2A1AB

Pkr kinase domain-eif2alpha complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
269
Chain Sequence
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 84
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a1aB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a1aB01
4IAKA 4AE6A 3IKAA 2PPQA 1MQ4A 4QPMA 1BUHA 2ETRA 5EHOA 3QGYA 3T3VA 2I1MA 2WU7A 5FD2A 2PWLA 2XIZA 4WRGA 4IHPA 2JGZA 5CZHA 1KE8A 4DTBA 4P4CA 3G6HA 4R3PA 4WKQA 2FVDA 4CLIA 5CALA 5AR4A 2Z02A 3OZ6A 4QMQA 4YHFA 2WAJA 3GENA 2R3FA 5HX6A 2X81A 4G6LA 5JKGA 3BBWA 2VO3A 5FTQA 3MWUA 2VWIA 3D94A 3G0EA 2C5XA 5C8MA 4WA9A 1KE5A 2OF4A 4RLLA 3TKIA 3DBQA 2NRYA 1JOWB 2Y7JA 2AYPA 1QPJA 3LCSA 5IQIA 3NMUF 3LXLA 2PVHA 4O0UA 4Q9SA 4A4OA 3CKWA 5D12A 4AOIA 3MA6A 2BZKB 3TKHA 4LOPA 4GUEA 3JVRA 3FBVA 1XHAA 3WF6A 1Y6BA 4MVFA 5LVPA 4HJOA 5IEYA 4KS8A 5DHJA 4OAUC 3KY2A 4UALA 4NJDA 4BCIA 3BU3A 2YA9A 4IM3A 2VO0A 4DG2E 3FC1X 1NY3A 3WI6A 1JKSA 4J53A 3QZFA 1S9JA 1OL1A 2XKFA 3CTJA 2R7IA 4CZYB 1Q8UA 4QTAA 3GC0A 2VTNA 1PXPA 2X2LA 4IWPA 2HZIA 5D1JA 2EWAA 4TRLA 3VUIA 3MYGA 4W4VA 1G5SA 1VJYA 3SGCA 3ITZA 4EZ3A 2GNHA 2DWBA 3ODZX 5AR3A 4KIPA 4FEQA 4TTHB 3TNPC 5AWMA 5DOSA 2RFSA 5HX8A 4O7NA 2OW3A 4IDVA 5FEQA 4AZEA 2QNJA 5TR6A 2ZYBA 3W55A 2Y0AA 4O27B 3U55A 2Z7RA 2C6LA 3EIDA 3BX5A 1ZY5A 2XS0A 4O7LA 3QKMA 3UOKA 3FZPA 3NCGA 2B7AA 4U0IA 3AT2A 3LFFA 2WMBA 3HUBA 4NWMA 3OWKA 4J1RA 3V3VA 2GNJA 5AUTA 2HYYA 5KMIA 3L9LA 4BTKA 4HVSA 3G9NA 3G51A 2V55A 3GUBA 3MFUA 3Q2MA 1OECA 2BDFA 1FINA 2YM8A 3RNIA 4EQMA 3KRWA 4JXFA 2CN8A 1J7UA 2XNGA 5I4NA 2ZMDA 3R7OA 4EWQA 3BYUA 4KRCA 3HA6A 4ZMFA 2XMYA 3UODA 2CPKE 2VX0A 4YTHA 3V5JA 2HAKA 3LJ1A 1ZOHA 3AD5A 4L01A 2X8IA 3RPRA 4IFCA 1QL6A 3HMMA 1GIJA 2BVAA 4JG8A 2OF2A 3OY1A 2IZRA 3BHTA 3DKGA 4BKZA 4F1OA 3EN5A 3KQ7A 4E5AX 4O0XA 5E4HA 4FSUA 4I3ZA 4M69A 5AV2A 4BZNA 4G5PA 2GHLA 3O50A 3FLYA 4ZTRA 3KXMA 5I3OA 4G3EA 3UNJA 3N9XA 3F3UA 4IANA 1Q8YA 4USEA 3TIYA 4ANNA 3F2RA 3LOKA 4IVCA 3MB7A 4BTJA 3QBNA 2C5VA 4YLJA 2BFYA 3D2IA 2IW9A 4PMSA 5K5NA 4EH6A 2YEXA 4RIYB 3C5UA 3DBEA 5HI2A 3IW8A 3OCTA 1KWPA 2VTOA 4GT4A 3U4UA 5CVFA 3VRYA 4IQ6A 2CKEA 4K6ZA 3SAYA 3OW3A 4BTFA 4YSJA 3DY7A 1H0VA 2C5OA 2WFYA 3OT3A 3FZTA 4AXAA 5F9EA 4FUYA 4NU1A 1UWJA 4GJ2A 4DTKA 1M52A 2VTSA 4L3PA 3TTIA 4C4FA 2BKKA 2VRXA 3IDCA 2FSTX 3UP7A 4A9SA 2J2IB 4WSQA 2C0OA 1REJA 2PMNX 4BGGA 2XEZA 4F63A 4OUCA 3CCNA 4FIJA 4FZ6A 2PUPA 2QR8A 3FDNA 4KIKB 3HGKA 3R71A 4RLKA 1P2AA 1A48A 4C0TA 3UZRA 4Y95A 3R73A 3R8LA 4X0MA 3GU7A 4R1VA 2PULA 3K2LA 4OGRA 3QTSA 3SC1A 1G3NA 4I5CA 3ATTA 2VTAA 2ITNA 4YU2A 4O7TA 5JGBA 5FEDA 3AC2A 2WMVA 4FSRA 4TWNA 3I81A 1OKZA 4DT9A 5CI6A 5ETFA 4L7FA 3QUEA 3EQGA 3SVVA 4CG8A 2EVAA 1TVOA 1Q3DA 4FIEA 4PDOA 3W2PA 4CLJA 4ZZMA 1PRYA 4QMUA 5E90A 4EYMA 2UZVA 3ZBXA 4YJTA 4FG7A 3RAWA 2I0YA 2OXYA 3E8DA 1H1SA 3EFJA 1BLXA 4D4YA 2YWPA 4HGTA 1ZZLA 2BUJA 5HE3A 3F5GA 4PQNA 3R8ZA 3THBA 4FZ7A 4RA5A 5IA3A 2RKUA 5IQFA 2OJGA 4H36A 4FSYA 5FM2A 4F70A 1VZOA 3C4WA 4IZ7A 3AQVA 3BKBA 5EI2A 2V62A 3N4TA 5A4CA 2HENA 4C3RA 3SOAA 4M0ZA 1NVRA 1U5QA 3QUPA 4FKSA 4U79A 5DR9A 4FKWA 4UXLA 1XQZA 2O5KA 4FTOA 3QQLA 2HZ0A 4JAJA 4JDJA 4L42A 5F1ZA 3V8WA 4B6LA 4C02A 4E3CA 3S0OA 2HW6A 3FZSA 3UIXA 4XJ0A 4AN2A 4OTWA 3QF9A 2VUWA 4K9YA 3VUTA 5TE0A 3VUDA 3OC1A 2X39A 3IDPA 3NUPA 2HOGA 3F6XA 4R7IA 5CWZA 4C4HA 5TF9A 1H4LA 2ERZE 4NTTA 2R3QA 2WEVA 2I0HA 4KIKA 4O1OA 4XG8A 2C0IA 4LGHA 3H4JA 4FKLA 4WSYA 3S2PA 3ZDUA 5JGAA 4FT3A 4AFEA 1IA9A 2J9MA 4D0XA 4ZEGA 3W32A 4H1MA 2GU8A 5GZAA 1WFCA 2HXLA 4O21A 3IGGA 1WMKA 3NVKI 4WD5A 4OTQA 3P08A 3R83A 5ACKA 5JFSA 4QYHA 2XIRA 5CASA 5AUZA 5J1VA 3ENHA 5AV4A 2JIVA 4ACMA 4EEVA 4JL9A 3UG2A 5FLFA 5IQGA 1R0EA 3IOKA 4LRJA 4IJPA 2YM7A 1ZOEA 4M8TA 2OI4X 1YXSA 2OWBA 4WT6A 5HNIX 3CE3A 4NIFA 1JBPE 4H3PA 3RP9A 2XH5A 3VBTA 3QKKA 1ZOGA 4FT9A 3ZHPC 3R1SA 3P23A 4IVBA 4PPBA 5CYIA 4ZMEA 2C6IA 2R3KA 1AD5A 4LRMA 4N0SA 2P33A 4U45A 2R2PA 5C01A 5E8ZA 3I7CA 4TNBA 2UW7A 4E6DA 3BEAA 4U5JA 4J7BA 2P2HA 2BAQA 4E73A 5M4IA 3KXGA 1ERKA 1CKPA 4BVUA 4LYNA 2VWWA 4X21A 2I7QA 4HCTA 3EYGA 4YSMA 2HCKA 3ZO2A 5FGKA 4N6ZA 5HG5A 3QTXA 3DJ6A 3FPMA 4RX5A 3KFAA 4DTAA 1NW1A 4LL0A 5CEOA 3ZRKA 3ZZWA 3CGOA 1G8AA 4E93A 3EQBA 3OBJA 4ZY4A 2G1TA 2J6MA 3UMWA 4AOJA 2UZOA 5CEQA 5IQAA 2OH4A 4TWOA 1U59A 4BWKA 2C1BA 5EQEA 1Q62A 4ZIMA 2XNPA 4ITIA 5F95A 3RCDA 2BRGA 4YTCA 3MY1A 4Q2AA 2QONA 3AC4A 2PZPA 4EOKA 3QYWA 4WRSA 3RGFA 3KXHA 4IH8A 4DINA 1QMZA 1WBWA 2B9JA 2IVVA 3PJ8A 2GDOA 2UW3A 4YC6A 5CTPA 3DLSA 3QXOA 4QTCA 4W4XA 4ASZA 3HDNA 3PIXA 4DEGA 1W98A 3FY2A 5DT4A 4CZTA 3ZMMA 4BDFA 2Y6OA 1OMWA 3AD6A 3ZC5A 2GS7A 4D2VA 3DTCA 3CJGA 1KOBA 5CAQA 2OZOA 2QQ7A 4I93A 4IMYA 5E8VA 3VUKA 4GK2A 4DEIA 3QQHA 2NNWB 2Z60A 3HMOA 1UNHA 1LR4A 2FA2A 2C4GA 3R0TA 4CZUA 4Q9ZA 4FV4A 4JX7A 3CQUA 3CS9A 3VW6A 3ORKA 3ZEPA 2CKQA 3E5AA 4O22A 1CM8A 3NNUA 5DEWA 2E9PA 3W8QA 5JSMA 4QQTA 1XH7A 3HRCA 2J0JA 4DGLC 4BIDA 1W7HA 4FKOA 3DA6A 3FZ1A 4FZFB 3D0EA 2ZM3A 4N57A 3WZUA 4JI9A 2WMTA 2YCFA 5HIBA 3ANQA 3KMMA 3CTHA 4HYIA 3HV3A 4RWJA 4YTIA 5LVNA 3UTOA 4AACA 3E8EA 1S9IA 5C03A 2IWIA 1CKJA 2XK7A 4X6QC 3R8MA 2JAVA 3TZ9A 