2A1AB

Pkr kinase domain-eif2alpha complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
269
Chain Sequence
b'GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 84
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a1aB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a1aB01
3ZHPC 3NCZA 1WBOA 1ZXEA 4UMUA 5FUTA 2QU6A 3QD0A 5EHYA 2REIA 3BYOA 3TJCA 5FXRA 1A06A 4IX6A 3KRXA 4KS7A 4EEVA 4PP7A 2PZPA 4YR8A 3K5VA 5CXZA 3TI1A 3H9RA 4OUCA 4ANSA 4QP2A 2WFYA 1PXJA 2OIDA 3AC2A 4IWPA 4FIJA 2OJFE 2PE1A 1JKKA 3S4QA 3ZSIA 5I0BA 2VWZA 2YEXA 3F9NA 3O7LB 2UUEA 3F66A 3FMMA 4JDJA 3LZBA 3PJ2A 1F0QA 2XUUA 4K33A 3W33A 5CT7A 3KC3A 5K5NA 3D7TA 5CSXA 5CVGA 4YHFA 4RQKA 3UO5A 3NUXA 4KBCA 4EH4A 2F7EE 1UNGA 4OBPA 1OPKA 3GQIA 4PPBA 4PRJA 4PY1A 4D0WA 4WOVA 3DTCA 1FMOE 4GW8A 4AUAA 3U4WA 2O3PA 4H58A 2OI4X 4PMTA 2WEIA 4UMTA 4IFCA 3MFTA 5FTGA 4XBRA 5AX3A 2PULA 4FTOA 2CN8A 1H1RA 2ZB1A 4E4NA 3UBDA 1WZYA 3HUBA 4HNFA 4UEUA 4Y46A 3FYJX 2UZUE 4IB3A 3OWLA 1YVJA 4HVDA 2UZDA 1GY3A 3SQQA 3FKNA 4YLKA 5AIRA 2PUNA 4HYIA 4RBLA 4HVSA 5JZNA 3PZHA 4F7JA 2ITOA 2VTOA 2O64A 4HYHA 5CTPA 3VS0A 3LM5A 3BBTB 4EKLA 4DH8A 4G5JA 5CEKA 5LVLA 4BN1A 3B8RA 4QMLA 2C6KA 4XH6A 1OKVA 5CU0A 2HWOA 3OW4A 5CENA 3TIZA 3Q60A 2X4FA 3QZHA 5CAUA 3CJFA 1QPDA 4OAUC 4G5PA 2W1ZA 1PF8A 3ORNA 2YIQA 3UP2A 4OT6A 2R3OA 4Y8DA 2P4IA 1MUOA 2UVYA 1STCE 3C4FA 3ZEWA 4FTRA 3PPJA 2QCSA 1E9HA 3FL4A 4DA5A 4QTEA 2XIYA 3CTJA 5H9BA 3NVKI 2J50A 3KCKA 5A14A 5JFWA 3VW8A 5DRBA 2PL0A 5AM6A 4APCA 3R1YA 5FDXA 5M57A 3AT2A 3C1XA 3DBCA 1YDSE 5EK7A 3GU5A 3MTFA 4A9UA 5EM5A 3PXKA 5A6OA 3DCVA 4CG9A 3FYKX 3Q4UA 1Q8ZA 3D5VA 2YM8A 5IEYA 2CKPA 2QLUA 3KB7A 2RGPA 3DBFA 4ZIMA 2XF0A 2BPMA 2XYNA 4MXOA 2OZAA 4P7EA 4FL3A 4FT0A 3RWPA 4GT3A 4H1MA 3SC1A 4EOSA 5KKRC 5E9EA 5LVMA 4U44A 4OR5A 3K2LA 2W96B 4ITJA 4ANNA 4F1MA 4X3FC 4O1PA 3RPSA 3EN9A 2XBAA 3HKOA 4C58A 5C03A 5F1ZA 4D1XA 3QALE 5HE2A 2PVYA 5KE0A 2YIXA 4IADA 5GHVA 4DG3E 5K4JA 3TM0A 3B2WA 3G0FA 3TTJA 4LOOA 4ANLA 5AR4A 1TQIA 4R78A 4LUEA 3A7FA 1HOWA 4H3PA 4JX3A 3UIBA 2VU3A 1P4FA 4G16A 4L45A 3HV6A 4EOLA 3IONA 3DXPA 4KAOA 4GK4A 2WQMA 4ANMA 3VWAA 1MP8A 3PSDA 4EH7A 2X9FA 4FV5A 5F20A 4ITHA 1SVEA 3IO7A 3AQVA 3FSKA 3UPXA 4G31A 4CQEA 5J7BA 3WF8A 3DK7A 2VAGA 4BB4A 4OTWA 3OBGA 4CFUA 2EB3A 2X8DA 3ZC6A 3MYGA 4JVGA 1G5SA 3PJCA 5A6NA 3QUPA 4FSRA 2XBJA 2JDOA 3PIYA 2O63A 3E87A 2VTRA 5AV3A 4PWNA 2OXDA 3KK9A 5HORA 3H4JA 4OBQA 4QMOA 4U80A 4O0RA 4E4XA 4F7NA 4TL0A 5IPJA 3DFAA 4QMSA 4Q5EA 3FLNC 1PMEA 3T8OA 5F9EA 5GNKA 3W8QA 4M3QA 2VX0A 4F64A 4YJRA 4NT4A 5J9YA 2RIOA 3TNIA 2C47A 3F82A 4YUQA 2ZMDA 3PLAE 2EUFB 3QU0A 4UWBA 3QQKA 4U79A 2IW9A 2VO0A 3CEKA 5HNIX 3QA8A 3UC3A 4F7SA 3NUUA 4D5KA 3HV5A 3FL5A 5CQWA 4FT3A 1APME 4X2FA 2W5BA 5BYLA 4IH8A 4IDTA 2OJ9A 2IN6A 5IQDA 3CTQA 5A4LA 4XG9A 2O0UA 3ZO4A 3SW4A 3EQHA 4RWIA 1QPJA 3R1NA 5CZIA 4E8AA 1JKLA 2R3HA 3W2QA 1YOMA 4IAAA 4DGNA 4YLJA 3R9NA 3FQSA 1W7HA 3OD6X 4PMSA 4XLIA 5AV2A 5K3YA 4A9TA 4L7FA 3UGCA 4QP4A 3IG7A 5EI2A 3ZLXA 3MB6A 3KMUA 3DJ5A 4C02A 4KKHA 4D28A 5IA0A 3P78A 4RX9A 5CAVA 4QNYA 5FXQA 4BCFA 3FXXA 2HY0A 4XYFA 4FKLA 3AXWA 3OROA 4O2ZA 4QTCA 3GT8A 3TXOA 3FZSA 3ZSHA 4CCUA 4R3RA 4BCJA 1ERKA 3PVGA 4QMXA 5JH6A 1CM8A 1H0VA 3NIEA 4MD8E 4A4OA 4EQCA 5IQHA 4WSYA 2BROA 2YLEA 4EHVA 4ZMEA 2JKKA 2F9GA 5D41A 5FEQA 4ORKA 4L53A 1M17A 4U97A 4ZLOA 2G1TA 4U81A 3N4TA 4FEUA 2PVHA 4RX8A 4RIXB 5BVEA 4CYIA 1M7NA 2OZOA 4QMTA 5A3XA 4AE6A 1MRYA 4CSVA 3H3CA 1NW1A 4E6QA 3HAVA 3PRIA 5FLFA 5HIDA 2C0TA 5IG1A 4E6AA 4MWIA 5DI1A 2BCJA 4IZ7A 3DKCA 3DPKA 3OTUA 3C4EA 4JRVA 3T3VA 2VO7A 5D11A 4D2VA 5J9ZA 1KOAA 1U54B 5HO7A 2HELA 1Q24A 2CKOA 3VBYA 3WIGA 5ETCA 2OJJA 3MPMA 4G6NA 3L8XA 5M55A 4CVAA 3GOPA 1FINA 2UVZA 4FTNA 4KBAA 5I9VA 3R28A 4P4CA 2GHLA 1UA2A 5CEPA 4FV6A 5IDNA 2PVFA 3QHWA 4BGGA 2P33A 3TDVA 1JAMA 2W7XA 4WBOA 1DAWA 4IFGA 2BAQA 4WRGA 4NL0A 3MA3A 5IQCA 2H9VA 4BDFA 4RIYA 2YM3A 1FOTA 1YWNA 5L4QA 3PXFA 3DTWA 4YLLA 2BIYA 2F49A 2VTPA 3HEGA 3KF4A 3WE4A 2HXLA 2GNLA 4E26A 2G9XA 3FQHA 4UWCA 4FV1A 3BWJA 4I6BA 4FGRA 3D7ZA 4O0TA 2CGVA 3U6JA 2PHKA 4BDBA 5HCZA 2GTMA 4O2PA 3U4UA 3ORLA 5I9ZA 3I7CA 5J1VA 3W8LA 4RZVA 4FTQA 4AF3A 2PTKA 3F7WA 1XQZA 4LM5A 1OIRA 4C0TA 3KXXA 1OL5A 3PVWA 3OVVA 3WIKA 1R78A 1OB3A 1FGKA 1PXIA 2PYWA 4ZP5A 5FP5A 3U9CA 1TKIA 3OCBA 4L7SA 2WOUA 4JI9A 4AA4A 2ZDUA 2IW6A 3CE3A 3TG1A 4FBXA 3BLQA 3R7IA 3VJOA 4A4XA 1BKXA 2JD5A 2JLDA 2QVSE 5CANA 5LWNA 2B1PA 3BQCA 4UZHA 3T9TA 2PVJA 4AOJA 5CZHA 2XNNA 3DAKA 3BYMA 3FPMA 4FTTA 3DGKA 4LG4A 4Z9LA 3ZO2A 3D15A 4IE9A 4O7ZA 2OKRA 2Y6MA 4U45A 5M08A 2FO0A 2WXVA 1U4DA 3QTXA 4I20A 4QYHA 3RBWA 1WBWA 4AQCA 4JJRA 2C3KA 3LFQA 1JVPP 4NW6A 5CF6A 4AZTA 5AX9A 5HE3A 2WGJA 5E1EA 4DC2A 1YOLA 2I0YA 3UZPA 1Y6BA 3PY0A 2XP2A 3EN6A 3ORXA 4M0ZA 4B7TA 2BFYA 4ONAA 4C2WA 4E93A 5HU3A 4E4LA 4F6SA 5IH5A 3GU4A 4UALA 3O8TA 4NSTA 3D0EA 3EQDA 3F5PA 4NCTA 2H34A 4O27B 4ACGA 3AD6A 2VO6A 1R3CA 3MS9A 2J6MA 3FI4A 3MPAA 4GG5A 4PMMA 3VAPA 3SLSA 3MVLA 1Q8TA 3G5DA 3T3UA 4BCKA 3EQBA 3R1SA 2VGOA 4C61A 4FKVA 5M44A 5HE0A 4QQTA 1YHWA 4KIKB 4OTHA 2XM9A 3C51A 4LL5A 4RJ6A 4RGJA 3C5IA 4G9CA 