2A1AB

Pkr kinase domain-eif2alpha complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
269
Chain Sequence
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 84
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a1aB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a1aB01
3R9NA 3QRIA 2BRNA 4IAIA 4QYFA 4B8MA 3UOJA 1H1WA 1REJA 3MS9A 3O8TA 4NKSA 4QTAA 4EHEA 4AQCA 4QYYA 3OOMA 1VYWA 3TTJA 3IS5A 5FM3A 2CGUA 5CSXA 3VNTA 2UZUE 2CLQA 2ITXA 4FTMA 4QQ5A 2PVMA 5FTOA 3DNEA 3VJOA 1H0VA 4ZY5A 2VWYA 5AV1A 4AW5A 1JLUE 3ANRA 5LVNA 3ZC5A 1OZ1A 3BYSA 2AC3A 1VR2A 3QKKA 3OWLA 3FC2A 1PXLA 2ITPA 4K33A 4Q9SA 5EFQA 4QMWA 5JZNA 3TI1A 4EOIA 5C8NA 4QD6A 4XOYA 2A4LA 1H1SA 3BYOA 1DI9A 3C50A 4ZXTA 4ANSA 3RGFA 2ITNA 2RSVA 2Y0AA 4RC4A 4QP2A 1MRUA 3WF7A 3DAEA 4MTAA 5AUZA 3NNVA 4PTEA 3OHTA 3SAYA 3C0GA 1APME 2VTRA 4DEBA 3CBLA 3GCSA 4QMVA 3LOKA 4RC2A 3E62A 3CTHA 3BU6A 1WBOA 3QQLA 5EDRA 2ETRA 2W17A 3BZ3A 1O6KA 2XEZA 4GT4A 2VWZA 4YGAA 3NNWA 4GSBA 4OAUC 3QYZA 5AADA 4IZYA 2PE2A 3EZVA 4DLIA 2HK5A 1L3RE 2UVYA 3F2AA 2C3KA 2NP8A 2WMBA 3EN5A 5IH6A 3W32A 4LV8A 2OJGA 3BI6A 4MYGA 4E8AA 4YZBA 4PDYA 2FYSA 1RDQE 4I6BA 4CFVA 2Y6MA 2Y4IB 4XG9A 4FYNA 3LMGA 4DINA 1RW8A 2RL5A 2UW4A 3PSBA 3VJNA 2B4SB 3ATSA 3RBWA 4P5ZA 5DRBA 1CDKA 3EN7A 4IMYA 4PQNA 4ZMFA 4F65A 4ZS0A 3UC3A 1KWPA 5DWRA 3AC8A 3KC3A 1LP4A 2X0GA 4YP8A 3VS0A 5H8BA 3WE4A 4L45A 4R3CA 4V04A 3RPVA 1YQJA 3GC9A 4V0GA 3VW8A 4FEUA 5FUTA 3F69A 3MDYA 4RIWA 1XHAA 2WOUA 4CV8A 3V6SA 4X21A 3D2IA 3NNUA 3QFVA 4UBAA 4IEBA 4C8BA 4C62A 2PMNX 4R1VA 4EK3A 4ZJVA 4AS0A 2YWPA 2LGCA 2BRBA 3C4WA 3KXMA 4FEQA 3LQ3A 3ZEWA 2PK9A 1YOMA 1JKSA 4O7RA 3THBA 4AN2A 3C4ZA 3FMKA 3Q04A 5A46A 2WMRA 3MIAA 4RZVA 3PE1A 4XV2A 4C4EA 2B0QA 2JKMA 3EQDA 3FKNA 2OXYA 3VBWA 4O7ZA 5EHLA 3PYYA 5DNRA 2PVRA 3VVHA 3Q2JA 4V0GB 5FXQA 2WTDA 3AD6A 4RIWB 4U42A 2FSTX 4DGNA 1ZAOA 2ZB0A 5CLPA 4E5BA 4QQCA 1T45A 2P55A 2J9MA 2VTPA 3A8WA 4LMUA 3CJGA 1LEWA 3MGYA 2HWPA 1Q8YA 2E9UA 4X2GA 3PXKA 3TT0A 5JMSA 5K5NA 3VHKA 2X6EA 2X7FA 5EW8A 1H1RA 4FE2A 5CU4A 5JGDA 4HVDA 3KMWA 3QXOA 2EB3A 1BI8A 4N4SA 5FG8A 5DMZA 3HA6A 4HYUA 3CTJA 5A6OA 5EQEA 4E7WA 3RK5A 2HW6A 3LCDA 2X2KA 2REIA 2EWAA 4XCUA 1PW2A 3V5PA 4C3FA 1YOJA 3WZUA 4G3CA 1I44A 2JKQA 3PXFA 4CV9A 5L2QA 4U97A 3CKXA 3TDVA 2VTMA 1ZOEA 1QPCA 2X4ZA 3K3JA 4AT3A 3TN8A 2JFMA 2XNGA 1OB3A 2I6LA 2R3MA 2XIRA 1BUHA 3ALNA 3CR0A 3R1NA 3W10A 2BZJA 3E64A 3I5NA 2Z02A 3PPKA 3BHVA 4D5HA 4MNFA 3Q53A 5KHXA 3E3BX 1YHSA 5E8UA 3KXNA 4NU1A 3KMMA 5HGIA 4ACCA 3I0QA 5IQBA 5KMJA 5CU6A 4OUCA 5HNBA 3HV3A 5KMKA 4O6EA 2WB8A 3QYWA 4FTKA 5CAQA 3QRTA 3PPJA 3P7BA 2XNMA 3DQWA 1Y8YA 3TJCA 3N4TA 4AT5A 3TG1A 2XK8A 4QPAA 3CP9A 2VO0A 4EWQA 3RAIA 3QUPA 3S00A 3RNIA 3O7LB 4EZ7A 4G34A 4EHGA 3QGWA 4GUEA 1HCLA 4QTEA 4BDHA 5CT0A 5HD4A 5IQDA 1J91A 4F63A 2BZHB 3IQ7A 4I5CA 1YW2A 4PMTA 3UIBA 4TXCA 5K4IA 4YU2A 3ZXZA 3PXZA 5AV2A 4I23A 3CPCA 3PJ8A 4GU6A 4KRCA 4PL5A 5CVGA 2R3OA 5BUJA 3NYVA 2XNEA 2UZBA 2BDFA 2CKPA 4CG9A 3MPMA 1OL2A 5E8SA 1V0BA 3KRWA 2QODA 2XH5A 5BYYA 2OKRA 3RP9A 3ZYAA 2CDZA 5DFPA 4A9RA 3RWQA 4OAVB 3ID6C 1YWRA 4YTFA 1W8CA 4FZ6A 1S9IA 4OBOA 3A7IA 4DTKA 4M97A 2B1PA 2XP2A 2BAQA 5EI8A 4BTKA 2WHBA 2W06A 1J1BA 2BHEA 4Q2AA 4FSUA 1T46A 2OO8X 4YSMA 4IJ9A 3ZFMA 4A9SA 3FY0A 5L3AA 1PMUA 4XP0A 4FOCA 2WMUA 4GH2A 2IW6A 2Q0NA 2VV9A 4IX3A 4ASDA 1PMEA 2PVLA 4EH4A 2GPHA 4FODA 4MXCA 5GZ9A 5K4JA 1NT2A 3FZSA 3T8OA 2GNIA 4YR8A 4L9IA 1OIYA 3K5UA 4WRGA 3NVKI 3ORZA 5TKDA 3DTWA 1E1VA 3QKMA 3PP0A 3OD6X 5H3QA 3TKHA 4I41A 2PMLX 2F57A 2XS0A 2KTYA 2YISA 4N0SA 3TV6A 2E9OA 4IE9A 5D10A 2YCFA 4BDAA 5EYCA 1F0QA 4CG8A 4RX7A 3R28A 5BVKA 2WTJA 4O7NA 3OUKA 2JITA 5M4IA 2PVJA 3GT8A 4GK4A 4E4NA 4L67A 3SG9A 4FVPA 4UWBA 5CENA 4EQMA 1WBTA 3NCZA 2P0CA 3TV7A 3AC4A 3CIKA 2FUMA 3MFSA 4LUDA 3A99A 4HVGA 1XBCA 3DBQA 3FZ1A 5LARA 3R9DA 1H28A 3DBFA 5CVHA 4ZAUA 4WNPA 5J87A 1P4OA 4TY1A 5AR8A 2R9SA 3BGPA 3RPOA 4YTCA 3KK9A 4TZRA 4L3LA 5CNNA 5BVDA 3D83A 1J1CA 5KHWA 2WMTA 4BIEA 4CRLA 2GQRA 4CGAA 3PY0A 4FNWA 3L9LA 3W1FA 4IZAA 2QOKA 4RRVA 5FTGA 3ZUVA 2PUUA 4C4JA 4IADA 4MNEB 3ORIA 2BTSA 2W4JA 3GVUA 4C4IA 2ITQA 1W98A 3CCNA 4L42A 1URCA 1WBPA 1XKKA 4KKHA 2O64A 3OEFX 4IVDA 3P1AA 5B2KA 3F3TA 4GVJA 5JT2A 4ZTSA 4R8QA 4OGRA 4PDPA 3UPZA 5CASA 2XKDA 1IG1A 3MESA 4IBMA 4LRMA 1ZOHA 4RWLA 4F7JA 2W9FB 3HUBA 3MY5A 4HGEA 3Q4TA 5GINE 3SRVA 3S1HA 1Q61A 3IW6A 3PIXA 3QA0A 5DIAA 1KSWA 2WTKB 4BTJA 3FXWA 1UU8A 3MFUA 2R3NA 2X7OA 2G9XA 1BMKA 3PLSA 1PXMA 2CNUA 4DTBA 4F6UA 2YIRA 4FKIA 4GFGA 4JL9A 4AP7A 1Q5KA 2W1GA 4AA0A 3VULA 2CNQA 5CZHA 3R04A 3TWJA 1FOTA 1YRPA 4ZSGA 3SRVB 3ATTA 4UXQA 4D0XA 1M2RA 4O0YA 2YLFA 2ZV8A 4FIGA 3H10A 3IOKA 5KUPA 4GEOA 5CAUA 1LEZA 3CGOA 4YJNA 4IWPA 3SLSA 4C38A 4OTHA 1R0PA 4C33A 3G9LX 3BYVA 4TNBA 3ORPA 4IANA 3JYAA 3QC9A 3M42A 5CAVA 3PRFA 1Q3WA 3F3WA 4EOLA 1IAJA 5EM6A 3BGZA 3ZUUA 3PWDA 3JUHA 3MH0A 5JN2A 4ZLOA 4G3DA 4XJ0A 3A60A 4IB1A 1RQQA 4TYIA 4YZ9A 1SZMA 4FKVA 3KN6A 3HX4A 3AC3A 4JXFA 4TYEA 3NUYA 5L2TA 5LVOA 5I9WA 5T3QA 3VAPA 1XWSA 2R3QA 1OKWA 4Z55A 1CTPE 1G8SA 1Q24A 3RAWA 3RCJA 2XK6A 2WKMA 4APPA 5BMMA 2R3KA 3W8QA 