2A1AB

Pkr kinase domain-eif2alpha complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
269
Chain Sequence
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 84
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a1aB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a1aB01
4CKRA 1O6KA 3PWYA 3F2AA 2JIIA 4YZMA 1FQ1B 5B2KA 1IASA 4DG2E 3HDNA 1CKPA 1LPUA 3K3JA 3P7BA 1XJDA 3VC4A 4ZTQA 1YDSE 4MD8E 4MX9A 4NIFB 3ULIA 2J51A 2ZAZA 5HNBA 2C5NA 3HRCA 3MA3A 4E6CA 2C6IA 4DTAA 4GFGA 4BI1A 3TUCA 3D5VA 3MESA 2QVSE 2YABA 4FE2A 4LM5A 2C5VA 4ZY6A 3OZ6A 2G2IA 1O9UA 3Q96A 2H96A 4KINA 4XH6A 3RK9A 2VZ6A 5CVFA 2QOKA 5E8SA 3OBJA 5FP6A 4LGGA 4IX6A 4YZCA 5IKWA 4EOOA 4GFOA 1LP4A 3NZ0A 4BGQA 4HVHA 1HCKA 2ZDUA 3QCQA 1RJBA 4I4FA 4U8ZA 3WARA 4J99A 3BLHA 3TUDA 2YCSA 4XP0A 1WBSA 1RW8A 4L67A 2YCFA 4LG4A 1NVQA 1TQPA 3P23A 5DYJA 2WTJA 4O38A 4YO6A 3ULZA 4N57A 4O86A 2BCJA 3TIYA 2HZNA 2I40A 5FEQA 5L6PA 4HOKA 3ZLSA 2WIPA 4EOMA 4P5QA 3ID6C 3D4QA 3I4BA 3F5XA 5HCYA 2HW6A 2R3FA 4B8LA 4F9BA 5L3AA 2BMCA 4ANLA 1FVVA 2Z2WA 4TKSA 4GW8A 3K54A 3W8LA 3QTIA 3WYXA 4C36A 2DYLA 2R3JA 2ITYA 5M06A 2JDTA 4GFMA 1KSWA 4MVFA 4YTHA 2VWZA 2VD5A 4FIIA 3WZJA 3ZLWA 3N4VA 2F49A 4C59A 5GIOE 3E8CA 3W2RA 3EKNA 2VWWA 3R00A 4LYNA 5CI7A 4AQCA 4BTFA 1FVTA 1W84A 3R9RA 3EZVA 2YN8A 1H00A 2O64A 5D7AA 1F0QA 3BWJA 5I3RA 3DLZA 5DG5A 2WTDA 5CX9A 2BAKA 2AC3A 4BB4A 3FV8A 5IMXA 4CT2A 1MUOA 3DS6A 4LI5A 5H9BA 4AE6A 4R7HA 3BEAA 1Z9XA 4A9RA 4O0SA 2LAVA 3RI1A 1B6CB 2QOLA 3I5NA 1H27A 5EI2A 2B55A 4FNZA 5HE1A 3UBDA 5KNJA 4NKAA 3ODYX 3OT3A 2DQ7X 1ZZLA 3IDPA 3O17A 3DU8A 4Y5HA 4C33A 4OTRA 4C62A 3IPHA 1AGWA 4DH1A 4FEVA 3LXLA 3VW6A 4XOYA 3VBWA 2PVNA 4YZNA 5ACBC 5CEPA 3RTPA 3W2QA 3TDWA 3DK7A 3LFCA 3HYHA 4LFIA 5AR2A 4BTKA 3OEZA 4AU8A 5IG1A 3FQHA 5HLWA 2J0LA 4JR7A 4QTEA 4K18A 3UVQA 5DRDA 4YJRA 1M2RA 5E90A 4DITA 2R3LA 2W1DA 4GIHA 4I0SA 5FXRA 3FMLA 4EC9A 2UVYA 3F3ZA 4QOXA 1G3NA 4CQEA 5FTOA 4PWNA 4ITJA 2GHGA 4L46A 1YXSA 4XG4A 4NT4A 3VRYA 4BCMA 3KN5A 3TJDA 4BCJA 4L42A 2GNFA 5A54A 2ITNA 2E2BA 5CALA 1WVYA 4E4LA 4F9AA 4F9CA 2IG7A 1OL2A 2X9EA 2E9VA 4QMZA 4C4FA 2PUUA 4O7VA 1ZMWA 3MVMA 3FKOA 2PE2A 1ZYJA 3HV6A 4JBQA 3NUUA 4K11A 3E63A 3V5PA 3EQHA 4BGHA 4USEA 4L8MA 4PP9A 5K3YA 4DCEA 3PXRA 2Z7LA 1V0OA 3U9CA 4RQKA 5LVLA 1OPKA 1R78A 2ACXA 4Z7HA 3NUPA 3FPQA 5JEBA 3RZFA 4PL3A 3UOLA 1OPLA 4BVUA 2P55A 3NNVA 4UZDA 2UZTA 3RJCA 1Q8TA 4RVMA 2IZRA 2WIHA 4EK3A 2VN9A 4AW2A 1QMZA 5F1ZA 3RWQA 5J8IA 4HGSA 2WELA 1VYZA 4JG6A 4V05A 3DXQA 3Q3BA 3VUMA 3C0GA 3C4EA 4RRVA 4TWPA 2G2HA 4IB0A 3V5WA 4C4HA 3RAHA 2BHHA 3FXXA 1ATPE 3PRIA 4LRJA 2XBJA 3MGYA 4FZFB 4PPAA 4DH8A 4BF2A 2QURA 4D1ZA 4DCAA 3EFLA 3LOKA 5CQWA 4TT7A 1CTPE 4DG3E 3ORXA 3FKNA 3PIZA 4TYHA 5EYMA 3KMWA 4RX8A 4KBKA 2CGVA 2OJGA 2W5AA 3MPTA 2BVAA 1W82A 3RM6A 2JFLA 3NNXA 4QMMA 3KXXA 2QHNA 4DE4A 2PMOX 1SMHA 4EH2A 3FMDA 4NTSA 3ZC6A 2RIOA 3AQVA 2YAKA 5IDPA 2CGXA 3O7LB 5K4IA 2G15A 4ZTMA 2C6LA 3KQ7A 5AX3A 4QMLA 3F88A 3EZRA 4RJ5A 1PXNA 4XS2A 4DFZE 4IHPA 1E1VA 2WXVA 3VNTA 2YCRA 3LFSA 4MBIA 5ANJA 4PF4A 4ACHA 3CCNA 4AX8A 4CFWA 1OVEA 1QPDA 4R5YA 1FINA 2C6TA 3KXNA 4D4SA 4FKIA 5ANOA 1APME 1PF8A 3S1HA 2HZIA 2OJFE 3AC3A 5DA3A 4V0GB 3GU6A 4BFMA 2OJIA 4GKIA 4EOJA 4YURA 1URWA 2OZAB 4FT9A 4A4OA 2BRHA 3QX4A 3UMWA 1YI6A 2Z7SA 1U5RA 2VX0A 3U8WA 3ZEWA 4AGUA 4CZTA 3KMMA 3BV3A 3LLTA 5A4TA 1AD5A 2QOHA 2IVVA 4DN5A 3M1SA 5IA0A 4WOVA 3FZPA 2PE0A 4O2ZA 4PX6A 4FV8A 3AC4A 4FKLA 3E3BX 1L3RE 3RM7A 5J87A 3C0HA 2NRYA 3BYVA 4RJ7A 1QCFA 3O8UA 3ROYA 3E8NA 3PA5A 4PV0A 2YIYA 3TI1A 4RIWA 2ERZE 4NKSA 4ZJVA 2QOIA 3PRFA 4RC4A 2WMXA 4RFMA 3DQWA 1WCCA 3NVMB 4IB3A 2Z60A 3DXPA 1STCE 2OZOA 3AMBA 1HOWA 2UVXA 3OOGA 2OK1A 3OROA 3PXKA 4FSRA 4U44A 4X0MA 5H3QA 3S95A 3KL8A 5EDPA 5HGIA 1IAHA 3R04A 4X3JA 4IJPA 2IZSA 4ZTHA 4MXCA 3R8ZA 4MXZA 4EK5A 3OS3A 4I22A 3DV3A 4X3FB 5FGKA 2WMQA 1Z5MA 4K0YA 5M08A 2FVDA 1WVWA 1W0XC 5FP5A 4B6LA 3RCJA 3ZUVA 3JVSA 1Y6BA 4F08A 1A9UA 4BCFA 2VTIA 3W10A 3K5UA 3H10A 4L44A 3PA3A 4A4LA 4WD5A 4QPMA 4L9IA 1Q8ZA 4MH7A 1H28A 5AV0A 4MCVA 5EI8A 3VJNA 5LVMA 3ZSHA 5GNKA 2X0GA 5E4HA 4HVSA 4DAWA 4G17A 4XG3A 4UEUA 2ZV7A 3BQCA 3GOPA 3ZU7A 4D1XA 5TT7A 2QO2A 4QYHA 4JRNA 2ETRA 4HYUA 3I60A 3PE1A 4TNDA 4RX9A 5AJQA 1R39A 5DH3A 4E3CA 1DI9A 1H08A 4J8NA 5CVHA 5IUGA 4PL4A 2XVDA 5BYLA 2OFUA 5AP4A 5CU2A 2X2KA 2XK8A 5E92A 5ETFA 2OKRA 3HA8A 4MNFA 3BIZA 4FVQA 3VUIA 5HKMA 3HP2A 3RHXA 3CXWA 4XG6A 3LPBA 1R1WA 3NLBA 3OVVA 2YISA 4AZWA 4R3RA 4A07A 2DS1A 2BR1A 1H26A 3RBWA 3VBVA 5D12A 2R3KA 1OKYA 3SXFA 2PL0A 2PE1A 4CNHA 4QMNA 3ZBXA 2PMLX 2IW8A 4BDBA 5J9LA 2FSLX 3BLQA 1PRYA 2Y4IB 3FLNC 3MPAA 4HZSA 1XO2B 3LJ0A 4GK2A 5CT7A 4RJ3A 4V04A 1U54B 2XZSA 4FKRA 3KXZA 3KVWA 2GMXA 3F5GA 4FIHA 2CHLA 3EJ1A 4FUXA 2PU8A 4IX3A 2CLXA 5CY3A 5CXHA 4I0RA 5EHYA 1BYGA 3F61A 3H30A 1J7UA 3C4ZA 3HUBA 3VS5A 3BBTB 4S2ZA 3TZ9A 3VS2A 3JR1A 4EYMA 2OO8X 2WQEA 2V7OA 3ZONA 5EKNA 3E88A 2GFSA 3K5VA 3TXOA 5A4QA 2JC6A 5BVNA 2REIA 4E5BA 4HVIA 4AZTA 2W4JA 4IANA 3ATSA 3ENMA 4CCUA 4FTOA 1TQIA 1PXKA 4CT1A 2YM3A 4XG7A 3RPOA 4BDDA 2VTQA 3CD3A 3QKLA 3QTQA 5I9VA 3MH1A 5EW8A 3RGFA 