4BTKA 3GC8A 4L43A 2QOOA 4UX9A 4JNWA 2PZ5A 4ZSEA 2V62A 4O0VA 4CV8A 2UZOA 2P0CA 1J7IA 1OL2A 3OFMA 5FRIA 2GU8A 2IVVA 1SNUA 5DBXA 3SVVA 5CSHA 3V3VA 4MNEA 3O17A 3BX5A 2HENA 4JBPA 4L44A 3HGKA 4YU2A 4OT5A 4C62A 4DFBA 3ZU7A 3QTSA 4YZNA 2IO6A 1JSTA 3IDBA 4BDAA 4FVRA 1YXVA 4J98A 2X2LA 3SRVA 2BDJA 2ITZA 2OFUA 2XIZA 2B9FA 4EHZA 1SZMA 1Q3WA 4GFGA 5JGDA 4RQVA 5A54A 3VUMA 4EBWA 3LFBA 4FGBA 2RG6A 4JR7A 3HP5A 3MB7A 4NKSA 4CKRA 3CQWA 4E5AX 3MY5A 4J96A 4F9YA 5I5ZA 2E9PA 4KRDA 3R02A 4ZJJA 3ULZA 3BHHA 2JDRA 1WBNA 2A19B 4O82A 2J0IA 3COHA 1QL6A 3NUNA 4TWNA 3LQ5A 4U3YA 3C4XA 5HGIA 1QCFA 3OWJA 3SXFA 4DGOA 3GU6A 4EK5A 4ZY4A 3R83A 4FICA 3LKMA 4M0YA 4OTFA 4P2KA 1VZOA 4W9WA 4F9WA 2V55A 4FTAA 4MQ2A 3OS3A 4ZJIA 3ZRLA 4GVJA 4DBNA 4EWHA 1YXSA 2ITNA 2PMOX 1XHAA 5GINE 1PHKA 3EKKA 4FSQA 4HPUE 4V04A 3WZUA 5A9UA 2UW9A 3OP5A 4HJOA 4F7LA 4DHFA 4Y73A 4C4FA 3BLRA 2J2IB 4U0IA 5DH3A 2WMSA 2CGWA 2ZV8A 5AM7A 2R5TA 5CNOA 4DH5A 3DJ6A 3PWDA 1SNXA 3PE1A 4G3FA 4O7LA 2PUUA 1TQMA 3NEWA 4TRLA 3PLSA 2YHVA 3NYXA 3G90X 1BL7A 4KUJA 2WOTA 2O2UA 2ESMA 4G6OA 4IAZA 5DN3A 4J7BA 1PJKA 4D5HA 3DB6A 4FV4A 4W4VA 3CXWA 4EL9A 5CAQA 3VNTA 1K2PA 4OTQA 3E3PA 3OMVA 4AE9A 5KZIA 2ZDTA 1I44A 1WCCA 4FTMA 4XP3A 5AP6A 2CGXA 3JXWA 1T46A 4OTGA 4C7TA 3EQGA 1YHSA 4TWPA 4MXXA 4D2RA 2BR1A 4CMUA 2PU8A 4QP1A 5EOLA 3TUDA 2RL5A 3VIDA 4Z16A 2XRUA 3QFVA 5JGBA 5CX9A 2UW6A 3PZEA 5CU4A 3UOKA 4HPTE 4TYGA 3I5ZA 5A4QA 5DIAA 4O0YA 4A9SA 2J5FA 3NYVA 1XH7A 2ETMA 2IZUA 2QOFA 2R9SA 4XP2A 4DTBA 3MGYA 1ZYSA 2WMBA 2JEDA 3UVPA 4YC3A 4C3RA 5BVOA 4J71A 2QO2A 4RC4A 1YXUA 3QQHA 4R1VA 4BBFA 4G2FA 3VS6A 3F61A 2VTLA 4D4RA 3FMLA 5IQIA 4FIHA 4GYIA 4D4YA 4DFNA 3LLTA 4A4LA 4A7CA 4O7VA 2W1HA 4IB0A 4WA9A 2VUWA 4ANBA 4BTFA 3D5UA 3U55A 2C1BA 4MBLA 5EI8A 2ZYBA 4ANQA 2OBJA 3KF7A 4L00A 5TT7A 4B8LA 2W1FA 3EYGA 2QONA 4A9YA 4BC6A 5E8YA 2W0JA 4YNOA 4ZOGA 2WMQA 5CF5A 2YERA 3POZA 2OH0E 2FGIA 2IZSA 2RFDA 4U42A 5M4FA 4ID7A 3DNDA 1WFCA 2YZAA 4W4XA 4WO5A 1YHVA 2Z8CA 3GCUA 3AMAA 3PJ1A 5CI6A 4QQJA 2X8IA 2VTJA 4QNAA 5AIKA 4IZ5A 5J5TA 4AGWA 2JFLA 3OG7A 2UZEA 2B9IA 4WBBB 2YDJA 3DT1A 4FK6A 4S32A 4JLCA 2FUMA 4J1RA 4MKCA 4AW2A 4FNYA 5L2QA 3EYHA 1IA9A 4FEQA 4ZLYA 3FXZA 4KWPA 2JGZA 2WHBA 4S2ZA 4U43A 3SG8A 4YJQA 4II5A 4CFMA 2C6LA 4FKOA 2WB8A 3V01A 3HMOA 1UKIA 3FBVA 4ZS0A 2C6MA 5DR9A 2PK9A 3W10A 1UV5A 2PVRA 4LUDA 2UZTA 3BLHA 2GNGA 3FE3A 3FC1X 4EI4A 1PXNA 3M42A 5CF4A 4WD5A 5AUYA 4YURA 4IX3A 5DNRA 5BUIA 3FZRA 4DH3A 2XNBA 2W5AA 4NJ3A 2GS7A 3HRFA 2CGUA 5AP2A 3DZQA 1DS5A 3Q4TA 4GSBA 4UBAA 3SOCA 1H25A 4C4HA 5B0XA 3W18A 4X0MA 2XEZA 4ZSJA 4AWIA 3IOPA 5FEDA 3R9RA 1FGIA 3RCDA 1IRKA 5LMAA 3F3VA 4ERKA 3ZONA 3GC0A 1FMKA 2G01A 3WARA 4Z55A 4L67A 2JFMA 3TDWA 3UOLA 5DPVA 5EI6A 5EKNA 3KXHA 2YCSA 4RJ4A 1ATPE 2GFSA 3AC5A 4PNIA 4R6VA 4I6HA 3ZUUA 3MI9A 4CT1A 4CV9A 4C4IA 2BZKB 1YDTE 5ANIA 3O8UA 3QZGA 2B55A 3PJ3A 4KB8A 4O84A 1PYXA 2H96A 5BNJA 3TZ9A 2I40A 2J5EA 4YZDA 2FA2A 3I79A 4JRNA 4QPMA 4B9DA 2C0OA 4U40A 3EQCA 5I3OA 3HRBA 1O6LA 1XH6A 2UZNA 3C5UA 3E93A 1UU9A 1GZKA 1R39A 2P3GX 3DOGA 3LOKA 2YWPA 4FKJA 3SX9A 3UE4A 2ZM3A 5J9LA 2Z7RA 1M52A 3V5QA 2Z7LA 1KE6A 3BIZA 1T45A 3UVQA 3UQFA 2QOHA 3P86A 1JOWB 3BHVA 4EOJA 4C4GA 2YIRA 4EC8A 3S3IA 4KSQA 3FJQE 4G3DA 3CQUA 1YWVA 4WUNA 4FODA 4RFYA 4JIKA 3RP9A 3SD0A 5L2SA 3BGPA 5ANJA 2QKRA 1Y6AA 2WTKC 4EH2A 5FBNC 3EFLA 4O7SA 3DA6A 3PXRA 4G9RA 1OKZA 5J7HA 4BZDA 3RAKA 3ZXZA 4DYMA 1ZMUA 3OC1A 3QYWA 3TNPC 2VTNA 3BQRA 1QPEA 3ZDUA 3OTVA 3OY1A 4DT8A 1XKKA 2ERKA 3MV5A 5BQ0A 5ETFA 3MESA 2E9OA 3HUCA 5K0XA 4UXQA 5L6PA 2QURA 4GH2A 5EQEA 5L6WL 3P0MA 3C9WA 4Q2AA 4YBJA 3R7UA 4OLIA 4D9UA 3FHIA 4AGUA 5HG8A 5C4KA 5M4IA 3WZKA 2OIQA 2IZRA 3R8PA 5IISA 3KREA 3QUEA 3A4PA 1SVHA 4QYEA 2YABA 4PL5A 3QL8A 3TN8A 4Z7GA 1GOLA 4OTRA 1Q62A 4CEGA 3ORZA 4FKRA 4XOZA 5CNNA 3O71A 3ZRMA 4CCBA 5JFXA 2BZJA 4NIFB 3DBEA 4F6WA 4O7NA 2HOGA 2PMLX 4RX7A 3RI1A 4MXZA 4AS0A 2B0QA 2BILB 3GU7A 3H0ZA 4O22A 4JQ8A 2DUVA 1BYGA 3MJ1A 4PL4A 1JKTA 5JEBA 2QG7A 2BRGA 4NW5A 1H08A 4XCUA 5K5XA 2Q0BA 3MY0A 4AP7A 5AWMA 4C36A 1H01A 5C27A 3BV3A 5HU9A 4XV2A 3FZOA 3MBLA 3K3IA 4W4YA 5AAGA 1WVXA 5JGAA 4O7YA 3OOGA 3NRMA 5E8ZA 3M1SA 1UU7A 3SW7A 4AX8A 3KRRA 5CU3A 2QOQA 3RINA 5DRDA 4WNKA 4CKJA 3WF6A 1B38A 4U8ZA 5L8JA 4GYGA 3BGQA 4I92A 5HEZA 4UN0C 2HXQA 3R9DA 2UW7A 4BDGA 3DK6A 1ZARA 5FQDC 3QCXA 4E1ZA 3TZ8A 2VRXA 2QOLA 4PDPA 4EJNA 2QO7A 2BKZA 1M2QA 4YP8A 4WIHA 5EM6A 4FC0A 4MK0A 3BZ3A 2C6TA 3VUTA 1HCKA 1ZY5A 3MVMA 4GT4A 4EZ3A 4R8QA 5BYZA 4N57A 3MH3A 3QWJA 4AU8A 3L9MA 2GTNA 4RLLA 4ZTSA 4AZSA 3V8WA 4BIEA 2HIWA 2XK7A 2VD5A 1WBSA 4CRSA 2ONLA 4FYNA 4Y85A 2OIBA 3EN5A 2YA9A 1ZY4A 2ZB0A 2WPAA 2C6IA 3D83A 5IA2A 1OBGA 4NK9A 4RVLA 4FG9A 2ZV9A 2GFCA 5D10A 1PW2A 3UTOA 2WTWA 2XIXA 3OT8A 3W2PA 3KA0A 4QTAA 4AG8A 2PMNX 2XNGA 3B8QA 4U5JA 3OBJA 3ZO3A 4ZJVA 4J99A 1U54A 3GEQA 4BI2A 4RX5A 2VX1A 3LVPA 3FEGA 1OGUA 3FMKA 1NT2A 4DT9A 5GZ9A 3LFFA 3ZMMA 5GZAA 3LPBA 2E9NA 4UMQA 3LXNA 2A0CX 4P90A 1UU3A 3ACKA 4QMYA 4J53A 3VBTA 3OUKA 5HIEA 4BI1A 1P5EA 3Q2JA 4LOPA 3RPVA 4AT4A 4DEBA 4OTDA 2VV9A 4Q5HA 2ETRA 4FKUA 2RSVA 1OL1A 4EYJA 4U6RA 4QPAA 