2R64A 4LI5A 4K18A 2E9NA 1SM2A 3LFBA 3ORPA 3QCXA 4EK4A 4X3FC 3TACA 2J90A 4HYSA 4O84A 3ORXA 4GU6A 5CEMA 4LOQA 1R78A 4I41A 3QAME 4EHZA 3DK3A 4USFA 4EK6A 4ZY5A 3NR9A 1W0XC 4PRJA 4GV1A 3B8RA 5AV1A 4K77A 4F65A 4F08A 3CIKA 3P0MA 3RVGA 3O51A 4HZRA 3ZFMA 4F09A 4ZOGA 4JRVA 3QTWA 3R22A 2B53A 2RFNA 2WU6A 3V51A 3EN6A 3EKNA 4R1YA 5AIRA 3PXQA 3ZLYA 2WTWA 4JBQA 2AC5A 4A9TA 1KOAA 4FSZA 1YRPA 3KVWA 1V1KA 2CKOA 4GG5A 1UA2A 2WHBA 2ZV8A 3ZBFA 5C9CA 1T45A 3MH0A 3DDQA 4U41A 1H26A 5AEPA 1F3MC 4MKCA 2YERA 4ALVA 3LFDA 3ZM4A 3DXQA 2YIYA 2W1ZA 3TKUA 2PVYA 5ETAA 1NXKA 2QO7A 3AC5A 3KXNA 3OCSA 3VW8A 2VTJA 3O96A 1MUOA 3FZOA 4JQEA 3ZONA 4NM5A 3NUAA 5J8IA 3DJ5A 3MH2A 4RQVA 4HVGA 5L6PA 2F2UA 3ORZA 5DNRA 3PG1A 2XBJA 3JUHA 4F6WA 3G90X 2ZAZA 1JKLA 3JR1A 5LMKA 2F7EE 4I6QA 4IX5A 4JVGA 4ZSLA 3A60A 2BIYA 3KXZA 4CYIA 3POZA 3DZOA 4XG4A 3AXWA 2CNQA 4YGAA 2IZSA 2W5HA 3N4UA 4H05A 4GG7A 2C6MA 4I1ZA 4L52A 2GS6A 3B8QA 3ALNA 4OTGA 4GEOA 4RT7A 4FZAB 3TUCA 4QP8A 3CEKA 4IVDA 5K4JA 4I6FA 1PF8A 3BQCA 3R9RA 3GGFA 2RFDA 3NW7A 4E4NA 2F7ZE 4EORA 5EM7A 4ACDA 5JEBA 4FYOA 5JH6A 1M2RA 4GKIA 3LFNA 2AUHA 4YZ9A 2CN5A 4ACHA 2FSMX 4IBMA 4QP2A 4O2PA 2OJIA 3FKNA 4QYEA 4E7WA 3AGMA 4XP2A 3D5UA 4ANMA 3QD3A 3ZM9A 5F94A 3FV8A 3SG8A 5C26A 1YI4A 2WZJA 5A4EA 2PVJA 2BRHA 4BRXA 2WTKC 3DZQA 3F3TA 1F0QA 1MRYA 2X6DA 3II5A 4TZRA 3VHKA 1GNGA 3DTWA 4FG8A 5E8UA 2GTMA 5M4FA 5LCKA 3C4FA 2OZAB 2P0CA 5AP4A 2RG5A 3EZVA 2WPAA 3ZUUA 4QMNA 3WF8A 2PMOX 3V5WA 2R3RA 3F2NA 4XV2A 2CNVA 3NAXA 3VBXA 4MTAA 3FSFA 3GB2A 4F1TA 4L45A 3U6JA 4EC8A 4WNOA 4AUAA 3UP2A 4S33A 4U8ZA 1J7LA 3C0IA 4A7CA 3G6GA 5HVYA 5LARA 3BELA 4CFFA 4YTFA 4CGAA 5AUVA 4XH6A 3D5WA 3O23A 3UZPA 4I20A 4QP4A 5JQ5A 4CVAA 5IQHA 3GFWA 4OTDA 2VV9A 3I60A 5KZ0A 5IF1A 4FKIA 3QRKA 1VR2A 3V8SA 4EYJA 3BU5A 2HIWA 2BMCA 3UOJA 3JPVA 3UQGA 3RNYA 4XUFA 3C4ZA 3ZXTA 2CLQA 1H01A 4IACA 2H6DA 3LJ0A 2XK4A 3TWJA 4FK6A 2CKPA 1XH4A 4F99A 4D9TA 1PXJA 4AF3A 4C58A 4O7RA 2C3KA 5FQDC 4AT5A 3E62A 2JIUA 5A3XA 5TT7A 4JIKA 1PXMA 3ELJA 3COMA 2B9FA 3MH1A 3A61A 5HU9A 3K54A 2W1GA 3QQUA 5C27A 3PRIA 1OIRA 4TYIA 4XP0A 3LFAA 2PY3A 2QURA 2WTCA 3BYMA 4IB3A 5F20A 4BBEA 1JSVA 5D10A 5ETCA 2PE1A 4IX4A 4YLKA 4RX9A 5I0BA 4P5ZA 2B55A 4X2JA 4ZTHA 5AR7A 2C6OA 2YM3A 3A4PA 4ORKA 2F7XE 1LEZA 4LQMA 5DMZA 3OUKA 4TYHA 4PMMA 5FM3A 3SA0A 3BPRA 3P5KA 3TZMA 5HO7A 3PZEA 2PU8A 3DKFA 4FSQA 2JIIA 4DF3A 5AAEA 3DB8A 3GC7A 4L6QA 4YZDA 5LMBA 3G33A 4TYGA 2EXMA 3QTUA 3DDPA 2QVSE 2R7BA 3A7HA 4GT3A 4QQJA 3F69A 5D11A 4F0FA 3E7OA 4AT3A 1JSUA 3QTQA 4GIHA 1UU9A 2R3JA 1U4DA 2W4OA 3DBFA 1G8SA 4YURA 5AAGA 3GP0A 2C3JA 3GOPA 3PA3A 1IEPA 4U42A 3LIJA 2F49A 3KXXA 4DFUA 1XH9A 2CGXA 4DFBA 4C36A 4Y73A 4O0SA 4QYFA 5CU4A 2FB8A 3ROYA 4IX6A 5IDPA 4EBVA 4MCVA 3EQCA 3FI2A 4QTDA 4JG6A 5TKDA 4BDDA 5BQ0A 2ZB0A 3KC3A 3OW4A 4RWIA 2XIYA 2PTKA 1OVEA 3ZFXA 3GBZA 1F5QA 2UZNA 1YI6A 4GKHA 3TZ7A 2BHHA 3VJNA 4DT8A 3WZEA 1U5RA 4FGRA 4G16A 3AD4A 3QTRA 3OXIA 4BN1A 2YIRA 1R3CA 2UZBA 4O0VA 3AMYA 3W10A 3UQFA 3O8UA 2QKWB 2PYWA 4O7YA 5ANEA 1OIQA 2H96A 2C6TA 2EB3A 2J50A 5C4KA 4K0YA 5CU2A 5B0XA 3ZLWA 3CQWA 2Y4IB 4YJSA 2JBOA 5CQWA 5M56A 4BGHA 4KAOA 3VC4A 4DAWA 3BGZA 3IPHA 3NAYA 4DBNA 4ZY6A 2NPQA 3VN9A 4C35A 1W84A 4D1ZA 2R4BA 2X4ZA 1PYEA 4BCJA 4YJVA 3AT3A 2ACXA 1OPLA 2VWUA 3MTLA 5JZNA 5BYZA 3NYNA 4C3FA 4M14A 4NT4A 5IKWA 5B2MA 2XRWA 4ZSAA 4YLLA 3WE4A 4M13A 4GMYA 4CD0A 1JKKA 5LVLA 4ZTSA 4EH9A 4ALWA 3ETAA 4QMTA 4MQ2A 4IWQA 1ZYSA 4GJ3A 3CBLA 1JVPP 1E9HA 3BZ3A 4RVLA 5DWRA 4S30A 4BDAA 3QHWA 2E9OA 4OBPA 2WMQA 3LM0A 4A4LA 4JT3A 4ERWA 4MX9A 3SLSA 5JFXA 2RIOA 5FXSA 3TJDA 2RG6A 5DE2A 3QRJA 1OPKA 2YAKA 3VQUA 4FVQA 4EHEA 4S32A 5CEKA 5CU0A 1B6CB 2YCSA 5ITAA 3MJ2A 2C5YA 3RI1A 2EUFB 4BBFA 3WF9A 3NYVA 4I5MA 4FSTA 2WEIA 3DAEA 4XX9A 4AX8A 3ZRMA 4YO6A 4XYFA 4F9YA 5JZJA 4NM0A 4RX8A 5LQFA 3ZU7A 1KUTA 3HAMA 3C4EA 1R0PA 3ZRLA 5AIKA 5L8LA 3LZBA 3DQXA 4TXCA 2GPHA 3VBQA 1XH6A 2YN8A 3ID6C 4JG7A 3UPXA 1YWNA 5LWNA 4YHJA 1UU8A 5E8YA 3W33A 5M09A 3C4CA 5DA3A 5EW8A 5F4NA 3M11A 3M2WA 4I5HA 2WKMA 4IC7A 5DRBA 4U44A 5HD7A 2C6EA 3H0ZA 2XIKA 4RVTA 4F6UA 3CGFA 3H9FA 2VGPA 4EONA 5CAVA 3VIDA 3R7UA 4DA5A 3DLZA 4EC9A 4O82A 5BUIA 5IUHA 2JAMA 3DKOA 3OD6X 3Q4CA 4D5HA 4FTLA 4PP7A 3R2BA 4C33A 4OTPA 2WMAA 5FUTA 4Z16A 4JDIA 1PMNA 5H8BA 4ZXTA 3TEIA 2QC6A 3A2CA 3KN5A 4BCPA 4ZZOA 3TDWA 1WVYA 1TKIA 4CV9A 3OHTA 3KRXA 3PIZA 3AOXA 5FTGA 4U6RA 4UMUA 3QRTA 4XV3A 4RFZA 5L3AA 3EMGA 4UMPA 3QD4A 5DBXA 1KSWA 1WBTA 2XVDA 4IB1A 3FI4A 3FWQA 4II5A 5HZNA 4CFWA 3R00A 3WOWA 2ITXA 3C0GA 4AGWA 4M69B 2ITUA 2WIHA 4QP7A 1HCLA 3SV0A 3ZYAA 2OIBA 4A07A 2WIPA 4U3ZA 3FLWA 4UZDA 1SYKA 5JGDA 1VYZA 3PVGA 1OIYA 2B0QA 3P7CA 3GU4A 2Y6MA 1A06A 3OROA 4FV2A 4PV0A 1WVWA 4FSMA 1QPEA 3KCKA 3OY3A 4C4IA 4P2KA 5A46A 2UW8A 5BVOA 4NUSA 3NEWA 5AUWA 5K3YA 2VN9A 4A9UA 3HMPA 3U6HA 1JAMA 2VTTA 4HCUA 3Q53A 4MBIA 3SD0A 5CAOA 4RWLA 5CAUA 3WZKA 1DM2A 3DU8A 2YJRA 2JBPA 3MVLA 3BQRA 4MNEA 2X8DA 4RJ4A 4C34A 4EH2A 2Z2WA 4NTSA 4QMPA 4RRVA 4XLIA 5CXHA 5A6OA 1M7NA 4S34A 3AT4A 3NRMA 2WMSA 3ZO3A 4CTBA 3ZOSA 1H1WA 3HV6A 3P79A 2G2FA 4IADA 3F82A 5DGZA 5HVJA 1GZ8A 3A8XA 4BYJA 