 2CNQA 5IDNA 4KS7A 3VUDA 4ZTLA 3BWJA 1T45A 2Z7SA 3P7CA 2UZBA 2PVJA 3EN7A 4Y46A 4LV8A 4QMWA 4BI1A 4ITJA 2QD9A 3WZEA 5M06A 3UE4A 5DIAA 2QR7A 1RDQE 3QA8A 3KL8A 4NJ3A 1CM8A 1Q3DA 2KULA 4TN6A 4BDDA 5J7HA 1BI8A 2YIQA 3RPSA 1VZOA 2WMAA 3DBDA 4XJ0A 5JSMA 3RM6A 5EH0A 3O2MA 4HGSA 4BDEA 4GCJA 2PTKA 2BDJA 1PXIA 2JLDA 2XEYA 2XJ2A 4ZMFA 3VUKA 2BRGA 2VTMA 2WOUA
chains in the Genus database with same CATH superfamily
3UP7A 3VBVA 2VO7A 3TZ8A 4Z3VA 4DH5A 1YHVA 3HV4A 3SRVA 3PPZA 4E7WA 4GU9A 4R6VA 2JDOA 4X3JA 2PVMA 4OAVB 4XG6A 3SXFA 4RIOA 3EQDA 3GU8A 3JYAA 3FC2A 4X21A 4K9YA 5DLSA 3V8TA 4EH9A 2JIVA 3QD2B 1G8AA 2IJMA 4YSJA 3WZKA 4O0TA 1Z57A 3FDNA 4HYUA 2IZRA 4MX9A 1L8TA 2XMYA 3A8XA 2ZV7A 2GNFA 2C5XA 3NNUA 3S4QA 4O7YA 4IVCA 5EI8A 1O6KA 2W06A 5L8LA 2ZFYA 2HY81 1YOLA 4PWNA 4XP0A 3F69A 3FL4A 2ZDUA 4FZFB 4QQJA 3FUPA 3RZBA 3R9OA 2PUIA 2W7XA 4J96A 2ETKA 4FKQA 2VU3A 5FBNC 3G33A 4IZYA 5K3YA 1ERKA 2OXDA 2ZJWA 2QO9A 3NNWA 3GNIB 2PZ5A 1M2QA 4K1BA 1XMMA 1NVRA 1OIYA 3LQ3A 4Q2AA 3MB6A 1YXXA 1NT2A 1GZOA 4NM0A 1U4DA 1J91A 2C6EA 3GQLA 3FMEA 3VUTA 2WQBA 1PXJA 5B2LA 3TDWA 4A4XA 3ZRKA 4I94A 4C3PA 3R8ZA 3MH1A 2BIKB 3R1SA 4MD8E 4O7WA 5D12A 5DHJA 5K4IA 4WNPA 4FK3A 4XLIA 4DA5A 2DWBA 4ZIMA 4BBMA 5IQFA 4JQEA 1BL6A 4NCTA 3HV6A 3SLSA 4ANSA 3ORTA 5J9LA 2W05A 2X7OA 5AP7A 3TL8A 4GK3A 3OBGA 5FD2A 2WTDA 1FQ1B 5AV3A 2XNPA 3ZSHA 3BL9A 3PTGA 3UVPA 2ITUA 3REPA 5AP1A 3D7ZA 4TYHA 4DCEA 2VWWA 4E6QA 1H27A 5JFWA 5LQFA 4BY9E 3NS9A 1YI3A 3ITZA 4GH2A 3DFCB 4IFCA 4U7ZA 2QQ7A 1UVRA 4X2GA 5CU4A 3LQ8A 4HZSA 4K0YA 2H9VA 5TKDA 4N70A 4JL9A 3OW3A 3HX4A 4AZSA 5DGZA 4GG5A 4AXAA 2X8EA 2PPQA 3P5JC 1KE6A 2PWLA 4GT5A 5ICPA 4UX9A 2BZJA 3KFAA 4O0UA 1CMKE 2ERZE 2XK8A 5H9BA 3H10A 5BMMA 4JBOA 3F3VA 3D7TB 4D9UA 4XBRA 4KUJA 2F9GA 2W5BA 