2A1AB

Pkr kinase domain-eif2alpha complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
274
structure length
269
Chain Sequence
GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 84
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a1aB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a1aB01
3Q60A 4NK9A 2IWIA 2VTOA 4RWLA 5HGIA 3EWHA 4RJ8A 5K5XA 4FKGA 3IW5A 3VJOA 2QO2A 3BELA 3AMBA 4JX3A 5EYKA 2JLDA 2YM4A 3EFJA 4G5JA 4XG8A 3FZOA 3T9TA 4UX9A 2B4SB 3FE3A 3QZHA 4ZZOA 4DG3E 3CJGA 4L42A 3D94A 4BIEA 3GP0A 4BGQA 2WKMA 2VWBA 1NT2A 4G2FA 3VIDA 3Q9YA 5GHVA 3E5AA 5KHWA 3E3BX 3HP2A 2O2UA 2XIXA 5CAQA 2HENA 4BDFA 5KMLA 4IAKA 4QTAA 5JFXA 2XB7A 1ATPE 3PXRA 2P4IA 1Z57A 3VULA 4RFMA 1Q8ZA 1RQQA 1YXUA 3CQWA 3RJCA 4MTAA 4FKPA 3WZJA 4D5KA 3T3UA 3UQCA 4GFGA 3OW3A 2A2AA 2DQ7X 3QXPA 3PTGA 4JVGA 3WF9A 3RPSA 4ACCA 1QPJA 4O0XA 5HO6A 4I0RA 3ZM9A 4LGDA 5BYZA 2CPKE 2HWPA 3OROA 3REPA 3MFSA 1M52A 5HNBA 2C6DA 4GKHA 4K33A 4IM2A 3BYSA 1TVOA 4N4SA 4AX8A 1VZOA 1WBTA 3C4WA 3R8LA 2XNEA 3NMUF 5DLSA 5IA4A 4LOQA 4QQ5A 4ASZA 4JT3A 4RBLA 3K5VA 1L8TA 1NVSA 2F2CB 1OL7A 3R73A 3NCZA 4ZZNA 3OBGA 3ZFMA 3GC7A 5A6OA 4Q9ZA 5M4CA 3M42A 4WNOA 1V0OA 1P4FA 5EI6A 5DT0A 3QTXA 2VTPA 2CCHA 5HE1A 1XH9A 3LFAA 4C62A 3BQCA 2J50A 4D4YA 3RZFA 2OFVA 2UW8A 2UZDA 1U46A 3AC5A 3BGQA 4II5A 3UMXA 4PDSA 2X8EA 3VBXA 2JFMA 2ZMCA 1ZYCA 3IO7A 4I94A 4Z3VA 1REKA 2WTWA 2GTMA 4AGCA 5LCJA 3LW0A 1KE9A 4FIEA 5D41A 4EZ3A 4QTDA 2CLQA 1YW2A 3G9NA 3EQHA 2B54A 3NNWA 3JPVA 4J8NA 3ZSHA 2KULA 2X8DA 3EZRA 4LM5A 2E9VA 4RA4A 4E4XA 1J1CA 2RGPA 2UW4A 3FPMA 2GNFA 2OWBA 3E64A 5AR2A 4BKZA 4A06A 4EYJA 3ODYX 3DDQA 4LG4A 2XNMA 4CQGA 4IVAA 2C3JA 1UNGA 1HOWA 4CSVA 3W2OA 1SMHA 4DEBA 1FINA 3CY3A 5CS6A 4X2FA 2FUMA 3ORXA 4E5WA 1XKKA 3TJCA 4TYIA 3KMWA 5D9HA 3UIXA 3WF5A 4EKKA 5J5TA 4LL0A 4CYJA 2XEYA 2X7OA 4PMTA 4OT5A 5J9LA 3TV6A 4APCA 2HYYA 2OF4A 5CEQA 1WMKA 2IVSA 3CR0A 3VUDA 3HAMA 2XYNA 3UOLA 3AC1A 4BDCA 3EFKA 5J9YA 3ET7A 2C3LA 4NFMA 5FEDA 4D2WA 3MTFA 4HGSA 2BRMA 3CS9A 2OFUA 3KXHA 3ORLA 5G1XA 3CTJA 2GSFA 3HZTA 3F82A 2PVNA 3V6SA 5ACBC 4EK5A 