5FBOA 5EW3A 5IH4A 3A62A 3IGOA 3LCOA 4JG6A 2C1AA 3QTUA 5JRQA 4GFMA 3HAMA 3ZEPA 5FD2A 3G6GA 4FSTA 2DYLA 5LMKC 4HOKA 5ANKA 4FNXA 4I5PA 1CDKA 3DLSA 3L8SA 2WQNA 3ANQA 5JMSA 3LFNA 1Y91A 1UVRA 4YJOA 2C5XA 4YZ9A 2Z2WA 4Y95A 2HY81 3GFWA 5HCYA 4S30A 4O81A 4AN9A 4IIRA 4WG5A 5CSPA 3QHRA 3LXLA 2B9HA 4YTIA 4IVBA 4TN6A 4FSMA 4HGTA 2EXEA 3FZPA 3KEXA 2BRBA 3R8UA 4BCIA 3QLGA 1S9IA 1Y8GA 2LGCA 4O6LA 4YPDA 4ZS4A 2VWVA 3HZTA 3CIKA 1IR3A 3AMBA 2V7OA 2W4OA 5AEPA 4IVDA 5IZFA 4HCTA 4J8MA 4OGRA 2PZYA 4YZBA 1GZOA 3KXMA 3NR9A 2J0KA 3O2MA 4ASZA 4K6ZA 2I0EA 3O7LD 2YDKA 3FLZA 2ZJWA 1JLUE 4AZVA 4AA5A 4O83A 5FP6A 4BHNA 3OEZA 4FI1A 1QPCA 3MA6A 5KMLA 4M14A 3EQPA 3S2PA 4F63A 4CQGA 2PVKA 2VTMA 5FTQA 4ZZNA 4F1OA 4USDA 1K9AA 3ALOA 4KNBA 4BFMA 4DN5A 3Q9WA 4QP9A 4EK6A 1J7UA 3FKOA 3UVRA 3WOWA 4KKGA 4DG2E 4XV9A 3E3BX 4M7IA 3RWQA 1IAHA 3DQXA 3FLYA 4RVTA 2QODA 3TV4A 1OIUA 4WT6A 2VWYA 3NYOA 3PPZA 2O65A 4ARKA 2FH9A 4CKIA 4EOMA 4QD6A 5TOZA 5FM2A 3UIMA 1V0OA 3ZC5A 4F65A 3QQJA 4AW0A 4C37A 3PDTA 4FV0A 3LCTA 3UMXA 3JYAA 4AZWA 2J0JA 3HVCA 4NM7A 3WZJA 3W16A 4C4EA 2GDOA 1Q5KA 3A60A 3BRBA 4QPSA 4RC3A 5KMOA 3BHYA 2QOCA 2CLXA 2WQEA 3F2RA 1JPAA 1NVSA 3Q4ZA 5CLPA 4S33A 3GCVA 4NYEA 5EDQA 5DFPA 3NDMA 4LFIA 4NU1A 4BKZA 5KHXA 1WMKA 4LL0A 4J97A 3ORMA 4ALWA 3EL7A 3DS6A 4D2TA 5L2TA 4GIIA 4H3QA 2NPQA 2VWXA 2OWBA 2SRCA 3UYTA 5AUTA 3F2NA 3E8EA 2IWIA 3EH9A 3UOJA 4IW0A 4BCMA 1YXTA 4EOKA 3MN3A 4BDJA 4LMUA 3Q5IA 4YSJA 2Z02A 3EQFA 4XJ0A 3ZSGA 2UW8A 2WMTA 4AGCA 4EZ7A 2VWBA 3M2WA 1P2AA 4C33A 1DI9A 3NNWA 4X2JA 4XRJA 3UG2A 1MRVA 4EOIA 1FBNA 3QYZA 2ITQA 4DEIA 3D5WA 4IWQA 5KKRB 3EB0A 3QD4A 3FUPA 1XWSA 2ZAZA 3CGOA 4GK2A 3WZEA 3V5JA 4X3FB 4FYOA 4F9BA 4IVAA 3I60A 4YBKA 3TWJA 4WNPA 3DDQA 3G9LX 2QG5A 1PRYA 4IQ6A 3NX8A 4G17A 5DA3A 4F1TA 2BVAA 5CSVA 3V04A 2B54A 4K77A 4I0RA 3R7GA 5JQ5A 5IU2A 5BUEA 3G6HA 2NNWB 4FX3A 3Q52A 3HA8A 4YJPA 5E90A 4G6LA 5I9UA 3F3TA 3NIZA 2RKUA 3CLYA 1W98A 4X3JA 2YLFA 2ETKA 3GQLA 4CFVA 5ACBC 1PKGA 3R2YA 4FZ7A 2BIKB 4BKJA 3JY0A 3ZYAA 3NMUF 3C7QA 4Q9SA 2C6OA 3L8VA 4LGGA 3O51A 4RZWA 1JQHA 3P23A 4C4JA 2XKEA 4DLIA 3A7HA 3G51A 3QRJA 5DHJA 4EJ7A 2PY3A 2OSCA 3LCSA 5K0KA 4KABA 3DU8A 1KE9A 4MHAA 4UY9A 4X21A 5DR2A 3FXWA 4HGEA 2W1GA 3FPQA 3ZLWA 5TO8A 4RJ3A 3P7AA 1G8SA 5HBHA 4DINA 5C8NA 4AGDA 3VRYA 4OTPA 5CU2A 3BE9A 3TUBA 2IVUA 4XV3A 2DQ7X 3QRIA 1OKWA 2J7TA 5EH0A 3ZM9A 1ZOEA 2XK6A 1Q8UA 2XM8A 4DEAA 3LIJA 5EQPA 1MQBA 2C5YA 3CD8A 4BIDA 3DJ7A 4W8DA 3FWQA 4FZDB 3V6RA 3ZDIA 5F4NA 3E62A 3FV8A 5CXHA 3PPKA 3MVJA 5JKGA 5DG5A 3BE2A 4FTLA 1OMWA 1JNKA 3A8XA 4GUBA 2A27A 5CSWA 2PUIA 4OBOA 3BV2A 2XK4A 2ERZE 3H9OA 4X6QC 4ZTNA 5JQ8A 4Y83A 3QTIA 3E64A 2BAJA 2XNEA 4TYHB 2IJMA 3GCQA 5HVJA 4K18A 1L3RE 1U59A 3QZFA 2FYSA 2F7ZE 3CS9A 5AP4A 3EZRA 2P55A 4MEDA 2GMXA 2J0LA 3UZRA 2YWVA 2R64A 3HRCA 5CQUA 3VULA 1BX6A 2ZV2A 3NW7A 3AC1A 5IUHA 4IJ9A 2CNVA 5ETIA 1RE8A 3QCSA 2W4JA 3F88A 5M51A 4IAKA 4PTEA 2R3GA 1AQ1A 2KTYA 2E9UA 3SKCA 3AGLA 3HECA 3OCGA 4AN2A 4F99A 4L9IA 5HD4A 3FI3A 4TY1A 5DYJA 2YCQA 5DGZA 5C8MA 3QAME 4HVIA 4ASXA 3R01A 3RVGA 2R3NA 3PJ8A 3LFCA 5TF9A 3ORPA 4D4VA 1WVWA 1OBDA 3LAUA 4DH7A 2GCDA 3RKBA 4L6QA 5E92A 2YDIA 2FB8A 3MSSA 4QP7A 4TYJA 4BGQA 4PDOA 4FSNA 1SMHA 3RM7A 3S00A 5AUWA 4EH6A 1I09A 2IW8A 4ZSLA 4FNZA 4IDVA 1IA8A 3P1AA 3QUDA 4O38A 3W55A 3QWKA 3G33A 5KBRA 3HNGA 4PPCA 4AOTA 3OXIA 4JBOA 1TVOA 4KIQA 4F4PA 5E4HA 3NAXA 5D12A 3AT3A 4F9CA 5IA1A 3V8TA 1KV1A 2YM6A 2F4JA 3PVBA 3CCNA 3ZZWA 2Y4IC 4FTUA 2HW7A 3ELJA 3FAAA 5HD7A 1JBPE 3P08A 3REPA 3Q6WA 4FF8A 5I9YA 4FR4A 3DDPA 3RPYA 1YWRA 2CKQA 4BZOA 4YSMA 5TR6A 2GS2A 3PA5A 4BCGA 2P2HA 5I9XA 4G3CA 2XJ2A 4I0TA 5M4UA 4FE2A 4ZTLA 3GNIB 2VNWA 4FG7A 3GENA 3PG1A 4R5YA 5CVFA 4PDYA 2HZ0A 3BU5A 2W1EA 3E7OA 5LARA 5KMMA 3PFQA 3CKXA 3ZCLA 3R21A 3CC6A 4YPSA 5T3QA 3QC4A 4RT7A 4QMUA 5B2MA 1YXXA 4K11A 4YJUA 4MVFA 5HG5A 3L9NA 4XV1A 4ALUA 3CY2A 4BWKA 3BHTA 4Q9ZA 2G2FA 1VR2A 3KU2A 4FIFA 2XVDA 3RHKA 4BGHA 3UZTA 2VN9A 5A46A 4GRBA 3R7VA 1W83A 2G15A 4C2VA 2F7XE 3OXZA 3ALNA 3HL7A 5ACKA 2BDFA 2CDZA 2WTJA 1VJYA 4P5QA 4ACCA 1FVVA 3FLSA 5LVOA 2C5OA 5AP5A 3DK3A 4KA3A 3QTQA 2YJSA 5LCKA 4CD0A 4IEBA 1PXLA 1IASA 2R0UA 3R8LA 3WI6A 3QTRA 3WYYA 4JS8A 1H07A 4FKWA 4FTIA 4JBVA 4GJ3A 4PMPA 1L8TA 4QQCA 3CJGA 4U7ZA 3VUGA 3U6IA 3GB2A 3AD5A 4O21A 4JDKA 3MH0A 2CCIA 1CTPE 2OF2A 3TNHA 4TNBA 3UYSA 4M13A 5D7VA 4DITA 5JK3A 4TNDA 5EHOA 2XRWA 3GCPA 3BBWA 3ET7A 4N6YA 3PG3A 4YZCA 3S95A 4XG8A 5DMZA 2A1AB 5KX8A 2OFVA 1Q4LA 1ZYDA 2W17A 3NS9A 4AZEA 4IWOA 2OJGA 4GKIA 2X6EA 4EC9A 2VTHA 5BVNA 3QD2B 1E1XA 5J79A 4RIWB 1Z9XA 3FKLA 3IW6A 3CR0A 5FDPA 4EQMA 3U6HA 1PMVA 3KRJA 3SOAA 3FY2A 5CASA 4BDDA 4EONA 5GJGA 3PYYA 3WZDA 4GU9A 5LVPA 1OUKA 4JT3A 1REKA 4CTCA 3E8CA 5LQFA 4U3ZA 4XG4A 4I4FA 4IC7A 2VGPA 4APPA 4E7WA 2XCKA 4H1JA 4D1ZA 3QKKA 2WQOA 2EB2A 4I4EA 3JR1A 3KXNA 4KS8A 2HCKA 4NIFA 1XBBA 3PIZA 1ZZLA 1M7QA 2UW5A 3AT4A 3COKA 4G34A 3UO6A 2XK8A 3WYXA 3ZOSA 4NCTC 4MD7E 4YNEA 1OPLA 3RK7A 4USEA 3MWUA 2BTRA 4F70A 3MH1A 5BVDA 2WIHA 3ZUTA 5DT3A 1WVYA 3MFUA 4FEWA 2C3JA 4TYEA 1OI9A 2ITPA 4JX7A 4K0YA 2E9VA 3MFSA 4D4SA 4LRKA 4DCEA 4ENXA 