4BCNA 5IEVA 3R7EA 4XV2A 4D4YA 3H0YA 3E87A 5E91A 3LMHA 3LFFA 3QGWA 2UZDA 2XM9A 2W1FA 3UO6A 4C58A 2XS0A 4QMUA 4LMNA 5KX8A 2UUEA 2PPQA 4RZWA 2BZJA 5CENA 4GT5A 3IK3A 3NCGA 3ZXZA 4C37A 4ZSEA 4FC0A 3V8SA 2WAJA 3AT4A 3QQKA 3A4OX 4MXXA 3UOHA 4ZAUA 2O8YA 3FKLA 4DH3A 4ZSLA 4NFNA 3OC1A 5AAFA 3R8MA 4FKGA 3OW3A 5M56A 3S00A 3V04A 3GCQA 2BILB 2PZRA 2XH5A 1JOWB 4MWIA 2QO9A 5C26A 4NFMA 2VWXA 3E8EA 4EH9A 2YITA 3DCVA 5KZ0A 2UW5A 3F6XA 2UZLA 3VF9A 4FKQA 4O91A 4KKHA 2WOUA 4OT5A 4BR3A 3UIUA 2I1MA 3NX8A 3A7JA 3QAME 3AC8A 1TQMA 5HE0A 1Q8YA 4BL1A 3D5XA 4TN6A 5J7HA 4O0TA 2WTKB 4U81A 3MFUA 4YSMA 3R71A 4FV9A 1WBWA 3EL8A 2UW8A 2KULA 4L68A 1FMKA 5AAGA 4ZOGA 5H8GA 3IOKA 2SRCA 4KUJA 3CC6A 2GFCA 3RNIA 4Y8DA 3FXZA 4DLIA 2WMVA 5HCZA 3RALA 1H0VA 4WA9A 4ONAA 3BZ3A 4ZTLA 3QXOA 3QXPA 1PW2A 2VO0A 3MTFA 4QQ5A 3PA4A 2J9MA 2WMUA 4ANNA 3FLSA 4B4LA 3G5DA 3L8XA 3D83A 3PDTA 5KKRB 1Y8GA 3BYUA 3R1QA 3VUGA 5CF5A 4PDOA 3KXGA 4FV4A 3KN6A 2AUHA 2JDOA 4GK3A 3D94A 3UZPA 3QCXA 1H24A 3QC4A 5LJJA 1OPJA 4YPSA 4AXAA 1FGKA 3CQWA 4J8MA 4HNFA 5FDPA 3EIDA 3VBQA 4G3EA 4DHFA 1P5EA 3FDNA 4IVDA 5L8JA 4O7YA 2W5BA 3G0EA 4HCUA 4RBLA 2YDKA 3FI2A 3CEKA 3SAYA 2GNJA 3JYAA 4YJOA 4O0XA 4BDCA 5A9UA 3COIA 2FGIA 5FD2A 4YLKA 2XJ2A 3OCTA 5EI6A 5EYKA 4D2PA 1NT2A 4DTBA 3UMXA 5AADA 3WF5A 5LVNA 4X2FA 2HZ0A 3OOMA 5FM3A 4BBMA 4BDFA 2BUJA 3N4TA 1YOLA 3W8QA 4BWKA 3JY9A 1R0EA 4EJNA 3MY1A 3I6UA 2GS2A 1ZOHA 4XJ0A 4ID7A 5L8KA 1XH7A 3F69A 4C4EA 4CMTA 3FC2A 3U6JA 4LGHA 1YHWA 2X7OA 3KY2A 3CE3A 4ITIA 4M3QA 3V6RA 3QBNA 3SVVA 3C4CA 4WNOA 4F63A 4U42A 1ZOEA 4PMSA 3E92A 4BDKA 2B53A 5C03A 2UW7A 3W2SA 2BDFA 4IWPA 5BX0A 4YLJA 5BMMA 2OF2A 2WTWA 2QLUA 3EN6A 4QMTA 2Z7QA 3NMUF 4X21A 4L01A 4I4EA 4CZYB 4F6WA 4CLIA 5F9EA 5L4QA 4CEGA 4IWDA 3UOJA 2P2HA 3OUNB 1U4DA 5TE0A 1W7HA 3OMVA 2YLFA 4FTAA 5TR6A 2HY81 4BKYA 4O7SA 2G9XA 2FUMA 1KUTA 3NNUA 2X7GA 3GC9A 2Q83A 3QZGA 4OTWA 2X4FA 3IS5A 4LOQA 3BYSA 4CMUA 2GHLA 4DGLC 5BUEA 3OTUA 4DA5A 3QQHA 5KE0A 2W1ZA 3V6SA 3FSKA 3HAVA 2WTCA 1UNLA 2GQRA 4FV5A 2PVYA 4ZK5A 1H07A 4QTAA 3WE8A 1B39A 3SG8A 4X6RA 2YFXA 3IO7A 3PPJA 3PPKA 4I21A 4JAIA 4JAJA 1PXLA 4MNEB 4PUZA 2RGPA 2OFVA 3FXWA 1DI8A 2OICA 4FX3A 4H1MA 4AZSA 5A14A 3C9WA 4QP1A 3HUCA 1Y8YA 4DBXA 4ZS0A 2WEVA 2QD9A 5G1XA 3RPSA 4BCKA 4KABA 4QYEA 2GTMA 2QU6A 2YM6A 5FXSA 2BFXA 2V0DA 1P4FA 4DFBA 4JT3A 1ZZ2A 2C5YA 1OBGA 4OTFA 1LEZA 3DBCA 1ZRZA 4IZ5A 4JIAA 5HCXA 3OXIA 4GT4A 3DKCA 3CS9A 3HMPA 4GT3A 4E1ZA 2P3GX 2XNMA 2ZMDA 1ND4A 3GCSA 4O1OA 4K1BA 4XBUA 5DR6A 2W17A 3A99A 3ZFMA 1J7LA 4MYGA 4R77A 5EDQA 1PHKA 2GDOA 1JPAA 3CD8A 4JDJA 5IUHA 4FOCA 2W5HA 4OAUC 5A4EA 2PZ5A 2X81A 4QP4A 5JT2A 4C3PA 3SOCA 4I5MA 3EYHA 4U40A 3POOA 3QQLA 3SV0A 3W1FA 3F2NA 3EQPA 3O71A 3OTVA 4K2RA 4DEHA 5CEKA 5K9IA 5IUIA 2WTIA 5C4KA 4U79A 1BMKA 3IG7A 3BQRA 4FKOA 3TUBA 2Y8OA 4L53A 1H25A 4GVJA 4QYYA 3W32A 1S9JA 5JSMA 4G3FA 3KXHA 3POZA 4L00A 2YWVA 3UPXA 2XYUA 1E9HA 2IW6A 3NW7A 3TNHA 3FMEA 2UZNA 5EQPA 4DT9A 2YA9A 5GINE 5H2UA 4K8AA 3RAIA 4UN0C 4QMOA 2E9UA 3UC4A 4F65A 4C35A 4O7NA 4O96A 4PNIA 5TOZA 3ORPA 2YAAA 3EFWA 5KMKA 3MB7A 4G1WA 4JRVA 5HBEA 4YUQA 3CJGA 4D2SA 2VTPA 4FL2A 4F9WA 1H01A 1NY3A 3FHIA 4W9WA 2FO0A 4J7BA 1REJA 4XBRA 1ZARA 5KMOA 5HHWA 2NNWB 5ACKA 3LZBA 1BKXA 3PLAE 4LUEA 5AMNA 4O0RA 4RIXA 4FL1A 2OJ9A 5AIKA 1O6YA 2FH9A 3DB8A 4JDIA 4KIKB 5CSWA 4DH5A 4FSYA 3W33A 4AZVA 2JEDA 2LGCA 4I5CA 3UNKA 3LFEA 3LMIA 2BRMA 3SOAA 3EN5A 5D7VA 5BVKA 1PKGA 4EOIA 5HO8A 1UA2A 1NW1A 3DZQA 4JQ7A 1YOJA 3DBQA 4RA4A 1WBVA 2VX3A 4FV0A 3WZKA 3GOKA 2G2FA 3PUPA 1F3MC 2YIXA 3KA0A 5A3XA 4WNMA 3BX5A 1XBBA 2W1HA 3AC2A 2IVTA 2XF0A 2NO3A 3DAKA 4R3PA 1KOBA 1UVRA 1QPJA 3HKOA 2Z7RA 4Y72A 2XK4A 3G51A 2G01A 4AAAA 3EB0A 4C0TA 5GIPE 4AF3A 4I24A 3SW4A 5M44A 1U59A 2YIWA 5K4JA 2XK7A 1HCLA 3BGQA 4BDAA 4EBWA 4CTCA 3HV7A 2I0VA 2J6MA 3R1SA 2VTNA 2QC6A 1H4LA 1PMUA 3COHA 4FKVA 5IEYA 4D0WA 5HQ0A 1URCA 3IDBA 4RLKA 2QOCA 2C47A 5EG3A 3UZRA 4XG9A 4IWQA 3OEFX 4F6SA 2P0CA 4EOQA 3OCSA 5ITAA 2ZM3A 4MF0A 1YWVA 3TJCA 2VO6A 3RVGA 2JDVA 3I1AA 4XHKB 4AZEA 4EK4A 5JH6A 2EUFB 4TXCA 4ZLYA 2W99B 4FBXA 4M69B 4F4PA 3VUDA 1NA7A 4K33A 1Q24A 4DG0E 4USFA 3KULA 1YW2A 4O6LA 4YTFA 1RDQE 2JBOA 1BL7A 3EQFA 3G6HA 5CS6A 4U6RA 3D2KA 3HRFA 3DZOA 3EQRA 3LCTA 2AC5A 3Q52A 4S32A 4Y46A 5HVYA 4ANBA 2VTOA 5EHOA 4MHAA 3R73A 4AGDA 4EZ3A 1F5QA 3WIKA 3HRBA 4F6UA 3TDVA 3DT1A 3BU3A 1PKDA 4DFLA 3M2WA 2HK5A 3P9JA 4EWQA 4IX4A 4ANQA 3HVCA 4E6QA 4II5A 3GXLA 4YP8A 3S2PA 4TNBA 4TYGA 3PPZA 4BRXA 3QHRA 2B9JA 3UYSA 1YXVA 2QQ7A 4IZ7A 3IQ7A 4MD9E 4QPAA 3PVBA 4J96A 3OCBA 4I6HA 3E8DA 3FMKA 1SNUA 1NVSA 2Y4PA 3V5JA 4TL0A 2R5TA 5BPYA 1H1PA 4RIOA 4FEWA 4F70A 2JLDA 2QNJA 1SVGA 3MY0A 3B2WA 1ZYSA 3H9FA 4IACA 4O7RA 1OIRA 3CGFA 5CEOA 2BTSA 2FSMX 3MB6A 3Q9YA 3EQIA 3W16A 4XX9A 2R3HA 2XK3A 4P2KA 2A19B 2YJSA 1CDKA 4UYAA 2PSQA 4YJQA 3UP7A 3UQCA 3NIEA 1PMVA 5B2LA 3EN4A 2Q0BA 4FKWA 4N0SA 2HWPA 4G31A 2IZUA 4RJ8A 3JS2A 3Q5IA 3SRVA 2Y0AA 3D14A 1V0BA 3VO3A 1UKHA 4EH7A 3KU2A 3QL8A 4M14A 3CP9A 3DAJA 3PP0A 2X9FA 3ETAA 5I9XA 3QTZA 4EH3A 4QMQA 3BE9A 3PP1A 5BVFA 2QHMA 3A4PA 3ROCA 3UDBA 2JAVA 5AEPA 2ITTA 1Y57A 