2YABA 5EM6A 1JQHA 3Q9YA 2BR1A 1WBSA 3D5VA 5EFQA 5GJDA 4B9DA 1YOLA 4DFNA 3MSSA 4BCHA 5I3RA 4FEVA 3HYHA 4YJQA 3M42A 1XBCA 4C8BA 2V7OA 2GNLA 1SVHA 4AA5A 3IGOA 4IM0A 3GT8A 4HVDA 1Q24A 5E91A 2G9XA 3VUMA 2OBJA 2DQ7X 2RGPA 4OLIA 5ANJA 3E64A 3K5UA 3O7LD 2VX3A 5ACBC 5C8NA 1V0PA 2PVMA 3TG1A 2X6EA 4CFVA 1OL5A 1JWHA 3D9VA 4M0YA 4KABA 4IXPA 5EKNA 2R0UA 3L9MA 2GQSA 3K3IA 5CSPA 2DYLA 4BI0A 2GQRA 5IUGA 4I4EA 2P55A 3AGLA 3MBLA 1IA8A 4RIXA 3VS7A 5HORA 3NW5A 3CY3A 5KMLA 4XRJA 4OT5A 2X9FA 2XP2A 4YUQA 3VS3A 1U54B 3LCOA 3EOCA 3COHA 5CVHA 1W83A 5DN3A 4UXQA 2C6KA 4QMMA 3QALE 2BAKA 4UMTA 2QHMA 3R04A 5I9VA 1OBGA 4FZDB 3DK7A 3IW5A 1GOLA 4YMJA 3OTVA 4QQ5A 2H8HA 3SW4A 2OFVA 2QOLA 4BCMA 3QZHA 2C5NA 3NDMA 4ZJVA 3EQHA 1K9AA 1YXVA 2WMUA 2OIQA 4BCOA 3S3IA 4FSWA 2OFUA 1H27A 3UG1A 4EHGA 4Y5QA 3VWAA 5L8JA 1UU7A 1FGKA 3ZO4A 4PTGA 3Q9WA 4W9WA 4RX7A 4HYUA 4EH7A 4Y85A 3VBWA 4G1WA 5IH6A 2G2HA 4TW9A 4EOPA 4QP3A 4QO9A 2PHKA 2ITZA 2PMLX 5IU2A 4U81A 4P90A 3I6WA 5FBOA 2OK1A 3GVUA 4JBOA 3ZXZA 5HD4A 3R30A 4HNFA 5FRIA 2JD5A 4M66A 4BZDA 3QQFA 3E93A 4YNEA 2QR7A 5GJFA 2Z8CA 2X7FA 5CNOA 5AM6A 5HESA 4FTQA 4EI4A 5J9ZA 1CDKA 2GSFA 3BHVA 5E8TA 4MF1A 4CRLA 4EOJA 3KKVA 4NJ3A 4QTBA 3FLQA 5CQUA 3KRJA 4D2TA 1IG1A 3ORNA 4N6YA 5B2KA 4NIFB 5I9YA 4ANSA 1OKYA 4ZTNA 2GQGA 4CKIA 4C4GA 3WYYA 4IC8A 3AMAA 4LFIA 1FMKA 4NH1A 3CR0A 4W4WA 5K0KA 1KV1A 5IPJA 2F2CB 3CXWA 4UWYA 2ETKA 3QCYA 3NIEA 3IDBA 1U54A 5HCYA 3U87A 4F4PA 2ZM1A 2PUNA 4YP8A 4GW8A 3RAHA 4DG3E 4F9CA 2WGJA 4KRDA 1H25A 3V5QA 3PLSA 4EOOA 2Y4PA 2YISA 5HNBA 5HCXA 4ANBA 2E9VA 3JS2A 3GQLA 4W8EA 1ZMUA 2PSQA 4PUZA 2VTIA 3COIA 3FMLA 3O2MA 2VWYA 3ZSGA 4D5KA 1XR1A 4EL9A 3HVCA 4FX3A 3W2SA 3PY3A 3TNQB 4QP9A 4TNDA 3PXYA 3PLAE 4XRLA 3E8NA 4ZLOA 4CFUA 4NCTA 3G5DA 4D55A 1FMOE 3Q9XA 1FPUA 3SG9A 1Z5MA 4NFMA 3UVRA 5AADA 2Z7SA 5KMNA 2GNIA 3VF9A 4JRNA 2X8EA 3UZTA 1GY3A 5E92A 3ANRA 4G6NA 4CT1A 4UV0A 3PSBA 4R7HA 4F1MA 3VS2A 3U6IA 3PUPA 4R6VA 5A54A 3MIAA 3SDJA 4E5WA 3OWPA 3UPZA 3C0HA 2FH9A 5HBEA 5IA5A 1WBNA 4PMTA 3TNHA 4PNKA 2VTHA 4KIOA 3PPJA 4FIFA 1YDTE 2X2KA 3W16A 3NVMB 2BRMA 5BVWA 4DEAA 4XG7A 4M84A 3R7GA 2OICA 3QZGA 1QCFA 2PVLA 3LPBA 4Y5HA 5EOLA 2VWZA 4QMWA 4O7VA 5IQEA 4B4LA 5KMJA 5HBHA 1YHVA 3QD0A 2QOHA 2ZB1A 3NGAA 4FT7A 4G31A 4YJUA 2GFSA 3V8TA 3MFSA 2WOTA 4WUNA 5KKRB 2UW6A 2QI8A 1R39A 1UKHA 2QLUA 2JFLA 2ZOQA 3P78A 3SXSA 3UO4A 4E1ZA 3QXPA 1ND4A 3HL7A 3FPQA 5L8KA 3MS9A 1K3AA 1JPAA 1OUYA 4DC2A 1J1BA 2YLEA 3EN4A 2VGOA 5EH0A 4MBJA 3ERKA 5KE0A 5CX9A 2OKRA 4RBLA 2PVFA 4ZS4A 1Y8GA 2QOCA 4DN5A 1M14A 2B9HA 3CJFA 4GCJA 4KB8A 5C8KA 4FT5A 2YM5A 3KU2A 2WMRA 4PPCA 3IK3A 2OH0E 4LOOA 3F3VA 4DH8A 3I79A 4XLVA 5A6NA 3GCPA 4Y72A 3WE8A 4CV8A 4FEXA 3UQCA 3PG3A 5LVOA 4KIQA 4J52A 2A27A 1TQIA 2XCKA 4XMOA 4OW8A 4YZNA 4FT0A 2W1EA 3FQEA 5JRQA 2VTMA 3PJCA 3TT0A 4FTKA 3L9PA 2XKCA 4B0GA 2YZLA 3GCUA 2VX1A 4BCFA 4EZ5A 5FXRA 5CVGA 3KMWA 3NS9A 4CMUA 5HU3A 3IOPA 3VS4A 4APPA 4DEBA 5GJGA 4C4JA 2ZMCA 3OCGA 5CY3A 5HO8A 3VRZA 3O17A 4C37A 4IWDA 2G01A 3UGCA 3R28A 1YXUA 3LFEA 4I22A 4LL5A 1O6YA 4AW0A 4I5PA 4BCGA 2QU5A 2R3PA 3IW4A 4TWPA 4V04A 1H8FA 3DNDA 3RCJA 4KBKA 4MD7E 1OL6A 3FMEA 2ITTA 4BICA 4PDYA 3ZUTA 3Q5ZA 4ASXA 1M7QA 3TNIA 4K1BA 3EZRA 2HK5A 4V0GA 3MTFA 4FIHA 3IS5A 4MXXA 3BV3A 3NNVA 4K33A 3LVPA 4XOZA 4U3YA 4F6SA 5K5XA 5IQDA 3WILA 3QC4A 3FEGA 3KN6A 3SOCA 3D7TA 3UNZA 5K4IA 3A4OX 1BI8A 2Q83A 3EN9A 5IUIA 3Q4ZA 3FL4A 4TWCA 4AW5A 2YACA 2UZLA 4Z55A 4HGLA 3SRVA 3LFSA 4TPTA 5FWKK 4GYGA 2JEDA 3L8XA 2CGWA 3OOMA 4MEDA 4AT4A 3LLTA 3Q60A 3FMHA 3TIZA 3R9NA 4LUEA 2OXXA 4NYEA 1LUFA 2WO6A 2XK3A 3PSDA 3TN8A 3W2RA 1H0WA 5BYYA 5M4UA 5EDQA 3EQFA 2C30A 2O65A 3G2FA 4FVRA 4EOIA 4DFZE 4EQCA 4F7SA 5AP0A 4IAZA 4G34A 3LXNA 1YDSE 2QHNA 4QMLA 1W82A 4A9RA 2VWVA 3TCPA 5KO1A 3WIGA 4IAYA 4FEWA 3Q4UA 1ZYJA 3CTQA 3KL8A 4CCUA 5BNJA 1UNLA 5AJQA 2VNWA 1ZYLA 1MRUA 3NZ0A 4KWPA 4NW6A 4C38A 3TDVA 3KEXA 4TN6A 1OM1A 4RG0A 4NM3A 1I44A 3FMJA 2JKQA 3LFQA 2A4LA 3PWDA 2JLDA 5I5ZA 2ITQA 2REIA 4NEUA 4FKQA 1WBOA 3HZTA 2XRUA 3Q52A 4FTIA 3C7QA 1FVRA 5EQPA 3C13A 4Z3VA 5T68A 3F88A 3LCTA 3OCBA 4UX9A 2B52A 4FNYA 4BDCA 2YIWA 4K8AA 1GZOA 2R3MA 4CEGA 3UIMA 4GIIA 4U43A 3S95A 2ZVAA 4M15A 3IG7A 4GK3A 4XV1A 4ZLYA 5A14A 4OTFA 3C5IA 4AAAA 2C69A 3QD2B 4FV9A 4E6AA 4F9BA 5IZFA 3QQGA 4K2RA 2XUUA 4BIBA 2IJMA 3ULZA 2YCQA 3T8OA 5DR6A 2YM6A 4W4YA 2O3PA 5L2QA 3GU8A 3A7FA 4NM7A 2UZWE 4XG6A 3VHEA 4BZOA 3LHJA 1ZYCA 5E7RA 4TKSA 5HG9A 3QZIA 3FJQE 4QMZA 5HGIA 3OEZA 4FTMA 2A2AA 2JFMA 1CTPE 3HLLA 3TJCA 3AC3A 4EK5A 4U80A 5CSWA 2O0UA 4L3JA 4QPSA 2WMWA 4M97A 5CU6A 1DI9A 3R1YA 5H9BA 2WQBA 4LV8A 4OTIA 2OU7A 5HHWA 2BRNA 3WF7A 4FK3A 4D1SA 3HV5A 4FICA 4DHFA 5IQBA 4L67A 3F2AA 3HP5A 2QO2A 4IE9A 3TL8A 3L8PA 2WQNA 5L2TA 3SKCA 5J9YA 1BYGA 3CPBA 3E7VA 3A8WA 3WARA 4AS0A 2C0TA 5KBRA 1WVXA 3BI6A 4QQCA 1FVVA 2VTPA 3FQSA 2QOBA 5EYCA 5LJJA 1QPCA 1V0OA 3MVHA 4BCQA 3PDTA 2UW0A 2X2MA 2YITA 3I0QA 3NYXA 2CLXA 2JKMA 5KBQA 2QCSA 1PW2A 4FF8A 3OEFX 3RMFA 1PXNA 3WIKA 4AU8A 1H1QA 1FOTA 4JNWA 4W9XA 2FSLX 1O9UA 5D7VA 2PMIA 2OIDA 5C4LA 3R02A 3V6RA 4DCEA 2YIQA 3BWJA 5H3QA 5LMAA 4DGMA 