2NRUA 2VWVA 5CZIA 3NFFB 2JAVA 4BI0A 4QDEA 3VF8A 3QLFA 3TNIA 3QCYA 2GMXA 4IX3A 4D58A 4FG8A 2HELA 3ALNA 3E7OA 3FXXA 3SA0A 2XK6A 4P90A 2QU5A 1WAKA 3UG1A 5HORA 2CNVA 3CJGA 3QU0A 4FKRA 3AD6A 3FLQA 4RFYA 1FVVA 5D7VA 3O8PA 3ORMA 4YTIA 4YR8A 5AAEA 4G31A 4D0WA 3KCKA 3A7JA 5CEOA 2C6DA 1U5QA 4UZDA 5CS6A 5J1VA 3UDBA 1H1WA 5IZFA 3MY5A 4GIHA 3NR9A 3EZRA 5AX9A 4R5YA 3VS5A 4XX9A 2B53A 3KRRA 4ACHA 2CCIA 3AMYA 2PHKA 5DR2A 4C4FA 2C6KA 3MWUA 4P7EA 4K77A 3ZLSA 3LVPA 4FL1A 4FVPA 4L53A 1E9HA 2HIWA 3QZHA 2GQRA 2IWIA 1IEPA 4Y73A 3VW6A 2HENA 2ITQA 4MF0A 2OI4X 3OTUA 2BCJA 2ZB0A 3DJ5A 4ZP5A 4AACA 4DT9A 1Q24A 2W1CA 5IA0A 4W8EA 2HZ4A 1O6YA 1H8FA 3PA5A 4UYAA 3EKKA 2XBJA 3EB0A 4GYIA 5AP4A 5KE0A 3ZUTA 5BUEA 3PSDA 4C58A 3DKGA 5F20A 5BVEA 3ZONA 5I9XA 2ERKA 2VO6A 4M8TA 4EOQA 4XG3A 3KRJA 4IIRA 4WBBB 3Q9XA 2QO2A 2ITNA 3FZRA 4DTKA 4EOIA 3QTZA 1OL6A 2JD5A 3BV3A 3WF9A 4C2VA 3HMOA 3JXWA 3Q2MA 1I09A 3LFCA 4KKGA 4E4MA 4F7SA 4FC0A 4IX4A 3BU3A 5JRSA 4HGTA 4DH7A 3BQRA 4U6RA 3ZZEA 1MUOA 2EVAA 2BZHB 4IX5A 2OJJA 3KULA 3PXKA 1KE5A 4EBWA 2CGWA 4OT6A 4IJ9A 4Q9ZA 4FOBA 5M09A 2JFLA 3L8PA 3NUXA 2IN6A 3AT4A 5BPYA 2WU6A 5JKGA 4ZTMA 3RGFA 1YXVA 4NK9A 3F3ZA 4RIXA 5DRBA 4F9BA 5C1QB 3KREA 3GCVA 1BYGA 3KK9A 1QPDA 3HP2A 5IQAA 4QQTA 3ZM4A 4TYEA 4FV5A 5IPJA 5AM7A 1NXKA 4XOYA 5J9YA 2Q0NA 4AFEA 3SHEA 3EIDA 1U54B 2ZMDA 5CF6A 2QLUA 2QOLA 4PPAA 4WG3A 3R8PA 4RZVA 2OU7A 4TZRA 3AT2A 4L01A 4N6YA 3A60A 4QMPA 4RX7A 3BELA 3LOKA 4UWYA 4ZSLA 4XG7A 2X81A 4D28A 5FM2A 5I0BA 5HEZA 5FXSA 2HWOA 4OTFA 4BICA 3MVHA 4PDYA 2H8HA 3ZFXA 4G6LA 3BYVA 3COMA 4BZNA 4WG4A 5T68A 4J8NA 4O4DA 4JR7A 4DGOA 4BCHA 4RQVA 2XYUA 2JDVA 4YJOA 5DT3A 2J5EA 5F1ZA 4O7LA 2OJFE 5C26A 2GHLA 4D4VA 1YXUA 5EI6A 3ROYA 1W83A 3LCOA 4I22A 2ZV8A 4NL0A 3CGFA 5IEVA 2QG7A 1TQIA 