4WG3A 3RALA 3EYHA 4IDTA 4CFXA 3U9CA 5HX8A 4V01A 5E8ZA 3LMIA 5HTCA 2ZM1A 3R63A 5AR4A 3LKMA 2XK4A 4RLLA 5AP2A 2ITWA 3SHEA 2QO2A 2B9HA 1KE8A 3HLLA 3MTFA 5KE0A 3BHUA 2XM8A 3Q6WA 4FA2A 3UNKA 3O0GA 2XNBA 2Z7LA 4ZIMA 4YHJA 3D7ZA 4CYIA 5IQHA 3M2WA 2YLEA 2R7BA 3L8VA 2PSQA 4GK3A 5AFVA 4DEAA 4FIEA 5CF6A 3TACA 3UP2A 4EKLA 3L8PA 4IAYA 3UO4A 3WZJA 4ZTMA 3ZSIA 4FGRA 2X1NA 2B53A 2OJFE 4FTRA 3OWKA 3IO7A 3OXZA 3QCXA 1KE5A 1RE8A 2OW3A 3IDBA 4B8LA 3MY0A 5IF1A 4RVTA 3H9OA 4W9XA 4FTOA 5DE2A 4DITA 4TWNA 5CEPA 3L8XA 4KRDA 2UZOA 3MFRA 2WZJA 4BCIA 3FI2A 3MVHA 4E5AX 2AC5A 2YJSA 4DGGA 3NMUF 3CGFA 5CEMA 3W18A 4ERKA 4WUAA 5J7BA 3UQFA 4J8MA 4O1PA 1Y91A 3NVMB 1OL1A 3FY2A 4U6RA 4QMNA 3OWJA 2XRUA 3UMWA 2WFYA 3MPAA 1G3NA 2W5HA 3KXHA 3PTGA 4U7ZA 4BI0A 1OUKA 3KA0A 2C1BA 2WIPA 4U79A 4DBXA 4BIDA 3OXIA 2X2LA 4I94A 2QR7A 5M51A 3LFCA 4FV7A 5I9YA 5M56A 4MX9A 4ZS4A 2PVHA 4IB5A 3FYKX 3FI3A 3GP0A 3MA6A 4CFMA 5HORA 1YDTE 2FB8A 3E8CA 2P4IA 2GFSA 3P78A 3UZRA 5I3RA 1SNXA 4IVBA 3R8VA 1ZWSA 4DFYA 4BWPA 2OXDA 3WARA 2VO7A 1Z57A 4QMTA 3O23A 1FMKA 3IONA 3NDMA 3WILA 4CMOA 4AOJA 2C6DA 4S30A 3G5DA 1OVEA 3PA4A 4FR4A 4M12A 5GJFA 3D15A 4CQGA 2HELA 1KE6A 1XH6A 5EOBA 3PG3A 2C3LA 5IA3A 5M08A 2R3RA 2C0TA 3DLZA 1NVRA 3KXXA 4HGLA 3FLZA 4EH5A 5FLFA 4O7TA 5GJDA 4M7IA 4BHNA 4R77A 2R3PA 4JVGA 2GCDA 1WCCA 4AAAA 4BCOA 4KIOA 4AOIA 4YLJA 3QCYA 4Z3VA 3PRIA 1B39A 4U40A 5F1ZA 2PVYA 4X3JA 4WHZA 4USEA 4EOKA 5FP5A 4EYJA 5KMMA 4D2RA 4UB7A 2W4KA 1WBSA 4FV6A 3GCQA 3OTUA 4ACHA 4G2FA 1S9JA 2IVVA 2YEXA 3KCFA 1BX6A 4AT4A 3GUBA 1MUOA 2C5OA 3Q9WA 2EXEA 2QNJA 4PMPA 2UW0A 4OTWA 2BIYA 4YLLA 4BZNA 5ETCA 3NW6A 3FL4A 3S0OA 2X7GA 3EQIA 4G6LA 3UTOA 4B7TA 5AX9A 3ZLXA 4ASZA 3C0IA 4EK6A 1EH4A 1YXUA 2RG5A 4JAIA 4Y5QA 3L9MA 4CCBA 2A0CX 3QLFA 4WIHA 1A9UA 5IEXA 3RHKA 5A4CA 4O22A 3NYXA 2J0LA 4CT2A 5HIBA 1CSNA 4I5MA 4ARKA 4CKRA 5CI6A 1JAMA 5GIOE 3EIDA 4BY9E 2OZOA 4QMOA 3W55A 1W0XC 3MTLA 4DG3E 2YIYA 3CLYA 3T3UA 4L53A 5IQGA 3WOWA 3ZSHA 2GS6A 3NUNA 4IDVA 3MH2A 3Q4UA 2YAAA 4FT5A 4IFCA 4NJ3A 1W7HA 3HDMA 3EN6A 4YBJA 3GQLA 4W9WA 4L3PA 3KCKA 1YXSA 5DT3A 5EK7A 1PJKA 4M15A 5BVOA 1YVJA 3ZRLA 2WAJA 4C57A 4WG4A 3SKCA 4F4PA 1K2PA 3BEGA 3FZRA 4QMPA 4TYJA 4BKJA 1U5QA 3KFAA 3O51A 4JLCA 3DQXA 4HPTE 4UMUA 2W1HA 2XM9A 3I60A 3WYXA 4TWCA 5EH0A 2Y8OA 4IW0A 2KULA 3W2QA 3WF9A 5FWKK 4XH6A 5LXMA 3KXZA 3HDNA 4GUBA 4IIRA 2FH9A 2WMAA 1CKPA 4GYIA 5ETFA 4C3RA 2R3JA 2XK3A 3F6XA 5AP1A 2G15A 3O50A 1BI7A 3D5VA 3GI3A 4W4YA 4I1ZA 4U43A 4E4LA 3EN4A 4M14A 3AMBA 3WZEA 1H1QA 3LHJA 4NM5A 2GNHA 3W16A 4EL9A 3DBDA 4ANNA 4V05A 3QRUA 3B2WA 2Y4PA 2WTIA 2VTNA 3DOGA 3MVLA 2A19B 2YCQA 3R7EA 4I3ZA 2CMWA 4CVAA 2V5QA 2JBOA 2P2IA 4FTNA 5IDNA 2R7IA 5J5SA 2WMWA 3D5WA 1U46A 1O9UA 3ORLA 4FSYA 1PY5A 5HU9A 3MIYA 2YCSA 5CX9A 3NEWA 2HY81 4I5HA 2F7ZE 3BCEA 3U4WA 3P9JA 2BDJA 3UE4A 4N57A 3T9IA 5EM5A 1PXOA 4APCA 4CZUA 2I1MA 2YACA 4X6RA 3ULIA 2HZNA 4D28A 5C27A 1H08A 2YA9A 2PMOX 3UVQA 2OJJA 2J0KA 2O63A 4FSRA 4CKIA 2YCRA 4YO6A 2CKOA 4JDHA 3VBXA 3R7OA 1GZOA 3P7AA 2FVDA 4CQEA 5CF4A 3VS7A 4DGMA 3QQUA 2C4GA 3UJGA 1DI8A 4BDCA 4YJRA 2W5AA 4BZDA 4ENXA 3T3VA 4XEYA 5I4NA 5CAPA 3HNGA 3PZEA 4GYGA 4UZDA 5IKWA 4JAJA 3D5UA 3G15A 2QHMA 4B6LA 4I93A 4AF3A 3KU2A 3QUDA 4KKGA 3OMVA 5HE1A 5HKMA 5A4LA 3UG2A 3R02A 4F7LA 2QCSA 4D4YA 4EQCA 5IPJA 4RIXA 4NCTC 3EL7A 3R22A 3R30A 3C51A 3MB6A 4XOZA 1DS5A 3VF8A 4BTFA 2WTCA 3AOXA 4E4MA 4YJSA 4X2FA 4MQ2A 4IX5A 2OIBA 4ZMEA 1ZLTA 5AMNA 3NUPA 3PE2A 4FMQA 4F9BA 4ZZNA 5IDPA 3HMMA 4NCTA 4UMQA 4O81A 3IW4A 2G01A 3VWAA 3ETAA 4DYMA 2PE0A 5LJJA 3WBLA 3MH3A 4BKYA 4PMSA 3L1SA 3IOPA 4L8MA 3EQGA 4RX9A 2QKRA 3H9RA 4YC8A 1PF8A 1GAGA 2PZYA 4FT7A 4YHFA 4JOAA 4LOPA 4YZDA 2YDIA 4X2KA 5HX6A 3R2BA 2VO3A 4FUYA 5M07A 4USDA 4I4EA 4QRCA 2Z8CA 2WD1A 4NTSA 4IZ5A 5IA2A 3ORNA 3MFTA 4EOOA 4UX9A 4QTCA 2QQ7A 4BWXA 2QOIA 4OTDA 1UNHA 5AM6A 5HU3A 4M8TA 4H3BA 4BCFA 5CSPA 5DHJA 3UYSA 5HNIX 3TUDA 1WBVA 2YITA 2ERKA 5EI6A 3QD2B 2VZ6A 4H3PA 4MK0A 3HUCA 2C6IA 2OU7A 3GGFA 5H8EA 3M1SA 5DLSA 2WNTA 4PDOA 3S3IA 4Y46A 4M69A 2IVTA 1YHWA 3VUHA 4PMMA 2BAKA 5CU2A 3I7CA 3IW8A 4ZTLA 5KMIA 2BMCA 2C5YA 3HP2A 1WFCA 3EJ1A 5LCJA 4L68A 3UPXA 5M06A 5EDPA 2YZLA 4DA5A 3CQWA 4ANBA 3W2CA 2HWOA 4KAOA 2JKOA 4H3QA 2QOBA 4O1OA 5HVKA 1PXPA 1SYKA 3MN3A 4BCMA 4BGQA 4UZHA 3RPYA 4PNKA 4MWHA 2PY3A 4EOPA 1OKZA 3B2TA 1TQIA 4X2JA 3PSDA 5KMLA 4M69B 2C6MA 2I7QA 4ZLYA 2VTLA 2ZV2A 3LFBA 4FVQA 2JEDA 2OBJA 4ID7A 2W4OA 4IAZA 2R64A 3Q9YA 3TKUA 2XUUA 5H9BA 5TR6A 4AA4A 4LOQA 1ZY4A 2X39A 4L6QA 3FZTA 4BCJA 4GCJA 3G9NA 4DTAA 3RPRA 5GHVA 4JDKA 4YO4A 1OBGA 3GCUA 2PVFA 3TTIA 5LOHA 3NLBA 4FG8A 4UALA 5IQIA 4BDKA 5F95A 1JVPP 3FC1X 4LUEA 5IH5A 4IJPA 1H4LA 5BMSA 2QHNA 3HRCA 3TNQB 4BDGA 4IX6A 3ROYA 3HVCA 2WQBA 4D2WA 5IA1A 4K9YA 2DWBA 4EH6A 5J1WA 2WQNA 3IDPA 3SXRA 4F9YA 2QG7A 4IB3A 2HZ0A 4XX9A 3I81A 2BRHA 5IEYA 4W4WA 2CKEA 3QZFA 3P4KA 4BDFA 3NUUA 4EHVA 4QMQA 4O82A 4W8EA 4CRSA 4MVFA 3R73A 4D4SA 3WZKA 4DFLA 4ACMA 3NR9A 2UZTA 1JKTA 1H01A 4BCGA 5CQUA 2QVSE 4DFUA 1WBWA 4FTCA 2W9ZB 5BNJA 3RK7A 4C02A 2YAKA 1WZYA 3KRLA 4G3EA 4YUQA 5FP6A 3TIYA 2BKZA 3A61A 3DFAA 4KNBA 