5ICPA 4HYSA 2UZTA 3ZO1A 5KZ0A 4FEUA 3NAYA 3R22A 4O7RA 3W33A 4F9CA 5CU0A 3C51A 4FG7A 2BTSA 2EXMA 4FICA 4QYHA 4BTJA 5HCYA 3PXQA 2DUVA 3OOGA 4GIIA 2J6MA 3SXFA 3KVWA 4CT1A 3VF8A 4AZSA 2CNVA 5AAGA 2PZIA 4W4XA 4M66A 4ALVA 3ZFXA 4C38A 5CVGA 3ZFYA 4IE9A 2Y7JA 2VX1A 3EQBA 5EDPA 1XH8A 4YZCA 2NP8A 5HCXA 1GOLA 2YDJA 5CEKA 2GNLA 5EG3A 2QC6A 2BRNA 2GS7A 4IFGA 3S3IA 3E92A 3PPJA 4BN1A 1NVRA 2Z7SA 4AW0A 3F6XA 3H0YA 4YGAA 5CNOA 4ZOGA 2H96A 4IVBA 5FM3A 4GU6A 2PUIA 3CPBA 3FLQA 3ORKA 3PJCA 2PWLA 4FTRA 4XHKB 3RI1A 4D2VA 5CXZA 3IGOA 2PE2A 1R78A 2QQ7A 5BVEA 4U45A 2F9GA 1P5EA 2I0VA 3E88A 4L00A 3IQ7A 4EHGA 4JR3A 4S31A 3L8PA 2UW6A 4EZ7A 2FSOX 1PXLA 2AC5A 5HVYA 3DU8A 3AC2A 1JSVA 3MBLA 2ESMA 2VWUA 3PVUA 4X3FB 4DH7A 4FR4A 2XK6A 4FKJA 4P2KA 3D5UA 3HL7A 3I79A 4IH8A 2W1EA 2X6DA 4GJ3A 4DTAA 3FY0A 3DTWA 2YA9A 2OJFE 1XH5A 2R3FA 4U0IA 5HG7A 3B8RA 3HP5A 4K6ZA 1G8SA 2B7AA 2FSMX 4QTBA 4RJ5A 2ZV7A 3MA6A 1Q5KA 5KMMA 4GT5A 3W55A 1YDRE 5LVOA 3VS1A 5HG5A 5DGZA 1BL7A 5LMKA 3S4QA 1SNUA 4QTEA 2F2UA 4AT3A 3CC6A 3MIYA 4GG5A 4NCTA 3LIJA 4TYHA 3TTIA 3UOHA 4U8ZA 4BTMA 5HX6A 3LCOA 4C4IA 4EOJA 1XH4A 3N51A 4WG3A 1UNLA 3UYSA 1H4LA 3OWKA 1YI6A 4PTCA 3ZSIA 3QF9A 1L3RE 5H8GA 3BE9A 1M17A 3ROCA 4BIBA 4J7BA 4O27B 4QP7A 4BBFA 3FEGA 3UIBA 5JGBA 5EHOA 3LFSA 4WBBB 3PJ8A 5AUYA 3HX4A 3MFUA 3QKKA 3AXWA 4ZTHA 2QVSE 3LFCA 3MH0A 3L9LA 3NYVA 3TV7A 4BWPA 3FQSA 3HV3A 3PVGA 4DE4A 2G2FA 4FV7A 1YI3A 5KMOA 4EWQA 5CF6A 4GFMA 4ITIA 3BV3A 3QA0A 3QFVA 3F61A 5BYLA 3TKIA 3AD4A 2CN5A 1PYXA 2YAAA 3IW8A 4DF3A 1Q8TA 1OUYA 4BDDA 3RHKA 2BALA 4MXYA 4X21A 5EKOA 2HZ0A 5AP0A 5CXHA 3LQ5A 4FV1A 4JBQA 3TV4A 5JFSA 1FGIA 5HD4A 2ITOA 2X39A 3HYHA 2HXQA 4PDPA 2JDOA 4C0TA 2PVJA 4C8BA 4ZY4A 3R9RA 4V04A 4FNWA 4FV0A 4UBAA 1V1KA 4OR5A 4IX3A 2W4OA 3VUMA 3EIDA 1GZOA 2NRYA 4BI2A 1H1WA 5LWMA 5GIOE 2ETRA 3JY0A 4NL0A 3NIZA 3QTRA 3UVRA 3AT4A 2Z7RA 2YN8A 2J0JA 4G6OA 5CVHA 2QI8A 4A9TA 3R8MA 1P4OA 2XCHA 2VGOA 3C9WA 3K2LA 3ORTA 3RAKA 4FV2A 4E6CA 5A14A 1EH4A 5LVLA 3IDBA 4XOYA 3VRZA 5EM8A 4BHZA 4FE2A 1WFCA 4XV2A 1ZOGA 2BMCA 1ZOEA 2PVFA 4B99A 4JOAA 4UMRA 5I9VA 