5CEKA 2VTPA 4ORKA 3M2WA 4U97A 2E9NA 4BCFA 3OT8A 3U4WA 4FICA 3UBDA 2PSQA 4C38A 3VJOA 3P0MA 2X8DA 4IWPA 5IH6A 4ACMA 4IB0A 4EJ7A 3QXPA 3PWYA 4ZOGA 5IUIA 4H05A 5AADA 1QPCA 3DJ7A 3QTSA 5CSHA 3W0RA 3QRIA 5BVDA 2X7FA 1U5RA 1UWJA 2PZPA 1OVEA 3A7FA 1PMEA 5CXHA 2JGZA 1JKLA 3I79A 2HCKA 3ZUVA 3GOKA 4CKRA 4EH8A 5M53A 4U41A 2O0UA 4DFBA 3QHWA 1B38A 4L44A 4MQ1A 4WNOA 4RFMA 1S9JA 1URCA 4MNEB 2ITTA 5EYMA 5HNBA 1NW1A 4AXCA 4QP8A 3TUBA 3OEFX 5KHXA 1XH6A 3Q4TA 4YZMA 1YDTE 4ZK5A 4FNZA 4YC6A 5E8WA 1DI8A 3ZU7A 3R02A 2I1MA 4S30A 3WZDA 3LMHA 3AC2A 4D2SA 4JG7A 5IUGA 4WBOA 1ZXEA 2HK5A 3WF6A 1A9UA 4ZY5A 4UN0C 3BIZA 1M2PA 3SKCA 2XCHA 4BVUA 4DHFA 4AT3A 3C4WA 4G16A 4F4PA 3I5ZA 4ACDA 5FEEA 4XRJA 2UZLA 3BLHA 3NPCA 1UKIA 2VTQA 3CTJA 4JR3A 4Z55A 2X2MA 3ZFYA 3FLYA 2XIZA 3F82A 1OMWA 3KMWA 3LMGA 3PVGA 4UEUA 4YTHA 3W10A 2AEGA 4FTNA 5C8KA 2OXYA 3PFYA 4I24A 3AC3A 4FT3A 1OBGA 2WZJA 4C33A 3QGWA 3R9NA 5A46A 4JDHA 4EK5A 4ERWA 2F4JA 3Q9ZA 4F6SA 5I9WA 2QURA 3S2PA 2Y6MA 3COKA 5JN2A 3OXZA 4QPAA 4X6RA 2YJSA 2FA2A 5FEDA 4UMPA 2ITWA 4PL4A 4DHZA 4FG7A 3I81A 4G6NA 4BDCA 5HIBA 1J3HA 3FKLA 1J7IA 4E6AA 5I4NA 4WOVA 3D9VA 5KMLA 2C1BA 2J4ZA 4LOOA 5EI2A 3FI3A 5E92A 3SQQA 4CLIA 4DFNA 1DS5A 3PG1A 3NMUF 2WMUA 1W8CA 5AX3A 4C4IA 2B55A 4BIBA 4EH4A 4FIHA 3QUEA 3CQWA 4NEUA 4WIHA 2PZIA 3C4CA 3IDCA 5AUXA 3CCNA 4QP7A 5CZHA 4TL0A 2V55A 3KEXA 4LUEA 4U44A 5HE3A 2JAMA 5CX9A 4DGGA 5DT0A 3LM5A 3HV5A 5BVOA 2QOOA 3ORLA 3DJ6A 5AR2A 4LMUA 3W32A 1YVJA 4HVIA 4UMUA 3TV7A 1YOJA 3U51A 2C1AA 3TYKA 4IAAA 5EYCA 2PYWA 3BX5A 4Y85A 5EQYA 1V0BA 3CQUA 5AR3A 2WHBA 4BN1A 3RINA 2YIXA 2YWVA 5IQBA 3W55A 4QYFA 2OIBA 5AFVA 3BYMA 5FQDC 5L8JA 3PY0A 3QKMA 3V6RA 3MTLA 4ZXTA 4DEIA 2JEDA 2C47A 5FP5A 5HG7A 4ALUA 4EZ3A 1MRVA 2JBPA 2G01A 4DBXA 4MKCA 1JVPP 