4JIAA 5HX8A 4MCVA 4K9YA 3RHXA 3ORIA 4IWDA 1PYEA 3DY7A 5CEIA 4FTJA 1M2PA 2ZOQA 4D55A 4XEYA 2C4GA 3LXKA 3NZ0A 4UMRA 3EQRA 3PXZA 3D4QA 4U9AA 5H8EA 4O7WA 2Z60A 4YGAA 1GNGA 3CBLA 4GEOA 5EKOA 3L9PA 4TKSA 2DWBA 1BI8A 3EL8A 5KUPA 4FSUA 5L2IA 3F5GA 5EW8A 3WILA 3ZFYA 4BICA 4YTHA 3RAHA 4PPAA 4BBEA 1FQ1B 4DBXA 4MYGA 5IUGA 3LQ3A 1W84A 5E91A 3EN4A 4QMVA 4U41A 2P2IA 2W4KA 4BCQA 5BVKA 2PUPA 4AW5A 3TJDA 4M66A 4J95A 5EYMA 1YW2A 1OM1A 3WE8A 4EORA 3ZLYA 2HK5A 3ZFMA 3ZS5A 4M8TA 4R1YA 4QP3A 3ZXTA 3VUKA 2B7AA 3QBNA 3P79A 2YAAA 2WTIA 4RVKA 3R9HA 4RA4A 1U5QA 4HVHA 2JBOA 2IVSA 3WF7A 3N9XA 3GC7A 3PUPA 2JIVA 5KZ0A 4O96A 2C30A 3RTPA 2R7BA 3BYVA 2KULA 5FWKK 5LOHA 4IAFA 5EFQA 1GJOA 2XEYA 4RRVA 4ZTQA 4ZY6A 4A06A 4O91A 4QO9A 4KRCA 4Y5QA 2UZWE 1KE8A 2Z7QA 3NAYA 4K2RA 5BMMA 5HHWA 5DOSA 1LEZA 1UWHA 2R0IA 2W1CA 3DV3A 3C13A 2HWPA 4FV9A 2BUJA 3QRTA 3TTIA 2YM7A 3F3ZA 4MX9A 3SDJA 3F5UA 1CKIA 2R3MA 2RG5A 2OGVA 3O23A 4UXLA 5IQFA 4KINA 4DE4A 2R3RA 3CD3A 3ZM4A 4YO4A 4KIPA 4IAYA 5DR6A 3E5AA 3II5A 3Q4CA 1ZZ2A 1IG1A 3MJ2A 4O0SA 2HYYA 3Q5ZA 2JC6A 3VBXA 4S31A 4MBIA 5J8IA 2AUHA 2BAKA 3C4ZA 3ROYA 5LWMA 1FVRA 4XBUA 2EXMA 1O6KA 3QQUA 3C0HA 5H3QA 5HLPA 3ZBFA 4KIOA 4CNHA 5GIPE 2I7QA 4CTBA 4DEEA 3WBLA 5BMSA 4HCUA 4O7RA 4RVMA 5DWRA 4QMZA 4DEHA 2Z7SA 3G0EA 1ZWSA 4NKAA 5HZNA 3P7CA 3GU8A 1SYKA 1KOBA 3PSCA 2WQBA 1YI4A 1ZOHA 2BRNA 4S34A 4TPTA 3TNQB 4I0SA 3OEFX 4F9AA 5LMBA 4I93A 5BVWA 4C59A 5FEEA 3UNJA 5AV4A 2QD9A 4AOIA 2B52A 3FI2A 3E92A 3HDNA 3TV7A 1NVQA 5HTIA 1GIIA 2RF9A 3QXOA 3UDBA 4EZ5A 5AR7A 4EWQA 4EH9A 4LMNA 4E3CA 3HV4A 3Q96A 4C38A 1NXKA 5EYCA 3R9OA 3VF9A 1H00A 5AFVA 4PP9A 3F3UA 4ENYA 3E8DA 5EYKA 2YCRA 3VBQA 4H05A 1J3HA 3ERKA 1WBTA 2B53A 3EFKA 4AAAA 4BTMA 3UQCA 4JDIA 2NO3A 2F2CB 4XNEA 2C69A 3NGAA 4FL2A 5ETAA 3L1SA 2C6EA 3W2RA 4MH7A 3GOKA 3NW5A 3G9NA 2GS6A 3P9JA 3Q2MA 3OW3A 4K8AA 1RDQE 3HMPA 2QU5A 2WMRA 5KHWA 5IQEA 5IA5A 4FSYA 3VQHA 4QMNA 3GP0A 3T9IA 3PY3A 3L8PA 4KD1A 1ZMVA 5T68A 2XYUA 1J1CA 5CU6A 3OHTA 4MNFA 4WSQA 5A4EA 2YM4A 1OIYA 3PVUA 4Y72A 4M15A 4BYIA 3BWFA 4ANOA 2J90A 3TZ7A 4ZXTA 4RLKA 4CFNA 4CMTA 4G3GA 2W05A 5EW9A 4AT5A 4MF0A 2Y0AA 4KKEA 5HX6A 4XG3A 3DAJA 4MF1A 4XS2A 4ZSGA 3H10A 1H28A 4DGGA 3JUHA 3OT3A 5I3RA 4CLJA 4XUFA 4YJSA 1PMUA 3SXSA 5JZJA 2XMYA 4EKKA 3KN6A 4JQEA 5M09A 2FSMX 3R22A 4ZK5A 3I6WA 3R6XA 3ZUVA 3R63A 5FXSA 4M84A 5EOBA 2UW0A 1H0WA 3LMGA 1P4OA 1W0XC 2C3LA 4JXFA 4C57A 4GV1A 2O8YA 4FTKA 5ITAA 1KSWA 3LFEA 2XNOA 3RALA 4CFFA 4YHJA 3VO3A 4X3FA 2X39A 4FK3A 3S1HA 4D2SA 3HV7A 3SXRA 5CEOA 5FG8A 5HLNA 3F2AA 5AA8A 5CEMA 3EN7A 5C4LA 5B7VA 3W2SA 3PIXA 3COIA 2J0MB 2R3FA 2ZV7A 1Y57A 2NRUA 4FZ6A 3CGFA 3OWPA 4USFA 4WHZA 4ASDA 4ZTMA 3KY2A 1BLXA 4QT1A 5J95A 4D0XA 3PA3A 2Y7JA 2RFNA 4UYAA 3NNXA 2QR8A 4WG3A 5IQAA 3HDMA 3FDNA 2IZTA 2PVMA 2PZIA 4M97A 5HOAA 5L2WA 2WTKB 5J87A 4RIXA 3TZMA 4BYJA 5IDPA 5KMIA 4NFMA 4L68A 5EG3A 2WAJA 1Q41A 2OH4A 1HCLA 4R7BA 5EQYA 4L3LA 5CY3A 1Q61A 4JG8A 4FKSA 1PMNA 4ERWA 4LGDA 3QKMA 3R30A 4IANA 1DM2A 3VS4A 3I1AA 4G1WA 4F0FA 4PTCA 1ZYCA 2WELA 2WMAA 5HESA 4ITIA 4H3BA 4M69B 2QO9A 1URWA 3IW4A 4B0GA 4BWXA 1M14A 1V1KA 4V0GB 1OL6A 3WF9A 2X1NA 3CPBA 2PE0A 3KK8A 2PZRA 4V05A 5EYDA 3CY3A 1ZAOA 1J91A 2H8HA 4HW7A 3R8VA 4X6RA 5ANOA 2JAMA 3FMDA 3IECA 4JAJA 4ZLZA 5KMJA 3C4WA 4BCHA 2AC3A 3LQ8A 3VS2A 4UB7A 2BRMA 3KVXA 5LCJA 2XA4A 5CS6A 3V5WA 4F08A 4FA2A 4PL3A 2JITA 2VX3A 2QOIA 3UMWA 3I0QA 1G3NA 4QYFA 4RWJA 4CLIA 4IB5A 3MH2A 3DQWA 4GUEA 3R71A 3EFJA 3AMYA 5JFVA 4BY9E 1Q8WA 2JKOA 3NW6A 4PQNA 2XNMA 5DE2A 4R3PA 2YISA 2WTDA 1UWJA 1DAYA 3BHUA 3UPZA 4N4SA 3Q9ZA 1KUTA 3BEAA 5HICA 2Q83A 4O0WA 3GXLA 4FT5A 2VTQA 2V0DA 1RJBA 4G3EA 4TYHA 4BHZA 3MIAA 4YTFA 1JSVA 3IW5A 2AC5A 3LE6A 2G2IA 5AP3A 2W1IA 1VYWA 5CI7A 2DS1A 1GZNA 3QCYA 4I6QA 5IMXA 1CKPA 4QP8A 5JT2A 1YRPA 1CKJA 4GFOA 3EOCA 5HG9A 3GCSA 4NUSA 3R8ZA 3DBQA 3D94A 1R0EA 3TL8A 4EHEA 3LXPA 4EBVA 1CMKE 3QC9A 1OL7A 3QXPA 2GNHA 2J51A 5LVNA 3ATTA 3QRUA 2H6DA 4FIGA 3V6SA 3WF5A 3R2BA 3LLAA 3ACJA 3PRFA 5ANEA 1ZOGA 2FSLX 2YN8A 2BHEA 3ANRA 3FSFA 2GHGA 4BIBA 5L6OA 5C26A 4RJ7A 1ZMWA 3RGFA 2CMWA 4A9RA 1FVTA 5AMNA 1YOJA 3KFAA 4IB1A 3W1FA 4AZFA 3MFRA 1ZYLA 2X6DA 1Q97A 2X7OA 2C5VA 1UNLA 3V5TA 3EFWA 3KULB 4FEXA 4E5WA 5CVHA 5TE0A 4C3PA 3NUAA 1A48A 4YHTA 2PSQA 4RC2A 3TT0A 3OOMA 4L3PA 2Q0NA 3ODYX 4J8NA 3LJ0A 4LV5A 2CCHA 4L42A 5AUVA 3R7EA 4FIEA 3OCSA 5LXMA 3F3WA 4I1ZA 2ONLC 3PP1A 3ETAA 3H0YA 3QGYA 3CSVA 5DEYA 3ENMA 3IGGA 4ZMFA 2OK1A 3D5XA 3I6UA 2VTAA 4H36A 4I5MA 1Q8YA 2O5KA 2XKCA 4UV0A 2YM5A 3NCGA 4CFWA 2A4LA 1YDRE 1LUFA 1BI7A 1F5QA 2CPKE 3F5XA 4FUXA 4KIKA 3FQEA 3PY1A 4I3ZA 4R5SA 1OVEA 2B9JA 4IZYA 2C0IA 4CGAA 1W82A 4X7QA 1XH9A 2QI8A 2WD1A 4HZSA 5HO6A 4FUYA 4MWHA 4YJNA 5AR2A 1H24A 4B99A 2PVNA 3NWWA 3ZTXA 5AP0A 5JFSA 4K1BA 3GI3A 2X7GA 5HCXA 2WU7A 3IDCA 2RFSA 4Z3VA 4WNMA 3H30A 5H2UA 2HZIA 4PV0A 3U54A 4BDEA 4EQUA 3A61A 5AP7A 5ANGA 2HAKA 3MDYA 4IC8A 3TNWA 5IA4A 2OW3A 5GZ8A 4CZYB 2F2UA 2Y8OA 4FG8A 1OPJA 3TEIA 4I24A 4AA0A 4ZZMA 3L9LA 4F09A 2GHMA 1BL6A 4N6ZA 2LAVA 4I23A 4FTCA 3V5PA 3JVRA 5KCVA 1MQ4A 5CEQA 3Q3BA 2FSTX 4FV3A 4XMOA 3VHEA 5CYIA 