4YMJA 4USFA 2VTQA 2UZDA 3MW1A 4PRJA 1CKJA 5JH6A 3EKKA 5M09A 3CY3A 1ZYCA 4H58A 5CU0A 2I0EA 5I3OA 2X8DA 5AP5A 3SGCA 3D2KA 4EOJA 4CTBA 3JY9A 1REKA 1M7NA 2JBPA 1ZOGA 1SVEA 1B38A 3NW7A 4LL0A 2PU8A 1K3AA 2IN6A 5AR5A 4YPDA 1J7LA 1AD5A 2WTWA 2BCJA 3NW5A 4OTIA 3O96A 4I5PA 3ZM4A 1A48A 1OIQA 2HXQA 3LCTA 2QO7A 4FBXA 5FDPA 4O7YA 4O7LA 4KKEA 1WMKA 4R7IA 3G90X 4J1RA 4MQ1A 3DKGA 3FLNC 3TL8A 4C58A 4F70A 2HOGA 4X0MA 5K9IA 1KOBA 2CPKE 1Z9XA 4JQ7A 4DH7A 4QPSA 4YNOA 4L43A 4FKOA 1H00A 2CGVA 4BDIA 5M4UA 5LMKC 5D7VA 3HV4A 2E9PA 3G0FA 3K2LA 4FL1A 4OT5A 3OCBA 5AAFA 5AUTA 3U6HA 2JDOA 4GJ3A 1GZ8A 2BVAA 2FSLX 5AUVA 3DZOA 3P79A 3CPBA 4U81A 3D5XA 3FKOA 4FKRA 2C0OA 4G9RA 5ANIA 2OFUA 5CYIA 4Z16A 4F6WA 4BWKA 5IZFA 3E63A 3ZBFA 3GC0A 2WTVA 3NS9A 3PXYA 5HESA 5EG3A 2CN8A 3IW5A 2J90A 3BBTB 3UC4A 4GG7A 4LQMA 5EDQA 2BHHA 4RJ6A 3FXZA 1W83A 2QOFA 3EFLA 3ODYX 4FICA 4FZFB 5HBEA 4GRBA 5D11A 2O5KA 4ZTHA 1SM2A 5IUIA 1GIIA 4FV5A 3ZO4A 4BGHA 5HTIA 3BGQA 2PUPA 3TNWA 2Y6OA 4N6ZA 5AV3A 4S32A 4R3RA 1IA9A 4FSZA 4AW2A 3FDNA 4RFMA 1ZMWA 2C6OA 4RMZA 3CD8A 2OZAA 5L8KA 2RFSA 5KZIA 3FXXA 3PJ3A 2WO6A 5BYZA 5C03A 1IAHA 3MV5A 3QUEA 3E8DA 3DKOA 1JNKA 4FSQA 2EUFB 3ORKA 4JDJA 1Q97A 5C26A 3FPMA 5M57A 4ZEGA 4RQVA 3VUKA 4QP3A 3VRZA 5CEOA 1ZYJA 3L8SA 4UMTA 3EB0A 4RVMA 2PPQA 2PYWA 2ITZA 4MBIA 4TRLA 2WMVA 2H34A 3VBYA 4IAFA 4EYMA 2E9VA 2OZAB 4A4XA 1PXIA 4EH8A 3EKNA 3ZO3A 4HYHA 2W1IA 1VEBA 2HCKA 3KRRA 3RCDA 3DU8A 4TL0A 3DCVA 4BCQA 3QQHA 3TZMA 4OW8A 4K8AA 3LCSA 3PJCA 2WMXA 4RA5A 3GENA 2QLQA 3F2NA 4AACA 3NNXA 3IK3A 4YZNA 4DHFA 4DGOA 2ZMDA 2QD9A 4M68A 3OOGA 2BFXA 3FMLA 3SQQA 3U51A 1LR4A 4AU8A 3FL5A 3D7TA 2C3JA 5HE2A 2BAJA 1Q8ZA 3D94A 2X2MA 4C4FA 4R6VA 4FKUA 3L9NA 3LFAA 4X3FC 3V51A 3AGMA 3TZ7A 3OCGA 4FUXA 3F66A 1UKIA 3I4BA 2C6LA 5EW9A 3R8ZA 2C69A 3WE8A 3HKOA 3HECA 1Q4LA 4ZSEA 3O8PA 3R7VA 2HYYA 4AZEA 1W84A 4XG2A 5CY3A 1Y6AA 5FXRA 2YM6A 1FBNA 3WZDA 4OBPA 5JQ5A 3SOAA 4X3FA 4BHZA 2XIKA 3OROA 3P08A 2GHMA 2ITOA 3D7TB 1V0OA 4F1OA 1KE7A 4TWOA 5AP4A 3FYJX 4LM5A 3FLQA 4QYEA 3FI4A 3ZC6A 5EYMA 4QP6A 3E7VA 5HLPA 4UWYA 4QMYA 4QP9A 4LOOA 3SV0A 3LFEA 2UV2A 2A27A 2RKUA 4FKJA 2JDTA 1YI4A 1MQ4A 3A7HA 3ANQA 3MI9A 3QTQA 5F94A 3DKCA 2H96A 2DUVA 5GZ8A 4FKQA 2OFVA 3QLGA 4FIJA 2X8EA 3R00A 4X3FB 5JFVA 4XG8A 2J4ZA 5JGAA 3MJ2A 3U55A 5T6KA 1FVRA 5FEQA 4J97A 4E6DA 1BL6A 4BICA 2IWIA 4EWHA 5L4QA 5CTPA 4FT3A 5AP6A 4JBVA 2AUHA 4ZZMA 5BVWA 2YZAA 4CZYB 3RVGA 3GU5A 4YPSA 3C1XA 3LFSA 2OIDA 4AUAA 5D1JA 5EM7A 4UYNA 3DK3A 4O83A 4AFJA 2QU5A 4BGGA 1AQ1A 5IQFA 5A4EA 5D9HA 1JKKA 1U4DA 5FEEA 5EHYA 3R8UA 4HVIA 4PF4A 4QQTA 2PUNA 4UYAA 3Q9ZA 3MA3A 1YXXA 2QC6A 3KKVA 5DR9A 4C35A 5J79A 1IEPA 1U59A 2CLXA 2UW6A 2QR8A 5B2MA 3CC6A 3PUPA 2P2HA 3TIZA 3UP7A 3R6XA 3VUMA 4UEUA 4RA4A 3ZSGA 2C5VA 4TYHA 3ZDUA 3OEZA 2IVUA 3LCKA 4DN5A 5KX8A 3ORTA 3QQJA 4I6QA 2W1FA 2Z7QA 3OP5A 3QQGA 4QNAA 4U8ZA 4ZK5A 3R8LA 4A07A 2OXXA 3F7ZA 4RGJA 4RT7A 5AP7A 3RKBA 4F08A 3HAVA 3CS9A 5GIPE 2FO0A 1STCE 4ITHA 4DAWA 3AT4A 2IZRA 4S31A 5CXZA 1TKIA 3H4JA 1UVRA 5HNGA 3AG9A 1XH9A 1GY3A 3PVBA 3OCSA 4FF8A 3I1AA 5GJGA 3RJCA 4MXXA 3ROCA 4MF1A 4BBMA 1UWHA 2WEIA 3VS2A 2PUIA 4GVAA 4J95A 4YC6A 4D2TA 2C5NA 3U54A 1B6CB 3MWUA 5DT0A 1J7UA 3NUAA 4A4OA 2YM5A 5C01A 4O91A 3R9OA 4GW8A 5CXHA 5DR6A 1TQMA 4PL3A 4K2RA 5EKNA 1ATPE 3NYOA 4U80A 2E9NA 3V8TA 2WQMA 3E3PA 3E87A 4IWQA 4Q5EA 2VU3A 4EH7A 2FA2A 2GDOA 2I0HA 2C30A 4PPBA 4O84A 4P5QA 5DYJA 3V5WA 4TWPA 3LCOA 2IW8A 2W7XA 3KEXA 2VRXA 4C2VA 2BKKA 4FZDB 4KS8A 3TCPA 4I6HA 1BKXA 3ET7A 5AR7A 3NZ0A 4IB0A 1F5QA 2XF0A 3FMNA 4G31A 1XH7A 2YIWA 4PY1A 4U44A 2UZEA 5ANKA 4LG4A 1IR3A 2WMQA 4YBKA 1DAWA 5HVJA 4OTFA 5L8LA 5DN3A 3PA5A 5HCYA 1F3MC 1IASA 4FV9A 1OPLA 4BCNA 4GJ2A 4O27B 3C4CA 3HRBA 3Q32A 4PTCA 2UZWE 3ALOA 5DR2A 1J7IA 2YIXA 3LJ2A 4CSVA 2UVZA 4CYJA 3LIJA 1OL6A 2OH4A 3OFMA 1XBBA 4WOVA 5B0XA 4S34A 4O0SA 1KV1A 2GFCA 3KMUA 3QBNA 1UU9A 3AMAA 3LM0A 4JQ8A 4RQKA 3F82A 4FIHA 3R8PA 3EZRA 3F5UA 3LAUA 4FKLA 2WU7A 2XJ1A 5AV0A 3R83A 4C59A 4EK8A 3GCPA 4EEVA 3CSVA 1H8FA 4NM0A 3BE2A 3OT8A 4UXLA 4KBKA 5HICA 1LPUA 4RJ8A 3FLYA 4G1WA 5HD7A 4XV1A 4IC7A 3G51A 3MVMA 4AGCA 4W8DA 5E90A 3DJ5A 1Q8WA 3PJ2A 4O2PA 3C5UA 4ZSJA 2J50A 4KUJA 5FBNC 3W2SA 4HCUA 4OTPA 1VJYA 3LFFA 4RFYA 4FKSA 4GKIA 4DCAA 3BRBA 3HZTA 3K5VA 4O0VA 5CF8A 4XS2A 3BX5A 4XP2A 3UYTA 3F2RA 3TKIA 4LFIA 5K5XA 3HMPA 4PL4A 2PZPA 3POOA 5CI7A 5HE3A 3HV6A 5M55A 1PYEA 4L01A 2IG7A 2I40A 2GS2A 5KKRC 4BTMA 3O17A 4TNDA 2AYPA 1UNGA 2VN9A 1QPDA 1OIRA 4QT1A 4XG3A 4H39A 2EXCX 2B54A 2BFYA 5L6OA 2IJMA 4IVCA 4XRJA 4FNZA 2XCKA 3HV5A 3MJ1A 5IUGA 3C7QA 3W8LA 4CD0A 2CNVA 1G5SA 2C47A 2CCIA 3QRKA 4FC0A 3QL8A 4FL2A 2YIQA 3E7OA 3EMGA 3EQHA 5AA8A 1BL7A 4QP7A 3OZ6A 4O96A 4BCPA 2XNNA 5EHOA 3Q96A 3PLAE 3GU7A 3OY3A 2OJ9A 4CCUA 4AGUA 3SD0A 4EQUA 3QTUA 5ACBC 4F09A 3TUCA 3F5PA 3OCTA 3HAMA 3I79A 3MSSA 2JLDA 4AOTA 4RJ3A 3WYYA 2XYUA 4FTQA 4RVKA 4BR3A 4TN6A 1X8BA 3NUXA 3R1QA 3FQSA 4Y5HA 4YHTA 3UIXA 4RBLA 2RG6A 1PXNA 1ZYDA 4FV3A 2FSOX 1ZRZA 2B9FA 4GIIA 5M44A 4Y73A 3U4UA 2NRYA 2XBJA 5AP0A 3COIA 4PX6A 1IRKA 3UQCA 4F0IA 4D9UA 5J95A 3VW6A 5IEVA 5DI1A 