2YZLA 3NYVA 5CEIA 3ANQA 4ASXA 4D2WA 5CZIA 3QQGA 3TL8A 3TNIA 5FUTA 5FEEA 2PZYA 1BX6A 5IH5A 2VTMA 2NP8A 3QUDA 4BWXA 1UWJA 4ZEGA 3L1SA 4M97A 2HCKA 2R0UA 4ZY5A 3Q6UA 2XMYA 1JBPE 2B9FA 5HX8A 5IA5A 4G6NA 2QLQA 5M4IA 2OH4A 3RMFA 4H39A 2ITOA 4AP7A 5E1EA 3LQ8A 3FEGA 5EK7A 3EQGA 5H8EA 4C4GA 4QMPA 4AA4A 2CSNA 2WHBA 4XEYA 5TKDA 3VS3A 4ALWA 5TO8A 5C01A 4QMXA 3QYZA 2QKWB 1FBNA 5E9EA 3FQSA 3BKBA 5M09A 3EL7A 4PTCA 4XV1A 5DNRA 1WAKA 4QTDA 3SD0A 2ZV2A 3BHTA 4ZTRA 3GQLA 5BVEA 3ORLA 3OP5A 4M13A 5GZAA 5HORA 2C0OA 3OY1A 2C4GA 3Q6WA 3P0MA 4W8DA 3MFRA 2C6MA 4AUAA 4U9AA 4C4IA 1ZMUA 2B7AA 3DQXA 4J71A 3CY2A 5E8XA 4O0YA 2XM8A 3H9RA 3MN3A 1XQZA 3NS9A 2OG8A 3OCGA 5IQHA 1RQQA 2CPKE 2C6KA 3HMOA 3LQ5A 4DLJA 4JG8A 4AT4A 3DLSA 4BCPA 4FSMA 3CQEA 3QZHA 4BIBA 5AR4A 1P2AA 1GNGA 1XKKA 3VS7A 5CSPA 2ZM4A 3ACKA 3HV5A 1T46A 5GZ9A 4IB5A 3VS0A 3PG1A 4BN1A 2C1AA 1LUFA 3PVWA 4JQ8A 4JVGA 3G0FA 4IQ6A 3ZO1A 1VYWA 4ZTNA 3LFQA 4FA2A 2J5EA 2IZTA 3EQDA 4DFNA 1SZMA 2GHMA 5IU2A 2J4ZA 3VQHA 1O6LA 2VO3A 4YTIA 3WZDA 2EU9A 4AOIA 4D1SA 5HTBA 3NNWA 2UZWE 5K5NA 3PZHA 1VJYA 2ZYBA 3TTJA 4CFNA 2X6DA 5AP6A 1Q41A 4CFXA 3E93A 4UWBA 3G90X 2IVUA 4EWHA 2GNGA 5CANA 1OBDA 3HV4A 4OGRA 3FY2A 4FKTA 4WIHA 2IW9A 2JD5A 4L7FA 4O81A 3R7VA 5KMNA 3LXNA 2QG5A 3T3VA 4E4NA 5K0KA 3DNDA 3C5UA 5E8TA 3QX2A 2P2IA 2WMRA 3KF4A 4APPA 3M11A 1FOTA 5FBNC 2UZOA 4FTRA 4J53A 5I5ZA 2EB3A 4IJ9A 4J97A 3FMMA 2RFNA 3BE2A 5LXMA 4E20A 2P4IA 1GZNA 3GCPA 2EXEA 1W8CA 2R2PA 2YM4A 4G3CA 2H6DA 4GSBA 4AA0A 1PYEA 3BELA 5D9HA 3KGAA 4PDYA 2ITXA 3ZUUA 3AT3A 4OBQA 2CNQA 5IA4A 2F7ZE 2ITUA 3MPMA 3VBXA 4IFGA 3QTUA 2ZJWA 2UZVA 4FSQA 3PXFA 5JRSA 1A48A 2CNUA 2X8IA 4E7WA 2XNNA 5HD7A 2BROA 4NEUA 2Y6MA 1OKVA 3C1XA 3Q32A 5I4NA 3S0OA 3DBFA 2I0HA 3A61A 1YQJA 3IOPA 2OXYA 2JKQA 2UZEA 4HVDA 1P4OA 4U80A 3ORMA 4O84A 4IAIA 4YHFA 2HW7A 3ZEPA 5HD4A 2BZHB 3NW5A 4YMJA 1PYXA 2XNOA 4DEGA 3GP0A 3AT2A 4AG8A 5K0XA 5A6NA 2QOQA 3QGYA 5M51A 2RFSA 3WI6A 1XH8A 3KF7A 2PY3A 4NL0A 5BYYA 1YXXA 3FI3A 3H3CA 4O22A 5ANDA 3WILA 3HGKA 3LJ1A 1JSUA 4JDHA 3LCDA 1U46A 4KKEA 3QTRA 4FK3A 4KWPA 4E4XA 4OUCA 5KKRC 1MRYA 5M53A 2RG6A 1OIYA 2WO6A 3E5AA 3ENHA 4MQ1A 2GPHA 3LXKA 1KE5A 2OIBA 4YJSA 2PHKA 3BV2A 4BBFA 3PWDA 4EBVA 4WUAA 2WQNA 4MNEA 3TIZA 3KMUA 5EM7A 4RWLA 4FTKA 1UV5A 1YVJA 3WZEA 2W7XA 4JIKA 2XNPA 4G6OA 5DWRA 1M17A 4XLIA 4AWIA 3FLYA 3PJ3A 4CLJA 4IFCA 5HVJA 4DEEA 1Q3DA 4IDTA 5AR3A 2BRBA 3OT8A 4EQUA 3A8WA 2XKDA 4N6ZA 4RJ4A 3ALOA 4F7JA 3PJCA 3UJGA 3RK7A 3I79A 4EI4A 2WB8A 1UU3A 4DYMA 4O83A 4D2TA 2XIRA 5D10A 1M2PA 3MH0A 5KBRA 3UGCA 5IISA 2A27A 4BHZA 4I1ZA 4OTPA 4FKJA 3KEXA 5EYCA 2JIUA 2W4OA 5T6KA 3VULA 5EM8A 4FMQA 3IGOA 3HP5A 3II5A 3VBYA 3W2PA 2OBJA 1XH4A 2EXMA 3H4JA 4YC6A 3FC1X 5AIRA 3MIAA 3HECA 3G15A 2GNIA 3FLQA 1YI4A 3FYJX 3LVPA 4FICA 3BWFA 3WF7A 5EKOA 4EONA 4YJNA 3UG2A 4Z7GA 5M57A 2E9PA 3HZTA 2PZIA 4BDHA 4ANMA 3EFJA 4QYFA 3FBVA 4XUFA 3RWPA 4RQVA 3QD2B 3T3UA 2X8EA 1XH9A 5EH0A 3ELJA 1GIJA 1JVPP 2R7IA 5HLNA 4YBKA 3R9OA 2OH0E 3Q2MA 3BGPA 1JKTA 3R9HA 2PVLA 4YNEA 5J1WA 4CFFA 4PTEA 3SHEA 5CU6A 3DPKA 2FA2A 3TG1A 1MQBA 2VGPA 4OR5A 4PL5A 5AUZA 4XRJA 3C0IA 2ITZA 2XKCA 4BIDA 4UXLA 4XV9A 3NRMA 4MK0A 3HEGA 5DT0A 2VV9A 2ETMA 3B8RA 4LRMA 5FDXA 5HZNA 2ITWA 5I9ZA 3ZM9A 4EZ5A 3IKAA 4RIXB 4WUNA 4EC8A 5GJGA 3FSFA 4FYNA 3V5TA 3BBWA 2V62A 3HNGA 4TY1A 3LM5A 3VQUA 4QQCA 4NTTA 4Q5EA 3FL5A 5L2TA 4F1TA 3DJ5A 3O8TA 1YRPA 3R2BA 4O27B 4U0IA 1WBNA 3LFNA 1JKSA 5EW9A 5CYIA 4V01A 3D2IA 3RAWA 4W4VA 1JSTA 4A06A 4AS0A 4TWNA 1REKA 3KK9A 4BDGA 1W98A 5CU0A 3QHWA 4F64A 1GOLA 1KE7A 2GTNA 3BYOA 2BPMA 1Q8UA 4I23A 4QNYA 2YWPA 3KCKA 5E8UA 3OWLA 4BCQA 4F7SA 3VHKA 2CKOA 3FZ1A 1WBTA 3NDMA 3L9PA 2F4JA 3DBDA 5AA9A 3KCFA 2FSTX 4PDPA 1OL5A 2OU7A 2W9ZB 4FF8A 3R2YA 2WKMA 2XRUA 4QQJA 3E7VA 3R9DA 3TNWA 1JAMA 1ZAOA 4HCVA 2HXQA 5I3OA 4CTBA 2R9SA 4BCHA 4F7NA 4EH5A 4GH2A 1Q62A 4QQTA 1UU9A 5HTIA 4M84A 3TKIA 4FG9A 4YZDA 3F5PA 3P78A 3C5IA 4G3GA 4LL0A 4ZXTA 4BKZA 1RE8A 4RFYA 5DFPA 4NM7A 3ZFYA 3QCYA 5JFXA 2NRUA 2VWUA 4RVLA 2EB2A 4UY9A 2YHVA 3IDCA 4YC3A 4KD1A 4Z55A 5KMMA 1K9AA 3DFCB 4RVTA 4CRLA 4ZIMA 4GCJA 4NCTC 3GUBA 4YJVA 1DAYA 3U51A 3VVHA 4M69A 2V5QA 2OLCA 3KULB 3LW0A 3QD4A 4FG8A 5JKGA 3LM0A 5J5TA 2JITA 5CNNA 2J90A 2BTRA 3EMGA 1ERKA 4OBOA 3P1AA 1X8BA 5LVOA 2CN8A 3QTWA 4MXOA 4BKJA 3SC1A 1MRUA 4NCTA 1OKZA 2ZDTA 1R0PA 2A0CX 5JQ5A 4U45A 3I6WA 3MS9A 3UE4A 4KA3A 5BVWA 3WF9A 5B7VA 4I6QA 3OHTA 3R02A 1VZOA 3MBLA 3ZRKA 4ZTSA 3LFBA 3DTWA 2VRXA 3KRRA 3DB6A 3LE6A 4TYJA 3FY0A 1IR3A 2WOTA 4NM5A 2C30A 2QR7A 4H1JA 4KS7A 3EOCA 4GU6A 4HYIA 4C57A 5JGBA 2WU7A 2B0QA 4R5SA 4LOOA 4HGEA 3A8XA 1DM2A 3BLRA 4D9TA 4UMUA 5CAUA 3KRWA 4ASEA 4I0TA 1YXTA 4XNEA 5E1SA 3SXRA 3V8WA 3ANRA 4EZ7A 5J7BA 3BCEA 4CGAA 4ZMFA 5JZNA 5HG9A 5I9YA 1OITA 3FHRA 2VTLA 3HMIA 4FTJA 1UKIA 3NCZA 4JLCA 2PULA 2XNEA 3ALNA 2CCIA 3ITZA 2HWOA 3IW5A 4D0XA 5GZ8A 4I93A 1CSNA 2YCQA 1MQ4A 2QO7A 5DHJA 4ARKA 4RSSA 3ZDIA 2UZUE 4YLLA 3MJ1A 4YSJA 2J7TA 4IDVA 4KSPA 4QRCA 3UG1A 4EORA 3R8VA 4UMPA 4S33A 2HIWA 3K2LA 4QNAA 2X6EA 1G8AA 5EM5A 2J5FA 4UMTA 3PLSA 4NW5A 4UXQA 1UNHA 3G2FA 4FTLA 4PNKA 3T9IA 