3R8MA 3O0GA 4RSSA 2CSNA 3NUPA 3Q32A 5FTOA 5A4CA 1V0PA 3LJ1A 3RK9A 1YI6A 3K3JA 3KCFA 4DTKA 3A7GA 2WMVA 2JIUA 4LOQA 4CRLA 4CYJA 3R7OA 5CAPA 5HLWA 3LMHA 4FV7A 4FEVA 3S0OA 3VHKA 3OUNB 3ROCA 2VWWA 4NJDA 4NZWB 3EKNA 1FPUA 1M2RA 3A7JA 3GUBA 2W1DA 3IDPA 3M11A 4TXCA 1E1VA 3UIUA 1U46A 3D7TB 3KL8A 4FT9A 4XLVA 3Q9YA 3MVHA 3TKHA 3ZBXA 5A4TA 5IA3A 2ITWA 1H1QA 2FSOX 1SM2A 3EJ1A 5CT0A 4YJTA 5AV0A 2OJIA 3AG9A 2PE2A 2JDVA 4TWCA 3KQ7A 3U8WA 3Q04A 3ZH8A 3AOXA 3LHJA 2HZNA 3CTHA 4LGHA 3MTLA 3PXYA 5C9CA 5KMKA 4IAIA 5LJJA 2UZVA 1X8BA 3R1QA 5IUIA 4AN3A 2EVAA 3Q6UA 1R0PA 2UW3A 5B2KA 2VWUA 4QTBA 4CZUA 4OW8A 4EUUA 5DT0A 3JS2A 2XJ1A 4RIWA 2NP8A 3A8WA 5DEWA 5FGKA 3C50A 1H27A 3ZZEA 3IW7A 3VS7A 3KRLA 4FKQA 1NY3A 1NA7A 2VTIA 5HKMA 1AD5A 4E73A 3UP7A 5IF1A 4IJPA 5KMNA 3DXQA 2R7IA 1JKSA 3BI6A 2RFEA 5G1XA 2HZ4A 2BFXA 3OWKA 4ACDA 2XS0A 4QMMA 5IEXA 5JRSA 4IVCA 2XNPA 5AR8A 5T6KA 2QC6A 3RK5A 5D1JA 1PXPA 5CF8A 2GQRA 2XKDA 4RJ8A 5AR3A 3JY9A 4ZEGA 5BUJA 4GL9A 4HGSA 1YI3A 4I6FA 4RFZA 4EOOA 5M06A 1SVGA 3I4BA 5HNGA 2VO3A 4FVPA 2QNJA 3SAYA 4NTSA 3QQGA 5H8GA 3R00A 3TCPA 2GQSA 2GPHA 1RW8A 4PUZA 4XG2A 3VQUA 3Q53A 5F94A 5HVYA 1YKRA 4XP0A 5J1WA 4P5ZA 5CALA 4TW9A 3FMHA 4O0UA 5AA9A 4GK3A 5AUXA 5B2LA 3EQIA 5CAOA 2V7AA 3KRWA 3BCEA 1GIHA 4N70A 1PKDA 3U51A 2X7FA 4RJ5A 4FL1A 1OUYA 4EUTA 4FOBA 2BALA 4AT3A 2F57A 5HBEA 2E2BA 4FIIA 2OZAB 3OXTA 4RWKA 4EOQA 4TTHB 4TYIA 4R3CA 3PXQA 4UZDA 4DFZE 5IMEA 2J9MA 2J4ZA 2ITUA 4L8MA 2ITTA 3DB8A 2JBPA 1LP4A 5AR5A 5AAFA 1H26A 2A2AA 4W9XA 5I9WA 3KMMA 4LRJA 5EM8A 3QTWA 3FLWA 2OLCA 2X4ZA 5AAEA 4M67A 2CNUA 1XH5A 2PPQA 1ZYJA 2QLQA 1R1WA 2ITXA 4BKYA 4EH8A 4EK4A 4GT5A 5K9IA 4IX4A 4WRSA 2IVTA 2C5NA 3THBA 3C0IA 3I7BA 3F7ZA 3I0OA 3FY0A 4FZFB 4AW1A 4LV8A 2W06A 4L52A 4FKPA 3EIDA 4AXAA 1URCA 3EMGA 4Z7HA 3HMMA 3QZIA 4JOAA 3LJ2A 3LFSA 3VUIA 2WEVA 3V51A 4I21A 5HTBA 4W4WA 4X2GA 3EWHA 4EOPA 1ZLTA 3NNVA 4RWLA 4D9TA 5M4CA 4NM0A 2OXYA 3RZBA 3ZO1A 1IAJA 3D9VA 3NUSA 1PXKA 2XIKA 3MW1A 2QQ7A 5E8SA 3VN9A 4GJ2A 3VW6A 2WNTA 1UU8A 3HYHA 5AUZA 4ASEA 4A07A 3C4CA 3MIYA 3ORTA 4BI0A 3ID6C 3RPOA 3ORKA 3ZFXA 4GKHA 2BMCA 1MRUA 2JDSA 3SV0A 4E6DA 3FZTA 2CHLA 3POOA 4ZY5A 2VNYA 1H4LA 2V22A 2C3IB 4MXYA 2R3PA 4XX9A 4ZZOA 2JKQA 2UZLA 3LCDA 5BYYA 3RZFA 2W5HA 3O96A 4XG7A 3MPTA 4UWYA 3ZRKA 1LPUA 4UMPA 3FHRA 1W8CA 4YZMA 5IKWA 2XK9A 2OO8X 3LM0A 3VBVA 4EHGA 3IK3A 2AYPA 3IOKA 4QQ5A 5TKDA 3UOHA 5FM3A 3N4UA 4CG8A 4C35A 3KVWA 4YJVA 5H8BA 3UODA 1ZRZA 3PSBA 3RAIA 1TQPA 2YJRA 3UQGA 4GU6A 2BZHB 4DGLC 3KMWA 2I0VA 3D14A 2I1MA 5GJDA 2QKWB 1H1PA 3TKIA 5I4NA 4FSWA 3NSZA 2ZM1A 4LRMA 4KBKA 2QHMA 4CZTA 2R4BA 4HNIA 4NFNA 5BVFA 2UW4A 4FKTA 1Z57A 4RG0A 4PTGA 2YIYA 4QYYA 2Y4PA 1WAKA 3VF8A 2VWIA 5DLSA 4DF3A 4D2PA 2ACXA 4FT7A 4JAIA 3Q9XA 5HNBA 3NLBA 5M53A 2CKEA 5IQBA 4J52A 5KO1A 3GFEA 3NNUA 3FZ1A 3VRZA 4D2WA 3VS1A 3E8NA 4FV8A 4ACHA 1IEPA 3LFAA 4NH1A 1B6CB 4HCVA 3OY3A 3AD4A 3QQFA 5E1SA 3VC4A 3HMNA 4NEUA 4EH5A 4C8BA 4DH1A 2JIIA 3LW0A 1LEWA 4QOXA 4E20A 4NWMA 3FMEA 5E7RA 3B2TA 3PTGA 4C34A 2QHNA 3ATSA 5ICPA 2XKFA 3TKUA 3GVUA 2EWAA 5AV1A 4NTTA 3VUHA 3FMJA 1AGWA 4IZAA 4JL9A 3TUCA 3KKVA 4JG7A 4IBMA 3DBDA 2XK3A 2BKKA 2Y4IB 3PP0A 1OITA 4W8EA 4FVQA 3RCJA 4FMQA 3UG1A 5KNJA 2VTSA 1Z5MA 3RMFA 5D9HA 1UKHA 4GMYA 4XOYA 4CT2A 4E6CA 4I22A 3SHEA 4HVGA 4HZRA 2WTVA 4KSPA 3V5LA 5CWZA 3P7BA 3A4OX 4YTCA 2OXXA 2B4SB 4XG6A 3OCTA 2R3IA 5E8WA 1KE5A 1LR4A 5D7AA 2WMXA 2XH5A 1K3AA 4B6LA 5AUUA 2R3JA 1DI8A 3QTZA 4CXAA 3AGMA 4O6EA 4WKQA 3RM6A 4GVAA 4HGLA 3BEGA 5L8KA 3BU6A 5HIBA 3HP2A 3DFCB 3H9FA 2WZJA 4WNOA 5HO8A 4IM0A 2R3LA 2ZMCA 3R73A 3DKFA 3PE2A 3IW8A 1RQQA 1REJA 3JVSA 3U9NA 4PNKA 2X0GA 5HQ0A 4HYUA 4O0XA 5M56A 2ITYA 4V01A 1OECA 3A99A 3BELA 3E7VA 2HW6A 4I5HA 4RIYB 1O6YA 3DNEA 4YC6A 4PX6A 4I41A 3GC9A 4DAWA 5L8LA 5HG7A 3JPVA 3RNIA 1A9UA 3QRKA 3QX2A 2WIPA 1KWPA 3D2IA 2YAKA 3GGFA 4JBQA 5GJFA 3N51A 4BWPA 2W99B 5F95A 2W9ZB 2WMWA 1J1BA 1XBCA 5AADA 3N4VA 1ND4A 3D2KA 1F3MC 3LCKA 1KE7A 4BTJA 1O9UA 5ANDA 2ZVAA 5E8XA 2GNIA 3NPCA 2CN5A 2YCFA 2ZM4A 4TT7A 4R7IA 3QKLA 3AC3A 3BYSA 1YQJA 2CLQA 1XO2B 4DFLA 3KXGA 2WO6A 3NYNA 5AJQA 4YMJA 3A2CA 1PXMA 1UNHA 2XB7A 4MD9E 4BCOA 1V0BA 3K54A 1CSNA 5C1QB 4MXAA 2GSFA 4L01A 4H39A 3QQLA 3VS3A 2GNFA 4PDSA 4RPVA 4MAOA 4DG0E 4QMQA 1GIJA 1XR1A 3COMA 2R2PA 2JDTA 3TIYA 4BDHA 2C6DA 4RMZA 1P14A 4GS6A 3IPHA 4L46A 4QP6A 3ITZA 3O50A 5HTCA 4GCJA 4M69A 2QOBA 4O7TA 3IKAA 3A7IA 4BBMA 3C0GA 3SA0A 4IACA 4BCNA 4V0GA 4RIOA 4ZTHA 1G8AA 1WBPA 4ZSAA 3IS5A 3FLQA 3P5KA 5BPYA 1EH4A 4DTAA 2ITVA 2OG8A 3ENHA 4B8MA 4C3FA 2X2KA 1VYZA 5J5SA 2R3QA 3QX4A 4ALVA 1Q3DA 4ACMA 3OZ6A 3V8SA 1JWHA 4XHKB 4IXPA 4R7HA 3UJGA 4IM2A 4FV2A 3RAWA 2X9EA 3NVMB 1QMZA 4QTDA 2EXCX 3BGZA 1KV2A 3BU3A 4MBJA 2YZLA 5HI2A 2UVXA 5EHLA 2IG7A 4I94A 1VEBA 2WU6A 3E63A 3G2FA 2JKMA 4MXCA 5DT4A 4GIHA 5AP1A 3RJCA 2I6LA 3DKOA 5IH6A 2YITA 3O8PA 4D1SA 4CMOA 2XIRA 2BRHA 3DZOA 4X2NA 4QMPA 4MTAA 2BHHA 4FNWA 1XJDA 5EDPA 2R3KA 4EK3A 5M07A 2I0HA 4OAVB 3LMIA 5C8KA 3CKWA 5L3AA 2W9FB 1OZ1A 4EH3A 3R7YA 2YACA 5KBQA 3QGWA 4QRCA 3BPRA 3ODZX 3UO4A 2C68A 5C01A 1OKYA 3DLZA 4MNEB 4BZNA 1H1SA 