3N4UA 2YM4A 4MD9E 5DEYA 1YI3A 5HG5A 3Q5ZA 5JK3A 4PDSA 5BQ0A 4A7CA 4GS6A 3BLHA 1M17A 1DM2A 4EKKA 2BZKB 1OL7A 3DK6A 3FHRA 3KL8A 4FV8A 5CWZA 4NUSA 4GIHA 3S4QA 1JWHA 3NRMA 4CNHA 4AE6A 4UN0C 1CKIA 4NTTA 5J5TA 4OBQA 3LFDA 4BCKA 5C8KA 4MH7A 3QA8A 4LRKA 1H27A 1YKRA 2GTMA 3AQVA 4AZTA 4FIIA 4CFNA 1OITA 5FEDA 2VD5A 5KMNA 4MXZA 3A7FA 3F3UA 4EHZA 1M52A 3Q5IA 4AG8A 4U3ZA 2J5EA 1M2PA 3R0TA 5HIEA 4RJ5A 5KMOA 1NVQA 1ZARA 3VQHA 3VO3A 3ZS5A 2XKEA 3GFEA 1OBDA 3LXKA 4PP7A 3SC1A 4DLJA 4MXOA 3VS3A 4TTHB 5C4LA 3QU0A 4HZRA 4YNEA 5L8JA 2QOLA 3ZRKA 3HGKA 3UZTA 1ND4A 1WBNA 2IO6A 4GV1A 4AE9A 2QOOA 5DVRA 4BIBA 5IISA 3DY7A 2GS7A 3LQ5A 4NL0A 5CEQA 4NEUA 3IECA 1H25A 2C1AA 4E73A 4MBLA 4QMXA 4ORKA 3AC1A 3O7LD 3TNPC 4M0YA 4JS8A 4K18A 3SDJA 4U0IA 2ONLC 2CJMA 3DGKA 3LJ1A 4D9TA 4PNIA 4DC2A 3FMEA 5JFXA 4YJUA 2PTKA 2HZ4A 2JAMA 3VUDA 2FSMX 3CE3A 2XNPA 1OM1A 3GCVA 3ZLWA 1YXVA 2EB2A 3V3VA 4KWPA 1FGIA 1XJDA 2VGPA 3HEGA 5FQDC 4IM0A 3DLSA 4C37A 4DCEA 3QZGA 3FE3A 5LQFA 2VWUA 3PJ1A 4LI5A 4MD8E 1SVGA 2A2AA 3H3CA 3GU8A 4WBOA 4OTRA 5EW3A 3Q2MA 3SX9A 2VTAA 4MKCA 5ICPA 5J9ZA 4G3FA 3UZPA 2Y9QA 4CEGA 4IH8A 4WBBB 5IQEA 3HA8A 3PWYA 4RG0A 4PP9A 4U5JA 4Z9LA 4DFNA 2G2HA 3TJDA 4N6YA 4A06A 4JQEA 4R1YA 4WA9A 2B9IA 3LJ0A 3ORXA 2O0UA 4TT7A 3RAHA 3UOHA 4ANLA 3BHTA 3MYGA 4FNYA 4NSTA 5KCVA 4RWIA 2GSFA 5CSHA 1Q8UA 4HYIA 3Q4ZA 1M14A 3JR1A 2A1AB 2C5XA 4WNOA 3QTRA 3WIGA 3CXWA 2W1ZA 2ETMA 1GJOA 2VAGA 3I0OA 4QP4A 3D9VA 1XH8A 3F88A 5DEWA 4JIAA 4N70A 4ASEA 4U9AA 3IW7A 4R5YA 4EBWA 3U6IA 3JY0A 4FG9A 3VN9A 1NXKA 2Z7SA 1FMOE 3E8NA 5C1QB 4RWKA 3P0MA 3VQUA 2IZTA 3DXNA 3E93A 4OT6A 4EI4A 5BUIA 3DBCA 4YJQA 5D12A 4H36A 1DAYA 4F1TA 1U5RA 5E8WA 3EOCA 2XMYA 1QCFA 3K54A 4RIOA 4CMUA 4I20A 3ZFXA 2X9EA 3D14A 1A06A 1UV5A 4EZ3A 3RNYA 2R3FA 3IPHA 4L7FA 3ZHPC 2B7AA 3P23A 4PWNA 2JFLA 4FTIA 4FTUA 2ZAZA 5LMAA 5EQPA 5CQWA 4FEXA 4ANQA 5E1EA 2ZVAA 3P86A 4B9DA 3EFWA 5E8TA 3V5QA 4F0GA 3QC4A 5EOLA 5IMEA 5JQ8A 3ZFYA 5AIRA 3BEAA 3DNDA 4YJOA 5HCZA 5EQYA 4H1MA 4AZSA 2W0JA 1W82A 4GKHA 2HW7A 5B7VA 2F7EE 4IQ6A 3QHWA 2W96B 3V6RA 3Q3BA 2XIXA 3ZLYA 2HENA 1CMKE 2O2UA 2V7AA 2ZM3A 1NY3A 3BBWA 2JDVA 4KBCA 4K6ZA 3DA6A 4O21A 2VWIA 1QPJA 3DDQA 3VRYA 4WUNA 3DXQA 3ERKA 4F7SA 4UMPA 3FLSA 2BUJA 4J8NA 1FGKA 4RIXB 5AUXA 4F0FA 2DYLA 1OECA 2WPAA 3PXRA 4KIKA 2HZIA 1OKVA 2G1TA 4IVAA 4W4XA 5EYKA 3VBTA 5HG8A 1Z5MA 3GU6A 1JSVA 5JKGA 2VWBA 3RZFA 3QTIA 4G16A 4XUFA 3W2RA 4FNXA 2VTSA 3FPQA 4BB4A 4WKQA 5FBOA 5LVPA 5HIDA 4BFMA 5CSVA 5L2IA 5HG9A 4AGWA 4M67A 3C5IA 2LAVA 4NK9A 4C36A 5AUWA 4OLIA 3FSFA 5LMBA 2BRGA 4DT9A 5D7AA 4EH3A 3VS4A 3F61A 3JPVA 3EQFA 3NCGA 4KIKB 1ZYSA 3BKBA 4EONA 3SVVA 2WU6A 3R1SA 2SRCA 4P90A 3AMYA 5AM7A 2YERA 3R7IA 3OBGA 3MPTA 4K1BA 4CKJA 3GNIB 2ZOQA 1OL5A 4C2WA 5BVNA 1H1PA 1QPEA 2Q0BA 4IACA 3GOKA 5ITAA 5T68A 3ITZA 4DGLC 3QRJA 2GU8A 1TQPA 4UY9A 5KZ0A 2WOTA 4BDJA 5CT7A 1JSTA 2OG8A 3U8WA 3UOLA 2BDWA 3H9FA 4DEHA 3HP5A 4WNKA 5JRQA 5L2WA 3KGAA 1HOWA 1I09A 3H0ZA 1O6YA 1GZNA 5EM8A 2HXLA 4ALUA 2J51A 1E1XA 1OI9A 2PL0A 4XLVA 2C0IA 3M11A 3TZ9A 3V04A 1PXJA 3A8XA 2Y4IC 4IHPA 1P5EA 2OWBA 3H30A 4WT6A 5J1VA 4M66A 4JI9A 2UZVA 5I9ZA 3FLWA 3FEGA 3IKAA 5LVLA 3LM5A 4FTAA 4K77A 1ZMUA 3LPBA 4F9CA 4DH5A 1PMVA 1PMNA 4IXPA 2R3LA 5ANGA 5JRSA 4F64A 4XG4A 3Q60A 3FMJA 3O71A 4O0WA 3UOKA 2XBAA 4FGBA 3QTWA 4FYOA 3PDTA 3KRXA 4I0TA 4KINA 3SW7A 1XBAA 4HNFA 5I5ZA 4NM7A 1GZKA 1UU7A 4A9UA 4P7EA 5HBJA 3I6UA 4WSYA 2GNGA 2HIWA 4I4FA 5JEBA 2RIOA 5IG1A 1PKGA 3AGLA 4FI1A 2XJ2A 3DV3A 3ZMMA 4AW1A 4L3JA 3QZHA 5L6PA 2XB7A 2B55A 4DF3A 4G3GA 2ITTA 3BIZA 3SG8A 2CSNA 5LCKA 5G1XA 5CU3A 2WXVA 3VUTA 4Y8DA 2OLCA 4ALWA 3R8MA 3ZUTA 3BPRA 3ODZX 4G6OA 4FTJA 2VTTA 5F4NA 5FM2A 4U3YA 3MB7A 3LLTA 5DGZA 4TYGA 1ZYLA 2NRUA 3I7BA 1ERKA 2GTNA 2XYNA 4CT1A 4DH3A 5A3XA 4ZTQA 3GOPA 1Q8TA 3OT3A 1UU3A 4OTQA 3WI6A 1UKHA 1VYZA 4BVUA 5DBXA 2JIIA 4HJOA 4EUUA 3BWFA 4FG7A 5D41A 2DQ7X 5EYDA 5IA5A 4Y85A 1Y6BA 4ZJJA 4KS7A 4NW5A 3DB6A 5J9LA 3IGOA 4IFGA 4QP1A 4QQJA 4RPVA 3BWJA 3HMOA 4J98A 4L52A 4XHKB 3JXWA 4TPTA 3G33A 2VTHA 4ZTRA 2F9GA 3F5GA 4D58A 5IQAA 4RWJA 5H8GA 3LW0A 4QP8A 4BI1A 2VNWA 3BLQA 2B52A 2XIZA 4R7HA 3W33A 3V01A 2YDKA 5H2UA 3OBJA 4FK6A 4QNYA 1PRYA 3UIMA 4NFNA 3BYUA 2QG5A 3QHRA 1Q99A 5C8MA 3LMHA 2IPXA 3JVRA 2IZUA 4ITJA 2J0JA 3EWHA 3QWKA 5M4CA 4EC9A 4AZWA 2X81A 4ZY4A 2OH0E 3GU4A 4M0ZA 4QTBA 1Q41A 2W1DA 4ITIA 4EJNA 5K0XA 5A9UA 5E8YA 3N4VA 5C4KA 4YZCA 4IAAA 4O7VA 2BTRA 2ZDUA 4G9CA 4DEEA 1YI6A 3E88A 1GIHA 1FQ1B 3EYGA 3G2FA 3QTSA 3ZU7A 5LMKA 2E2BA 2PZRA 5HOAA 3BQCA 5I9UA 5BX0A 1YWVA 4P4CA 1NW1A 3AT2A 3NSZA 2YABA 4DBNA 4O2ZA 5CALA 4DG2E 2V7OA 4J52A 2J7TA 3FMDA 5CF5A 1BLXA 3PVUA 2JD5A 4BKZA 5A14A 3KN5A 3OF0A 3KULA 2XKCA 4GL9A 4I0SA 2BRMA 2PWLA 4DFZE 4E4XA 5JGBA 1FVVA 3IDCA 3GEQA 3AD4A 2ERZE 3COMA 1TVOA 5HTBA 4D1SA 4X2NA 3PIZA 3BLRA 1Q3DA 5GNKA 2UW3A 4CFUA 2JIVA 3A62A 3TZ8A 2JC6A 3V5JA 4XBUA 5E92A 5TE0A 4BC6A 1RJBA 3PFQA 2YN8A 4FSTA 4DH8A 5HI2A 4QMZA 3PA3A 3Q6UA 4R5SA 3KULB 3OTVA 3FQEA 4K0YA 4LYNA 4LGHA 4WG5A 3V8SA 3WF5A 2EXMA 2PHKA 4LGDA 2WEVA 1JPAA 2VTOA 1XH4A 3UNJA 3VF9A 3B8QA 4HW7A 5AUUA 2ZB1A 