2UZDA 4JBPA 5FXQA 3CSVA 2UV2A 4UWBA 1LPUA 4MXYA 1O6KA 2W7XA 3OVVA 5J5SA 2RF9A 3MY5A 2PE2A 3OT8A 3PY0A 3DB6A 4ITHA 4LG4A 3BYVA 4TYHB 5CENA 3RK9A 3PJ3A 2GFCA 4BBMA 5B2LA 4O6LA 2X1NA 5D7AA 2F57A 5EHYA 2CHLA 4GS6A 4Y8DA 5E8SA 4CSVA 2ONLA 3QX4A 3QQKA 3LXKA 2WELA 4AE9A 3P9JA 2KTYA 2IVUA 4C3PA 3RAIA 3ORMA 3GEQA 5IEXA 2C3LA 1H1PA 4X2NA 2B1PA 1IR3A 3QFVA 2JDVA 4OR5A 4X3FA 1YKRA 4V05A 5CT0A 4JQ7A 2LAVA 1YHWA 3BLHA 4ARKA 3GCSA 3A7GA 2W05A 3QGWA 4DEDA 4EK8A 4LGGA 2IVSA 2O2UA 2W1HA 3KF7A 3QCQA 3QHRA 3UYSA 2W17A 4ANQA 1LP4A 5DEYA 4BCNA 4CKJA 3OP5A 1IRKA 3BWFA 4FOBA 4S31A 4Z9LA 3IW7A 4O0TA 3U8WA 1JLUE 4J96A 5J95A 4E20A 4FA2A 1UVRA 2WQEA 4DGOA 4I92A 5ANOA 3C4XA 2C68A 2W0JA 3GC9A 2BAJA 3PVUA 4ZSGA 5IMEA 3LXPA 3F5PA 3DV3A 4FV6A 5E1EA 3VAPA 5TOZA 3LLAA 1PKGA 4WO5A 2ZM4A 3RHKA 3Q6UA 2WTKB 3ATSA 4DLIA 4RVMA 3PE1A 3R63A 3LCKA 3U54A 4GVAA 4BDGA 4CMOA 5BVDA 3VUGA 3ORTA 4RC3A 4TYEA 2WOUA 5GNKA 5EKOA 1BL7A 5CEPA 3V04A 2FUMA 4E6CA 2XKEA 5EM5A 3FMDA 2OJ9A 4LMUA 4E26A 4YR8A 2C3IB 4KBCA 4D2SA 4CG9A 4YC8A 4KKHA 4ITJA 2CCHA 3KGAA 3NUXA 5FDXA 4FOCA 5JQ8A 4DH5A 3EN7A 4WHZA 1WCCA 5EI6A 3S4QA 2J0MB 4D4SA 4KKEA 4C7TA 3VJOA 2UUEA 3TI1A 2W1IA 3HX4A 2HWPA 3E92A 3OFMA 3F3ZA 3R01A 5FG8A 3HKOA 3VBYA 3K3JA 5J7HA 3JY9A 5DRDA 4O7SA 2BFXA 1BX6A 3RBWA 4CXAA 4FL1A 2Y4IC 4CQEA 3R1QA 5A4LA 5ICPA 5L4QA 4FKUA 3ZEWA 3BBTB 5L2IA 3FUPA 3NUYA 4C2WA 4CNHA 4G3FA 4JX3A 4QNAA 3FQHA 4IZ5A 1ZWSA 3ACKA 5JK3A 4FKGA 2HY81 4DEHA 4DH3A 1T46A 4RJ6A 3MIYA 2BIKB 2J0KA 3RINA 2XJ0A 1FBNA 3G0FA 2ZV7A 4Y83A 1OPJA 3ZZEA 5M08A 5HIEA 3T3UA 3UOLA 5GIPE 2CGVA 1DS5A 2SRCA 3MI9A 3MN3A 4IX3A 3KF4A 5L6WL 5GZ8A 4EBWA 4EH3A 4D0WA 2W99B 3TM0A 5CLPA 3UO6A 5KX8A 3ZTXA 4NZWB 3CC6A 5HICA 5IISA 4XS2A 3Q9ZA 4PL3A 2GCDA 2ITVA 4ZLZA 3VULA 5AUYA 2XNNA 1JSTA 4EUTA 4WNKA 3GCVA 2X0GA 3O7LB 3R9HA 4EHVA 4PWNA 1IAHA 3U4WA 4WG3A 4FEUA 4X2FA 4IAAA 2V0DA 3PP0A 4BKJA 2YWVA 2B4SB 3OWJA 3QTZA 4MK0A 2QOKA 2H9VA 2XA4A 3F5UA 4AWIA 3RAKA 4QMSA 5DPVA 5LWMA 4AZFA 2ITOA 3PPZA 5HNGA 3W1FA 2PZRA 2HZNA 2BKZA 1Z57A 1BL6A 3GNIB 5IMXA 4FG9A 4AFJA 4DH7A 3UO5A 4ZS0A 2XYUA 3H0YA 4RZVA 5FP5A 4JLCA 4FE2A 5DT3A 3V01A 3ACJA 3O8TA 5DVRA 1KV2A 3LQ8A 3EL7A 3IW6A 3F5XA 5KZIA 3LM5A 3WBLA 4M7IA 4KNBA 5H2UA 4FNZA 2R3NA 4ENYA 4G9CA 1XH8A 4O91A 4UBAA 4EKLA 3RPSA 2DS1A 2YM4A 2A19B 3A99A 4L3LA 4NSTA 4OBOA 3IONA 5J5TA 3UYTA 3E87A 1FQ1B 2BRBA 4QP6A 5M44A 2R9SA 5AMNA 3NPCA 2V5QA 2QOQA 1BMKA 5M07A 4FMQA 1OGUA 4O6EA 5BVEA 3E3PA 2V22A 5KHWA 2WD1A 4D4VA 3HDMA 4AZWA 3FMKA 4MYGA 3DFCB 4DFXE 3GC8A 3EQRA 4WG4A 4CCBA 4JR7A 3R8VA 3IO7A 4RMZA 5AP5A 3COKA 3BYSA 3DJ7A 4YO4A 4EJNA 2YDKA 2QO9A 4FYNA 4MNEB 4ZK5A 2BHEA 3FLNC 4NKSA 5DG5A 3MPMA 4UMQA 3OF0A 4R3CA 4PTCA 4DFLA 1KE7A 3H10A 4GUBA 4I23A 4RIWB 4CRSA 5AA9A 2R0IA 2W96B 4YBJA 3R7IA 4F64A 4GFOA 3MB6A 4RJ5A 3R21A 5J9LA 3DPKA 1NVQA 1OITA 3FKOA 4L8MA 2BILB 4EKKA 3ODYX 3KMUA 5FBNC 4O83A 4EH8A 3CKXA 3CLYA 2JKKA 3ORLA 3G9LX 4AG8A 4BCKA 3B2WA 2QG7A 1M17A 4M12A 4BHZA 3PRFA 4NK9A 4IW0A 1PMUA 4XG2A 1PXKA 3DBDA 4U7ZA 2XNMA 2O8YA 3DXNA 2RL5A 1RW8A 4I6BA 5A4QA 3EHAA 3SX9A 4HOKA 5CF4A 4U9AA 4FODA 4BC6A 3PTGA 3MPAA 4W8DA 4EOMA 4UMRA 1NT2A 4M3QA 5I9ZA 2ITWA 4ZAUA 3DT1A 4G5JA 5M55A 4BIEA 1OL2A 5HTBA 3QYZA 2IG7A 4ONAA 3V5TA 3R7EA 2WTJA 4IAIA 1YXTA 3HP2A 4E8AA 1ZARA 3RALA 3Q04A 5HTCA 3C51A 4QYGA 4E5BA 4RIXB 3I0OA 4FV3A 3MA3A 4GK4A 4RC4A 4LMNA 4ZJJA 2W9ZB 4G3CA 5CAPA 1A9UA 1U46A 4YZMA 3E3BX 3H30A 4E4MA 1P14A 3JXWA 2O64A 2QD9A 3D15A 4BGQA 4EUUA 3EKKA 1OI9A 3DCVA 4RQKA 3ALOA 4NL0A 1AQ1A 2GNGA 3AMBA 5DI1A 2ZDUA 3ZS5A 4FV1A 5BX0A 2BZJA 1YDRE 5CT7A 2IZUA 1J91A 5A4TA 4JJRA 1DAYA 2VAGA 3TNWA 2I40A 3M1SA 1ZLTA 4WNPA 1RJBA 2VTRA 4ACCA 4RIWA 1PY5A 4MF0A 4R8QA 3KREA 4O0YA 1FVTA 4F7NA 2H34A 2XYNA 3FHRA 4QYYA 1ZMVA 2R3LA 4FKVA 4PL4A 5AM7A 5AP1A 4HVHA 3BLRA 3WZDA 3UBDA 1UU3A 3QC9A 4APCA 4AZVA 2ZV2A 1NVSA 4B8LA 4I0SA 4RJ7A 2G2IA 1VYWA 3V6SA 4NFNA 5AP2A 5EK7A 3DQWA 1Q8WA 2YIXA 3FYKX 2XK9A 3FXXA 3GU5A 4AGCA 2JC6A 3EWHA 3SXFA 4CFMA 5J79A 4BB4A 1YWRA 4Q5HA 4UYNA 2JITA 2XIXA 3MJ1A 4CFXA 5ANGA 5EYMA 1RE8A 3CY2A 3WF5A 3HECA 5IG1A 3FI8A 4BWPA 3EJ1A 4X2KA 2HY0A 3C50A 4Z7HA 3Q32A 4FVPA 4FNXA 3RM6A 4NCTC 4WBBB 3U51A 2J4ZA 5AP3A 1V0BA 4RWKA 2GHMA 4F0IA 3RPVA 4IEBA 4BTMA 4C4EA 5AP6A 2XNOA 3UE4A 5FP6A 2XB7A 4AZTA 4H3QA 3FMMA 3QA0A 4PPAA 3MV5A 4FIIA 1URCA 3QCSA 4PL5A 4ZP5A 5BUEA 5KMMA 5LXMA 3W18A 5AUXA 4O7ZA 1PYXA 1NA7A 3U9CA 3DAJA 2JDSA 3I5NA 4OTHA 3RWPA 2R3IA 1P4FA 4BDEA 4V01A 5EM8A 1HCKA 1RQQA 4H1JA 3ZDIA 2IN6A 2X9EA 3FLSA 2J0IA 1UWHA 2XK8A 4RJ8A 4RSSA 5T3QA 1ZYDA 1P5EA 2EB2A 2ITYA 4P7EA 3ZO1A 2YDJA 3UNKA 4BY9E 4AN3A 2W9FB 4YBKA 3REPA 4AGDA 2W5BA 3BGPA 4O86A 2OXDA 4QMYA 1PMEA 1B39A 5J87A 3W2QA 3E8CA 4L44A 3RJCA 4DITA 4PDPA 3EL8A 1XBBA 3T9IA 3FC2A 2ITPA 2PZIA 3HUCA 3R1NA 5BMMA 4FV7A 1CMKE 2YLFA 4L7SA 5E8WA 3NUNA 4PY1A 3H9RA 1PKDA 4H58A 1XWSA 4DGNA 5ANDA 4S2ZA 4B8MA 4AW2A 4XHKB 2PL0A 2V7AA 4WIHA 4B99A 5EQYA 3LE6A 3ZCLA 4DYMA 4EH5A 1Q41A 1YQJA 4D58A 2Y9QA 4C62A 1LEWA 2JDTA 1OKWA 2UVYA 4EK3A 5KNJA 2Y8OA 3WYXA 1URWA 1H1RA 4KUJA 1XH5A 2YHVA 3R9OA 