1OIQA 4YO6A 1NVRA 2OICA 4LQMA 4LI5A 3HMIA 4TZRA 3W32A 3FI8A 3E88A 4DCAA 3RPRA 4R77A 1S9JA 1GZ8A 3HLLA 4BRXA 3SRVB 4QMWA 4ZAUA 1Q99A 5E8UA 3AC8A 2XZSA 3W2OA 1PXOA 4F0IA 3VBWA 4L3JA 4O1OA 4M68A 4TWOA 4X2KA 3UC4A 4BDKA 3BYUA 4NM3A 3OF0A 4Y5HA 4WUAA 4IX5A 4YC8A 4FKIA 4DEDA 2QR7A 4O86A 3R04A 3I81A 4RFMA 3DXNA 3HX4A 3CPCA 2OF4A 3DKGA 4ZTRA 3RNYA 3VVHA 3SG9A 4M12A 4AACA 4IHPA 4RA5A 4F0GA 5JSMA 2OU7A 3G15A 3EZVA 2YIWA 3KULA 5EDRA 3FC2A 3AC4A 3SGCA 3MY1A 4FOCA 2QOKA 4WG4A 2IPXA 4DFUA 2JAVA 4JR3A 3QLFA 4CFXA 4E5BA 1J7LA 2BZIB 3VS5A 3EHAA 1BMKA 1U5RA 1WBVA 2WKMA 3UIXA 4BR3A 3ZLSA 4BCPA 2UZBA 4DFYA 3QA0A 3PA4A 5G6VA 4IM3A 3QCQA 2G2HA 5GIOE 2UV2A 3BKBA 4XRLA 3U87A 1H1WA 1GAGA 5HE1A 4D58A 3CQEA 5HVKA 1H8FA 2FVDA 2PWLA 3TACA 2X8EA 2X81A 1Y8YA 3GBZA 5IEVA 2XCHA 5K4IA 3IQ7A 3HV3A 2YFXA 3PWYA 4FZAB 1XBAA 1BUHA 4NM5A 4BDCA 4DFXE 4EYMA 2GQGA 3HA6A 4DEGA 3W2CA 3UNZA 4AFJA 2EU9A 5HBJA 5JN2A 2Y9QA 4FKGA 2BDWA 2WMUA 4DLJA 4B4LA 4QYGA 3KN5A 3F6XA 2CJMA 3NUYA 3VJNA 2WTCA 1B39A 3VUDA 5E8VA 1XH8A 3LFDA 4BVUA 4UYNA 4EK8A 4BF2A 5E8TA 4F6UA 3QF9A 4E4MA 5EM7A 3TV6A 5LMKA 4OTIA 4PF4A 3KXZA 4JQ7A 3UNKA 5BX0A 2PMIA 4I5CA 2VTTA 1JSUA 2VZ6A 3R0TA 4IMYA 3FMNA 2Y6OA 4BDIA 1XH4A 2XJ0A 3QD3A 2PVLA 2BTSA 2V5QA 4GG7A 3ULIA 2GNJA 3I5NA 3K5UA 4JDHA 4N0SA 4AFEA 5IQGA 2NRYA 3CP9A 4HYSA 4BL1A 4LYNA 4MQ1A 5DVRA 3F69A 3P4KA 4DGMA 2CNQA 1PY5A 4FSZA 3KGAA 2X2MA 3DAEA
chains in the Genus database with same CATH superfamily
3ZHPC 3NCZA 1WBOA 1ZXEA 4UMUA 5FUTA 2QU6A 3QD0A 5EHYA 2REIA 3BYOA 3TJCA 5FXRA 1A06A 4IX6A 3KRXA 4KS7A 4EEVA 4PP7A 2PZPA 4YR8A 3K5VA 5CXZA 3TI1A 3H9RA 4OUCA 4ANSA 4QP2A 3AKKA 2WFYA 1PXJA 2OIDA 3AC2A 4IWPA 4FIJA 2OJFE 2PE1A 1JKKA 3S4QA 3ZSIA 5I0BA 4AAYA 2VWZA 2YEXA 3F9NA 3O7LB 2UUEA 3F66A 3FMMA 4JDJA 3LZBA 3PJ2A 1F0QA 2XUUA 4K33A 3W33A 5CT7A 3KC3A 5K5NA 3D7TA 5CSXA 5CVGA 4YHFA 4RQKA 3UO5A 3NUXA 4KBCA 4EH4A 2F7EE 1UNGA 4OBPA 1OPKA 3GQIA 4PPBA 4PRJA 4PY1A 4D0WA 4WOVA 3DTCA 1FMOE 4GW8A 4AUAA 3U4WA 2O3PA 4H58A 2OI4X 4PMTA 2WEIA 4UMTA 4IFCA 3MFTA 5FTGA 4XBRA 5AX3A 3NFFB 2PULA 4FTOA 2CN8A 1H1RA 2ZB1A 4E4NA 3UBDA 1WZYA 3HUBA 4HNFA 4UEUA 4Y46A 3FYJX 2UZUE 4IB3A 3OWLA 1YVJA 4HVDA 2UZDA 1GY3A 3SQQA 3FKNA 4YLKA 5AIRA 2PUNA 4HYIA 4RBLA 4HVSA 5JZNA 3PZHA 4F7JA 2ITOA 2VTOA 2O64A 4HYHA 5CTPA 3VS0A 3LM5A 3BBTB 4EKLA 4DH8A 4G5JA 5CEKA 5LVLA 4BN1A 3B8RA 4QMLA 2C6KA 4XH6A 1OKVA 4O4EA 5CU0A 2HWOA 3OW4A 5CENA 3TIZA 3Q60A 2X4FA 3QZHA 5CAUA 3CJFA 1QPDA 4OAUC 4G5PA 2W1ZA 1PF8A 3ORNA 2YIQA 3UP2A 4OT6A 2R3OA 4Y8DA 2P4IA 1MUOA 2UVYA 1STCE 3C4FA 3ZEWA 4FTRA 3PPJA 2QCSA 1E9HA 3FL4A 4DA5A 4QTEA 2XIYA 3CTJA 5H9BA 4FJVA 3NVKI 2J50A 3KCKA 5A14A 5JFWA 3VW8A 5DRBA 2PL0A 5AM6A 4APCA 3R1YA 5FDXA 5M57A 3AT2A 3C1XA 3DBCA 1YDSE 5EK7A 3GU5A 3MTFA 4A9UA 5EM5A 3PXKA 5A6OA 3DCVA 4CG9A 3FYKX 3Q4UA 1Q8ZA 3D5VA 2YM8A 5IEYA 2CKPA 2QLUA 3KB7A 2RGPA 3DBFA 4ZIMA 2XF0A 2BPMA 2XYNA 4MXOA 2OZAA 4P7EA 4FL3A 4FT0A 3RWPA 4GT3A 4H1MA 3SC1A 4EOSA 5KKRC 5E9EA 5LVMA 4U44A 4OR5A 3K2LA 2W96B 4ITJA 4ANNA 4F1MA 4X3FC 4O1PA 3RPSA 3EN9A 2XBAA 3HKOA 4C58A 5C03A 5F1ZA 4D1XA 3QALE 5HE2A 2PVYA 5KE0A 2YIXA 4IADA 5GHVA 4DG3E 5K4JA 3TM0A 3B2WA 3G0FA 3TTJA 4LOOA 4ANLA 5AR4A 1TQIA 4R78A 4LUEA 3A7FA 1HOWA 4H3PA 4JX3A 3UIBA 2VU3A 1P4FA 4G16A 4L45A 3HV6A 4EOLA 3IONA 3DXPA 4KAOA 4GK4A 2WQMA 4ANMA 3VWAA 1MP8A 3PSDA 4EH7A 2X9FA 4FV5A 5F20A 4ITHA 1SVEA 3IO7A 3AQVA 3FSKA 3UPXA 4G31A 4CQEA 5J7BA 3WF8A 3DK7A 2VAGA 4BB4A 4OTWA 3OBGA 4CFUA 2EB3A 2X8DA 3ZC6A 3MYGA 4JVGA 1G5SA 3PJCA 5A6NA 3QUPA 4FSRA 2XBJA 2JDOA 3AKLA 3PIYA 2O63A 3E87A 2VTRA 5AV3A 1VLRA 4PWNA 2OXDA 3KK9A 5HORA 3H4JA 4OBQA 4QMOA 4U80A 4O0RA 4E4XA 4F7NA 4TL0A 5IPJA 3DFAA 4QMSA 4Q5EA 3FLNC 1PMEA 3T8OA 5F9EA 5GNKA 3W8QA 4M3QA 2VX0A 4F64A 4YJRA 4NT4A 5J9YA 2RIOA 3TNIA 2C47A 3F82A 4YUQA 2ZMDA 3PLAE 2EUFB 3QU0A 4UWBA 3QQKA 4U79A 2IW9A 2VO0A 3CEKA 5HNIX 3QA8A 3UC3A 4F7SA 3NUUA 4D5KA 3HV5A 3FL5A 5CQWA 4FT3A 1APME 4X2FA 2W5BA 2XANA 4IH8A 5BYLA 4IDTA 2OJ9A 2IN6A 5IQDA 3CTQA 5A4LA 4XG9A 2O0UA 3ZO4A 2ZFYA 3SW4A 3EQHA 4LV7A 4RWIA 1QPJA 3R1NA 5CZIA 4E8AA 1JKLA 2R3HA 3W2QA 1YOMA 4IAAA 4DGNA 4YLJA 3R9NA 3FQSA 1W7HA 3OD6X 4PMSA 4XLIA 5AV2A 5K3YA 3BL9A 4A9TA 4L7FA 3UGCA 4QP4A 3IG7A 5EI2A 3VONA 3ZLXA 3MB6A 3KMUA 3DJ5A 4C02A 4KKHA 4D28A 5IA0A 3P78A 4RX9A 5CAVA 4QNYA 5FXQA 4BCFA 3FXXA 2HY0A 4XYFA 4FKLA 3AXWA 3OROA 4O2ZA 4QTCA 3GT8A 3TXOA 3FZSA 3ZSHA 4CCUA 3W0NA 4R3RA 4DHIB 4BCJA 1ERKA 3PVGA 4QMXA 5JH6A 1CM8A 1H0VA 3NIEA 4MD8E 4A4OA 4EQCA 5IQHA 4WSYA 2BROA 2YLEA 4EHVA 4ZMEA 2JKKA 2F9GA 5D41A 5FEQA 4ORKA 4L53A 1M17A 4U97A 4ZLOA 2G1TA 4U81A 3N4TA 4FEUA 2PVHA 4RX8A 4RIXB 5BVEA 4CYIA 1M7NA 2OZOA 4QMTA 5A3XA 4AE6A 1MRYA 4CSVA 3H3CA 1NW1A 4E6QA 3HAVA 3PRIA 5FLFA 5HIDA 2C0TA 5IG1A 4E6AA 4MWIA 5DI1A 2BCJA 4IZ7A 3DKCA 3DPKA 3OTUA 3C4EA 4JRVA 3T3VA 2VO7A 5D11A 4D2VA 5J9ZA 1KOAA 1U54B 5HO7A 2HELA 1Q24A 2CKOA 3VBYA 3WIGA 5ETCA 2OJJA 3MPMA 4G6NA 3L8XA 5M55A 4CVAA 3GOPA 1FINA 2UVZA 4FTNA 4KBAA 5I9VA 3R28A 4P4CA 2GHLA 1UA2A 5CEPA 4FV6A 5IDNA 2PVFA 3QHWA 4BGGA 2P33A 3TDVA 1JAMA 2W7XA 4WBOA 