3QZIA 2WQEA 2PVKA 4FKGA 4TW9A 3ZBXA 3I5ZA 1MQBA 2XNOA 3C4XA 4KIPA 3C9WA 4FIFA 4DH1A 2R5TA 3UQGA 5BUEA 4JIKA 3NGAA 1JQHA 3DK7A 4RX8A 4O38A 2ITVA 3DZQA 3QQFA 4CLIA 4DEDA 2VX3A 4DE4A 2V0DA 5AA9A 4QPMA 4QO9A 3HL7A 4C61A 4ZLZA 2VTIA 4D4VA 2GNJA 4UMRA 3BE9A 4YLKA 5J9YA 1LUFA 3G6GA 3VC4A 1K9AA 3UO6A 1ZMVA 4E6AA 4BCHA 5AUYA 2RFDA 3EH9A 4FL3A 4RJ4A 1MRYA 4FV2A 4DFBA 3FSKA 5AAEA 2HAKA 3ZEPA 1GIJA 4IWOA 3OXTA 2F4JA 3BYMA 4DEGA 4F9AA 2YWVA 4NWMA 4FT0A 5DT4A 2F2CB 5FDXA 4Y83A 4E1ZA 3QKLA 3QX4A 5HLNA 3CEKA 4MCVA 4B99A 2XVDA 1ZY5A 2I0YA 2UVXA 3REPA 4BDDA 4MXYA 5TOZA 3KB7A 4YSJA 4MXAA 4PPCA 4CFFA 5F9EA 4FEWA 4IM3A 3GC7A 3A4OX 4PTGA 3UODA 4E20A 2R2PA 4K11A 3PY3A 5KBRA 4R7BA 4YC3A 5FTQA 4H05A 2YFXA 4HZSA 3COHA 2J2IB 4FZAB 4L7SA 2BPMA 2QO9A 3R7YA 4EH2A 1R39A 4XBRA 4EZ5A 3OG7A 2J0MB 2R3HA 3BQRA 3N9XA 1PHKA 5ANOA 3WIKA 3RTPA 4FKPA 4D0WA 1Q62A 2JGZA 3QTXA 5E8XA 4GFOA 5AR2A 5AWMA 4AX8A 4JX7A 4YTHA 5HO6A 2W1CA 4F7NA 3KREA 3FQHA 2JDRA 3R7UA 3TDWA 5KBQA 3ZONA 2P33A 4PUZA 4ANMA 4TKSA 3UVPA 2X6DA 3NIEA 4D1ZA 4B0GA 3EN9A 3F7WA 4RFZA 3ZTXA 3MBLA 3HRFA 4AZVA 2OF4A 4XLIA 5E4HA 4KIQA 4ZY6A 3VUGA 2DS1A 3LE6A 3QD0A 2PZIA 4J71A 1XH5A 3EQCA 4J53A 4F6SA 2VWVA 4BBEA 4MNEA 4W4VA 2YM7A 3CQEA 2R3GA 2C6TA 3QCQA 4RJ7A 3QALE 3ZOSA 2R4BA 2ZV9A 3DT1A 3NIZA 4LMNA 1H07A 5K0KA 2VWXA 2WTKC 4AWIA 5ETAA 2CN5A 5CANA 3WF6A 5HE0A 4D2PA 3BHYA 3VUIA 2GQSA 2XK7A 2O8YA 4Q5HA 4R78A 3NX8A 5I0BA 4C0TA 3RPSA 5HQ0A 2V55A 1YOLA 3PSCA 4I22A 3R01A 5ETIA 4JG8A 1V0PA 1FPUA 4KABA 2WIHA 5E9EA 5LWMA 4JBQA 2WGJA 4MHAA 2NO3A 2UW9A 2WQOA 1ZXEA 3QGYA 5IH4A 3ACKA 5J7HA 2FGIA 3K3IA 3Q9XA 2JAVA 3C0HA 3LFQA 4YTIA 3VBVA 4NM3A 3F3VA 4II5A 4ASXA 5HEZA 3BU3A 2VGOA 3C4FA 3QTZA 3UNZA 3ZCLA 4HVHA 4AN9A 3FZOA 2ESMA 3KVWA 5AR3A 3U87A 5FD2A 2H6DA 4D1XA 4IX4A 4BF2A 2Y7JA 1H24A 4TYHB 3AC2A 3NAYA 3I6WA 4ZTNA 4E5WA 1YDSE 1U54A 2UZNA 2XCHA 2XZSA 1WVWA 4ZOGA 2R0UA 4FSMA 4KSPA 3LXLA 5TF9A 4JDIA 3BV3A 1SNUA 5JFWA 3G6HA 1JSUA 2XRWA 5FRIA 5L6WL 2YJRA 4D5KA 4ZJIA 3FZPA 3ZZWA 2Z7RA 3R1YA 5DH3A 3NUSA 4NFMA 3NPCA 4GFMA 2OJIA 2VX1A 4HCTA 4RIYA 5HLWA 3B8RA 4F1MA 1FVTA 4KB8A 4XV3A 4C3PA 1U54B 3R2YA 3R7GA 4FSNA 4QMLA 4ZSLA 4FZ7A 3ZM9A 3E92A 4QMMA 3FI8A 1J3HA 3TV4A 3LQ8A 2ITYA 4OTGA 4E3CA 2QOCA 4NYEA 3HV7A 2X9FA 3BHHA 2ZV7A 2ZJWA 1YWNA 4HPUE 4NT4A 2BROA 3MVJA 3Q52A 3QWJA 4WNMA 2ZDTA 4D4RA 1UWJA 5HZNA 4RIYB 2JIUA 3LFNA 4I21A 2ITUA 4D2SA 2BZIB 1QMZA 5I9VA 4O0TA 2EU9A 5FGKA 1VZOA 5AX3A 3NAXA 2F7XE 2GHGA 3JS2A 5JSMA 3KXGA 4MWIA 4G5PA 5CZIA 2ZM4A 4F9WA 3CTQA 4LGGA 4EK5A 2QI8A 4EJ7A 3O2MA 1OKYA 1YXTA 4FOBA 4NKAA 2ETKA 4AA5A 3IGGA 3V8WA 1PKDA 4XG7A 4XYFA 3KY2A 4DT8A 1WAKA 4LV5A 2X4FA 3ZDIA 5A4TA 5BYLA 5DA3A 2OK1A 3AC5A 1V1KA 4JRNA 5E8VA 4EK4A 3RMFA 5AJQA 3R71A 3LLAA 4ZZOA 3OW3A 4BDBA 5ANJA 5BPYA 3DXPA 4BDEA 5DOSA 1L8TA 3RM6A 4DEIA 2R0IA 3SA0A 1O6LA 4M84A 5IA0A 3DKFA 4G17A 4NZWB 3PY1A 3QAME 3DTCA 1MRVA 4ACGA 2UUEA 4XNEA 3V5TA 3PP1A 1UA2A 3EFKA 3UIUA 4BRXA 3D0EA 5IMXA 3H0YA 5L2SA 1R78A 2PVNA 3TXOA 2YM3A 3PVGA 4M3QA 3DB8A 3RWPA 2WELA 1E9HA 3MH1A 3UBDA 4O7SA 4IM2A 4NH1A 4JT3A 4BN1A 4QMSA 2BALA 4J96A 3BELA 2CGXA 3T9TA 5AIKA 1M7QA 1R1WA 2F49A 4U45A 5A6NA 2Q83A 3OVVA 4EBVA 4O0RA 2QOHA 2RGPA 4EUTA 4QOXA 3C4EA 5IUHA 4E6QA 3E5AA 4UV0A 3TM0A 3RM7A 2PMIA 3DAKA 2YM8A 1YHVA 2YHVA 4L00A 3HYHA 4C4HA 4FEVA 3DDPA 4FKTA 3F9NA 5E1SA 3UMXA 4AXAA 2G2FA 4E93A 4Y72A 3W2OA 3R9HA 3EL8A 4YURA 4JBPA 4A9TA 2Z60A 4LRJA 3UO5A 3G0EA 4I0RA 5CEIA 4MBJA 1YDRE 3QF9A 2JKKA 4MF0A 5CSWA 3RI1A 3ZO1A 4A9YA 1HCKA 2V62A 4JJRA 4B4LA 4C4GA 4DG0E 2CKQA 1P14A 3D4QA 1AGWA 3LZBA 4XRLA 3KF7A 3SXSA 5CS6A 3UG1A 3QCSA 1WVYA 4HOKA 3VS1A 4ENYA 1OMWA 4HYSA 5A4QA 5HO7A 3F5XA 2GQGA 3V5LA 3FV8A 1R0EA 1NA7A 3CQUA 5HBHA 2XA4A 3RAKA 4FK3A 3PZHA 3KQ7A 4Y95A 4PPAA 4AN3A 1GOLA 4Z7HA 1URWA 1KUTA 4M13A 1FINA 4O86A 1BYGA 4X7QA 2BR1A 4GT3A 2H9VA 3DS6A 1OIUA 4UWCA 3OUNB 1OPJA 5IU2A 4KBAA 2CHLA 4JG6A 1NVSA 4YZMA 5DRDA 3POZA 2ZYBA 3FMHA 4BL1A 4BYJA 3FJQE 4MD7E 3VS6A 4CXAA 2J5FA 4KD1A 1ZZ2A 2BILB 3CY2A 4JRVA 4JX3A 4QTDA 5I9XA 3KVXA 1OGUA 3LVPA 5HCXA 4AW0A 5KKRB 4WSQA 3FAAA 4BI2A 2V22A 3DBEA 3EQRA 3QD4A 3VBQA 2P3GX 4BZOA 4NW6A 2WMSA 3LXPA 4C7TA 3FUPA 5ACKA 4BYIA 2QLUA 3KF4A 2EVAA 3GC8A 5JZJA 4JG7A 4QYHA 5DG5A 2HY0A 2NPQA 1KOAA 3A4PA 5E91A 2RFEA 4X6QC 3WF8A 4EOQA 3RZBA 1XO2B 2XJ0A 5TT7A 3FHIA 4EC8A 4JR7A 3E8EA 3GBZA 4L44A 4U41A 2PE1A 3KRJA 5E7RA 3GFWA 1G8AA 1SMHA 1ZZLA 4S2ZA 3VS5A 3ZO2A 3JVSA 4RZWA 1OUYA 1WVXA 4XMOA 5BVFA 1SVHA 2GNLA 3PPZA 5HHWA 3S2PA 3TNIA 4BBFA 4FV1A 3A2CA 4EH9A 3PVWA 3ZLSA 3UGCA 5CVFA 2UZLA 4I6FA 4EOMA 5M53A 3ENHA 5BVEA 4HVSA 5ANDA 5HG7A 4R3PA 4RC3A 3OY1A 5HO8A 4NJDA 4ZSAA 5CAOA 4FX3A 4IWDA 4I92A 5CNOA 4YJTA 5FXSA 4J99A 3UVRA 4CFWA 3NWWA 3LXNA 2QURA 3CJFA 2J6MA 3DJ7A 3P5KA 4YJVA 2ONLA 5KO1A 3ULZA 2UW8A 4GG5A 3U9NA 2OI4X 1PXKA 2X8IA 3SW4A 3KK8A 4FSWA 5F20A 5EI2A 5AV4A 2CGWA 4RSSA 1QL6A 3GQIA 2W1EA 3FBVA 3NYNA 4CTCA 2C3IB 4I24A 5G6VA 4PV0A 4ALVA 2ACXA 3QD3A 3FMMA 4WRSA 2OICA 2RFNA 3A7JA 4KSQA 4O7WA 4O0UA 1H26A 2IVSA 2W99B 2VX0A 3EFJA 4EORA 3ELJA 3HMNA 4Z7GA 4HNIA 4WO5A 