4CKJA 3U6HA 1PJKA 5AFVA 3IW8A 4U3ZA 3FAAA 3QFVA 4JOAA 5F95A 3UODA 2ZV8A 1Z57A 1XBAA 4XRLA 4DEIA 4LL5A 4CG9A 3BU6A 5ANEA 1I09A 1I44A 5HIDA 3RPRA 3MY5A 4FV2A 5L2WA 5CASA 3FI8A 4PTGA 5CVGA 2J0JA 5FTQA 2C6DA 5C9CA 2VUWA 3UYTA 4F09A 4C3FA 4DINA 3LQ3A 1QPCA 4L3PA 2XIKA 3D5WA 3SX9A 3QU0A 5IQFA 5LCKA 4WRGA 4XV3A 4QMYA 5CF4A 4EK8A 3V5LA 4HVGA 2F57A 2HY0A 2VAGA 4JI9A 4LRKA 2YDJA 5AR8A 5AUYA 5KHWA 3B8QA 3LAUA 4X2KA 4LUDA 3VUHA 5C4LA 3SGCA 1OGUA 4EYJA 2CGWA 4I5HA 4X3FC 3F3VA 3FZTA 3VS1A 4D4RA 4TYEA 2A1AB 3ZRLA 4IVCA 5CLPA 4PRJA 4LMUA 4O7LA 1J91A 2ONLA 3HMMA 1A06A 2ZMCA 4X2JA 4HW7A 5KO1A 4G3DA 3I5ZA 4MXYA 3R83A 2BRNA 3QD0A 3R30A 2CJMA 2H34A 2XIXA 4H3QA 1GJOA 1ZLTA 4PMTA 3GC0A 4M8TA 4A7CA 3P86A 5JZJA 2CMWA 5L6WL 3QRUA 2XIZA 4BCIA 3RNYA 1H1WA 2GU8A 1YHVA 4QT1A 4FSTA 2WMAA 4JX7A 2GQSA 2Y4IC 5AM6A 3O8PA 1XH5A 3QWKA 5IH4A 3TT0A 1OECA 1WBPA 4XMOA 3NUSA 5KBQA 2R3PA 4I20A 3KXMA 2IWIA 3FPMA 3IW6A 2JBPA 1Q97A 4IAFA 4KRCA 5JFWA 2ETKA 4RGJA 3P08A 4EHZA 3AOXA 1ZYDA 4CXAA 3BRBA 1SM2A 4H58A 3E7OA 4R8QA 5D41A 3HLLA 2R0IA 3MYGA 4E8AA 4K77A 3ZYAA 1ZOGA 3DBEA 5CQUA 5LOHA 5BMSA 3BHYA 1DAWA 1GZ8A 2BIKB 3I81A 3N9XA 1UWHA 4BDIA 3P4KA 4FV6A 4KIPA 4FT3A 2JGZA 3QYWA 4LOPA 3ZSIA 3R1YA 2WU6A 3C13A 4QP9A 5CF6A 4WG5A 3OWKA 5EYDA 1Q5KA 2Y6OA 4KS8A 2R3MA 2VGOA 3SXSA 4ACMA 4CD0A 3RP9A 1ZYCA 3GCVA 3V3VA 3VUKA 3NWWA 2XNBA 4M12A 4C2WA 2CCHA 3ZSGA 3MFSA 4Y85A 3UIXA 4TPTA 2E9NA 3CIKA 4B9DA 5IA3A 4QP2A 4DGOA 3ORZA 4CFUA 4IC8A 3MH2A 4JX3A 4A9UA 1FPUA 1FVRA 1KE8A 3EQCA 3D15A 4BDEA 4QP7A 3LLAA 1OKWA 4FL3A 4Q9SA 2BZKB 5JMSA 4DBNA 3IONA 1JLUE 4FIFA 2PVHA 4F7LA 4J1RA 3UO4A 4YBJA 3UP2A 4A9TA 2I7QA 4NJ3A 3PXQA 1Q61A 3UIMA 3M42A 5CI6A 4AGCA 4CSVA 5DI1A 1Q4LA 3VHEA 3NYNA 3L9MA 1UU7A 3DDPA 5EHLA 4O7ZA 3FZOA 3MIYA 5FBOA 4ZZNA 4Q2AA 3V51A 4ACDA 3NUNA 3PTGA 2XIYA 4HGTA 3REPA 1BUHA 2PWLA 4HYHA 4LV8A 2VX1A 2Y9QA 3EFKA 5CXZA 2WD1A 1ZY4A 2ERKA 5ETIA 3A62A 2UW6A 3ORNA 1SNXA 4U7ZA 5BVOA 4ANSA 4X2GA 4IMYA 3PE2A 5EFQA 4UYNA 2H9VA 2JFMA 2XCKA 3ZDUA 4H3BA 5FTGA 4JBVA 3QA0A 4LV5A 2GCDA 4MXAA 3ODZX 1IEPA 5IEXA 3MWUA 3D7TB 1JWHA 2XCHA 2XP2A 2UW3A 3TZ7A 4CMOA 4MAOA 2GNLA 1IG1A 4L45A 1YI3A 5HG7A 3CQUA 1KWPA 5BQ0A 2XK6A 2XNGA 1ZYLA 4S31A 4KAOA 4G34A 3AGMA 3UPZA 5B0XA 2OI4X 4QTCA 1P14A 2VTAA 4GYGA 4NSTA 4RWKA 1IA9A 4YO4A 2C3JA 3LKMA 3JY0A 2ITQA 3Q9WA 5CEMA 2I0EA 4YC8A 4H36A 2BZIB 2ZB1A 4G2FA 3KRJA 4M7IA 4A9SA 1SVEA 4YJPA 5AP0A 4ALVA 4BZNA 5HVKA 4C34A 3E64A 3V5QA 2BHEA 2Z8CA 5EM6A 2A4LA 4RMZA 3QALE 5H8BA 2B4SB 4KKGA 3NYOA 5BYZA 2CGUA 2YLEA 3ZRMA 4EH6A 5CEQA 4FSWA 4JQEA 3DOGA 3FZRA 2PVKA 5AP5A 3ZOSA 4JXFA 4UWCA 4EOKA 1IRKA 4WRSA 2QOBA 3O96A 5AUVA 2WMSA 4TYHB 1XR1A 5M07A 4KNBA 4GUEA 3ZC5A 2UW4A 5IQEA 4FTQA 3R22A 2BKZA 3DGKA 4XCUA 4O7WA 2V55A 4JS8A 3GU7A 2R3NA 3CJFA 5AV4A 3ATTA 5AUXA 4CG8A 4GYIA 2XYNA 3GNIB 4MBLA 1YOMA 2R64A 4RJ6A 1Q8WA 4Y95A 4HYSA 5HNGA 4BICA 4D4VA 4F0GA 1KV2A 1GIIA 2PK9A 4FIJA 2CLQA 4IIRA 3VIDA 3QQUA 4KRDA 3IW7A 4YNOA 3CLYA 3PJ8A 1JKKA 2XRWA 4WT6A 2XEYA 3HDMA 4WHZA 2OSCA 3V8TA 4EQMA 4D2VA 3I7BA 3EYGA 4C7TA 2HZ4A 3CKWA 4K6ZA 4R7BA 4G6LA 3VAPA 3NVKI 2PMNX 2WQBA 2EXCX 4BYJA 5LVPA 4APCA 3GEQA 3GENA 4AN9A 4IM2A 3GBZA 4V0GA 1PY5A 2GS6A 4RLLA 5HOAA 3VRZA 3E3PA 4JBOA 4W4WA 4UBAA 4EK6A 5BVDA 4EKKA 4BBEA 3D7TA 4AFJA 1XH6A 2OZAA 3WOWA 5IH6A 1Q3WA 1CKJA 1H1RA 1E1XA 3E62A 3GGFA 3LFDA 4H3PA 2WZJA 4ZP5A 3U87A 3VBTA 3LJ2A 2A2AA 4FSUA 5CSHA 3R8PA 2O0UA 4FZDB 3SA0A 5AV1A 1WBOA 4W8EA 2ZM1A 4Q5HA 4U3YA 5A4LA 4FKPA 4FZ6A 2HYYA 3H9OA 4ZZMA 5AA8A 5E8YA 5ANIA 2VO7A 4LQMA 4IEBA 4O82A 5B2MA 3EWHA 3ZO4A 2RFEA 4FTUA 4O21A 5GJDA 2BIYA 4L43A 5L8LA 3O50A 2OIQA 2WGJA 3GB2A 3L8PA 2CKPA 4FGBA 3B2TA 5EDRA 1OL7A 2BAJA 5ICPA 4OAVB 4X2NA 2W1CA 4W4XA 4EQCA 4S30A 3VS4A 5HU3A 5CZHA 3PJ2A 4FTMA 3PSCA 2C1BA 3DDQA 4AZFA 1Y6AA 3FQEA 5DT4A 2VTRA 3C4XA 4FYOA 4FV1A 4G9RA 4B0GA 4X3FA 2XUUA 1YWRA 4FEQA 4KSQA 4FNXA 5JFVA 2YEXA 3LIJA 4CV9A 5M55A 5BUJA 4DFXE 4RIWB 4MD7E 2IJMA 2F2UA 4C4JA 1FMOE 3PY0A 4QP3A 5G6VA 5HEZA 4YZBA 3JXWA 2WTVA 3WIGA 3OF0A 2GQGA 4NH1A 3AC5A 3OBGA 4FTCA 3GCUA 4I41A 2QCSA 3NYXA 4IZYA 3LHJA 2W1IA 4RG0A 5DLSA 3BU5A 3NGAA 3P7AA 4KBCA 5LMAA 4GG5A 5CWZA 3OXZA 3QA8A 4HJOA 3L9LA 2R3GA 3WYYA 2VWVA 2EWAA 2PUNA 4DFYA 4X7QA 4G9CA 3F82A 4FG7A 3CTQA 2IO6A 1CMKE 2PVMA 5HESA 4I5PA 4J95A 5IQBA 4RX5A 5T68A 5C8NA 4TWCA 1NVRA 3O23A 1AQ1A 3HMNA 4CQGA 4FT5A 5IQDA 3DTCA 4J52A 4FT0A 4HPUE 4QMSA 3SDJA 4TWOA 3MV5A 4L7SA 1Y91A 5HU9A 4O0WA 2X39A 5DN3A 4DC2A 3R01A 4NZWB 3QF9A 2QOFA 3QKMA 5J9ZA 3VF8A 5AP1A 2PMIA 2XJ1A 2EVAA 3EH9A 3F3UA 4MEDA 3C51A 5EW3A 3TZ8A 1TVOA 1K2PA 4QMVA 3MI9A 3ORTA 5AP7A 2PYWA 4EH8A 3R1NA 4R1VA 1QPEA 1KV1A 4RZVA 4DGMA 1JNKA 4FV7A 4DH7A 4IAYA 4IBMA 4D28A 3BHHA 3AD4A 4PMPA 4Z16A 4H05A 2DWBA 3Q4CA 5CU3A 5IA2A 3CPBA 3JPVA 4FTTA 1GIHA 3TCPA 2UZBA 3R8UA 5I9WA 5IPJA 3GU5A 4WBBB 4UX9A 2DUVA 3UNZA 4ORKA 2X2MA 4F9YA 4QYGA 4D9UA 2GNHA 4CCBA 4UWYA 3HL7A 3NEWA 3OW4A 3RPVA 3ACJA 3RCDA 4I6BA 3GU4A 3ZLXA 2BAQA 2C0IA 3VN9A 1PXOA 5DPVA 3PSDA 2C5OA 3UNJA 1L8TA 2FB8A 2X7FA 4G5JA 2R3IA 5HE2A 3QLFA 5J95A 2W06A 3HX4A 