1DAWA 4IFGA 2BAQA 4WRGA 4NL0A 3MA3A 5IQCA 2H9VA 4BDFA 4RIYA 2YM3A 1TFFA 1FOTA 1YWNA 5L4QA 3PXFA 3DTWA 4YLLA 2BIYA 2F49A 2VTPA 3HEGA 3KF4A 3WE4A 2HXLA 2GNLA 4E26A 4QDVA 3W0QA 2G9XA 3FQHA 4UWCA 4FV1A 3BWJA 4I6BA 4FGRA 3D7ZA 4O0TA 2CGVA 3U6JA 2PHKA 4BDBA 5HCZA 2GTMA 4O2PA 3U4UA 3ORLA 5I9ZA 3I7CA 5J1VA 3W8LA 2IF8A 4RZVA 4FTQA 4AF3A 2PTKA 3F7WA 1XQZA 4LM5A 1OIRA 4C0TA 3KXXA 1OL5A 3PVWA 3OVVA 3WIKA 1R78A 4QDEA 1OB3A 1FGKA 1PXIA 2PYWA 4ZP5A 5FP5A 3U9CA 1TKIA 3OCBA 4L7SA 2WOUA 4JI9A 4AA4A 2ZDUA 2IW6A 3CE3A 3TG1A 4FBXA 3BLQA 3R7IA 3VJOA 4A4XA 1BKXA 2JD5A 2JLDA 2QVSE 5CANA 5LWNA 2B1PA 3BQCA 4UZHA 3T9TA 2PVJA 4AOJA 5CZHA 2XNNA 3DAKA 3BYMA 3FPMA 4FTTA 3DGKA 4LG4A 4Z9LA 3ZO2A 3D15A 4IE9A 4O7ZA 2OKRA 2Y6MA 4U45A 5M08A 2FO0A 2WXVA 1U4DA 3QTXA 4I20A 4QYHA 3RBWA 1WBWA 4AQCA 4JJRA 2C3KA 3LFQA 1JVPP 4NW6A 5CF6A 4AZTA 5AX9A 5HE3A 2WGJA 5E1EA 4DC2A 1YOLA 2I0YA 3UZPA 1Y6BA 3PY0A 2XP2A 3EN6A 3ORXA 4M0ZA 4B7TA 2BFYA 4ONAA 4C2WA 4E93A 5HU3A 4E4LA 4F6SA 5IH5A 3GU4A 4UALA 3O8TA 4NSTA 3D0EA 3EQDA 3F5PA 4NCTA 2H34A 4O27B 4ACGA 3AD6A 2VO6A 1R3CA 3MS9A 2J6MA 3FI4A 3MPAA 4GG5A 4PMMA 3VAPA 3SLSA 3MVLA 1Q8TA 3G5DA 3T3UA 4BCKA 3EQBA 3R1SA 2VGOA 4C61A 4FKVA 5M44A 5HE0A 4QQTA 2X0OA 1YHWA 4KIKB 4OTHA 2XM9A 3C51A 4LL5A 4RJ6A 4RGJA 3C5IA 4G9CA 4BTKA 3GC8A 4L43A 2QOOA 4UX9A 4JNWA 2PZ5A 4ZSEA 2V62A 4O0VA 4CV8A 2UZOA 2P0CA 1J7IA 1OL2A 3OFMA 5FRIA 2GU8A 2IVVA 1SNUA 5DBXA 3SVVA 5CSHA 3V3VA 4FRFA 4MNEA 3O17A 3BX5A 2HENA 4JBPA 4L44A 3HGKA 4YU2A 4OT5A 4C62A 4DFBA 3ZU7A 3QTSA 4YZNA 2IO6A 1JSTA 3IDBA 4BDAA 4FVRA 1YXVA 4J98A 2X2LA 3SRVA 2BDJA 2ITZA 2OFUA 2XIZA 2B9FA 4EHZA 1SZMA 1Q3WA 4GFGA 5JGDA 4RQVA 5A54A 3VUMA 4EBWA 3LFBA 4FGBA 2RG6A 4JR7A 3HP5A 3MB7A 4NKSA 4CKRA 3CQWA 4E5AX 3MY5A 4J96A 4F9YA 5I5ZA 2E9PA 4KRDA 3R02A 4ZJJA 3ULZA 3BHHA 2JDRA 1WBNA 2A19B 4O82A 2J0IA 3COHA 1QL6A 3NUNA 4TWNA 3LQ5A 4U3YA 3C4XA 5HGIA 1QCFA 3OWJA 3SXFA 4DGOA 3GU6A 4EK5A 4ZY4A 3R83A 4FICA 3LKMA 4M0YA 4OTFA 4P2KA 1VZOA 4W9WA 4F9WA 2V55A 4FTAA 4MQ2A 3OS3A 4ZJIA 3ZRLA 4GVJA 4DBNA 4EWHA 1YXSA 2ITNA 2PMOX 1XHAA 5GINE 1PHKA 3EKKA 4FSQA 4HPUE 4V04A 3WZUA 5A9UA 2UW9A 3OP5A 4HJOA 4F7LA 4DHFA 4Y73A 4C4FA 3BLRA 2J2IB 4U0IA 5DH3A 2WMSA 2CGWA 2ZV8A 5AM7A 2R5TA 5CNOA 4DH5A 5BV3A 3DJ6A 3PWDA 1SNXA 3PE1A 4G3FA 4O7LA 2PUUA 1TQMA 3NEWA 4TRLA 3PLSA 2YHVA 3NYXA 3G90X 1BL7A 4KUJA 2WOTA 2O2UA 2ESMA 4G6OA 4IAZA 5DN3A 4J7BA 1PJKA 4D5HA 3DB6A 4FV4A 4W4VA 3CXWA 4EL9A 5CAQA 3VNTA 1K2PA 4OTQA 3E3PA 3OMVA 4AE9A 5KZIA 2ZDTA 1I44A 1WCCA 4FTMA 4XP3A 5AP6A 2CGXA 3JXWA 1T46A 4OTGA 4C7TA 3EQGA 1YHSA 4TWPA 4MXXA 4D2RA 2BR1A 4CMUA 2PU8A 4QP1A 5EOLA 3TUDA 4AQKA 2RL5A 3VIDA 4Z16A 2XRUA 3QFVA 5JGBA 5CX9A 2UW6A 3PZEA 5CU4A 3UOKA 4HPTE 4TYGA 3I5ZA 5A4QA 4BJJB 5DIAA 4O0YA 4A9SA 2J5FA 3NYVA 1XH7A 2ETMA 2IZUA 2QOFA 2R9SA 4XP2A 4DTBA 3MGYA 1ZYSA 2WMBA 2JEDA 3UVPA 4YC3A 4C3RA 5BVOA 4J71A 2QO2A 4RC4A 1YXUA 3QQHA 4R1VA 4BBFA 4G2FA 3VS6A 4O4DA 3F61A 2VTLA 4D4RA 3FMLA 5IQIA 4FIHA 4GYIA 4D4YA 4DFNA 3LLTA 4A4LA 4A7CA 4O7VA 2W1HA 4IB0A 4WA9A 2VUWA 4ANBA 4BTFA 3D5UA 3U55A 2C1BA 4MBLA 5EI8A 2ZYBA 4ANQA 2OBJA 3KF7A 4L00A 5TT7A 4B8LA 2W1FA 3EYGA 2QONA 4A9YA 4BC6A 5E8YA 2W0JA 4YNOA 4ZOGA 2WMQA 5CF5A 2YERA 3POZA 2OH0E 2FGIA 2IZSA 2RFDA 4U42A 5M4FA 4ID7A 3DNDA 1WFCA 2YZAA 4W4XA 4WO5A 1YHVA 2Z8CA 3GCUA 3AMAA 3PJ1A 5CI6A 4QQJA 2X8IA 2VTJA 4QNAA 5AIKA 4IZ5A 5J5TA 4AGWA 2JFLA 3OG7A 2UZEA 2B9IA 4WBBB 2YDJA 3DT1A 4FK6A 4S32A 4JLCA 2FUMA 4J1RA 4MKCA 4AW2A 4FNYA 5L2QA 3EYHA 1IA9A 4FEQA 4ZLYA 3FXZA 1G8JA 4KWPA 2JGZA 2WHBA 4S2ZA 4U43A 3SG8A 4YJQA 4II5A 4CFMA 2C6LA 4FKOA 2IEWA 2WB8A 3V01A 3HMOA 1UKIA 3FBVA 4ZS0A 2C6MA 5DR9A 2PK9A 3W10A 1UV5A 2PVRA 4LUDA 2UZTA 3BLHA 2GNGA 3FE3A 3FC1X 4EI4A 1PXNA 3M42A 5CF4A 4WD5A 5AUYA 4YURA 4IX3A 5DNRA 5BUIA 3FZRA 4DH3A 2XNBA 2W5AA 4NJ3A 2GS7A 3HRFA 2CGUA 5AP2A 3DZQA 1DS5A 3Q4TA 4GSBA 4UBAA 3SOCA 1H25A 4C4HA 5B0XA 3W18A 4X0MA 2XEZA 4ZSJA 4AWIA 3IOPA 5FEDA 3R9RA 1FGIA 3RCDA 1IRKA 5LMAA 3F3VA 4ERKA 3ZONA 3GC0A 1FMKA 2G01A 3WARA 4Z55A 4L67A 2JFMA 3TDWA 3UOLA 5DPVA 5EI6A 5EKNA 3KXHA 2YCSA 4RJ4A 1ATPE 2GFSA 3AC5A 4PNIA 4R6VA 4I6HA 3ZUUA 3MI9A 4CT1A 4CV9A 4C4IA 2BZKB 1YDTE 5ANIA 3O8UA 3QZGA 2B55A 3PJ3A 4KB8A 4O84A 1PYXA 2H96A 5BNJA 3TZ9A 2I40A 2J5EA 4YZDA 2FA2A 3I79A 4JRNA 4QPMA 4B9DA 2C0OA 4U40A 3EQCA 5I3OA 3HRBA 1O6LA 1XH6A 2UZNA 3C5UA 3E93A 1UU9A 1GZKA 1R39A 2P3GX 3DOGA 3LOKA 2YWPA 4FKJA 3SX9A 3UE4A 2ZM3A 5J9LA 2Z7RA 1M52A 3V5QA 2Z7LA 1KE6A 3BIZA 1T45A 3UVQA 3UQFA 2QOHA 3P86A 1JOWB 3BHVA 4EOJA 3BLAA 4C4GA 2YIRA 4EC8A 3S3IA 4KSQA 3FJQE 4G3DA 3CQUA 1YWVA 4WUNA 4FODA 4RFYA 4JIKA 3RP9A 3SD0A 5L2SA 3BGPA 5ANJA 2QKRA 1Y6AA 2WTKC 4EH2A 5FBNC 3EFLA 4O7SA 3DA6A 3PXRA 4G9RA 1OKZA 5J7HA 4DHJA 4BZDA 3RAKA 3ZXZA 4DYMA 1ZMUA 3OC1A 3QYWA 3TNPC 2VTNA 3BQRA 1QPEA 3ZDUA 3OTVA 3OY1A 4DT8A 1XKKA 2ERKA 3MV5A 5BQ0A 5ETFA 3MESA 2E9OA 3HUCA 5K0XA 4UXQA 5L6PA 2QURA 4GH2A 5EQEA 5L6WL 3W0MA 3P0MA 3C9WA 4Q2AA 4YBJA 3R7UA 4OLIA 4D9UA 3FHIA 4AGUA 5HG8A 5C4KA 5M4IA 3WZKA 2OIQA 2IZRA 3R8PA 5IISA 3KREA 3QUEA 3A4PA 1SVHA 4QYEA 2YABA 4PL5A 3QL8A 