4S33A 2GNFA 4P2KA 3FKLA 5B2LA 5GZAA 3FWQA 2QU6A 4ZP5A 3ENMA 2VO6A 4XG6A 1P4FA 3DPKA 4CMTA 2IZSA 2W5BA 3PXQA 5AAGA 3OW4A 4EOSA 2UW7A 2IW9A 2W05A 4XV9A 2VNYA 3BU5A 2J0IA 3RHXA 2ZMCA 2OIQA 5DPVA 3EQPA 4GU9A 4IZ7A 4JNWA 3TEIA 3GB2A 4GT5A 3TNHA 3DJ6A 4MEDA 3S95A 1UNLA 4KA3A 2CCHA 3F3ZA 2F2UA 1CM8A 4GMYA 5KNJA 3TUBA 2OSCA 4QYGA 2O3PA 4WD5A 4D55A 2QOQA 4ANOA 2PZ5A 1H0WA 3QX2A 3U6JA 1OPKA 2QKWB 2C6KA 3O8UA 3R21A 4IC8A 4ONAA 4XP3A 1JKLA 3EHAA 4L46A 4FVRA 5AP3A 5IQCA 3C13A 2UW5A 1XR1A 5C9CA 3ACJA 2BIKB 2XIYA 4NIFA 2O65A 3SXFA 3UDBA 2GHLA 4ACDA 4CLJA 3CD3A 3N51A 1M2QA 3QXPA 3AT3A 3IG7A 4JBOA 3P7CA 1JOWB 3DAJA 3BV2A 2PULA 1KE9A 3ORMA 4RLKA 3EQBA 2H8HA 1R3CA 3Q4CA 4C34A 2C68A 4AGDA 2OF2A 3RINA 4E6CA 3ZRMA 3R9RA 4RVLA 5HVYA 2XKFA 4ERWA 4DFXE 4RX5A 3ZXTA 5CEKA 2OGVA 5TO8A 3CKWA 1Y8GA 2I0VA 3VHEA 5J8IA 4E26A 5JFSA 3PIYA 4HCVA 5LVMA 2NNWB 3COKA 3II5A 4NIFB 4QMUA 3AD5A 4OR5A 5EKOA 4D2VA 1P2AA 2XEYA 4IAKA 4AFEA 3OWPA 4F99A 3HMIA 1IA8A 3ZZEA 2QONA 4FV0A 4FT9A 3ZH8A 4O0XA 5LWNA 2XK9A 1MP8A 4FTLA 4HGSA 4G5JA 5M4FA 4HGTA 4G6NA 4FKWA 5AEPA 3A7GA 3PG1A 4H1JA 5ANEA 2VUWA 2Z2WA 4FV4A 4LL5A 4FTTA 3OC1A 4MAOA 2JDSA 1PYXA 3OS3A 4Q9ZA 5A54A 3RK9A 2YDJA 2VWWA 3L9PA 1GNGA 3DFCB 2R3IA 3W2PA 4YJPA 1XQZA 2B9JA 4O6LA 4A4LA 5IA4A 1JBPE 4AZFA 3VIDA 1KV2A 2RF9A 3AXWA 3QQKA 4JR3A 2GMXA 3SOCA 4CZTA 2C6EA 4J7BA 2G2IA 4GK2A 1Y57A 3MY1A 3GXLA 5K3YA 2VTJA
chains in the Genus database with same CATH superfamily
3R9NA 3QRIA 2BRNA 4IAIA 4QYFA 4B8MA 3UOJA 1H1WA 1REJA 3MS9A 3O8TA 4NKSA 4QTAA 4EHEA 4AQCA 4QYYA 3OOMA 1VYWA 3TTJA 3IS5A 5FM3A 2CGUA 5CSXA 3VNTA 1ST4A 2UZUE 2CLQA 2ITXA 4FTMA 4QQ5A 2PVMA 5FTOA 3DNEA 3VJOA 4AXFA 1H0VA 4ZY5A 2VWYA 5AV1A 4AW5A 1JLUE 3ANRA 5LVNA 3ZC5A 1OZ1A 3BYSA 2AC3A 1VR2A 3QKKA 3OWLA 3FC2A 1PXLA 2ITPA 4K33A 4Q9SA 5EFQA 4QMWA 5JZNA 3TI1A 4EOIA 5C8NA 4QD6A 4XOYA 2A4LA 1H1SA 3BYOA 1DI9A 3C50A 4ZXTA 4ANSA 3RGFA 2XAOA 2ITNA 2RSVA 2Y0AA 4RC4A 4QP2A 1MRUA 3WF7A 3DAEA 4MTAA 5AUZA 3NNVA 4PTEA 3OHTA 3SAYA 3C0GA 1APME 2VTRA 4DEBA 3CBLA 3GCSA 4QMVA 3LOKA 4RC2A 3NFFB 3E62A 3CTHA 3BU6A 1WBOA 3QQLA 5EDRA 2ETRA 2W17A 3BZ3A 1O6KA 2XEZA 4GT4A 2VWZA 4YGAA 3NNWA 4GSBA 4OAUC 3QYZA 5AADA 4IZYA 2PE2A 3EZVA 4DLIA 2HK5A 1L3RE 2UVYA 3F2AA 2C3KA 2NP8A 4O4BB 2WMBA 3EN5A 5IH6A 3W32A 4LV8A 2OJGA 3BI6A 4MYGA 4E8AA 4YZBA 4PDYA 2FYSA 1RDQE 4I6BA 4CFVA 2Y6MA 2Y4IB 4XG9A 4FYNA 3LMGA 4DINA 1RW8A 2RL5A 2UW4A 3PSBA 3VJNA 2B4SB 3ATSA 3RBWA 4P5ZA 2X0PA 5DRBA 1CDKA 3EN7A 4IMYA 4PQNA 4ZMFA 4F65A 4ZS0A 3UC3A 1KWPA 5DWRA 3AC8A 3KC3A 1LP4A 2X0GA 4YP8A 3VS0A 5H8BA 3WE4A 4L45A 4R3CA 4V04A 3RPVA 1YQJA 3GC9A 4V0GA 3VW8A 2IF8A 4FEUA 3F69A 5FUTA 3MDYA 4RIWA 1XHAA 2WOUA 4CV8A 3V6SA 4X21A 3D2IA 3NNUA 3QFVA 4UBAA 4IEBA 4C8BA 4C62A 2PMNX 4R1VA 4EK3A 4ZJVA 4AS0A 2YWPA 2LGCA 2BRBA 3C4WA 3KXMA 4FEQA 3LQ3A 3ZEWA 2PK9A 1YOMA 1JKSA 4O7RA 3THBA 4AN2A 3C4ZA 3FMKA 3Q04A 5A46A 2WMRA 3MIAA 4RZVA 3PE1A 4XV2A 4C4EA 2B0QA 2JKMA 3EQDA 3FKNA 2OXYA 3VBWA 4O7ZA 5EHLA 3PYYA 5DNRA 2PVRA 3VVHA 3Q2JA 4V0GB 5FXQA 2WTDA 3AD6A 4RIWB 4U42A 2FSTX 4DGNA 1ZAOA 2ZB0A 5CLPA 4E5BA 3PFYA 4QQCA 1T45A 2P55A 2J9MA 2VTPA 3A8WA 4LMUA 3CJGA 1LEWA 3MGYA 2HWPA 1Q8YA 2E9UA 4X2GA 3PXKA 3TT0A 5JMSA 5K5NA 3VHKA 2X6EA 2X7FA 5EW8A 1H1RA 4FE2A 5CU4A 5JGDA 4HVDA 3KMWA 3QXOA 2EB3A 1BI8A 4N4SA 5FG8A 5DMZA 3HA6A 4HYUA 3CTJA 5A6OA 5EQEA 4E7WA 3RK5A 2HW6A 3LCDA 2X2KA 2REIA 2EWAA 4XCUA 1PW2A 3V5PA 4C3FA 1YOJA 3WZUA 4G3CA 1I44A 2JKQA 3PXFA 4CV9A 5L2QA 4U97A 3CKXA 3TDVA 2VTMA 1ZOEA 1QPCA 2X4ZA 3K3JA 4AT3A 3TN8A 2JFMA 2XNGA 1OB3A 2I6LA 2R3MA 2XIRA 1BUHA 3ALNA 4DHZA 3CR0A 3R1NA 3W10A 2BZJA 3E64A 3I5NA 2Z02A 3PPKA 3BHVA 4D5HA 4MNFA 3Q53A 5KHXA 3E3BX 1YHSA 5E8UA 3KXNA 4NU1A 3KMMA 5HGIA 4ACCA 3I0QA 5IQBA 5KMJA 5CU6A 4OUCA 5HNBA 3HV3A 5KMKA 4O6EA 2WB8A 3QYWA 4FTKA 5CAQA 3QRTA 3PPJA 3P7BA 2XNMA 3DQWA 1Y8YA 3TJCA 3N4TA 4AT5A 3TG1A 2XK8A 1G8JA 4QPAA 3CP9A 2VO0A 4EWQA 3RAIA 3QUPA 3S00A 3RNIA 3O7LB 4EZ7A 4G34A 4EHGA 3QGWA 4QDVA 4GUEA 1HCLA 4QTEA 4BDHA 5CT0A 5HD4A 5IQDA 1J91A 4F63A 2BZHB 3IQ7A 4I5CA 1YW2A 4PMTA 3UIBA 4TXCA 5K4IA 4YU2A 3ZXZA 3PXZA 3VONA 5AV2A 4I23A 3CPCA 3PJ8A 4GU6A 4KRCA 4PL5A 5CVGA 2R3OA 5BUJA 3NYVA 2XNEA 2UZBA 2BDFA 2CKPA 4CG9A 3MPMA 1OL2A 5E8SA 1V0BA 3KRWA 2QODA 2XH5A 5BYYA 2OKRA 3RP9A 3ZYAA 2CDZA 5DFPA 4A9RA 3RWQA 4OAVB 3ID6C 1YWRA 4YTFA 1W8CA 4FZ6A 1S9IA 4OBOA 3A7IA 4DTKA 4M97A 2B1PA 2XP2A 2BAQA 5EI8A 4BTKA 2WHBA 2W06A 1J1BA 2BHEA 4FRFA 4FSUA 4Q2AA 1T46A 2OO8X 4YSMA 4IJ9A 3ZFMA 4A9SA 3FY0A 5L3AA 1PMUA 4XP0A 4FOCA 2WMUA 4GH2A 2IW6A 1G8KA 2Q0NA 2VV9A 4IX3A 4ASDA 1PMEA 2PVLA 4EH4A 2GPHA 4FODA 4MXCA 5GZ9A 5K4JA 1NT2A 3FZSA 3T8OA 2GNIA 4YR8A 4L9IA 1OIYA 3K5UA 4WRGA 3NVKI 3ORZA 5TKDA 3DTWA 1E1VA 3QKMA 3PP0A 3OD6X 5H3QA 3TKHA 4I41A 2PMLX 2F57A 2XS0A 2KTYA 2YISA 4N0SA 3TV6A 2E9OA 4IE9A 5D10A 2YCFA 2AEGA 4BDAA 5EYCA 1F0QA 4CG8A 4RX7A 3R28A 5BVKA 2WTJA 4O7NA 3OUKA 2JITA 5M4IA 2PVJA 3GT8A 4GK4A 4E4NA 4L67A 3SG9A 4FVPA 4UWBA 5CENA 4EQMA 1WBTA 3NCZA 2P0CA 3TV7A 3AC4A 3CIKA 2FUMA 3MFSA 4LUDA 3A99A 4HVGA 1XBCA 3DBQA 3FZ1A 5LARA 3R9DA 