1IR3A 3QUDA 3VRZA 4D5HA 5LMKA 4FEUA 4WA9A 3IDPA 2UW8A 4Z7HA 2X4FA 2BKZA 3R83A 1PJKA 2OSCA 2J5FA 4HJOA 4RIWA 3HDMA 4IFGA 4XCUA 2IVUA 4H36A 4PL3A 5CI7A 2W4OA 4MXYA 5CSWA 5CTPA 4FIEA 3L9LA 4YHJA 3G2FA 4YNOA 3V5JA 5DBXA 4CZTA 4DINA 2C3IB 3SXSA 2R9SA 5M4UA 5LCJA 4P2KA 4D1ZA 4E4LA 5IISA 4PF4A 4EZ7A 3RAIA 3F2RA 3EFKA 4AW5A 1OKYA 3FAAA 4XG4A 5CT0A 4CFWA 3NUSA 4L46A 4PRJA 1W7HA 2EXMA 3C7QA 3I4BA 4UWCA 4USDA 4D55A 2JITA 2VV9A 4KIKB 2PVNA 1WFCA 3VS4A 3KB7A 4AW2A 5CF8A 5KBQA 3C13A 4QTCA 2GU8A 5LJJA 5A4LA 5BYLA 3RNYA 4QPSA 4UXQA 3V04A 3R7GA 1TFFA 3WZJA 5AR5A 1PMNA 3OWJA 4GVAA 3RI1A 4DDIA 3HGKA 3OW4A 4ID7A 5JRQA 3R7OA 1QPJA 2X0QA 4U9AA 3DK3A 2LGCA 3AC8A 4BCPA 3W0NA 1STCE 1KE8A 4AP7A 4BKYA 1I44A 1ZMVA 1Q8UA 2IVVA 2VD5A 3P23A 4APPA 4A4LA 3OHTA 3VUIA 5AP2A 5EOBA 2PUPA 4EONA 2UW0A 5D1JA 4FV8A 5EDRA 1ZY4A 2BAQA 3BGZA 2WMXA 2PUNA 3LFBA 2UZVA 5AV1A 3VUHA 3TTIA 3PJ2A 3QRJA 3W18A 3PSBA 4CRLA 5M4IA 5EW9A 1ZLTA 2FH9A 3FZTA 4FTMA 4H39A 4II5A 2GTMA 1K2PA 1JWHA 3UOKA 4AA0A 4IB5A 5LWNA 1KV1A 2GDOA 4IVAA 2IZSA 3MN3A 4NTTA 1ZYCA 3RKBA 2WTJA 4ZTNA 4JOAA 4YO6A 3UIBA 5C4LA 4IAKA 4C4HA 4XP2A 4NW6A 1YXTA 4A9SA 1UNGA 4C4JA 1W84A 4K2RA 5LCKA 4ZJIA 3FMJA 5LVLA 4DDGA 3HA6A 3C4ZA 3A8WA 3FEGA 4PQNA 4EWHA 4AGCA 5DN3A 5HU9A 4G1WA 4YZDA 1LEWA 3CR0A 3PIYA 5AR7A 2JIUA 2AC5A 3EZVA 3PA3A 4IB1A 2WQOA 4IM0A 4JIAA 4EQUA 4D5KA 3U55A 2PMIA 1WMKA 5HO8A 1GNGA 4E1ZA 3EH9A 3G0FA 2VX0A 2HZNA 3ZC5A 5KX8A 3NSZA 4U3YA 1M2RA 2I0YA 3GXLA 1JQHA 4YNEA 4LDTA 4DTAA 4B4LA 2F57A 2FSMX 4TWOA 4ANQA 1H1QA 4R3PA 2BILB 4PMTA 2AYPA 3RALA 4I92A 4MWHA 2WTCA 3GCQA 4RRVA 5E8VA 3UO4A 3PVUA 4HCUA 4J99A 5DNRA 2X9FA 4AOJA 2HWPA 2V7AA 5TF9A 4HVGA 3LFDA 2HAKA 5AUYA 3TCPA 4AE6A 4I6BA 2B52A 3LM0A 4RVTA 4YU2A 3VO3A 1P4OA 4MYGA 2NO3A 3IONA 