4IXPA 4PY1A 3ZMMA 5LMKA 1IA8A 3PFQA 4WG4A 4BZDA 5ANKA 3TKHA 1S9IA 3AG9A 3P5KA 4RFZA 4A4XA 4CVAA 4GRBA 4M15A 3QWJA 4CV8A 3EKKA 4BC6A 2J0MB 3TTIA 2VWBA 1JKLA 4ANOA 4NU1A 4PPBA 2C0TA 4AW1A 5HBJA 3Q2JA 2O5KA 3VS6A 4I92A 2PVRA 2W1GA 4A9YA 3WZUA 4TYIA 1OM1A 5DT3A 1ZMVA 5DMZA 4L3LA 5CF8A 3COMA 3JVRA 2E9OA 5AUUA 4AW5A 5GHVA 3F3WA 1J3HA 3HA6A 3NAYA 5LWNA 3VW8A 3R7YA 2ONLC 4CKIA 1V1KA 3A7FA 4Y83A 4NW6A 4U41A 4I94A 2VWIA 4U97A 3ZZEA 3UO5A 1PMEA 1LR4A 4QPSA 3BYMA 2Q0NA 4D2RA 5DIAA 4RC3A 2C6EA 1H1QA 3NPCA 3ORIA 3FUPA 4FK6A 4WO5A 5CSVA 4CYIA 2RG5A 5GJFA 2YIRA 3UC3A 4AE9A 3R7GA 5JFSA 2JAMA 3DNEA 5AP2A 5A6OA 4DGGA 2ITVA 5EOBA 3VWAA 4EKLA 5JN2A 2V7AA 4P7EA 3SRVB 1H1SA 3T9TA 2CKQA 4OBPA 4FSZA 1OZ1A 1OIUA 2WMWA 3R21A 4UMQA 2C3LA 2UW9A 4GVAA 4XP3A 3DFAA 4NYEA 4JDKA 1M2QA 3FZSA 3F9NA 3ZHPC 5HO6A 4OW8A 4R3CA 3GI3A 3S3IA 3NAXA 5LCJA 1M7QA 2OWBA 4M0YA 4FEXA 4ZJIA 5E7RA 4BCOA 2I6LA 1BL6A 1OMWA 4IVAA 5FEDA 1B38A 2QU5A 4JJRA 4NK9A 4BTJA 4F1OA 5KZIA 1WFCA 3PY1A 4ZJJA 2YM7A 3QCSA 2PVFA 4W4YA 2X1NA 4FR4A 3U4WA 3ZH8A 4GG7A 2B52A 2GSFA 2WMBA 2X4ZA 2W0JA 4BI0A 4EHGA 4EH4A 4F0FA 2W96B 3WE4A 5CAVA 1YKRA 4E26A 5DBXA 3OWJA 3T8OA 3KKVA 2QONA 3C7QA 3N51A 4XG2A 3NW6A 4EOLA 3HAMA 2XBAA 1MRVA 3OXTA 4FUYA 1KE9A 2O65A 4EJ7A 4FKUA 1CKIA 3AMYA 3CTHA 3MFTA 1H0WA 4RC2A 3CGOA 3MVHA 4P4CA 4U5JA 1YDTE 3F3TA 3KK8A 3O51A 4ASZA 4I6FA 2F7XE 3S4QA 4RVKA 5DEWA 3MTLA 3ZCLA 3A7HA 4BGGA 2C69A 3DJ6A 3PIXA 3TV7A 5IA1A 5E8WA 3O7LD 4X6QC 3LFAA 3Q4UA 4USDA 5AWMA 3QZFA 2OXDA 2VNWA 4NIFA 3LCKA 4XLVA 2Y7JA 5IQGA 4HCTA 5ETAA 3UVPA 2YM5A 4N4SA 4OTIA 2XKFA 4D5HA 4DEAA 4F0IA 5KUPA 4ALUA 3QUEA 2VTSA 4IH8A 5AUWA 4PDSA 4RA5A 3A7IA 5FQDC 4GL9A 3R8LA 1SVHA 2ZOQA 4N70A 2O2UA 2PUPA 4GKHA 3DJ7A 3MW1A 3MDYA 5DE2A 2UW0A 4AN3A 5C27A 5A4CA 1G8SA 5DR9A 2O3PA 3K3IA 2UV2A 3W2OA 5HG5A 5L2QA 4DF3A 5LMBA 5JGDA 5DR2A 2Z02A 5CTPA 4RIYA 4MKCA 3JUHA 2ZV9A 1G5SA 3PSBA 3Q5ZA 1VR2A 1WZYA 4IW0A 4UV0A 3GT8A 3F2RA 4O0VA 5J5SA 1LEWA 4MF1A 3DKFA 4YZ9A 3TNPC 4ZLOA 4RWJA 1OIQA 5TF9A 4F1MA 2R3QA 5AR5A 3RK5A 5IMEA 4HGLA 2BDWA 3R7UA 2HAKA 3RKBA 2PTKA 3G33A 4OLIA 1PMNA 3DKGA 3TWJA 3UZTA 4B7TA 4DEDA 4JNWA 5JGAA 4ENYA 4PMMA 1XHAA 3F66A 1T45A 3Q60A 4EL9A 5DEYA 4BWPA 4DT8A 4Z9LA 2CKEA 3FLWA 5AV3A 5D11A 4WBOA 5HO7A 4R7IA 4BCGA 3AXWA 5L6OA 5AV2A 4K9YA 3UIBA 3KFAA 3TACA 3UTOA 2W9FB 3QRJA 4FEUA 3PY3A 2XEZA 4O0UA 5EOLA 1R3CA 3N4UA 2WQOA 4AT3A 2VWYA 4ITHA 4EHVA 4FKSA 4O7TA 5L2IA 4AN2A 3ET7A 1GZKA 2WTKC 5DOSA 4IVBA 2VTHA 3C4WA 2HELA 4KBAA 5F20A 5HLPA 3AGLA 4BY9E 4RX7A 2OXXA 3GFWA 3ZXTA 3TZMA 2F7EE 4TZRA 5JK3A 2G1TA 3AC1A 3QZIA 3R6XA 4IC7A 2R3OA 5CSXA 2PZPA 3ZFXA 4E4MA 2OF4A 4NJDA 5BUIA 3DXNA 3NR9A 4F99A 5CAPA 3TV4A 3LCOA 4ENXA 4RT7A 4E93A 3LXPA 1PXMA 1SYKA 4E6AA 3AD5A 3DY7A 5KMJA 4GS6A 3ZM4A 2PVJA 5IF1A 3BHVA 3KRXA 4GJ3A 4ZZOA 4IAKA 5CT0A 3PIYA 4TRLA 5KMLA 4OTDA 3G9NA 4JL9A 4R6VA 4C02A 4BZOA 1H8FA 4EHEA 4IM0A 4UZHA 5I9UA 3PVUA 3ZBFA 5C1QB 3QQFA 2PUIA 5IQAA 4EEVA 4UMRA 1EH4A 3CY3A 3GC7A 4RIYB 1TKIA 2XK9A 3P7CA 4ACCA 3FLZA 3GC8A 1JSVA 1KOAA 4ASDA 4C2VA 3QRKA 3NUAA 1Q99A 4OT6A 3G9LX 3VJOA 4E6DA 3IW4A 3TNQB 3I0QA 4MQ2A 2F9GA 3MVLA 4XG8A 2ESMA 3L9NA 4GEOA 4D58A 4D5KA 3UQGA 3FJQE 3RHKA 5HIEA 2J0KA 2QR8A 2VNYA 3BEGA 5IDNA 5D1JA 3R7IA 3RAKA 1IAJA 2XJ0A 3IECA 5LARA 5EQYA 4KIKA 4IX5A 1DS5A 3MH3A 4MBJA 4ZMEA 2C3IB 1UNGA 1YWNA 3F7WA 3Q4TA 4GJ2A 4IM3A 3W18A 2HXLA 4CRSA 2P33A 2WPAA 1ZY5A 1XWSA 3R63A 4AOJA 3EQBA 4P90A 4YHTA 3SLSA 3QRIA 4QTBA 4NUSA 3THBA 4RPVA 3NIZA 4WNPA 2RKUA 5HNIX 2XB7A 2CDZA 3U55A 4DEBA 4WSYA 1OL1A 4KIOA 5AAEA 4BHNA 3O2MA 2OIDA 3C50A 5M4UA 3WF6A 3L8SA 4CFVA 3EN9A 4EUUA 3SW7A 4WKQA 3FL4A 3KRLA 4M66A 5HE3A 1OUYA 5J1VA 3PYYA 2R3RA 2HOGA 3PXZA 2O63A 4TTHB 2RFDA 3TN8A 3ZS5A 5J79A 3DA6A 5BNJA 3GFEA 1XBCA 4FIGA 3QLGA 4FT7A 3P79A 5FRIA 4G5PA 3KREA 2IN6A 2WFYA 1QL6A 4Y5QA 2QG7A 2VTJA 3HV3A 2RSVA 5FLFA 3U4UA 3V01A 1GAGA 4M68A 5IQCA 3U9NA 4PQNA 2J2IB 4WNKA 3D7ZA 2BKKA 5CU4A 4AFEA 2HENA 3TV6A 4XOZA 1BLXA 3CPCA 3D5UA 2WMTA 5FWKK 4C3RA 1YXUA 4IB1A 4QMWA 3TM0A 4U43A 4PP7A 5AX9A 5IQIA 4JBPA 2OJJA 4ACGA 2QOOA 4OTGA 3R28A 4EUTA 4HZRA 3ZO2A 2YDIA 3BHUA 4OTQA 4AGWA 2VTTA 5DGZA 5HTCA 4JR3A 4L6QA 3ZLYA 2YERA 2C68A 2W1EA 3A60A 3COKA 3KVXA 4YJTA 2X8DA 4B8MA 4PPCA 3FYKX 2IVSA 5C8KA 2YIQA 2FSOX 5F94A 4AT5A 4BIEA 4I3ZA 3FI4A 4DGNA 3U6IA 3NUXA 5I0BA 3GQIA 4QO9A 1PXPA 4EOSA 5HBHA 2B9HA 3R7OA 4BYIA 2R4BA 2UVZA 2YJRA 3QUPA 3PXYA 4EOPA 4E5AX 1M14A 5KCVA 2B54A 3PVGA 3I0OA 4XP2A 4FI1A 2JDSA 3NUYA 4HNIA 4FODA 4BTMA 5HX6A 3CR0A 2C5XA 2J50A 2FYSA 5LMKC 3OFMA 3H0ZA 3ORKA 4O2PA 3CKXA 3OG7A 1GZOA 3QD3A 3QC9A 3W55A 5IZFA 3OD6X 4FIEA 5AR7A 3KC3A 4FOBA 2QI8A 3Q04A 5AM7A 3QKKA 4GV1A 3UOKA 5ETCA 5ANGA 3KB7A 3PJ1A 2YZAA 3ZO3A 3L8VA 3FMNA 4YTCA 5HI2A 4BI2A 1BI8A 2W05A 4HPTE 3FE3A 5M4CA 4AW0A 3QTXA 2H8HA 4O1PA 5EQEA 1OUKA 3R0TA 4ZS4A 1BI7A 2OGVA 3BPRA 5DRBA 2JKKA 3MJ2A 4C38A 2BFYA 1YDRE 2XA4A 3UVRA 4C8BA 3LCSA 3SG9A 4DFUA 2OW3A 4RWIA 1VEBA 1PXJA 2WQMA 4MTAA 5KHXA 4UALA 3QTSA 2NPQA 3DK6A 3GU8A 3MA6A 4QP8A 3ZTXA 2JKMA 5CNOA 5CAOA 1M52A 4QD6A 3RZBA 4AA5A 