4I94A 3SXRA 3LMIA 4PDSA 4PX6A 1H08A 3NWWA 1Q8TA 3PY1A 4CKRA 3GFEA 3TV7A 4HPTE 5BPYA 3MESA 4MWIA 2LGCA 3PIYA 3DAKA 5GIOE 4P5QA 4YJNA 5IA1A 3PXKA 3LKMA 1KE6A 2VZ6A 3HV4A 3VS1A 3ENMA 3I5ZA 3O8PA 2Z7QA 3OUNB 5AAFA 3QKLA 4BDKA 5BMSA 2CDZA 1GAGA 3D2KA 2EXEA 2C1AA 3F3WA 3ET7A 3RWQA 3ZUVA 4YJPA 2AC3A 4MWHA 2R3OA 3QL8A 2R3HA 4HW7A 3ULIA 1XO2B 4JAIA 3MDYA 4J95A 4OT6A 3FSKA 5ETIA 3NYOA 4G6OA 1YOMA 4QT1A 3VQHA 3F7ZA 4BDIA 2FSOX 2F4JA 4LRKA 4WUAA 4BYIA 4CT2A 3FMNA 3PJ1A 3FY0A 3P7AA 2OSCA 4RIYA 3PA5A 2W06A 3L9NA 1H24A 3PXZA 3FHIA 1Q3WA 4TL0A 5BVNA 5HVKA 5KKRC 1STCE 3HNGA 5E9EA 1Q97A 1MQBA 5AUUA 1Q5KA 3P4KA 1IASA 3QLGA 3SW7A 4O0WA 2IW8A 4PTEA 1YOJA 4XBRA 5AR5A 4FGBA 3QTIA 4UY9A 3EH9A 2BTSA 2PVNA 4G2FA 2CNUA 4FTUA 4ANLA 4DBXA 4RC2A 4QOXA 3OTUA 2YDIA 3UIUA 5FDPA 3V5LA 2UZTA 1YI3A 3OBGA 3PSCA 1M2PA 3RZBA 4FNWA 2BZHB 3SHEA 3ZH8A 4GFMA 1I09A 2XJ1A 2W4KA 2GMXA 2IW6A 3PXFA 4GH2A 5HLPA 2Q0NA 3NUUA 3PJ2A 3Q96A 4IWOA 4R5SA 1ZRZA 1XJDA 3MFTA 1H07A 2BZIB 3F7WA 2YAAA 5HE2A 4EJ7A 4V0GB 3UC3A 3D7ZA 4G3GA 5AP7A 4Z7GA 4AP7A 4MD9E 5CANA 5IDNA 4O7WA 3D14A 2Q0BA 3PWYA 5I9XA 4LM5A 3N4VA 2JDOA 3D7TB 4L68A 4MNFA 4XBUA 4C2VA 5HG7A 3BHUA 5KUPA 3GU6A 2XZSA 4I0TA 1OB3A 2WXVA 3BEGA 4I6HA 3EYHA 4LV5A 3H9OA 3SRVB 3OWLA 4UB7A 3RK7A 2X7OA 2PVKA 3ORIA 3L8SA 5DYJA 4BF2A 2IO6A 2OLCA 2BPMA 4FUXA 2VWBA 2UW5A 3KA0A 4HGEA 3EB0A 4QD6A 3GXLA 3R2YA 1REKA 3VF8A 4RZWA 2X7GA 3C1XA 3DS6A 3E88A 1ZXEA 4ZTQA 2FGIA 4MD8E 2XM8A 1VEBA 2B54A 4AOTA 5CF6A 4JBVA 2R5TA 4GT5A 3H3CA 4IFGA 5CNNA 5GHVA 3ROCA 4A4XA 3CPCA 1TQPA 1X8BA 3QWKA 5LMKC 3EFWA 4J8NA 3OMVA 4IAFA 2UW4A 2QOIA 3NCZA 3LQ3A 4KBAA 4F9WA 4IM2A 2ZJWA 1GIIA 1J1CA 2QG5A 4R5YA 3I1AA 2FO0A 4CTCA 4O1PA 3RK5A 3KCFA 4IJ9A 4JOAA 4FIGA 4BFMA 4D1XA 4ANOA 2A1AB 4XOYA 3C9WA 2BDWA 4YJRA 4JQ8A 4RFYA 4QNYA 5AX3A 5DLSA 2VU3A 4KD1A 5EW3A 3MVJA 2OG8A 2X4FA 2PZ5A 1MRVA 5T6KA 4BI2A 4I4FA 5HTIA 1PJKA 1BKXA 1PHKA 3HV7A 3A7JA 3RZFA 4MQ1A 5HE1A 4QMVA 3A7IA 1CSNA 1SZMA 2GTNA 4L00A 4L53A 4HCVA 2GNFA 1Z9XA 2YZAA 3TXOA 3UOHA 3PP1A 4UWCA 4FTAA 5CF5A 3DKCA 5AA8A 2FYSA 4CYJA 5HO6A 5CS6A 4HVIA 4HZSA 2YJSA 2P4IA 2ONLC 3OXZA 4BI1A 5J7BA 4AA0A 4YHTA 2XNEA 1JKTA 3E63A 4AQCA 4KSPA 5DT0A 5IQCA 5EYDA 4QTEA 1H28A 1Q4LA 1YW2A 2CJMA 4ZZNA 5HQ0A 3Q6WA 2PK9A 4MXAA 4NW5A 2F9GA 5JFVA 3BGQA 3R7YA 2CGUA 3OG7A 2J0LA 4AN9A 4MAOA 4MBLA 5M4CA 5EOBA 1MP8A 2UW9A 1XBAA 5IA0A 2O63A 4L43A 4YC3A 3U9NA 3NNWA 1PXIA 2JDRA 3BE9A 4E4LA 3A62A 3F61A 4MH7A 1ZMWA 5BVKA 4EH4A 5HBJA 4ALUA 5KMKA 2GS2A 5E1SA 3PFQA 2WTVA 1SVEA 4O0RA 4WOVA 4EQUA 4G17A 5H8EA 3VNTA 4X7QA 4MHAA 4I21A 5CSVA 3DK6A 1APME 3UIBA 3MFRA 5KMOA 3VO3A 4ENXA 4FV0A 1GJOA 2BALA 3LAUA 1OUKA 1Q61A 4D4RA 2RSVA 2I0EA 2XEYA 4FC0A 5JFWA 2OJFE 4ZTMA 4BDBA 4IVAA 4KS7A 3SQQA 4X3FB 1OKVA 3BV2A 5J1WA 1W8CA 2VWXA 3L1SA 4OAVB 4DFYA 5AR2A 4A9YA 1KE9A 3D5XA 1Y57A 2W1DA 3RTPA 4AZSA 4UZHA 3LW0A 2QOFA 3FKLA 2PUIA 1WZYA 5ANKA 3TUDA 3PYYA 3FZRA 4PNIA 1YHSA 1ZZ2A 5HKMA 1WBPA 4M68A 2ZDTA 4L9IA 4QP1A 2G15A 3CD8A 4XP3A 3FAAA 5DR2A 4D2WA 5ANIA 4D9UA 1Y91A 3OS3A 4XV9A 2E2BA 5EW9A 3NX8A 5A9UA 4USDA 2BCJA 2HW7A 3I4BA 3JY0A 4CFNA 4J71A 5JN2A 2B9IA 2WMXA 4R78A 2PVRA 4O96A 4FI1A 4UYAA 5I9UA 3RPYA 1YXXA 2HZ4A 5IEVA 5KCVA 5DH3A 3NIZA 3QWJA 2DUVA 5CEIA 4F9AA 5CSHA 4D2PA 5HLWA 3VS6A 3AC1A 5H8GA 2VTLA 2WNTA 1SMHA 3POOA 3F9NA 3FI3A 4FR4A 5JRSA 4DG0E 3RHXA 5FEEA 5LVMA 3BU6A 2VO6A 4OTRA 3CQEA 1B38A 4HYHA 3VBVA 3GCQA 4MXOA 4ZTLA 4BDJA 2UZEA 3T9TA 3QRUA 2UVXA 4JS8A 1OL7A 4H3BA 3UMXA 3V5PA 2Z7LA 3BLQA 3EQPA 4WG5A 4RFMA 1J7IA 3Q2JA 2XKDA 2PUUA 3LJ2A 3NW6A 3QRIA 1YWVA 1XKKA 2PE0A 5D41A 2XF0A 3MVMA 2NRUA 3KB7A 5HOAA 2XK6A 4X2GA 4GYIA 5IA2A 3MW1A 5BVFA 2W5AA 5JMSA 3S00A 2J51A 2OO8X 2IZTA 2NP8A 2HELA 2CMWA 3GQIA 3OXTA 4WBOA 5I9WA 1UKIA 1Q99A 2W1FA 4KSQA 2J7TA 5CZIA 3Q4TA 1GZKA 4FV5A 4DCAA 4BDHA 4BKYA 4YPSA 3DOGA 5IH5A 4GL9A 4U97A 4B7TA 1L8TA 4E4XA 2XM9A 3HRFA 4YZBA 2VO7A 3N51A 5M57A 4FTCA 3RPOA 3P7BA 4GSBA 4ZSJA 3NUSA 3R6XA 5L2WA 3BHHA 2WB8A 3UJGA 2BROA 1WAKA 4FKPA 4G3DA 3DNEA 3EQIA 2EXCX 4R3RA 3RM7A 1GIHA 3DGKA 1R1WA 4F7JA 3I6UA 5HLNA 2BTRA 4FTJA 4X6RA 4XNEA 3FLZA 4LUDA 4I24A 1IAJA 1OBDA 3P86A 3D83A 5CU3A 2E9UA 3S1HA 3UDBA 4JDHA 3DFAA 3HMNA 4I0RA 4GRBA 4QRCA 4QPAA 3FXWA 3R8UA 4IIRA 1ZY4A 4HPUE 4EOLA 4ASEA 5KHXA 3UVQA 4WNMA 2I6LA 4Q5EA 2HWOA 4FSNA 3MY0A 1HOWA 1UV5A 4BR3A 3G15A 4XEYA 4DLJA 5C1QB 5K9IA 1BI7A 2J5FA 3CP9A 4Y46A 5GZ9A 3VVHA 4TY1A 3F66A 3W2CA 2XNBA 5CF8A 3CD3A 3BCEA 3AC8A 1H00A 3QQJA 4CQGA 1ZAOA 1E1VA 4BL1A 3KK9A 4CMTA 2J5EA 3EFLA 5D9HA 3UC4A 2P3GX 5HG8A 3QLFA 4DH1A 2XBAA 4QMOA 4JDKA 4FTTA 1OZ1A 4IZAA 4RPVA 4DE4A 2OGVA 2KULA 4LGDA 2IVTA 2QU6A 4KKGA 5HCZA 5BUJA 5DFPA 3BYOA 2OZAA 1Y8YA 4MXZA 5G1XA 2NO3A 3BHYA 3FL5A 5B7VA 3NNXA 4FTRA 3PPKA 4ERKA 5CXZA 3HEGA 4BHNA 4O81A 3KULB 3KRLA 4XG9A 3MPTA 2GHGA 4ZJIA 3W2OA 2ZV9A 4IZYA 4UEUA 3NLBA 4KA3A 3HRBA 4GVJA 5L6OA 2QKRA 3NSZA 3KVXA 5JT2A 4NKAA 1P4OA 2QOOA 2WQOA 4QMXA 2C6DA 2A0CX 4RIOA 3TZ8A 2VTQA 2QODA 3IECA 5EYKA 3RKBA 3JVSA 5CSXA 5EI8A 4RVKA 4EZ7A 1ATPE 3AG9A 4XCUA 4ZSEA 5AV3A 4A06A 2RFEA 3BIZA 3O0GA 3R9DA 