4D1SA 4AOTA 5LWMA 1J7UA 2X4ZA 2ONLA 5CQWA 1TVOA 4FTJA 2YDKA 4BDGA 4GJ3A 3I0QA 4ITIA 2JDTA 2PMNX 3DBQA 4ZZNA 4MHAA 3RCDA 3O8TA 3VUGA 4LV7A 3W2RA 4QMQA 2BKKA 1GAGA 2Y0AA 3HNGA 3ZXTA 4EC9A 4NIFB 4C57A 4M69A 4D2VA 5HLNA 5LXMA 2X8IA 2XZSA 2YCRA 4R78A 3C9WA 1SNXA 1FMOE 4C36A 2VWZA 4NM5A 3IS5A 3WZUA 4DEBA 1QMZA 1HOWA 1KOBA 2I0HA 2XK9A 2W1GA 4QMYA 4F65A 5E9EA 5EQPA 3P7AA 3UO6A 3VS3A 2OF2A 5AJQA 2XNMA 2JKOA 4FG9A 4GSBA 4WD5A 4E6CA 3GCPA 3MVMA 4NKAA 3UC4A 2WTKB 4RJ4A 4O2PA 5KMKA 3BPRA 4AX8A 3HYHA 4GRBA 4KBAA 3OVVA 2BRNA 4Q5HA 1PXNA 4ANNA 1X8BA 4CV9A 2QOHA 4CFMA 2J0KA 3F5GA 2PE2A 5GJDA 3COIA 4LL5A 3VHEA 4S33A 1GZ8A 2BIYA 2W1EA 5IH4A 1PYEA 3E5AA 4CFXA 3R22A 5E91A 4BDIA 3TMOA 1JSTA 2ETMA 1H25A 2B54A 4D4RA 5JK3A 3QXOA 3I7CA 3VS1A 2QOBA 4JX3A 3QALE 3VHKA 2ZM1A 1H28A 2R2PA 4PTCA 3VBYA 4BTMA 4MNFA 3IPHA 3DKCA 4IW0A 3LJ1A 3Q9YA 4P5QA 4AWIA 3P9JA 4E5WA 4F9WA 2OJGA 4LRJA 4PMMA 5FLFA 3DBFA 3NIZA 4ZZMA 4BCNA 3FHIA 1H01A 1OKWA 3Q5ZA 3Q4UA 3TV4A 3FJQE 3WE8A 2BPMA 2O64A 3QC4A 4ZTRA 3AD5A 3QKLA 5HCYA 5FM3A 1L3RE 1SZMA 2QKRA 4NFNA 4RWIA 3T3UA 3TJDA 4BCOA 4RVKA 4KS8A 4CYIA 2RFNA 2HZIA 1QPEA 3EN4A 3ATTA 5CY3A 4HYIA 3DLZA 2C0TA 5ACBC 1BMKA 3EFWA 3MIAA 4YLJA 2XIRA 3SRVB 1Y91A 3KXXA 3QD0A 2XP2A 2RIOA 4O0YA 4ZS4A 4ZSEA 5BV3A 5CVGA 1V0PA 2W0JA 5HQ0A 2P33A 3QX2A 4CSVA 1OECA 3UC3A 1RE8A 2QONA 4DG3E 4KSPA 5CAUA 4C62A 1G8KA 3MI9A 3F7ZA 3F2AA 4CKJA 1WVYA 4ANLA 5A4CA 4OTHA 3BLAA 3FY0A 3R73A 4EK8A 2VNYA 3LQ5A 4A9TA 2ITVA 2YM4A 3I0OA 4GG7A 4X3FA 5M55A 4YC3A 3W2PA 3NYOA 4A9RA 5I3RA 2XB7A 4EZ5A 4ASXA 4ASEA 1H00A 3FZSA 5GZAA 3SG9A 5HI2A 4FTLA 2I7QA 2QR8A 2O5KA 4G5JA 5TE0A 3BGPA 1GY3A 4QMOA 4FEVA 1OL5A 3FKOA 1ZY5A 2YM3A 5CT7A 5HVYA 3SW7A 2WTKC 3A62A 3OCGA 3F88A 1A48A 3IGGA 1SVEA 4I23A 4FI1A 2XARA 