4Q9ZA 2ZVAA 3QRTA 3MVJA 4CYJA 5L2SA 1W83A 2R7BA 4R1YA 3OY3A 4QP6A 3Q9XA 3FMJA 3A7GA 4FV3A 4NM0A 1KE6A 3OWPA 3O0GA 4FSNA 3G6GA 5HG8A 4ZSAA 4L52A 2KTYA 3EHAA 4OTHA 2ZB0A 3RINA 4W9XA 5FG8A 3I7CA 4AACA 4YGAA 3NSZA 5JQ8A 1FGIA 3A2CA 4NWMA 3CSVA 4FZAB 4YJUA 2BRGA 4FVPA 3GVUA 2CN5A 4L3JA 1U5QA 3PG3A 4IWOA 4DTKA 2F2CB 2YACA 4FNYA 3BGZA 2GS7A 3MSSA 4ZSGA 4G16A 3U54A 3D9VA 5DVRA 1YHSA 5KMIA 4B99A 2J0IA 3WF8A 4E73A 5LWMA 3DKOA 2QODA 5CAQA 4FGRA 5HICA 4YR8A 2BDJA 3CBLA 2WNTA 3Q4ZA 2JIVA 2AYPA 4FNWA 4YPDA 3IGGA 2BALA 2JDRA 1JQHA 3QQJA 4IADA 3DAEA 4P5ZA 4YU2A 3UQFA 3Q53A 4J98A 4IAAA 4Y73A 5M4FA 1OL6A 4KIQA 1WVXA 3R9NA 4GIIA 5K5XA 3TEIA 5HIBA 4GU9A 2X2LA 3FMHA 5LQFA 5AP3A 2RL5A 3VUTA 1OI9A 4GK4A 4IE9A 2B1PA 4FTNA 5E8VA 4D55A 4KB8A 1J1CA 4ZSJA 5A46A 3BI6A 3D0EA 1U54A 3WBLA 5C8MA 4ZLZA 5FXQA 3EN7A 1NXKA 3PZEA 3OUKA 4YHJA 4ERKA 1J7IA 3C4FA 4WSQA 2CNVA 4GMYA 2YM8A 4N6YA 4LGDA 3ZUTA 1V0PA 4MWHA 3ZZWA 4IAZA 1K3AA 2WEIA 4JG7A 4CFMA 1MP8A 3CTJA 4C61A 4E5WA 5J9YA 2C6OA 2XKEA 3AD6A 1ZXEA 2I0YA 4O6EA 2W4KA 4M0ZA 3F5UA 2RF9A 4FVRA 1M7NA 4AOTA 2VU3A 4FTIA 2V22A 3RPYA 4R78A 3DK3A 1OB3A 4FZ7A 3Q9ZA 1WMKA 4XYFA 5FM2A 2ITPA 5JRQA 2JKOA 5AUTA 1J1BA 1GY3A 2C3KA 3SQQA 4BDJA 1ZWSA 3ERKA 4GUBA 4TW9A 3SKCA 2IPXA 2QKRA 3F7ZA 3TKUA 1CM8A 4UB7A 4M67A 4CZUA 5T3QA 4NM3A 4IZAA 3FWQA 2B9IA 4Z3VA 4ZY4A 1PXIA 1UU8A 3LMGA 3AMAA 4S34A 5E8ZA 4WG3A 5F4NA 3W2CA 4ERWA
chains in the Genus database with same CATH superfamily
4CKRA 1O6KA 3PWYA 3F2AA 2JIIA 4YZMA 1FQ1B 5B2KA 1IASA 4DG2E 3HDNA 1CKPA 1LPUA 3K3JA 3P7BA 1XJDA 3VC4A 4ZTQA 1YDSE 4MD8E 4MX9A 4NIFB 3ULIA 2J51A 2ZAZA 5HNBA 2C5NA 3HRCA 3MA3A 4E6CA 2C6IA 4DTAA 4GFGA 4BI1A 3TUCA 3D5VA 3MESA 2QVSE 2YABA 4FE2A 4LM5A 2C5VA 4ZY6A 3OZ6A 2G2IA 1O9UA 3Q96A 2H96A 4KINA 4XH6A 3RK9A 2VZ6A 5CVFA 2QOKA 5E8SA 3OBJA 5FP6A 4LGGA 4IX6A 4YZCA 5IKWA 4EOOA 4GFOA 1LP4A 3NZ0A 4BGQA 4HVHA 1HCKA 2ZDUA 3QCQA 1RJBA 4I4FA 4U8ZA 3WARA 4J99A 3BLHA 3TUDA 2YCSA 4XP0A 1WBSA 1RW8A 4L67A 2YCFA 4LG4A 1NVQA 1TQPA 3P23A 5DYJA 2WTJA 4O38A 4YO6A 3ULZA 4N57A 4O86A 2BCJA 3TIYA 2HZNA 2I40A 5FEQA 5L6PA 4HOKA 3ZLSA 2WIPA 4EOMA 4P5QA 3ID6C 3D4QA 3I4BA 3F5XA 5HCYA 2HW6A 2R3FA 4B8LA 4F9BA 5L3AA 2BMCA 4ANLA 1FVVA 2Z2WA 4TKSA 4GW8A 3K54A 3W8LA 3QTIA 3WYXA 4C36A 2DYLA 2R3JA 2ITYA 5M06A 2JDTA 4GFMA 1KSWA 4MVFA 4YTHA 2VWZA 2VD5A 4FIIA 3WZJA 3ZLWA 3N4VA 2F49A 4C59A 5GIOE 3E8CA 3W2RA 3EKNA 2VWWA 3R00A 4LYNA 5CI7A 4AQCA 4BTFA 1FVTA 1W84A 3R9RA 3EZVA 2YN8A 1H00A 2O64A 5D7AA 1F0QA 3BWJA 5I3RA 3DLZA 5DG5A 2WTDA 5CX9A 2BAKA 2AC3A 4BB4A 3FV8A 5IMXA 4CT2A 1MUOA 3DS6A 4LI5A 5H9BA 4AE6A 4R7HA 3BEAA 1Z9XA 4A9RA 4O0SA 2LAVA 3RI1A 1B6CB 2QOLA 3I5NA 1H27A 5EI2A 2B55A 4FNZA 5HE1A 3UBDA 5KNJA 4NKAA 3KIOC 3ODYX 3OT3A 2DQ7X 1ZZLA 3IDPA 3O17A 3DU8A 4Y5HA 4C33A 4OTRA 4C62A 3IPHA 1AGWA 4DH1A 4FEVA 3LXLA 3VW6A 4XOYA 3VBWA 2PVNA 4YZNA 5ACBC 5CEPA 3RTPA 3W2QA 3TDWA 3DK7A 3LFCA 3HYHA 4LFIA 5AR2A 4BTKA 3OEZA 4AU8A 5IG1A 3FQHA 5HLWA 2J0LA 4JR7A 4QTEA 4K18A 3UVQA 5DRDA 4YJRA 1M2RA 5E90A 4DITA 2R3LA 2W1DA 4GIHA 4I0SA 5FXRA 3FMLA 4EC9A 2UVYA 3F3ZA 4QOXA 1G3NA 4CQEA 5FTOA 4PWNA 4ITJA 2GHGA 4L46A 1YXSA 4XG4A 4NT4A 3VRYA 4BCMA 3KN5A 3TJDA 4BCJA 4L42A 2GNFA 5A54A 4F78A 2ITNA 2E2BA 5CALA 1WVYA 4E4LA 4F9AA 4F9CA 2IG7A 1OL2A 2X9EA 2E9VA 4QMZA 4C4FA 2PUUA 4O7VA 1ZMWA 3MVMA 3FKOA 2PE2A 1ZYJA 3HV6A 4JBQA 3NUUA 4K11A 3E63A 3V5PA 3EQHA 4BGHA 4USEA 4L8MA 4PP9A 5K3YA 4DCEA 3PXRA 2Z7LA 1V0OA 4AQKA 3U9CA 4RQKA 5LVLA 1OPKA 1R78A 2ACXA 4Z7HA 3NUPA 3FPQA 5JEBA 3RZFA 4PL3A 4O4BB 3UOLA 1OPLA 4BVUA 2P55A 3NNVA 4UZDA 2UZTA 3RJCA 1Q8TA 4RVMA 2IZRA 2WIHA 4EK3A 2VN9A 4AW2A 1QMZA 5F1ZA 3RWQA 5J8IA 3UDZA 4HGSA 2WELA 1VYZA 4JG6A 4V05A 3DXQA 3Q3BA 3VUMA 3C0GA 3C4EA 4RRVA 4TWPA 2G2HA 4IB0A 3V5WA 4C4HA 3RAHA 2BHHA 3FXXA 1ATPE 3PRIA 4LRJA 2XBJA 3MGYA 4FZFB 4PPAA 4DH8A 4BF2A 2QURA 4D1ZA 4DCAA 3EFLA 3LOKA 5CQWA 4TT7A 1CTPE 4DG3E 3ORXA 3FKNA 3PIZA 4TYHA 5EYMA 3KMWA 4RX8A 4KBKA 2CGVA 2OJGA 2W5AA 3MPTA 2BVAA 1W82A 3RM6A 2JFLA 3NNXA 4QMMA 3KXXA 2QHNA 4DE4A 2PMOX 1SMHA 4EH2A 3FMDA 4NTSA 3ZC6A 2RIOA 3AQVA 2YAKA 4DDIA 5IDPA 2CGXA 3W0NA 3O7LB 5K4IA 2G15A 4ZTMA 2C6LA 3KQ7A 5AX3A 4QMLA 3F88A 3EZRA 4RJ5A 1PXNA 4XS2A 4DFZE 4IHPA 1E1VA 2WXVA 3VNTA 2YCRA 3LFSA 4MBIA 5ANJA 4PF4A 4ACHA 3CCNA 4AX8A 4CFWA 1OVEA 1QPDA 4R5YA 1FINA 2C6TA 3KXNA 4D4SA 4FKIA 5ANOA 1APME 1PF8A 3S1HA 2HZIA 2OJFE 3AC3A 5DA3A 4V0GB 3GU6A 4BFMA 2OJIA 4GKIA 4EOJA 4YURA 1URWA 2OZAB 4FT9A 4A4OA 2BRHA 3QX4A 3UMWA 1YI6A 2Z7SA 1U5RA 2VX0A 3U8WA 3ZEWA 4AGUA 4CZTA 3KMMA 3BV3A 3LLTA 5A4TA 1AD5A 2QOHA 2IVVA 4DN5A 3M1SA 5IA0A 4WOVA 3FZPA 2PE0A 4O2ZA 4PX6A 4FV8A 3AC4A 4FKLA 3E3BX 1L3RE 2X0OA 5J87A 3C0HA 2NRYA 3BYVA 3RM7A 4RJ7A 1QCFA 3O8UA 3ROYA 3E8NA 3PA5A 4PV0A 2YIYA 3TI1A 4RIWA 2ERZE 4NKSA 4ZJVA 2QOIA 3PRFA 4RC4A 2WMXA 4RFMA 3DQWA 1WCCA 3NVMB 4IB3A 2Z60A 3DXPA 1STCE 2OZOA 3AMBA 1HOWA 2UVXA 3OOGA 2OK1A 3OROA 3PXKA 4FSRA 4U44A 4X0MA 5H3QA 3S95A 3KL8A 5EDPA 5HGIA 1IAHA 3R04A 2NYAA 4X3JA 4IJPA 2IZSA 4ZTHA 4MXCA 3R8ZA 4MXZA 4EK5A 3OS3A 4I22A 3DV3A 4X3FB 5FGKA 2WMQA 1Z5MA 