1H28A 3DBFA 5CVHA 4ZAUA 4WNPA 5J87A 1P4OA 4TY1A 5AR8A 2R9SA 3BGPA 3RPOA 4YTCA 3KK9A 4TZRA 1TZDA 4L3LA 3ML1A 5CNNA 5BVDA 3D83A 1J1CA 5KHWA 2WMTA 4BIEA 4CRLA 2GQRA 4CGAA 3PY0A 4FNWA 3L9LA 3W1FA 4IZAA 2QOKA 4RRVA 5FTGA 3ZUVA 2PUUA 4C4JA 4IADA 4MNEB 3ORIA 2BTSA 2W4JA 3GVUA 4C4IA 2ITQA 1W98A 3CCNA 4L42A 1URCA 1WBPA 1XKKA 4KKHA 2O64A 3OEFX 4IVDA 3P1AA 5B2KA 3F3TA 4GVJA 5JT2A 4ZTSA 4R8QA 4OGRA 4PDPA 3UPZA 5CASA 2XKDA 1IG1A 3MESA 4IBMA 4LRMA 1ZOHA 4RWLA 4F7JA 2W9FB 3HUBA 3MY5A 4HGEA 3Q4TA 5GINE 3SRVA 3S1HA 1Q61A 3IW6A 3PIXA 3QA0A 5DIAA 1KSWA 2WTKB 4BTJA 1ST0A 3FXWA 1UU8A 3MFUA 2R3NA 2X7OA 2G9XA 1BMKA 3PLSA 1PXMA 2CNUA 4DTBA 4F6UA 2YIRA 4FKIA 4GFGA 4JL9A 4AP7A 1Q5KA 2W1GA 4AA0A 3VULA 4DHJA 2CNQA 5CZHA 3R04A 3TWJA 1FOTA 1YRPA 4ZSGA 3SRVB 3ATTA 4UXQA 4D0XA 1M2RA 4O0YA 2YLFA 2ZV8A 4FIGA 3H10A 3IOKA 5KUPA 4O4FA 4GEOA 5CAUA 1LEZA 3CGOA 4YJNA 4IWPA 3SLSA 4C38A 4OTHA 1R0PA 4C33A 3G9LX 3BYVA 4TNBA 1XMLA 3ORPA 4IANA 3JYAA 3QC9A 3M42A 5CAVA 3PRFA 1Q3WA 3F3WA 4EOLA 1IAJA 5EM6A 3BGZA 3ZUUA 3PWDA 3JUHA 3MH0A 5JN2A 4ZLOA 4G3DA 4XJ0A 3A60A 4IB1A 1RQQA 4TYIA 4YZ9A 1SZMA 4FKVA 3KN6A 3HX4A 3AC3A 4JXFA 4TYEA 3NUYA 5L2TA 5LVOA 5I9WA 5T3QA 3VAPA 1XWSA 2R3QA 1OKWA 4Z55A 1CTPE 1G8SA 1Q24A 3RAWA 3RCJA 2XK6A 2WKMA 4APPA 5BMMA 2R3KA 3W8QA 4WG3A 3RALA 3EYHA 4IDTA 4CFXA 3U9CA 5HX8A 4V01A 5E8ZA 3LMIA 5HTCA 2ZM1A 3R63A 5AR4A 3LKMA 2XK4A 4RLLA 5AP2A 2ITWA 3SHEA 2QO2A 2B9HA 1KE8A 3HLLA 3MTFA 5KE0A 3BHUA 2XM8A 3Q6WA 4FA2A 3UNKA 3O0GA 2XNBA 2Z7LA 4ZIMA 4YHJA 3D7ZA 4CYIA 5IQHA 3M2WA 2YLEA 2R7BA 3L8VA 2PSQA 4GK3A 5AFVA 4DEAA 4FIEA 5CF6A 3TACA 3UP2A 4EKLA 3L8PA 4IAYA 3UO4A 3WZJA 4ZTMA 3ZSIA 4FGRA 2X1NA 1W2FA 2B53A 2OJFE 4FTRA 3OWKA 3IO7A 3OXZA 3QCXA 1KE5A 1RE8A 2OW3A 3IDBA 4B8LA 3MY0A 5IF1A 4RVTA 3H9OA 4W9XA 4FTOA 5DE2A 4DITA 4TWNA 5CEPA 3L8XA 4KRDA 2UZOA 3MFRA 2WZJA 4BCIA 3FI2A 3MVHA 4E5AX 2AC5A 2YJSA 4DGGA 3NMUF 3CGFA 5CEMA 3W18A 4ERKA 4WUAA 5J7BA 3UQFA 4J8MA 4O1PA 1Y91A 3NVMB 1OL1A 3FY2A 4U6RA 4QMNA 3OWJA 2XRUA 3UMWA 2WFYA 3MPAA 1G3NA 2W5HA 3KXHA 3PTGA 4U7ZA 4BI0A 1OUKA 3KA0A 2C1BA 2WIPA 4U79A 4DBXA 4BIDA 3OXIA 2X2LA 4I94A 2QR7A 5M51A 3LFCA 4FV7A 5I9YA 5M56A 4MX9A 4ZS4A 2PVHA 4IB5A 3FYKX 3FI3A 3GP0A 3MA6A 4CFMA 5HORA 3PUFC 1YDTE 2FB8A 3E8CA 2P4IA 2GFSA 3P78A 3UZRA 5I3RA 1SNXA 4IVBA 3R8VA 1ZWSA 4DFYA 4BWPA 2OXDA 3WARA 2VO7A 1Z57A 4QMTA 3O23A 1FMKA 3IONA 3NDMA 3WILA 4CMOA 4AOJA 2C6DA 4S30A 3G5DA 1OVEA 3PA4A 4FR4A 4M12A 5GJFA 3D15A 4CQGA 2HELA 1KE6A 1XH6A 5EOBA 3PG3A 2C3LA 5IA3A 5M08A 2R3RA 2C0TA 3DLZA 1NVRA 3KXXA 4HGLA 3FLZA 4EH5A 5FLFA 4O7TA 5GJDA 4M7IA 4BHNA 4R77A 2R3PA 4JVGA 2GCDA 1WCCA 4AAAA 4BCOA 4KIOA 4AOIA 4YLJA 3QCYA 4Z3VA 3PRIA 1B39A 4U40A 5F1ZA 2PVYA 4X3JA 4WHZA 4USEA 4EOKA 5FP5A 4EYJA 5KMMA 3W0QA 4D2RA 4UB7A 3UDSA 2W4KA 1WBSA 4FV6A 3GCQA 3OTUA 4ACHA 4G2FA 1S9JA 2IVVA 2YEXA 3KCFA 1BX6A 4AT4A 3GUBA 1MUOA 2C5OA 3Q9WA 2EXEA 2QNJA 4PMPA 2UW0A 4OTWA 2BIYA 4YLLA 4BZNA 5ETCA 3NW6A 3FL4A 3S0OA 2X7GA 3EQIA 4G6LA 3UTOA 4B7TA 5AX9A 3ZLXA 4ASZA 3C0IA 4EK6A 1EH4A 4BJJA 1YXUA 2RG5A 4JAIA 4Y5QA 3L9MA 4CCBA 2A0CX 3QLFA 4WIHA 1A9UA 4AQKA 5IEXA 3RHKA 5A4CA 4O22A 3NYXA 2J0LA 4CT2A 5HIBA 1CSNA 4I5MA 4ARKA 4CKRA 5CI6A 1JAMA 5GIOE 3EIDA 4BY9E 2OZOA 4QMOA 3W55A 1W0XC 3MTLA 4DG3E 2YIYA 3CLYA 3T3UA 4L53A 5IQGA 3WOWA 3ZSHA 2GS6A 3NUNA 4IDVA 3MH2A 3Q4UA 2YAAA 4FT5A 4IFCA 4NJ3A 1W7HA 3HDMA 3EN6A 4YBJA 3GQLA 4W9WA 3AKLA 4L3PA 3KCKA 1YXSA 5DT3A 5EK7A 4BJJB 1PJKA 4M15A 5BVOA 1YVJA 3ZRLA 2WAJA 2XARA 4C57A 4WG4A 3SKCA 4F4PA 1K2PA 3BEGA 3FZRA 4QMPA 4TYJA 4BKJA 1U5QA 3KFAA 3O51A 4JLCA 3DQXA 4HPTE 4UMUA 2W1HA 2XM9A 3I60A 3WYXA 4TWCA 5EH0A 2Y8OA 4IW0A 2KULA 3W2QA 3WF9A 5FWKK 4XH6A 5LXMA 3KXZA 3HDNA 4GUBA 4IIRA 2FH9A 2WMAA 1CKPA 4GYIA 5ETFA 4C3RA 2R3JA 2XK3A 3F6XA 5AP1A 2G15A 3O50A 1BI7A 3D5VA 3GI3A 4W4YA 4I1ZA 4U43A 4E4LA 3EN4A 4M14A 3AMBA 3WZEA 1H1QA 3LHJA 2XAMA 2XALA 4NM5A 2GNHA 3W16A 4EL9A 3DBDA 4ANNA 4V05A 3QRUA 3B2WA 2Y4PA 2WTIA 2VTNA 3DOGA 3MVLA 2A19B 2YCQA 3R7EA 4DDIA 4I3ZA 2CMWA 4CVAA 2V5QA 2JBOA 2P2IA 4FTNA 5IDNA 2R7IA 5J5SA 2WMWA 3D5WA 1U46A 1O9UA 3ORLA 4FSYA 1PY5A 5HU9A 3MIYA 2YCSA 5CX9A 3NEWA 2HY81 4I5HA 2F7ZE 3BCEA 3U4WA 3P9JA 2BDJA 3UE4A 4N57A 3T9IA 5EM5A 1PXOA 4APCA 4CZUA 2I1MA 2YACA 4X6RA 3ULIA 2HZNA 4D28A 5C27A 1H08A 2YA9A 2PMOX 3UVQA 2OJJA 2J0KA 2O63A 4FSRA 4CKIA 2YCRA 4YO6A 2CKOA 4JDHA 3VBXA 3R7OA 1GZOA 3P7AA 2FVDA 4CQEA 5CF4A 3VS7A 4DGMA 3QQUA 2C4GA 3UJGA 1DI8A 4BDCA 4YJRA 2W5AA 4BZDA 4ENXA 3T3VA 4XEYA 5I4NA 5CAPA 3HNGA 3PZEA 4GYGA 4UZDA 5IKWA 4JAJA 3D5UA 3G15A 2QHMA 4B6LA 4I93A 4AF3A 3KU2A 3QUDA 4KKGA 3OMVA 5HE1A 5HKMA 5A4LA 3UG2A 3R02A 4F7LA 2QCSA 4D4YA 4EQCA 5IPJA 4RIXA 4NCTC 3EL7A 3R22A 3R30A 3C51A 3MB6A 4XOZA 1DS5A 3VF8A 4BTFA 2WTCA 3AOXA 4E4MA 4YJSA 4X2FA 4MQ2A 4IX5A 2OIBA 4ZMEA 1ZLTA 5AMNA 3NUPA 3PE2A 4FMQA 4F9BA 4O4EA 4ZZNA 3HMMA 4NCTA 4UMQA 5IDPA 4O81A 3IW4A 2G01A 3VWAA 3ETAA 4DYMA 2PE0A 5LJJA 3WBLA 3MH3A 4BKYA 4PMSA 3L1SA 3IOPA 4L8MA 2X0QA 3EQGA 4RX9A 2QKRA 3H9RA 4YC8A 1PF8A 1GAGA 2PZYA 4FT7A 4YHFA 4JOAA 4LOPA 4YZDA 2YDIA 4X2KA 5HX6A 