4X3JA 4EOSA 1EH4A 3LMGA 4H39A 4RGJA 4TYJA 4DGGA 5M51A 3HMIA 1GZNA 3EQDA 3HA8A 4FKRA 3O71A 5HEZA 1SVGA 2XCHA 3VS0A 4RA4A 3HAVA 3PXRA 2XJ2A 4FKJA 4F0GA 2UVZA 4PP9A 2R3GA 4YZCA 1O6LA 2QLQA 2UZUE 3K5VA 4IB0A 4D2RA 1K2PA 4GFGA 3MH3A 2YCRA 1SNUA 4OBQA 1Y6AA 4KINA 4ASDA 4C57A 4J8MA 4J97A 3ZC6A 3PE2A 4EOQA 4D28A 3LQ5A 3DBCA 4AW1A 4G9RA 5AX9A 4C61A 5M06A 4AGUA 3FYJX 4PMPA 2CSNA 4FKTA 4PF4A 1YVJA 3KRRA 3FE3A 4K11A 5AR8A 4BWXA 1CKIA 2PZYA 5E8XA 1DAWA 5IH4A 3LFCA 1Q8ZA 4JIAA 4N4SA 3PVBA 3ZSHA 5DIAA 5L2SA 2ETMA 4R77A 2CCIA 3OOGA 4HNIA 4C59A 4FL3A 4RJ3A 3P1AA 1AGWA 2W1CA 3Q3BA 1E1XA 4R7BA 5CI7A 3KULA 4N70A 1M2QA 3B2TA 3LMHA 3PA4A 3PZHA 4YPDA 2HXQA 3PVWA 2JKOA 2BDJA 2W4JA 5EHLA 3ZFYA 5FTOA 5AV0A 3ZLSA 3ZSIA 3QU0A 1FGIA 3IQ7A 4ACGA 3DXPA 4IDTA 1L3RE 1OIUA 1WBVA 2YFXA 2EU9A 3L8VA 4ID7A 3UVPA 3QX2A 2WQMA 4AA4A 2VNYA 2WTIA 4U40A 5HIDA 1QPDA 2P2IA 2I0VA 4FV8A 4J98A 4O2ZA 5EG3A 4E6QA 1PXLA 4FL2A 3MGYA 4YJOA 1PXOA 3QUDA 5G6VA 5HE0A 3TV4A 3GI3A 5EDPA 3TUBA 5LOHA 4M67A 1SNXA 1J3HA 1JNKA 2C47A 3R8PA 1PMVA 3W8LA 4IB5A 4MXCA 3FXZA 3WZJA 2VD5A 5EDRA 5TO8A 4L46A 1RDQE 3D4QA 4FBXA 1UNGA 3TV6A 3VS5A 4J99A 4HGSA 4O38A 5IA4A 3GOKA 5LCJA 2ESMA 3BE2A 2ERKA 5GINE 4XG3A 3I7BA 3JYAA 4FTNA 3VUHA 5M53A 1DI8A 2IPXA 4UN0C 5AFVA 3R7VA 3BRBA 2OJJA 3EFKA 1TQMA 3LCDA 4GU9A 4DEEA 4EWHA 5K0XA 5BYLA 2WTDA 3KK8A 4JR3A 4YNOA 3Q5IA 3TTJA 4F7LA 4TT7A 3QA8A 3ZLXA
chains in the Genus database with same CATH superfamily
4IAKA 4AE6A 3IKAA 2PPQA 1MQ4A 4QPMA 1BUHA 2ETRA 5EHOA 3QGYA 3T3VA 2I1MA 2WU7A 5FD2A 2PWLA 2XIZA 4WRGA 4IHPA 2JGZA 5CZHA 1KE8A 4DTBA 4P4CA 3G6HA 4R3PA 4WKQA 2FVDA 4CLIA 5CALA 5AR4A 2Z02A 3OZ6A 4QMQA 4YHFA 2WAJA 3GENA 2R3FA 5HX6A 2X81A 4G6LA 5JKGA 3BBWA 2VO3A 5FTQA 3MWUA 2VWIA 3D94A 3G0EA 2C5XA 5C8MA 4WA9A 1KE5A 2OF4A 4RLLA 3TKIA 3DBQA 2NRYA 1JOWB 2Y7JA 2AYPA 1QPJA 3LCSA 5IQIA 3NMUF 3LXLA 2PVHA 4O0UA 4Q9SA 4A4OA 3CKWA 5D12A 4AOIA 3MA6A 2BZKB 3TKHA 4LOPA 4GUEA 3JVRA 3FBVA 1XHAA 3WF6A 1Y6BA 4MVFA 5LVPA 4HJOA 5IEYA 4KS8A 5DHJA 4OAUC 3KY2A 1TZDA 4UALA 4NJDA 4BCIA 3BU3A 2YA9A 4IM3A 2VO0A 4DG2E 3FC1X 1NY3A 3WI6A 1JKSA 4J53A 3QZFA 1S9JA 1OL1A 2XKFA 3CTJA 2R7IA 4CZYB 1Q8UA 4QTAA 3GC0A 2VTNA 1PXPA 2X2LA 4IWPA 2HZIA 5D1JA 2EWAA 4TRLA 3VUIA 3MYGA 4W4VA 1G5SA 1VJYA 3SGCA 3W0PA 3ITZA 4EZ3A 2GNHA 2DWBA 3ODZX 5AR3A 4KIPA 4FEQA 4TTHB 3TNPC 5AWMA 5DOSA 2RFSA 5HX8A 4O7NA 2OW3A 4IDVA 5FEQA 4AZEA 2QNJA 5TR6A 2ZYBA 3W55A 2Y0AA 4O27B 3U55A 2Z7RA 2C6LA 3EIDA 3BX5A 1ZY5A 2XS0A 4O7LA 3QKMA 3UOKA 3FZPA 1ST0A 3NCGA 2B7AA 4U0IA 3AT2A 3LFFA 1ST4A 2WMBA 3HUBA 4NWMA 3OWKA 4J1RA 3V3VA 2GNJA 5AUTA 2HYYA 5KMIA 3L9LA 4BTKA 4HVSA 3G9NA 3G51A 2V55A 3GUBA 3MFUA 3Q2MA 1OECA 2BDFA 1FINA 2YM8A 3RNIA 4EQMA 3KRWA 4JXFA 2CN8A 1J7UA 2XNGA 5I4NA 2ZMDA 3R7OA 4EWQA 3BYUA 4KRCA 3HA6A 4ZMFA 2XMYA 3UODA 2CPKE 2VX0A 4YTHA 3V5JA 2HAKA 3LJ1A 1ZOHA 3AD5A 4L01A 2X8IA 3RPRA 4IFCA 1QL6A 3HMMA 1GIJA 2BVAA 4JG8A 2OF2A 3OY1A 2IZRA 3BHTA 3DKGA 4BKZA 4F1OA 3EN5A 3KQ7A 4E5AX 4O0XA 5E4HA 4FSUA 4I3ZA 4M69A 5AV2A 4BZNA 4G5PA 2GHLA 3O50A 3FLYA 4ZTRA 3KXMA 5I3OA 4G3EA 3UNJA 3N9XA 3F3UA 4IANA 1Q8YA 4USEA 3TIYA 4ANNA 3F2RA 3LOKA 4IVCA 3MB7A 4BTJA 3QBNA 2C5VA 4YLJA 2BFYA 3D2IA 2IW9A 4PMSA 5K5NA 4EH6A 2YEXA 4RIYB 3C5UA 3DBEA 5HI2A 3IW8A 3OCTA 1KWPA 2VTOA 4GT4A 3U4UA 5CVFA 3VRYA 4IQ6A 2CKEA 4K6ZA 3SAYA 3OW3A 4BTFA 4YSJA 3DY7A 1H0VA 2C5OA 2WFYA 3OT3A 3FZTA 4AXAA 5F9EA 4FUYA 4NU1A 1UWJA 4GJ2A 4DTKA 1M52A 2VTSA 4L3PA 3TTIA 4C4FA 2BKKA 2VRXA 3IDCA 2FSTX 3UP7A 4A9SA 2J2IB 4WSQA 2C0OA 1REJA 2PMNX 4BGGA 2XEZA 4F63A 4OUCA 3CCNA 4FIJA 4FZ6A 2PUPA 2QR8A 3FDNA 4KIKB 3HGKA 3R71A 4RLKA 1P2AA 1A48A 3W0OA 4C0TA 3UZRA 4Y95A 3R73A 3R8LA 4X0MA 3GU7A 4R1VA 2PULA 3K2LA 4OGRA 3QTSA 3SC1A 1G3NA 4I5CA 3ATTA 2VTAA 2ITNA 4YU2A 4O7TA 5JGBA 5FEDA 3AC2A 2WMVA 4FSRA 4TWNA 3I81A 1OKZA 4DT9A 5CI6A 3BL9A 5ETFA 4L7FA 3QUEA 3EQGA 3SVVA 4CG8A 2EVAA 1TVOA 1Q3DA 4FIEA 4PDOA 3W2PA 4CLJA 4ZZMA 1PRYA 4QMUA 5E90A 4EYMA 2UZVA 3ZBXA 4YJTA 4FG7A 3RAWA 2I0YA 2OXYA 3E8DA 1H1SA 3EFJA 1BLXA 4D4YA 2YWPA 4HGTA 1ZZLA 2BUJA 5HE3A 3F5GA 4PQNA 3R8ZA 3THBA 4FZ7A 4RA5A 5IA3A 2RKUA 5IQFA 2OJGA 4H36A 4FSYA 5FM2A 4F70A 1VZOA 3C4WA 4IZ7A 3AQVA 3BKBA 5EI2A 2V62A 3N4TA 5A4CA 2HENA 4C3RA 3SOAA 4M0ZA 1NVRA 1U5QA 3QUPA 4FKSA 4U79A 5DR9A 4FKWA 4UXLA 1XQZA 2O5KA 4FTOA 3QQLA 2HZ0A 4JAJA 4JDJA 4L42A 5F1ZA 3V8WA 4B6LA 4C02A 4E3CA 3S0OA 2HW6A 3FZSA 3UIXA 4XJ0A 4AN2A 4OTWA 3QF9A 2VUWA 4K9YA 3VUTA 5TE0A 3VUDA 3OC1A 2X39A 3IDPA 3NUPA 2HOGA 3F6XA 4R7IA 5CWZA 4C4HA 5TF9A 1H4LA 2ERZE 4NTTA 2R3QA 2WEVA 2I0HA 4KIKA 4O1OA 4XG8A 2C0IA 4LGHA 3H4JA 4FKLA 4WSYA 3S2PA 3ZDUA 5JGAA 4FT3A 4AFEA 1IA9A 2J9MA 4D0XA 4ZEGA 3W32A 4H1MA 2GU8A 5GZAA 1WFCA 2HXLA 4O21A 3IGGA 1WMKA 3NVKI 4WD5A 4OTQA 3P08A 3R83A 5ACKA 5JFSA 4QYHA 2XIRA 5CASA 5AUZA 5J1VA 3ENHA 5AV4A 2JIVA 4ACMA 4EEVA 4JL9A 3UG2A 5FLFA 5IQGA 1R0EA 3IOKA 4LRJA 4IJPA 2YM7A 1ZOEA 4M8TA 2OI4X 1YXSA 2OWBA 4WT6A 5HNIX 3CE3A 4NIFA 1JBPE 4H3PA 3RP9A 2XH5A 3VBTA 3QKKA 1ZOGA 4FT9A 3ZHPC 3R1SA 3P23A 4IVBA 4PPBA 5CYIA 4ZMEA 2C6IA 2R3KA 1AD5A 4LRMA 4N0SA 