4K0YA 5M08A 2FVDA 1WVWA 1W0XC 5FP5A 4B6LA 3RCJA 4LDTA 3ZUVA 3JVSA 1Y6BA 4F08A 1A9UA 4BCFA 1ST4A 2VTIA 3W10A 3K5UA 3H10A 4L44A 3PA3A 4A4LA 4WD5A 4QPMA 4L9IA 1Q8ZA 4MH7A 1H28A 5AV0A 4MCVA 5EI8A 3VJNA 5LVMA 3ZSHA 5GNKA 2X0GA 5E4HA 4HVSA 4DAWA 4G17A 4XG3A 4UEUA 2ZV7A 3BQCA 3GOPA 3ZU7A 4D1XA 5TT7A 2QO2A 4QYHA 4JRNA 2ETRA 4HYUA 3I60A 3PE1A 4TNDA 4RX9A 5AJQA 1R39A 5DH3A 4E3CA 1DI9A 1H08A 4J8NA 5CVHA 5IUGA 4PL4A 2XVDA 5BYLA 2OFUA 5AP4A 5CU2A 2X2KA 2XK8A 5E92A 5ETFA 2OKRA 2X0QA 3HA8A 4MNFA 3BIZA 4FVQA 3VUIA 5HKMA 3HP2A 3RHXA 3CXWA 4XG6A 3LPBA 1R1WA 3NLBA 3OVVA 2YISA 4AZWA 4R3RA 4A07A 2DS1A 2BR1A 1H26A 3RBWA 3VBVA 5D12A 2R3KA 1OKYA 3SXFA 2PL0A 2PE1A 4CNHA 4QMNA 3ZBXA 2PMLX 2IW8A 4BDBA 5J9LA 2FSLX 3BLQA 1PRYA 2Y4IB 3FLNC 3MPAA 4HZSA 1XO2B 3LJ0A 4GK2A 5CT7A 4RJ3A 4V04A 1U54B 2XZSA 4FKRA 3KXZA 3KVWA 2GMXA 3F5GA 4FIHA 2CHLA 3EJ1A 4FUXA 2PU8A 4IX3A 2CLXA 5CY3A 5CXHA 4I0RA 5EHYA 1BYGA 3F61A 3H30A 1J7UA 3C4ZA 3HUBA 3VS5A 3BBTB 4S2ZA 3TZ9A 3VS2A 3JR1A 4EYMA 4DHZA 2OO8X 2WQEA 2V7OA 3ZONA 5EKNA 3E88A 2GFSA 3K5VA 3TXOA 5A4QA 2JC6A 5BVNA 2REIA 4E5BA 4HVIA 4AZTA 2W4JA 4IANA 3ATSA 3ENMA 4CCUA 4FTOA 1TQIA 1PXKA 4CT1A 2YM3A 4XG7A 3RPOA 4BDDA 2VTQA 3CD3A 4MUQA 3QKLA 3QTQA 5I9VA 3MH1A 5EW8A 3RGFA 4BCNA 5IEVA 3R7EA 4XV2A 4D4YA 3H0YA 3E87A 5E91A 3LMHA 3LFFA 3QGWA 4AXFA 2UZDA 2XM9A 2W1FA 3UO6A 4C58A 2XS0A 4QMUA 4LMNA 5KX8A 2UUEA 2PPQA 4RZWA 2BZJA 5CENA 4GT5A 3IK3A 3NCGA 3ZXZA 4C37A 4ZSEA 4FC0A 3V8SA 2WAJA 3AT4A 3QQKA 3A4OX 4MXXA 3UOHA 4ZAUA 2O8YA 3FKLA 4DH3A 4ZSLA 4NFNA 3OC1A 5AAFA 3R8MA 4FKGA 3OW3A 5M56A 3S00A 3V04A 3GCQA 2BILB 2PZRA 2XH5A 1JOWB 4MWIA 2QO9A 5C26A 4NFMA 2VWXA 3E8EA 4EH9A 2YITA 3DCVA 5KZ0A 2UW5A 3UDTA 3F6XA 2UZLA 3VF9A 4FKQA 4O91A 4KKHA 2WOUA 4OT5A 4BR3A 3UIUA 2I1MA 3NX8A 3A7JA 3QAME 3AC8A 1TQMA 5HE0A 1Q8YA 4BL1A 3D5XA 4TN6A 5J7HA 4O0TA 2WTKB 3TYKA 4U81A 3MFUA 4YSMA 3R71A 4FV9A 1WBWA 3EL8A 2UW8A 2KULA 4L68A 1FMKA 5AAGA 4ZOGA 5H8GA 3IOKA 2SRCA 4KUJA 3CC6A 2GFCA 3RNIA 4Y8DA 3FXZA 4DLIA 2WMVA 5HCZA 3RALA 1H0VA 4WA9A 4ONAA 3BZ3A 4ZTLA 3QXOA 3QXPA 1PW2A 2VO0A 3MTFA 4QQ5A 3PA4A 2J9MA 2WMUA 4ANNA 3FLSA 4B4LA 3G5DA 3L8XA 3D83A 3PDTA 5KKRB 1Y8GA 3BYUA 3R1QA 3VUGA 5CF5A 4PDOA 3KXGA 4FV4A 3KN6A 2AUHA 2JDOA 4GK3A 3D94A 3UZPA 3QCXA 1H24A 3QC4A 5LJJA 1OPJA 4YPSA 4AXAA 1FGKA 3CQWA 4J8MA 4HNFA 5FDPA 3EIDA 3VBQA 4G3EA 4DHFA 1P5EA 3FDNA 4IVDA 5L8JA 4O7YA 2W5BA 3G0EA 4HCUA 4RBLA 2YDKA 3FI2A 3CEKA 3SAYA 2GNJA 3JYAA 4YJOA 4O0XA 4BDCA 5A9UA 3COIA 2FGIA 5FD2A 4YLKA 2XJ2A 3OCTA 5EI6A 5EYKA 4D2PA 1NT2A 4DTBA 3UMXA 5AADA 3WF5A 5LVNA 4X2FA 2HZ0A 3OOMA 5FM3A 4BBMA 4BDFA 2BUJA 3N4TA 1YOLA 3W8QA 4BWKA 3JY9A 1R0EA 4EJNA 3MY1A 3I6UA 2GS2A 1ZOHA 4XJ0A 4ID7A 5L8KA 1XH7A 3F69A 4C4EA 4CMTA 3FC2A 3U6JA 4LGHA 1YHWA 2X7OA 3KY2A 3CE3A 4ITIA 4M3QA 3V6RA 3QBNA 3SVVA 3C4CA 4WNOA 4F63A 4U42A 1ZOEA 4PMSA 3E92A 4BDKA 2B53A 5C03A 2UW7A 3W2SA 2BDFA 4IWPA 5BX0A 4YLJA 5BMMA 2OF2A 2WTWA 2QLUA 3EN6A 4QMTA 2Z7QA 3NMUF 4X21A 4L01A 4I4EA 4CZYB 4F6WA 4CLIA 5F9EA 5L4QA 4CEGA 4IWDA 3UOJA 2P2HA 3OUNB 1U4DA 5TE0A 1W7HA 3OMVA 2YLFA 4FTAA 5TR6A 2HY81 4BKYA 4O7SA 2G9XA 4O4FA 2FUMA 1KUTA 3NNUA 2X7GA 3GC9A 2Q83A 3QZGA 4OTWA 2X4FA 4QDVA 3IS5A 4LOQA 3BYSA 4CMUA 2GHLA 4DGLC 5BUEA 3OTUA 4DA5A 3QQHA 5KE0A 2W1ZA 3V6SA 4BJJA 3FSKA 1W2CA 1ST0A 2WTCA 3HAVA 1UNLA 2GQRA 4FV5A 2PVYA 4ZK5A 1H07A 4QTAA 2ZFYA 3WE8A 1B39A 3SG8A 4X6RA 2YFXA 3IO7A 3PPJA 3PPKA 4I21A 4JAIA 4JAJA 1PXLA 4MNEB 4PUZA 2RGPA 2OFVA 3FXWA 1DI8A 2OICA 4FX3A 4H1MA 4AZSA 5A14A 3C9WA 4QP1A 3HUCA 1Y8YA 4DBXA 4ZS0A 2WEVA 2QD9A 5G1XA 3RPSA 4BCKA 4KABA 4QYEA 2GTMA 2QU6A 2YM6A 5FXSA 2BFXA 2V0DA 1P4FA 4DFBA 4JT3A 1ZZ2A 2C5YA 1OBGA 4OTFA 1LEZA 3DBCA 1ZRZA 4IZ5A 4JIAA 5HCXA 3OXIA 4GT4A 3DKCA 3CS9A 3HMPA 4GT3A 4E1ZA 2P3GX 2XNMA 2ZMDA 1ND4A 3GCSA 4O1OA 4K1BA 4XBUA 5DR6A 2W17A 3A99A 3ZFMA 1J7LA 4MYGA 4R77A 5EDQA 3W0MA 1PHKA 2GDOA 1JPAA 3CD8A 4JDJA 5IUHA 4FOCA 2W5HA 4OAUC 5A4EA 2PZ5A 2X81A 4QP4A 5JT2A 4C3PA 3SOCA 4I5MA 3EYHA 4U40A 3POOA 3QQLA 3SV0A 3W1FA 3F2NA 3EQPA 3O71A 3OTVA 4K2RA 4DEHA 5CEKA 5K9IA 5IUIA 2WTIA 5C4KA 4U79A 1BMKA 3IG7A 3BQRA 4FKOA 2IF8A 3TUBA 2Y8OA 4L53A 1H25A 4GVJA 4QYYA 3W32A 1S9JA 5JSMA 4G3FA 3KXHA 3POZA 4L00A 2YWVA 3UPXA 2XYUA 1E9HA 2IW6A 3NW7A 3TNHA 3FMEA 2UZNA 5EQPA 4DT9A 2YA9A 5GINE 5H2UA 4K8AA 3RAIA 4UN0C 4QMOA 2E9UA 3UC4A 4F65A 4C35A 4O7NA 4O96A 4PNIA 5TOZA 3ORPA 2YAAA 3EFWA 5KMKA 3MB7A 4G1WA 4JRVA 5HBEA 4YUQA 3CJGA 4D2SA 2VTPA 4FL2A 4F9WA 1H01A 1NY3A 3FHIA 4W9WA 2FO0A 4J7BA 1REJA 4XBRA 1ZARA 5KMOA 5HHWA 2NNWB 3ML1A 5ACKA 3LZBA 1BKXA 3PLAE 4LUEA 5AMNA 4O0RA 4RIXA 4FL1A 2OJ9A 5AIKA 1O6YA 2FH9A 3DB8A 4JDIA 4KIKB 5CSWA 4DH5A 4FSYA 3W33A 4AZVA 2JEDA 2LGCA 4I5CA 3UNKA 3LFEA 3LMIA 2BRMA 3SOAA 3EN5A 5D7VA 5BVKA 1PKGA 4EOIA 5HO8A 1UA2A 1NW1A 3DZQA 4JQ7A 1YOJA 3DBQA 4RA4A 1WBVA 2VX3A 4FV0A 3WZKA 3GOKA 2G2FA 3PUPA 1F3MC 2YIXA 3KA0A 5A3XA 4WNMA 3BX5A 1XBBA 2W1HA 3AC2A 2IVTA 2XF0A 2NO3A 3DAKA 4R3PA 1KOBA 1UVRA 1QPJA 3HKOA 2Z7RA 4Y72A 2XK4A 3G51A 2G01A 4AAAA 3EB0A 4C0TA 5GIPE 4AF3A 4I24A 3SW4A 5M44A 1U59A 2YIWA 1TFFA 5K4JA 