3R2BA 2VO3A 4FUYA 1TFFA 5M07A 4USDA 4I4EA 4QRCA 2Z8CA 2WD1A 4NTSA 4IZ5A 5IA2A 3ORNA 3MFTA 4EOOA 4UX9A 4QTCA 2QQ7A 4BWXA 2QOIA 4OTDA 1UNHA 5AM6A 5HU3A 4M8TA 4H3BA 4BCFA 5CSPA 5DHJA 3UYSA 5HNIX 3TUDA 1WBVA 2YITA 2ERKA 5EI6A 3QD2B 2VZ6A 4H3PA 4MK0A 3HUCA 2C6IA 2OU7A 3GGFA 5H8EA 3M1SA 5DLSA 2WNTA 4PDOA 3S3IA 4Y46A 4M69A 2IVTA 1YHWA 3VUHA 4PMMA 2BAKA 5CU2A 3I7CA 3IW8A 4ZTLA 5KMIA 3AKJA 2BMCA 2C5YA 3HP2A 1WFCA 3EJ1A 5LCJA 4L68A 3UPXA 5M06A 5EDPA 2YZLA 4DA5A 3CQWA 4ANBA 3W2CA 2HWOA 4KAOA 2JKOA 4H3QA 2QOBA 4O1OA 5HVKA 1PXPA 1SYKA 3MN3A 4BCMA 4BGQA 4UZHA 3RPYA 4PNKA 4MWHA 2PY3A 4EOPA 1OKZA 3B2TA 1TQIA 4X2JA 3PSDA 4AXEA 5KMLA 4M69B 2C6MA 2I7QA 4ZLYA 2VTLA 2ZV2A 3LFBA 4FVQA 2JEDA 2OBJA 4ID7A 2W4OA 4IAZA 2R64A 3Q9YA 3TKUA 2XUUA 5H9BA 5TR6A 4AA4A 4LOQA 1ZY4A 2X39A 4L6QA 3FZTA 4BCJA 4GCJA 3G9NA 4DTAA 3RPRA 5GHVA 4JDKA 4YO4A 1OBGA 3GCUA 2PVFA 3TTIA 5LOHA 3NLBA 4FG8A 4UALA 5IQIA 4BDKA 5F95A 1JVPP 3FC1X 4LUEA 5IH5A 4IJPA 1H4LA 5BMSA 2QHNA 3HRCA 3TNQB 4BDGA 4IX6A 3ROYA 3HVCA 2WQBA 4D2WA 5IA1A 4K9YA 2DWBA 4EH6A 5J1WA 2WQNA 3IDPA 3SXRA 4F9YA 2QG7A 4IB3A 2HZ0A 4XX9A 3I81A 2BRHA 5IEYA 4W4WA 2CKEA 3QZFA 3P4KA 4BDFA 3NUUA 4EHVA 4QMQA 4O82A 4W8EA 4CRSA 4MVFA 3R73A 4D4SA 3WZKA 4DFLA 4ACMA 3NR9A 2UZTA 1JKTA 1H01A 4BCGA 5CQUA 2QVSE 4DFUA 1WBWA 4FTCA 2W9ZB 5BNJA 3RK7A 4C02A 2YAKA 1WZYA 3KRLA 4G3EA 4YUQA 5FP6A 3TIYA 2BKZA 3A61A 3DFAA 4KNBA 4YMJA 4USFA 2VTQA 4AAYA 2UZDA 3MW1A 4PRJA 1CKJA 5JH6A 3EKKA 5M09A 3CY3A 1ZYCA 4H58A 5CU0A 3AKKA 2I0EA 5I3OA 2X8DA 5AP5A 3SGCA 3D2KA 4EOJA 4CTBA 3JY9A 1REKA 1M7NA 2JBPA 1ZOGA 1SVEA 1B38A 3NW7A 4LL0A 2PU8A 1K3AA 2IN6A 5AR5A 4YPDA 4O4CA 1J7LA 1AD5A 2WTWA 2BCJA 3NW5A 4OTIA 3O96A 4I5PA 3ZM4A 1A48A 1OIQA 2HXQA 3LCTA 2QO7A 4FBXA 5FDPA 4O7YA 4O7LA 4KKEA 1WMKA 4R7IA 3G90X 4J1RA 4MQ1A 3DKGA 3FLNC 3TL8A 4C58A 4F70A 2HOGA 4X0MA 5K9IA 1KOBA 2CPKE 1Z9XA 4JQ7A 4DH7A 4QPSA 4YNOA 4L43A 4FKOA 1H00A 2CGVA 4BDIA 5M4UA 5LMKC 5D7VA 3HV4A 2E9PA 3G0FA 3K2LA 4FL1A 4OT5A 3OCBA 5AAFA 5AUTA 3U6HA 2JDOA 4GJ3A 1GZ8A 2BVAA 2FSLX 5AUVA 3DZOA 3P79A 3CPBA 4U81A 3D5XA 3FKOA 4FKRA 2C0OA 4G9RA 5ANIA 2OFUA 5CYIA 4Z16A 4F6WA 4BWKA 5IZFA 3E63A 3ZBFA 3GC0A 2WTVA 3NS9A 3PXYA 5HESA 5EG3A 2CN8A 3IW5A 2J90A 3BBTB 3UC4A 4GG7A 4LQMA 5EDQA 2BHHA 4RJ6A 3FXZA 1W83A 2QOFA 3EFLA 3ODYX 4FICA 4FZFB 5HBEA 4GRBA 5D11A 2O5KA 4ZTHA 1SM2A 5IUIA 1GIIA 4FV5A 3ZO4A 4BGHA 5HTIA 3BGQA 2PUPA 3TNWA 2Y6OA 4N6ZA 5AV3A 4S32A 4R3RA 1IA9A 3NFGB 4FSZA 4AW2A 3FDNA 4RFMA 1ZMWA 2C6OA 4RMZA 3CD8A 2OZAA 5L8KA 2RFSA 5KZIA 3FXXA 3PJ3A 2WO6A 5BYZA 5C03A 1IAHA 3MV5A 1W2DA 3QUEA 3E8DA 3DKOA 1JNKA 4FSQA 2EUFB 3ORKA 4JDJA 1Q97A 5C26A 3FPMA 5M57A 4ZEGA 4RQVA 3VUKA 4QP3A 3VRZA 5CEOA 1ZYJA 3L8SA 4UMTA 3EB0A 4I6LA 4RVMA 2PPQA 2PYWA 2ITZA 4MBIA 4TRLA 2WMVA 2H34A 3VBYA 4IAFA 4EYMA 2E9VA 2OZAB 4A4XA 1PXIA 4EH8A 3EKNA 3ZO3A 4HYHA 2W1IA 1VEBA 2HCKA 3KRRA 3RCDA 3DU8A 4TL0A 3DCVA 4BCQA 3QQHA 3TZMA 4OW8A 4K8AA 3LCSA 3PJCA 2WMXA 4RA5A 3GENA 2QLQA 3F2NA 4AACA 3NNXA 3IK3A 4YZNA 4DHFA 4DGOA 2ZMDA 2QD9A 4M68A 3OOGA 2BFXA 3FMLA 3SQQA 3U51A 1LR4A 4AU8A 3FL5A 3D7TA 2C3JA 5HE2A 2BAJA 1Q8ZA 3D94A 2X2MA 4C4FA 4R6VA 4FKUA 3L9NA 3LFAA 4X3FC 3V51A 3AGMA 3TZ7A 3OCGA 4FUXA 3F66A 1UKIA 3I4BA 2C6LA 5EW9A 3R8ZA 2C69A 3WE8A 3HKOA 3HECA 1Q4LA 4ZSEA 3O8PA 3R7VA 2HYYA 4AZEA 1W84A 2X0OA 4XG2A 1Y6AA 5CY3A 2YM6A 5FXRA 1FBNA 3WZDA 4OBPA 5JQ5A 3SOAA 4X3FA 4BHZA 2XIKA 3OROA 3P08A 2GHMA 2ITOA 3D7TB 1V0OA 4F1OA 1KE7A 2AQXA 4TWOA 5AP4A 3FYJX 4LM5A 3FLQA 4QYEA 3FI4A 3ZC6A 4F78A 5EYMA 4QP6A 3E7VA 5HLPA 4UWYA 4QMYA 4QP9A 4LOOA 3SV0A 3LFEA 2UV2A 2A27A 2RKUA 4FKJA 2JDTA 1YI4A 1MQ4A 3A7HA 3ANQA 3MI9A 3QTQA 5F94A 3DKCA 2H96A 2DUVA 5GZ8A 4FKQA 2OFVA 3QLGA 4FIJA 2X8EA 3R00A 4X3FB 5JFVA 4XG8A 2J4ZA 5JGAA 3MJ2A 3U55A 5T6KA 1FVRA 5FEQA 4J97A 4E6DA 1BL6A 4BICA 2IWIA 4EWHA 5L4QA 5CTPA 4FT3A 5AP6A 4JBVA 2AUHA 4ZZMA 5BVWA 2YZAA 4CZYB 3RVGA 4MUQA 3GU5A 4YPSA 3C1XA 3LFSA 2OIDA 4AUAA 5D1JA 5EM7A 4UYNA 3DK3A 4O83A 4AFJA 2QU5A 4BGGA 1AQ1A 5IQFA 5A4EA 5D9HA 1JKKA 1U4DA 5FEEA 2NYAA 5EHYA 3R8UA 4HVIA 4PF4A 4QQTA 2PUNA 4UYAA 3Q9ZA 3MA3A 2ZFYA 1YXXA 2QC6A 3KKVA 5DR9A 4C35A 5J79A 1IEPA 1U59A 2CLXA 2UW6A 2QR8A 5B2MA 3CC6A 3PUPA 2P2HA 3TIZA 3UP7A 3R6XA 3VUMA 4UEUA 4RA4A 3ZSGA 2C5VA 4TYHA 3ZDUA 3OEZA 2IVUA 3LCKA 4DN5A 5KX8A 3ORTA 3QQJA 4I6QA 2W1FA 2Z7QA 3OP5A 3QQGA 4QNAA 4U8ZA 4ZK5A 3R8LA 4A07A 4DHIB 2OXXA 3F7ZA 4RGJA 4RT7A 5AP7A 3RKBA 4F08A 3HAVA 3CS9A 5GIPE 2FO0A 1STCE 4ITHA 4DAWA 3AT4A 2IZRA 4S31A 5CXZA 1TKIA 3H4JA 1UVRA 5HNGA 3AG9A 1XH9A 1GY3A 3PVBA 3OCSA 4FF8A 3I1AA 5GJGA 3RJCA 4MXXA 3ROCA 4MF1A 4BBMA 1UWHA 2WEIA 3VS2A 2PUIA 4GVAA 4J95A 4YC6A 4D2TA 2C5NA 3U54A 1B6CB 3MWUA 5DT0A 1J7UA 3NUAA 1OGYA 4A4OA 2YM5A 5C01A 4O91A 3R9OA 4GW8A 5CXHA 5DR6A 1TQMA 4PL3A 4K2RA 5EKNA 1ATPE 3NYOA 4U80A 2E9NA 3V8TA 2WQMA 3E3PA 3E87A 4IWQA 4Q5EA 2VU3A 4EH7A 2FA2A 2GDOA 2I0HA 2C30A 4PPBA 4O84A 4P5QA 5DYJA 3V5WA 4TWPA 3LCOA 2IW8A 2W7XA 3KEXA 2VRXA 4C2VA 2BKKA 4FZDB 4KS8A 3TCPA 4I6HA 1BKXA 3ET7A 5AR7A 3NZ0A 4IB0A 1F5QA 2XF0A 3FMNA 4G31A 1XH7A 2YIWA 4PY1A 4U44A </