3SOCA 4R3CA 4Z9LA 3RPVA 4F0FA 3QQKA 5CEPA 5ANEA 4IAFA 2W5AA 3BLRA 5CAVA 4B7TA 4BKZA 3EQRA 1IASA 3BHTA 2VO3A 1FGKA 5HBJA 5GNKA 3W2OA 4LG4A 3U8WA 3UP2A 3Q96A 2V7OA 3C4FA 3POZA 3QA0A 3CJFA 4MBJA 4FEXA 5M08A 2GNJA 4K33A 4GK4A 3E64A 3NNVA 3QRUA 3VC4A 2ITXA 3PP1A 5M4FA 2PY3A 3EHAA 2XRUA 3OMVA 4RWJA 4K18A 3QWJA 3RPRA 2ITZA 4IVBA 3VS2A 3HEGA 3DQWA 3QTWA 3RK9A 4XV3A 5FEQA 5A4QA 3LMIA 3FMHA 4FGBA 3KY2A 4X0MA 4LGGA 2ZM4A 3SD0A 4AN2A 2VAGA 3F2NA 5CENA 1IA9A 3D4QA 4V0GA 4PV0A 2UZWE 3ATSA 4RWLA 4I6QA 1Y8YA 4I5PA 4C37A 1ZZ2A 4IZ7A 5CU6A 4PMPA 4IDVA 3TG1A 5E7RA 3OF0A 2ZDTA 4FR4A 4KIOA 4RT7A 5HGIA 1J7LA 3G51A 3D14A 2QC6A 4F1OA 1R39A 2O3PA 5DA3A 1B39A 4AW0A 5E4HA 4DG2E 5DE2A 4FSZA 5C9CA 1F0QA 1NVQA 3D5VA 4K6ZA 2J6MA 4D0XA 4D4YA 2JKKA 3T9TA 1P5EA 2O2UA 3BCEA 3N4UA 4FSWA 2IO6A 2OIDA 5DH3A 5BVNA 2G2FA 4FTUA 4HPTE 3FI4A 3W0OA 2Z60A 4M67A 2R3IA 3IK3A 2RL5A 4XV1A 3ZRMA 4ERKA 3OEZA 2FSOX 5IEYA 2XNBA 3FLSA 2PMOX 4MAOA 5JFVA 3QF9A 3ZM9A 4EQCA 5BQ0A 1REKA 1PKGA 3H9RA 4RVLA 5HZNA 4DF3A 3QTQA 4LGDA 3ZH8A 1VYWA 3MESA 1PRYA 3LPBA 2IW9A 3ROCA 4UZHA 4QP1A 5JEBA 3UPZA 2C5YA 3DXNA 3KN6A 3UOLA 5CQUA 4USEA 3Q6WA 2O65A 3LFEA 5HHWA 4JVGA 4NW5A 4CQEA 3O71A 5FXRA 3F7WA 5F9EA 4RBLA 4WHZA 5M07A 4R5SA 4BTJA 4CFVA 1ZOGA 4EORA 5HNIX 1H0WA 4HW7A 4IANA 2BRHA 4OR5A 5CU3A 4RQKA 2A0CX 1SVHA 2ZMCA 3A4OX 1YW2A 3NEWA 5DR9A 3U9CA 5CAQA 4CVAA 4IZAA 3DK6A 4M7IA 4FT9A 4GV1A 4C02A 4NM3A 1QCFA 4RG0A 1ZYJA 2BTSA 4A9UA 2OGVA 3Q6UA 2C4GA 2PVKA 4WNMA 4DBNA 3FXWA 4G9CA 3VBTA 4FMQA 2W5HA 4PNIA 4ZY6A 4PTGA 5FXQA 4JLCA 3K5VA 5J8IA 5KMIA 1YRPA 3F5UA 3MPTA 1Q8YA 3R21A 3MA6A 3UYSA 3PIXA 4FKSA 4FOCA 2CGUA 3FLWA 4GIIA 1Q3WA 4I6FA 4KKEA 3DK7A 1OIUA 4JQ7A 2PVYA 3QKKA 3ZHPC 3SGCA 4GL9A 5FDXA 3K3JA 3I1AA 4QNYA 3HMIA 3IW6A 