2P33A 4U45A 2R2PA 5C01A 5E8ZA 3I7CA 4TNBA 2UW7A 4E6DA 3BEAA 4U5JA 4J7BA 2P2HA 2BAQA 4E73A 5M4IA 3KXGA 1ERKA 1CKPA 2AEGA 4BVUA 4LYNA 2VWWA 4X21A 2I7QA 4HCTA 3EYGA 4YSMA 2HCKA 3ZO2A 5FGKA 4N6ZA 5HG5A 3QTXA 3DJ6A 3FPMA 4RX5A 3KFAA 4DTAA 1NW1A 4LL0A 5CEOA 3ZRKA 3ZZWA 3CGOA 1G8AA 4E93A 3EQBA 3OBJA 4ZY4A 2G1TA 2J6MA 3UMWA 4AOJA 2UZOA 5CEQA 5IQAA 2OH4A 4TWOA 1U59A 4BWKA 2C1BA 5EQEA 1Q62A 4ZIMA 2XNPA 4ITIA 5F95A 3RCDA 2BRGA 4YTCA 3MY1A 4Q2AA 2QONA 3AC4A 2PZPA 4EOKA 2X0QA 3QYWA 4WRSA 3RGFA 3KXHA 4IH8A 4DINA 1QMZA 1WBWA 2B9JA 2IVVA 3PJ8A 2GDOA 2UW3A 4YC6A 5CTPA 3DLSA 3QXOA 4QTCA 4W4XA 4ASZA 3HDNA 3PIXA 4DEGA 1W98A 3FY2A 5DT4A 4CZTA 3ZMMA 4BDFA 2Y6OA 1OMWA 3AD6A 3ZC5A 2GS7A 4D2VA 3DTCA 3CJGA 1KOBA 5CAQA 2OZOA 2QQ7A 4I93A 4IMYA 5E8VA 3VUKA 4GK2A 4DEIA 3QQHA 2NNWB 2Z60A 3HMOA 1UNHA 1LR4A 2FA2A 2C4GA 3R0TA 4CZUA 4Q9ZA 4FV4A 4JX7A 3CQUA 3CS9A 1W2DA 3ORKA 3VW6A 3ZEPA 2CKQA 3E5AA 4O22A 1XMMA 1CM8A 3NNUA 5DEWA 2E9PA 3W8QA 5JSMA 4QQTA 1XH7A 3HRCA 2J0JA 4DGLC 4BIDA 1W7HA 4FKOA 3DA6A 3FZ1A 4FZFB 3D0EA 2ZM3A 4N57A 3WZUA 4JI9A 2WMTA 2YCFA 5HIBA 3ANQA 3KMMA 3CTHA 4HYIA 3HV3A 1OGYA 3BLAA 4RWJA 4YTIA 5LVNA 3UTOA 4AACA 3E8EA 1S9IA 5C03A 2IWIA 1CKJA 2XK7A 4X6QC 3R8MA 2JAVA 3TZ9A 2R64A 4LI5A 4K18A 2E9NA 1SM2A 3LFBA 3ORPA 3VONA 3QCXA 4EK4A 4X3FC 3TACA 2J90A 4HYSA 4O84A 3ORXA 4GU6A 5CEMA 4LOQA 1R78A 4I41A 3QAME 4EHZA 3DK3A 4USFA 4EK6A 3ML1A 4ZY5A 3NR9A 1W0XC 4PRJA 4GV1A 3B8RA 5AV1A 4K77A 4F65A 4F08A 3CIKA 3P0MA 3RVGA 3O51A 4HZRA 3ZFMA 4F09A 4ZOGA 4JRVA 3QTWA 3R22A 2B53A 2RFNA 2WU6A 3V51A 3EN6A 3EKNA 4R1YA 5AIRA 3PXQA 3ZLYA 2WTWA 4JBQA 2AC5A 4A9TA 1KOAA 4FSZA 1YRPA 3KVWA 1V1KA 2CKOA 4GG5A 1UA2A 2WHBA 2ZV8A 3ZBFA 5C9CA 1T45A 3MH0A 3DDQA 4U41A 1H26A 5AEPA 1F3MC 4MKCA 2YERA 4ALVA 3LFDA 3ZM4A 3DXQA 2YIYA 2W1ZA 3TKUA 2PVYA 5ETAA 1NXKA 2QO7A 3AC5A 3KXNA 3OCSA 3VW8A 3O5AA 2VTJA 3O96A 1MUOA 3FZOA 4JQEA 3ZONA 4NM5A 3NUAA 5J8IA 3DJ5A 3MH2A 4RQVA 4HVGA 5L6PA 2F2UA 3ORZA 5DNRA 3PG1A 2XBJA 3JUHA 4F6WA 3G90X 2ZAZA 1JKLA 3JR1A 5LMKA 2F7EE 4I6QA 4IX5A 4JVGA 4ZSLA 3A60A 2BIYA 3KXZA 4CYIA 3POZA 3DZOA 4XG4A 3AXWA 2CNQA 4YGAA 2IZSA 2W5HA 3N4UA 4H05A 4GG7A 2C6MA 4I1ZA 4L52A 2GS6A 3B8QA 3ALNA 4OTGA 4GEOA 3UDSA 4RT7A 4FZAB 3TUCA 4QP8A 3CEKA 4IVDA 5K4JA 4I6FA 4DDIA 1PF8A 3BQCA 3R9RA 3GGFA 2RFDA 3NW7A 4E4NA 2F7ZE 4EORA 5EM7A 4ACDA 5JEBA 4FYOA 5JH6A 1M2RA 4GKIA 3LFNA 2AUHA 4YZ9A 2CN5A 4ACHA 2FSMX 4IBMA 4QP2A 4O2PA 2OJIA 3FKNA 4QYEA 4E7WA 3AGMA 4XP2A 3D5UA 4ANMA 3QD3A 3ZM9A 5F94A 3FV8A 3SG8A 5C26A 1YI4A 2WZJA 5A4EA 2PVJA 2BRHA 4BRXA 2WTKC 3DZQA 3F3TA 1F0QA 1MRYA 2X6DA 3II5A 4TZRA 3VHKA 1GNGA 3DTWA 4FG8A 5E8UA 2GTMA 5M4FA 5LCKA 3C4FA 2OZAB 2P0CA 5AP4A 2RG5A 3EZVA 2WPAA 3ZUUA 4QMNA 3WF8A 1XMLA 2PMOX 3V5WA 2R3RA 3F2NA 4XV2A 2CNVA 3NAXA 3VBXA 4MTAA 3FSFA 3GB2A 4F1TA 4L45A 3U6JA 4EC8A 4WNOA 4AUAA 3UP2A 4S33A 4U8ZA 1J7LA 3C0IA 4A7CA 3G6GA 5HVYA 5LARA 3BELA 4CFFA 4YTFA 3TYKA 4CGAA 5AUVA 4XH6A 3D5WA 3O23A 3UZPA 4I20A 4QP4A 5JQ5A 4CVAA 5IQHA 3GFWA 4OTDA 2VV9A 3I60A 5KZ0A 5IF1A 4FKIA 3QRKA 1VR2A 3V8SA 4EYJA 3BU5A 2HIWA 2BMCA 3UOJA 3JPVA 3UQGA 3RNYA 4XUFA 3C4ZA 3ZXTA 2CLQA 1H01A 4IACA 1TFFA 2H6DA 3LJ0A 2XK4A 3TWJA 4FK6A 2CKPA 1XH4A 4F99A 4D9TA 1PXJA 4AF3A 4C58A 4O7RA 2C3KA 5FQDC 4AT5A 3E62A 2JIUA 5A3XA 5TT7A 4JIKA 1PXMA 3ELJA 3COMA 2B9FA 3MH1A 3A61A 5HU9A 3K54A 4I6LA 2W1GA 3QQUA 5C27A 3PRIA 1OIRA 4TYIA 4XP0A 3LFAA 2PY3A 2QURA 2WTCA 3BYMA 4IB3A 5F20A 4BBEA 1JSVA 5D10A 5ETCA 2PE1A 4IX4A 4YLKA 4RX9A 5I0BA 4P5ZA 2B55A 4X2JA 4FJVA 4ZTHA 5AR7A 2C6OA 2YM3A 3A4PA 4ORKA 2F7XE 1LEZA 4LQMA 5DMZA 3OUKA 4TYHA 4PMMA 5FM3A 3SA0A 3BPRA 3P5KA 3TZMA 5HO7A 3PZEA 2PU8A 3DKFA 4FSQA 2JIIA 4DF3A 5AAEA 3DB8A 3GC7A 4L6QA 4YZDA 5LMBA 3G33A 4TYGA 2EXMA 3QTUA 3DDPA 2QVSE 2R7BA 3A7HA 4GT3A 4QQJA 3F69A 5D11A 4F0FA 3E7OA 4AT3A 1JSUA 3QTQA 4GIHA 1UU9A 2R3JA 1U4DA 2W4OA 3DBFA 1G8SA 4YURA 5AAGA 3GP0A 2C3JA 3GOPA 3PA3A 1IEPA 4U42A 3LIJA 2XAMA 2F49A 3KXXA 4DFUA 1XH9A 2CGXA 4DFBA 4C36A 4Y73A 4O0SA 4QYFA 5CU4A 2FB8A 3ROYA 4IX6A 5IDPA 4EBVA 4MCVA 3EQCA 3FI2A 4QTDA 4JG6A 5TKDA 4BDDA 5BQ0A 2ZB0A 3KC3A 3OW4A 4RWIA 2XIYA 2PTKA 1OVEA 3ZFXA 3GBZA 1F5QA 2UZNA 1YI6A 4GKHA 3TZ7A 2BHHA 4DHJA 3VJNA 4DT8A 3WZEA 1U5RA 4FGRA 4G16A 3AD4A 3QTRA 3OXIA 4BN1A 2YIRA 4DDGA 1R3CA 2UZBA 4O0VA 3AMYA 3W10A 3UQFA 3O8UA 2QKWB 2PYWA 4O7YA 5ANEA 1OIQA 2H96A 2C6TA 2EB3A 2J50A 5C4KA 4K0YA 5CU2A 5B0XA 3ZLWA 3CQWA 2Y4IB 4YJSA 2JBOA 5CQWA 5M56A 4BGHA 4KAOA 3VC4A 4DAWA 3BGZA 3IPHA 3NAYA 4DBNA 4ZY6A 2NPQA 3VN9A 4C35A 1W84A 4D1ZA 2R4BA 2X4ZA 1PYEA 4BCJA 4YJVA 3AT3A 2ACXA 1OPLA 2VWUA 3MTLA 5JZNA 5BYZA 3NYNA 4C3FA 4M14A 4NT4A 5IKWA 5B2MA 2XRWA 4ZSAA 4YLLA 3WE4A 4M13A 4GMYA 4CD0A 1JKKA 5LVLA 4ZTSA 4EH9A 3NFFB 4ALWA 3ETAA 4QMTA 4MQ2A 4IWQA 1ZYSA 4GJ3A 3CBLA 1JVPP 1E9HA 3BZ3A 4RVLA 5DWRA 4S30A 4BDAA 3QHWA 2E9OA 4OBPA 2WMQA 3LM0A 4A4LA 4JT3A 4ERWA 4MX9A 3SLSA 5JFXA 2RIOA 5FXSA 3TJDA 2RG6A 5DE2A 3QRJA 1OPKA 2YAKA 3VQUA 4FVQA 4EHEA 4S32A 5CEKA 5CU0A 1B6CB 2YCSA 5ITAA 3MJ2A 2C5YA 3RI1A 2EUFB 4BBFA 3WF9A 3NYVA 4I5MA 4FSTA 2WEIA 3DAEA 4XX9A 4AX8A 