2XK7A 1HCLA 3BGQA 4BDAA 4EBWA 4CTCA 3HV7A 2I0VA 2J6MA 3R1SA 2VTNA 2QC6A 1H4LA 1PMUA 3COHA 4FKVA 5IEYA 4D0WA 5HQ0A 1URCA 3IDBA 4RLKA 2QOCA 2C47A 5EG3A 3UZRA 4JMQA 4XG9A 4IWQA 3OEFX 4F6SA 2P0CA 4EOQA 3OCSA 5ITAA 2ZM3A 4MF0A 1YWVA 3TJCA 2VO6A 3RVGA 2JDVA 3I1AA 4XHKB 4AZEA 4EK4A 5JH6A 2EUFB 4TXCA 4ZLYA 2W99B 4FBXA 4M69B 4F4PA 3VUDA 1NA7A 4K33A 1Q24A 4DG0E 4USFA 3KULA 1YW2A 4O6LA 4YTFA 1RDQE 2JBOA 1BL7A 3EQFA 3G6HA 5CS6A 4U6RA 3D2KA 3HRFA 3DZOA 3EQRA 3LCTA 2AC5A 3Q52A 4S32A 4Y46A 5HVYA 4ANBA 2VTOA 5EHOA 4MHAA 3R73A 4AGDA 4EZ3A 1F5QA 3WIKA 3HRBA 4F6UA 3TDVA 3DT1A 3BU3A 1PKDA 4DFLA 3M2WA 2HK5A 3P9JA 4EWQA 4IX4A 4ANQA 3HVCA 4E6QA 4II5A 3GXLA 4YP8A 3S2PA 4TNBA 4TYGA 3PPZA 4BRXA 3QHRA 2B9JA 3UYSA 1YXVA 2QQ7A 4IZ7A 3IQ7A 4MD9E 4QPAA 3PVBA 4J96A 3OCBA 4I6HA 3E8DA 3FMKA 1SNUA 1NVSA 2Y4PA 3V5JA 4TL0A 2R5TA 5BPYA 1H1PA 4RIOA 4FEWA 4F70A 2JLDA 2QNJA 1SVGA 3MY0A 3B2WA 1ZYSA 3H9FA 4IACA 4O7RA 1OIRA 3CGFA 5CEOA 2BTSA 2FSMX 3MB6A 3Q9YA 3EQIA 3W16A 4XX9A 2R3HA 2XK3A 4P2KA 2A19B 2YJSA 1CDKA 4UYAA 2PSQA 4YJQA 3UP7A 3UQCA 3NIEA 1PMVA 5B2LA 3EN4A 2Q0BA 4FKWA 4N0SA 2HWPA 4G31A 2IZUA 4RJ8A 3JS2A 3Q5IA 3SRVA 2Y0AA 3D14A 1V0BA 3VO3A 1UKHA 4EH7A 3KU2A 1W2FA 3QL8A 4M14A 3CP9A 3DAJA 3PP0A 2X9FA 3ETAA 5I9XA 3QTZA 4EH3A 4QMQA 3BE9A 3PP1A 5BVFA 2QHMA 3A4PA 3ROCA 3UDBA 2JAVA 5AEPA 2ITTA 1Y57A 2YZLA 3NYVA 5CEIA 3ANQA 4ASXA 4D2WA 5CZIA 3QQGA 3TL8A 3TNIA 5FUTA 5FEEA 2PZYA 1BX6A 5IH5A 2VTMA 2NP8A 3QUDA 4BWXA 1UWJA 4ZEGA 3L1SA 4M97A 2HCKA 2R0UA 4ZY5A 3Q6UA 2XMYA 1JBPE 2B9FA 5HX8A 5IA5A 4G6NA 3AKJA 2QLQA 5M4IA 2OH4A 3RMFA 4H39A 2ITOA 4AP7A 5E1EA 3LQ8A 3FEGA 5EK7A 3EQGA 5H8EA 4C4GA 4QMPA 4AA4A 2CSNA 2WHBA 4XEYA 5TKDA 3VS3A 4ALWA 5TO8A 3P5JC 5C01A 4QMXA 3QYZA 2QKWB 1FBNA 5E9EA 3FQSA 3BKBA 5M09A 3EL7A 4PTCA 4XV1A 5DNRA 1WAKA 4QTDA 3SD0A 2ZV2A 3BHTA 4ZTRA 3GQLA 5BVEA 3ORLA 3OP5A 4M13A 5GZAA 5HORA 2C0OA 3OY1A 2C4GA 3Q6WA 3P0MA 4W8DA 3MFRA 2C6MA 4AUAA 4U9AA 4C4IA 1ZMUA 2B7AA 3DQXA 4J71A 3CY2A 5E8XA 4O0YA 2XM8A 3H9RA 3MN3A 1XQZA 3NS9A 2OG8A 3OCGA 5IQHA 1RQQA 2CPKE 2C6KA 3HMOA 3LQ5A 4DLJA 4JG8A 4AT4A 3DLSA 4BCPA 4FSMA 3CQEA 3QZHA 4BIBA 4O4DA 1P2AA 5AR4A 1GNGA 1XKKA 3VS7A 5CSPA 2ZM4A 3ACKA 3HV5A 1T46A 5GZ9A 4IB5A 3VS0A 3PG1A 4BN1A 2C1AA 1LUFA 3PVWA 4JQ8A 4JVGA 3G0FA 4IQ6A 3ZO1A 1VYWA 3W0RA 4ZTNA 3LFQA 4FA2A 2J5EA 2IZTA 3EQDA 4DFNA 1SZMA 2GHMA 5IU2A 2J4ZA 3VQHA 1O6LA 2VO3A 4YTIA 3WZDA 2EU9A 4AOIA 4D1SA 5HTBA 3NNWA 2UZWE 5K5NA 3PZHA 1VJYA 2ZYBA 3TTJA 4CFNA 2X6DA 5AP6A 1Q41A 4CFXA 3E93A 4UWBA 3G90X 2IVUA 4EWHA 2GNGA 5CANA 1OBDA 3HV4A 4OGRA 3FY2A 4FKTA 4WIHA 2IW9A 2JD5A 4L7FA 4O81A 3R7VA 5KMNA 3LXNA 2QG5A 3T3VA 4E4NA 5K0KA 3DNDA 3C5UA 5E8TA 3QX2A 2P2IA 2WMRA 3KF4A 4APPA 3M11A 1FOTA 5FBNC 2UZOA 4FTRA 4J53A 5I5ZA 2EB3A 4IJ9A 4J97A 3FMMA 2RFNA 3BE2A 5LXMA 4E20A 2P4IA 1GZNA 3GCPA 2EXEA 1W8CA 2R2PA 2YM4A 4G3CA 2H6DA 4GSBA 4AA0A 4DHJA 1PYEA 3BELA 5D9HA 3KGAA 4PDYA 2ITXA 3ZUUA 3AT3A 4OBQA 2CNQA 5IA4A 2F7ZE 2ITUA 3MPMA 3VBXA 4IFGA 3QTUA 2ZJWA 2UZVA 4FSQA 3PXFA 5JRSA 1A48A 2CNUA 2X8IA 4E7WA 2XNNA 5HD7A 2BROA 4NEUA 2Y6MA 1OKVA 3C1XA 3Q32A 5I4NA 3S0OA 3DBFA 2I0HA 3A61A 1YQJA 3IOPA 2OXYA 2JKQA 2UZEA 4HVDA 1P4OA 4U80A 3ORMA 4O84A 4IAIA 4YHFA 2HW7A 3ZEPA 5HD4A 2BZHB 3NW5A 4YMJA 1PYXA 2XNOA 4DEGA 3GP0A 3AT2A 4AG8A 5K0XA 5A6NA 2QOQA 3QGYA 5M51A 2RFSA 3WI6A 1XH8A 3KF7A 2PY3A 4NL0A 5BYYA 1YXXA 3FI3A 3H3CA 4O22A 5ANDA 3WILA 3HGKA 3LJ1A 1JSUA 4JDHA 3LCDA 1U46A 4KKEA 3QTRA 4FK3A 4KWPA 4E4XA 4OUCA 5KKRC 1MRYA 5M53A 2RG6A 1OIYA 2WO6A 3E5AA 3ENHA 4MQ1A 2GPHA 3LXKA 1KE5A 2OIBA 4YJSA 2PHKA 3BV2A 4BBFA 3PWDA 4EBVA 2IEWA 2WQNA 4MNEA 4WUAA 3TIZA 3TMOA 3KMUA 5EM7A 4RWLA 4FTKA 1UV5A 1YVJA 3WZEA 2W7XA 4JIKA 2XNPA 4G6OA 5DWRA 1M17A 4XLIA 4AWIA 3FLYA 3PJ3A 4CLJA 4IFCA 5HVJA 4DEEA 1Q3DA 4IDTA 5AR3A 2BRBA 3OT8A 4EQUA 3A8WA 2XKDA 4N6ZA 4RJ4A 3ALOA 4F7JA 3PJCA 3UJGA 4AXCA 3RK7A 3I79A 4EI4A 2WB8A 1UU3A 4DYMA 4O83A 4D2TA 2XIRA 5D10A 1M2PA 3MH0A 5KBRA 3UGCA 5IISA 2A27A 4BHZA 4I1ZA 4OTPA 4FKJA 3KEXA 5EYCA 2JIUA 2W4OA 5T6KA 3VULA 5EM8A 4FMQA 3IGOA 3HP5A 3II5A 3VBYA 3W2PA 2OBJA 1XH4A 2EXMA 3H4JA 4YC6A 3FC1X 5AIRA 3MIAA 3HECA 3G15A 2GNIA 3FLQA 1YI4A 3FYJX 3LVPA 4FICA 3BWFA 3WF7A 3W0OA 5EKOA 4EONA 4YJNA 3UG2A 4Z7GA 5M57A 2E9PA 3HZTA 2PZIA 4BDHA 4ANMA 3EFJA 4QYFA 3FBVA 4XUFA 3RWPA 4RQVA 3QD2B 3T3UA 2X8EA 1XH9A 5EH0A 3ELJA 1GIJA 1JVPP 2R7IA 5HLNA 4YBKA 3R9OA 2OH0E 3Q2MA 3BGPA 1JKTA 3R9HA 2PVLA 4YNEA 5J1WA 4CFFA 4PTEA 3SHEA 5CU6A 3DPKA 2FA2A 3TG1A 1MQBA 2VGPA 4OR5A 4PL5A 5AUZA 4XRJA 3C0IA 2ITZA 2XKCA 4BIDA 4UXLA 4XV9A 3NRMA 4MK0A 3HEGA 5DT0A 2VV9A 2ETMA 3B8RA 4LRMA 5FDXA 5HZNA 2ITWA 5I9ZA 3ZM9A 4EZ5A 3IKAA 4RIXB 4WUNA 4EC8A 3NFGB 5GJGA 3FSFA 4FYNA 3V5TA 3BBWA 2V62A 3HNGA 4TY1A 3LM5A 3VQUA 4QQCA 4NTTA 4Q5EA 3FL5A 5L2TA 4F1TA 3DJ5A 3O8TA 1YRPA 3R2BA 4O27B 4U0IA 1WBNA 3LFNA 1JKSA 5EW9A 5CYIA 4V01A 3D2IA 3RAWA 4W4VA 1JSTA 4A06A 4AS0A 4TWNA 1REKA 3KK9A 4BDGA 1W98A 5CU0A 3QHWA 4F64A 1GOLA 1KE7A 2GTNA 3BYOA 2BPMA 1Q8UA 4I23A 4QNYA 2YWPA 3KCKA 5E8UA 3OWLA 4BCQA 4F7SA 3VHKA 2CKOA 3FZ1A 1WBTA 3NDMA 3L9PA