4EQMA 3G9NA 4FV9A 4O96A 3ZO4A 4CCUA 4D2WA 4CMTA 2E2BA 5IF1A 4O1PA 4EYMA 5KMNA 4OTPA 3KXHA 4BCIA 3NRMA 4O83A 5L2WA 2YISA 3MBLA 4QP3A 3DS6A 3GQIA 3QX4A 4FE2A 5AWMA 3O7LD 3FMDA 1OGUA 1XR1A 3PFQA 2XK7A 3AOXA 3E7VA 3VVHA 1FVRA 4FL2A 3HRBA 2I0VA 3KULB 2J9MA 3UZTA 1Y6AA 3RHKA 2XAOA 1H07A 4RIXB 3CKWA 2W1HA 1T46A 5TT7A 3HA8A 3MDYA 5AUUA 2WD1A 3KF7A 4U45A 2XIKA 4NFMA 3RK7A 3UMWA 3PZEA 4KABA 4OUCA 2VTSA 3MPAA 5DEYA 3MFRA 5H8EA 2BRBA 3RWPA 4DH1A 3OXIA 3ZDIA 4O7VA 5EHYA 4XHKB 3C0IA 3SW4A 4O38A 2BALA 3MGYA 1OKZA 2PVRA 3R1YA 3D83A 1FVTA 2EB3A 3LJ0A 5DOSA 3W16A 1H08A 4JRNA 1PMUA 2XBAA 4HVHA 2J90A 3ZS5A 4CCBA 1TQPA 3NCGA 4AQCA 5LMAA 3W8LA 3VJNA 5J5SA 5KKRB 3R8MA 3AGMA 2R3RA 3GP0A 3KIOC 2R3MA 3ZTXA 5K0XA 2C6OA 1WVWA 2WXVA 3PVWA 4L7SA 3DA6A 2NP8A 3NUNA 3OCSA 4KNBA 4YPDA 2C6IA 3LXKA 5HE2A 1IRKA 1UU9A 3R00A 4N57A 1LP4A 3ZDUA 3DBCA 3JY0A 5FGKA 4WSQA 2JFMA 5A3XA 5IKWA 4EWQA 2B9FA 4CMUA 4L43A 4XOZA 5DFPA 4MUQA 4EBVA 4YTFA 4UY9A 1G8JA 2X2KA 3BRBA 3H9FA 3NX8A 2XKEA 1W2FA 3S95A 1KE9A 3VUMA 3W2CA 2Y7JA 3D5XA 3G9LX 4FKIA 3LXNA 4O22A 4U43A 4O0XA 5EHOA 3AQVA 4FSUA 4I0RA 1NY3A 3W2QA 4TW9A 1YWNA 1ZMWA 4HZRA 2WEVA 4AA5A 2XJ0A 4BIDA 3F3WA 2GQSA 3RNIA 1OUYA 3LCTA 5I9ZA 4CV8A 3KU2A 3DAKA 4C3FA 1ZYLA 5L2IA 3ML1A 4QYYA 3P08A 4U8ZA 3CKXA 3ZLXA 3R9HA 2R7IA 3MVJA 1DM2A 4M14A 3F3TA 2YACA 5H8BA 5ACKA 3G15A 4JG6A 3NZ0A 2UV2A 2ETRA 4W4VA 3UZPA 4FTTA 4U5JA 2ITPA 3NW6A 2OH4A 1NA7A 2RG6A 3GEQA 4CZUA 2GNLA 4BZOA 3QD3A 3UNZA 4TYIA 3W2SA 3EMGA 3LLTA 4JXFA 4YJSA 4YHFA 5FRIA 5HNGA 3LW0A 4FL3A 3OWPA 4YHTA 3MSSA 5CYIA 4N0SA 4FV3A 2UVYA 2F2UA 1EH4A 1P2AA 2H96A 5IQHA 5E1EA 5AP5A 2IPXA 4QQCA 4TYGA 4FBXA 5IMEA 4O7NA 4RJ7A 4D1XA 3TWJA 3MH0A 1GIJA 3IECA 3G90X 3DKFA 2GPHA 3A4PA 2GFCA 3RPYA 4CFNA 3V5QA 4ZTHA 4WRSA 