3ZRMA 4YO6A 4XYFA 4F9YA 5JZJA 4NM0A 4RX8A 5LQFA 3ZU7A 1KUTA 3HAMA 3C4EA 1R0PA 3ZRLA 5AIKA 5L8LA 3LZBA 3DQXA 4TXCA 2GPHA 3VBQA 1XH6A 2YN8A 3ID6C 4JG7A 3UPXA 1YWNA 5LWNA 4YHJA 1UU8A 5E8YA 3W33A 5M09A 3C4CA 5DA3A 5EW8A 5F4NA 2XANA 3M11A 3M2WA 4I5HA 2WKMA 4FRFA 4IC7A 5DRBA 4U44A 5HD7A 2C6EA 3H0ZA 4QDEA 2XIKA 4RVTA 4F6UA 3CGFA 3H9FA 2VGPA 4EONA 5CAVA 3VIDA 3R7UA 4DA5A 3DLZA 4EC9A 4O82A 5BUIA 5IUHA 2JAMA 3DKOA 3OD6X 3UDTA 3Q4CA 4D5HA 4FTLA 4PP7A 3R2BA 4C33A 4OTPA 2WMAA 5FUTA 4Z16A 4JDIA 1PMNA 5H8BA 4ZXTA 3TEIA 2QC6A 3A2CA 3KN5A 4BCPA 4ZZOA 3TDWA 1WVYA 1TKIA 4CV9A 3OHTA 3KRXA 3PIZA 3AOXA 5FTGA 4U6RA 4UMUA 3QRTA 4XV3A 4RFZA 5L3AA 3EMGA 4UMPA 3QD4A 5DBXA 1KSWA 1WBTA 2XVDA 4IB1A 3FI4A 3FWQA 4II5A 5HZNA 4CFWA 3P5JC 3R00A 3WOWA 2ITXA 3C0GA 4AGWA 4M69B 2ITUA 2WIHA 4QP7A 1HCLA 3SV0A 3ZYAA 2OIBA 4A07A 2WIPA 4U3ZA 3FLWA 4UZDA 1SYKA 5JGDA 1VYZA 3PVGA 1OIYA 2B0QA 3P7CA 3GU4A 2Y6MA 1A06A 3OROA 4FV2A 4PV0A 1WVWA 4FSMA 1QPEA 3KCKA 3OY3A 4C4IA 4P2KA 5A46A 2UW8A 5BVOA 4NUSA 3NEWA 5AUWA 5K3YA 2VN9A 4A9UA 3HMPA 3U6HA 3W0QA 1JAMA 2VTTA 4HCUA 3Q53A 4MBIA 3SD0A 5CAOA 4RWLA 5CAUA 3WZKA 1DM2A 3DU8A 1G8KA 2YJRA 2JBPA 3MVLA 3BQRA 4MNEA 2X8DA 4RJ4A 4C34A 4EH2A 2Z2WA 4NTSA 4QMPA 4RRVA 4XLIA 5CXHA 5A6OA 1M7NA 4S34A 3AT4A 3NRMA 2WMSA 3ZO3A 4CTBA 3ZOSA 4O4EA 1H1WA 3HV6A 3P79A 2G2FA 4IADA 3F82A 5DGZA 5HVJA 1GZ8A 3A8XA 4BYJA 2YABA 5EM6A 1JQHA 3Q9YA 2BR1A 1WBSA 3D5VA 5EFQA 5GJDA 4B9DA 1YOLA 2NYAA 4DFNA 3MSSA 4BCHA 5I3RA 4FEVA 3HYHA 4YJQA 3M42A 1XBCA 4C8BA 2V7OA 2GNLA 1SVHA 4AA5A 3IGOA 4IM0A 3GT8A 4HVDA 1Q24A 5E91A 2G9XA 3VUMA 2OBJA 2DQ7X 2RGPA 4OLIA 5ANJA 3E64A 3K5UA 3O7LD 2VX3A 5ACBC 5C8NA 1V0PA 2PVMA 3TG1A 2X6EA 4CFVA 1OL5A 1JWHA 3D9VA 4M0YA 4KABA 4IXPA 5EKNA 2R0UA 3L9MA 2GQSA 3K3IA 5CSPA 2DYLA 4BI0A 2GQRA 5IUGA 4I4EA 2P55A 3AGLA 3MBLA 1IA8A 4RIXA 3VS7A 5HORA 3NW5A 3CY3A 5KMLA 4XRJA 4OT5A 2X9FA 2XP2A 4YUQA 4DHZA 3VS3A 1U54B 3LCOA 3EOCA 3COHA 5CVHA 1W83A 5DN3A 4UXQA 2C6KA 4QMMA 3QALE 2BAKA 4UMTA 2QHMA 3R04A 5I9VA 1OBGA 4FZDB 3DK7A 3IW5A 1GOLA 4YMJA 3OTVA 4QQ5A 2H8HA 3SW4A 2OFVA 2QOLA 4BCMA 3QZHA 2C5NA 3NDMA 4ZJVA 3EQHA 1K9AA 1YXVA 2WMUA 2OIQA 4BCOA 3S3IA 4FSWA 2OFUA 1H27A 3UG1A 4EHGA 4Y5QA 3VWAA 5L8JA 1UU7A 1FGKA 3ZO4A 4PTGA 3Q9WA 4W9WA 4RX7A 4HYUA 4EH7A 4Y85A 3VBWA 4G1WA 5IH6A 2G2HA 4TW9A 4EOPA 4QP3A 4QO9A 2PHKA 2ITZA 2PMLX 5IU2A 4U81A 4P90A 3I6WA 5FBOA 2OK1A 3GVUA 4JBOA 3ZXZA 5HD4A 3R30A 4HNFA 5FRIA 2JD5A 4M66A 4BZDA 3QQFA 3E93A 4YNEA 2QR7A 5GJFA 2Z8CA 2X7FA 5CNOA 5AM6A 5HESA 4FTQA 4EI4A 5J9ZA 1CDKA 2GSFA 3BHVA 5E8TA 4MF1A 4CRLA 4EOJA 3KKVA 4NJ3A 4QTBA 3FLQA 5CQUA 3KRJA 4D2TA 1IG1A 3ORNA 4N6YA 5B2KA 4NIFB 5I9YA 4ANSA 1OKYA 4ZTNA 2GQGA 4CKIA 4C4GA 3WYYA 4IC8A 3AMAA 4LFIA 1FMKA 4NH1A 3CR0A 4W4WA 5K0KA 1KV1A 3W0RA 5IPJA 2F2CB 3CXWA 4UWYA 2ETKA 3QCYA 3NIEA 3IDBA 1U54A 5HCYA 3U87A 4F4PA 2ZM1A 2PUNA 4YP8A 4GW8A 3RAHA 4DG3E 4F9CA 2WGJA 4KRDA 1H25A 3V5QA 3PLSA 4EOOA 2Y4PA 2YISA 5HNBA 5HCXA 4ANBA 2E9VA 3JS2A 3GQLA 4W8EA 1ZMUA 2PSQA 4PUZA 2VTIA 3COIA 3FMLA 3O2MA 2VWYA 3ZSGA 4D5KA 1XR1A 4EL9A 3HVCA 4FX3A 3W2SA 3PY3A 3TNQB 4QP9A 4TNDA 3PXYA 3PLAE 4XRLA 3E8NA 4ZLOA 4CFUA 4NCTA 3G5DA 4D55A 1FMOE 3Q9XA 1FPUA 3SG9A 1Z5MA 4NFMA 3UVRA 5AADA 2Z7SA 5KMNA 2GNIA 3VF9A 4JRNA 2X8EA 3UZTA 1GY3A 5E92A 3ANRA 4G6NA 4CT1A 4UV0A 3PSBA 4R7HA 4F1MA 3VS2A 3U6IA 3PUPA 4R6VA 5A54A 3MIAA 3SDJA 4E5WA 3OWPA 3UPZA 3C0HA 2FH9A 5HBEA 5IA5A 1WBNA 4PMTA 3TNHA 4PNKA 2VTHA 4KIOA 3PPJA 4FIFA 1YDTE 2X2KA 3W16A 3NVMB 2BRMA 5BVWA 4DEAA 4XG7A 4M84A 3R7GA 2OICA 3QZGA 1QCFA 2PVLA 3LPBA 4Y5HA 5EOLA 2VWZA 4QMWA 4O7VA 5IQEA 4B4LA 5KMJA 5HBHA 1YHVA 3QD0A 2QOHA 2ZB1A 3NGAA 4FT7A 4G31A 4YJUA 2GFSA 3V8TA 3MFSA 2WOTA 4WUNA 5KKRB 2UW6A 2QI8A 1R39A 1UKHA 2QLUA 2JFLA 2ZOQA 3P78A 3SXSA 3UO4A 4E1ZA 3QXPA 1ND4A 3HL7A 3FPQA 5L8KA 3MS9A 1K3AA 1JPAA 1OUYA 4DC2A 1J1BA 2YLEA 3EN4A 2VGOA 5EH0A 4MBJA 3ERKA 5KE0A 5CX9A 2OKRA 4RBLA 2PVFA 4ZS4A 1Y8GA 2QOCA 4DN5A 1M14A 2B9HA 3CJFA 4GCJA 4KB8A 5C8KA 2ZFYA 4FT5A 2YM5A 3KU2A 2WMRA 4PPCA 3IK3A 2OH0E 4LOOA 3F3VA 4DH8A 3I79A 4XLVA 5A6NA 3GCPA 4Y72A 3WE8A 4CV8A 4FEXA 3UQCA 3PG3A 5LVOA 4KIQA 4J52A 2A27A 3W0MA 1TQIA 2XCKA 4XMOA 4OW8A 4YZNA 4FT0A 2W1EA 3FQEA 5JRQA 2VTMA 3PJCA 3TT0A 4FTKA 3L9PA 2XKCA 4B0GA 2YZLA 3GCUA 2VX1A 4BCFA 4EZ5A 5FXRA 5CVGA 3KMWA 3NS9A 4CMUA 5HU3A 3IOPA 3VS4A 4APPA 4DEBA 5GJGA 4C4JA 2ZMCA 3OCGA 5CY3A 5HO8A 3VRZA 3O17A 4C37A 4IWDA 2G01A 3UGCA 3R28A 1YXUA 3LFEA 4I22A 4LL5A 1O6YA 4AW0A 4I5PA 4BCGA 2QU5A 2R3PA 3IW4A 4TWPA 4V04A 1H8FA 3DNDA 3RCJA 4KBKA 4MD7E 1OL6A 3FMEA 2ITTA 4BICA 4PDYA 3ZUTA 3Q5ZA 4ASXA 1M7QA 3TNIA 4K1BA 3EZRA 2HK5A 4V0GA 3MTFA 4FIHA 3IS5A 4MXXA 3BV3A 3NNVA 4K33A 3LVPA 4XOZA 4U3YA 4F6SA 5K5XA 5IQDA 3WILA 3QC4A 3FEGA 3KN6A 3SOCA 3D7TA 3UNZA 5K4IA 3A4OX 1BI8A 2Q83A 3EN9A 5IUIA 3Q4ZA 3FL4A 4TWCA 4AW5A 2YACA 2UZLA 4Z55A 4HGLA 3SRVA 3LFSA 4TPTA 5FWKK 4GYGA 2JEDA 3L8XA 2CGWA 3OOMA 4MEDA 4AT4A 3LLTA 3Q60A 3FMHA 3TIZA 3R9NA 4LUEA 2OXXA 4NYEA 1LUFA 2WO6A 2XK3A 3PSDA 3TN8A 3W2RA 4AAYA 1H0WA 5BYYA 5M4UA 5EDQA 3EQFA 2C30A 2O65A 3G2FA 4FVRA </