3TN8A 4Z7GA 1GOLA 4OTRA 1Q62A 4CEGA 3ORZA 4FKRA 4XOZA 5CNNA 3O71A 3ZRMA 4CCBA 5JFXA 2BZJA 4NIFB 3DBEA 4F6WA 4O7NA 2HOGA 2PMLX 4RX7A 3RI1A 4MXZA 4AS0A 2B0QA 2BILB 3GU7A 3H0ZA 4O22A 4JQ8A 2DUVA 1BYGA 3MJ1A 4PL4A 1JKTA 5JEBA 2QG7A 2BRGA 4NW5A 1H08A 4XCUA 5K5XA 2Q0BA 3MY0A 4AP7A 5AWMA 4C36A 1H01A 5C27A 3BV3A 5HU9A 4XV2A 3FZOA 3MBLA 3K3IA 4W4YA 5AAGA 1WVXA 5JGAA 4O7YA 3OOGA 3NRMA 5E8ZA 3M1SA 1UU7A 3SW7A 2XAOA 4AX8A 3KRRA 5CU3A 2QOQA 3RINA 5DRDA 4WNKA 4CKJA 3WF6A 4AXCA 1B38A 4U8ZA 5L8JA 4GYGA 3BGQA 4I92A 5HEZA 4UN0C 2HXQA 3R9DA 2UW7A 4BDGA 3DK6A 1ZARA 5FQDC 3QCXA 4E1ZA 3TZ8A 2VRXA 2QOLA 4PDPA 4EJNA 2QO7A 2BKZA 1M2QA 4YP8A 4WIHA 5EM6A 4FC0A 4MK0A 3BZ3A 2C6TA 3VUTA 1HCKA 1ZY5A 3MVMA 4GT4A 4EZ3A 4R8QA 5BYZA 4N57A 3UDTA 3MH3A 3QWJA 4AU8A 3L9MA 2GTNA 4RLLA 4ZTSA 4AZSA 3V8WA 4BIEA 2HIWA 2XK7A 2VD5A 1WBSA 4CRSA 2ONLA 4FYNA 4Y85A 2OIBA 3EN5A 2YA9A 1ZY4A 2ZB0A 2WPAA 2C6IA 3D83A 5IA2A 1OBGA 4NK9A 4RVLA 4FG9A 2ZV9A 2GFCA 5D10A 1PW2A 3UTOA 2WTWA 2XIXA 3OT8A 3W2PA 3KA0A 4QTAA 4AG8A 1W2CA 2PMNX 2XNGA 3B8QA 4U5JA 3OBJA 4I6LA 3ZO3A 4ZJVA 4J99A 1U54A 3GEQA 4BI2A 4RX5A 2VX1A 3LVPA 3FEGA 1OGUA 3FMKA 1NT2A 4DT9A 5GZ9A 3LFFA 3ZMMA 5GZAA 3LPBA 2E9NA 4UMQA 3LXNA 2A0CX 4P90A 1UU3A 3ACKA 4QMYA 4J53A 3VBTA 3OUKA 5HIEA 4BI1A 1P5EA 3Q2JA 4LOPA 3RPVA 4AT4A 4DEBA 4OTDA 2VV9A 4Q5HA 2ETRA 4FKUA 2RSVA 1OL1A 4EYJA 4U6RA 4QPAA 5FBOA 5EW3A 5IH4A 3A62A 3IGOA 3LCOA 4JG6A 2C1AA 3QTUA 1XMMA 5JRQA 4GFMA 3HAMA 3ZEPA 5FD2A 3G6GA 4FSTA 2DYLA 5LMKC 4HOKA 5ANKA 4FNXA 4I5PA 1CDKA 3DLSA 3L8SA 2WQNA 3ANQA 5JMSA 3LFNA 2XAMA 1Y91A 1UVRA 4YJOA 2C5XA 4YZ9A 2Z2WA 4Y95A 2HY81 3GFWA 5HCYA 4S30A 4O81A 4AN9A 4IIRA 4WG5A 5CSPA 3QHRA 3LXLA 2B9HA 4YTIA 4IVBA 4TN6A 4FSMA 4HGTA 2EXEA 3FZPA 3KEXA 2BRBA 3R8UA 4BCIA 3QLGA 1S9IA 1Y8GA 2LGCA 4O6LA 4YPDA 4ZS4A 2VWVA 3HZTA 3CIKA 1IR3A 3AMBA 2V7OA 2W4OA 5AEPA 4IVDA 5IZFA 4HCTA 4J8MA 4OGRA 2PZYA 4YZBA 1GZOA 3KXMA 3NR9A 2J0KA 3O2MA 4ASZA 4K6ZA 2I0EA 3O7LD 2YDKA 3FLZA 2ZJWA 1JLUE 4AZVA 4AA5A 4O83A 5FP6A 4BHNA 3OEZA 4FI1A 1QPCA 3MA6A 5KMLA 4M14A 3EQPA 3S2PA 4F63A 4CQGA 2PVKA 2VTMA 5FTQA 4ZZNA 4F1OA 4USDA 1K9AA 3ALOA 4KNBA 4BFMA 4DN5A 3Q9WA 4QP9A 4EK6A 1J7UA 3FKOA 3UVRA 3WOWA 4KKGA 4DG2E 4XV9A 3E3BX 4M7IA 3RWQA 1IAHA 3DQXA 3FLYA 4RVTA 2QODA 3TV4A 1OIUA 4WT6A 2VWYA 3NYOA 3PPZA 2O65A 4ARKA 2FH9A 4CKIA 4EOMA 4QD6A 5TOZA 5FM2A 3UIMA 1V0OA 3ZC5A 4F65A 3QQJA 4AW0A 4C37A 3PDTA 4FV0A 3LCTA 3UMXA 3JYAA 4AZWA 2J0JA 3HVCA 4NM7A 3WZJA 3W16A 4C4EA 2GDOA 1Q5KA 3A60A 3BRBA 4QPSA 4RC3A 5KMOA 3BHYA 2QOCA 2CLXA 2WQEA 3F2RA 1JPAA 1NVSA 3Q4ZA 5CLPA 4S33A 3GCVA 4NYEA 5EDQA 5DFPA 3NDMA 4LFIA 4NU1A 4BKZA 5KHXA 1WMKA 4LL0A 4J97A 3ORMA 4ALWA 3EL7A 3DS6A 4D2TA 5L2TA 4GIIA 4H3QA 2NPQA 2VWXA 2OWBA 2SRCA 3UYTA 5AUTA 3F2NA 3E8EA 2IWIA 3EH9A 3UOJA 4IW0A 4BCMA 1YXTA 4EOKA 3MN3A 4BDJA 4LMUA 3Q5IA 4YSJA 2Z02A 3EQFA 4XJ0A 3ZSGA 2UW8A 2WMTA 4AGCA 4EZ7A 2VWBA 3M2WA 1P2AA 4C33A 3UDZA 1DI9A 3NNWA 4X2JA 4XRJA 3UG2A 1MRVA 4EOIA 1FBNA 3QYZA 2ITQA 4DEIA 3D5WA 4IWQA 5KKRB 3EB0A 3QD4A 3FUPA 1XWSA 2ZAZA 3CGOA 4GK2A 3WZEA 3V5JA 4X3FB 4FYOA 4F9BA 4IVAA 3I60A 4YBKA 3TWJA 4WNPA 3DDQA 3G9LX 2QG5A 1PRYA 4IQ6A 3NX8A 4G17A 5DA3A 4F1TA 2BVAA 5CSVA 3V04A 2B54A 4K77A 4I0RA 3R7GA 5JQ5A 2AEGA 5IU2A 5BUEA 3G6HA 2NNWB 4FX3A 3Q52A 3HA8A 4YJPA 5E90A 4G6LA 5I9UA 3F3TA 3NIZA 2RKUA 3CLYA 1W98A 4X3JA 2YLFA 2ETKA 3GQLA 4CFVA 5ACBC 1PKGA 3R2YA 4FZ7A 2BIKB 4BKJA 3JY0A 3ZYAA 3NMUF 3C7QA 4Q9SA 2C6OA 3L8VA 4LGGA 3O51A 4RZWA 1JQHA 3P23A 4C4JA 2XKEA 4DLIA 3A7HA 2NYAA 3G51A 3QRJA 5DHJA 4EJ7A 2PY3A 2OSCA 3LCSA 5K0KA 4KABA 3DU8A 1KE9A 4MHAA 4UY9A 4X21A 5DR2A 2A98A 3FXWA 4HGEA 2W1GA 3FPQA 3ZLWA 5TO8A 4RJ3A 3P7AA 1G8SA 5HBHA 4DINA 5C8NA 4AGDA 3VRYA 4OTPA 5CU2A 3BE9A 3TUBA 2IVUA 4XV3A 2DQ7X 3QRIA 1OKWA 2J7TA 5EH0A 3ZM9A 1ZOEA 2XK6A 1Q8UA 2XM8A 4DEAA 3LIJA 5EQPA 1MQBA 2C5YA 3CD8A 4BIDA 3DJ7A 4W8DA 3FWQA 4FZDB 3V6RA 3ZDIA 5F4NA 3E62A 3FV8A 5CXHA 3PPKA 3MVJA 5JKGA 5DG5A 3BE2A 4FTLA 1OMWA 1JNKA 3A8XA 4GUBA 2A27A 5CSWA 2PUIA 4OBOA 3BV2A 2XK4A 2ERZE 3H9OA 4X6QC 4ZTNA 5JQ8A 4Y83A 3QTIA 3E64A 2BAJA 2XNEA 4TYHB 1ST0A 2IJMA 3GCQA 5HVJA 4K18A 1L3RE 1U59A 3QZFA 2FYSA 2F7ZE 3CS9A 5AP4A 3EZRA 2P55A 1G8KA 4MEDA 2GMXA 2J0LA 3UZRA 2YWVA 2R64A 3HRCA 4O4FA 5CQUA 3VULA 1BX6A 2ZV2A 3NW7A 3AC1A 5IUHA 4IJ9A 2CNVA 5ETIA 1RE8A 3QCSA 2W4JA 3F88A 5M51A 4IAKA 4PTEA 2R3GA 1AQ1A 2KTYA 2E9UA 3SKCA 3AGLA 3HECA 3OCGA 4AN2A 4F99A 4L9IA 5HD4A 3FI3A 4TY1A 5DYJA 2YCQA 5DGZA 5C8MA 3QAME 4HVIA 4ASXA 3R01A 3RVGA 2R3NA 3PJ8A 3LFCA 5TF9A 3ORPA 4D4VA 1WVWA 1OBDA 3LAUA 4DH7A 2GCDA 3RKBA 4L6QA 5E92A 2YDIA 2FB8A 3MSSA 4QP7A 4TYJA 4BGQA 4PDOA 4FSNA 1SMHA 3RM7A 3S00A 5AUWA 4EH6A 1I09A 2IW8A 4ZSLA 4FNZA 4IDVA 1IA8A 3P1AA 3QUDA 4O38A 3W55A 3QWKA 3G33A 5KBRA 3HNGA 4PPCA 4AOTA 3OXIA 4JBOA 1TVOA 4KIQA 4F4PA 5E4HA 3NAXA 1XMLA 5D12A 3AT3A 4F9CA 5IA1A 3V8TA 1KV1A 2YM6A 2F4JA 3PVBA 3CCNA 3ZZWA 2Y4IC 4FTUA 2HW7A 3ELJA 3FAAA 5HD7A 1JBPE 3P08A 3REPA 3Q6WA 4FF8A 5I9YA 4FR4A 3DDPA 3RPYA 1YWRA 2CKQA 4BZOA 4YSMA 5TR6A 2GS2A 3PA5A 4BCGA 2P2HA 5I9XA 4G3CA 2XJ2A 4I0TA