1Q62A 3DAEA 2AC3A 3ORPA 2A98A 5HX8A 4WT6A 1WBVA 2Q83A 3V5LA 3EKNA 4IWDA 4BHZA 2XKFA 3O0GA 4QYGA 5CVHA 3QWKA 2F49A 1GZKA 4PNKA 1YWRA 3GUBA 4FTAA 2OZOA 4ANMA 4E26A 4WUNA 2XH5A 4AU8A 4QTEA 2QOCA 3R1NA 4NWMA 4O21A 5GINE 4FYOA 4YUQA 2CNUA 4FEQA 2YCFA 5HD4A 2PE0A 4BWKA 4TY1A 4CZYB 4FVQA 4PDPA 4HVSA 5BNJA 3R8UA 3UDSA 4FTCA 1CTPE 2CLQA 4YSMA 1ZRZA 3UNJA 1TQMA 4FV4A 5I9YA 2WTVA 3BE2A 3ULIA 5KUPA 2IF8A 4G9RA 4QMVA 1Q99A 3PUPA 3MY1A 3DXPA 2WU7A 2OJIA 5BYYA 4BCKA 2PULA 4O81A 4KRDA 4V04A 2VN9A 3QQHA 2CGVA 5L6WL 5E8SA 3A7IA 3QCXA 2G2HA 1CSNA 4W4YA 4EOOA 1YHSA 4CD0A 3DLSA 3CP9A 3QCSA 3FZ1A 4JDIA 3MPMA 2IEWA 4EK3A 3MA3A 4MWIA 5DMZA 3MFUA 4BDAA 3DTCA 4IBMA 5KMMA 3E92A 3VWAA 4RSSA 3TT0A 2V22A 5DG5A 4KAOA 2OKRA 5BX0A 4G3CA 3PXQA 2PK9A 3KMUA 2IW8A 2PU8A 3R2YA 3II5A 4IJPA 2WKMA 3R0TA 1NVSA 4KA3A 4XH6A 4CKIA 3S1HA 4IE9A 3R7YA 3E8EA 3QLGA 1Y6BA 3ORKA 2W96B 4N4SA 3SVVA 4X6QC 1XH7A 4FTQA 4IQ6A 3M42A 2JIIA 2BFXA 1OL7A 3S0OA 3MJ1A 3LIJA 3BI6A 3BE9A 3R1QA 3AGLA 3QQGA 1ZYDA 4QMSA 5EM7A 2E9PA 4AUAA 3PLSA 2PZYA 4FZ7A 3NYVA 3BBTB 2BR1A 4FTKA 4RX8A 4C2WA 3U6HA 2YN8A 4QEBA 3KK8A 3NUUA 4RIWB 2IW6A 2HXQA 3GB2A 4FKUA 5AV0A 4DCAA 4FSMA 3K5UA 2YLFA 4AW1A 2CKOA 2VX3A 4O2ZA 2PVLA 4CYJA 2Z2WA 5AR4A 2B0QA 1F3MC 5EM5A 2XYNA 3Q5IA 5HLPA 1VJYA 5J87A 5ANIA 2OG8A 5DR6A 4E6DA 1GIIA 2HY0A 3A7HA 4Q5EA 4TRLA 4EH3A 3BHYA 4FODA 3H9OA 4FSTA 4ZY4A 3VF9A 4HCTA 3E8DA 5E90A 5AP3A 2XIYA 5C8NA 1XQZA 3O8UA 4YPSA 2H34A 2LAVA 5KZ0A 3P4KA 1OUKA 2VTJA 3Q32A 3TIZA 3TV6A 4QDVA 4Y83A 2JBOA 4NKSA 3G5DA 3KRXA 3MY0A 4UMTA 3PLAE 4YMJA 4FT0A 1ZARA 4UXLA 5HG9A 2R3GA 3GFEA 3V5TA 4F08A 2G9XA 4ZS0A 3W0MA 2C5OA 3RMFA 5JGDA 3CTQA 4XNEA 1AD5A 4F9AA 4QTAA 3FL5A 5KO1A 3DNDA 3HV3A 4XG8A 4J8MA 5AUZA 1OIRA 3MV5A 2WTIA 4G17A 4B9DA 1FINA