3UOJA 4JRVA 2UW7A 4JJRA 3GVUA 2WMAA 3MN3A 4KS8A 4YPSA 3ZONA 3V3VA 2V0DA 3HMNA 4APPA 3ZDIA 5BPYA 3LXKA 4L6QA 2IVTA 2O8YA 4RIYA 2B9FA 2CN8A 3HAVA 5A4LA 4RVTA 1S9JA 4FNYA 4MBLA 3CPCA 3PY1A 3BRBA 4E8AA 3ACJA 4P4CA 4EONA 5BX0A 4RX5A 1PW2A 1REJA 3D7TB 2UZVA 3DS6A 4WRGA 3LFNA 2VWVA 3EJ1A 5CX9A 3RINA 3DCVA 3ZH8A 4BDHA 4GSBA 4CYIA 3R7EA 3KCFA 4FV4A 4JAIA 4CG8A 2IO6A 3MPMA 3FXXA 3R1YA 5I4NA 4DEDA 4D2RA 5G6VA 1KUTA 4UZHA 3LJ1A 5H9BA 1WBVA 4FGRA 3FLZA 2BPMA 4N57A 5D7AA 3FMLA 3Q6WA 3UJGA 5EW3A 3QD4A 3PA4A 4CFVA 1OPJA 4J95A 4C33A 3QHRA 2B53A 4B9DA 4QMYA 4FL2A 2PE1A 4X2JA 2EU9A 4IMYA 4MXOA 2CGUA 2C5VA 4HVSA 4FUXA 2R3IA 3NDMA 4PL3A 4DG2E 2GHLA 3CKWA 4RIWB 2PSQA 2PVHA 2YIQA 4FT3A 1OITA 3GU5A 3QC4A 4IANA 4KSQA 5M55A 4A07A 5JGDA 4RMZA 2PE0A 4Y46A 2XYUA 4M69B 4EL9A 1Q8UA 1P2AA 4AZFA 2C5NA 4DEGA 4IAIA 4BBEA 1OL5A 1R0PA 3LQ8A 4N6ZA 1XWSA 5CSWA 1OMWA 3OEFX 1BX6A 5D1JA 3SA0A 3O8UA 3IONA 5FQDC 2UV2A 3WYYA 3WZKA 4DT9A 3V51A 4C3RA 2VD5A 1WBSA 3VBVA 1DAYA 2RF9A 4YJTA 5DRDA 1K2PA 3TM0A 4FTKA 1OKZA 3ETAA 4FSWA 5E8SA 3P86A 4ZP5A 3E62A 1Q62A 2YFXA 3VW6A 4O7TA 2I1MA 2Q0BA 3C5IA 3DFCB 2F7EE 4I23A 4C3FA 1Y91A 3LMGA 4U79A 3ZEWA 4R7BA 3HVCA 4TYEA 4BDKA 5EI2A 3K3IA 4FL1A 2O63A 3G6HA 3MH3A 4PTGA 5GJFA 2J90A 2YCRA 5C9CA 4E7WA 5IA0A 1H1QA 3KK9A 3V5JA 4ACHA 5A46A 5L8KA 5I9XA 4FZ6A 2W5BA 2UZLA 1PXPA 4IACA 4PRJA 4AE9A 4ITJA 4AU8A 1A9UA 2X2MA 4FIIA 2WOUA 3OUKA 3OT8A 1OIQA 1OVEA 2R3RA 2QHNA 2XMYA 4I20A 2PVYA 3F2NA 2YZLA 5CYIA 3ZO3A 2PVKA 1CSNA 3BU3A 4FVQA 4TWCA 3FZSA 5FBNC 4FSZA 4D2TA 1QPEA 4EK4A 1R1WA 4IZAA 3KVXA 4YJRA 3UNZA 4BKYA 3ID6C 3GU7A 4FNZA 4MXCA 3EHAA 1YQJA 3RM6A 4OTQA 3D14A 5AUVA 3BYOA 3UODA 1PMVA 2XM9A 1MRVA 3GCQA 3PPZA 2XVDA 5EOBA 3CTQA 2PY3A 2XJ0A 2W9ZB 1MRUA 4B4LA 4FMQA 3V8SA 2OH4A 4FUYA 4OTGA 4NT4A 5GJDA 3BBWA 4GFOA 4QMLA 3RK7A 4S32A 3P23A 4EOKA 3RGFA 4JDHA 5DI1A 4BWXA 2QCSA 2RG5A 3PVWA 3W2QA 4D0WA 3HECA 3QXOA 4MF1A 3RAWA 5E8ZA 4JG7A 4IWDA 1FGKA 3UZTA 4IJPA 2CKPA 1FVVA 3C4ZA 2PUNA 1PKGA 4ZJIA 2OGVA 1ZWSA 3CIKA 1YVJA 1W8CA 3H10A 4O84A 3ODZX 4BY9E 2OZAB 3P79A 5AR7A 2JC6A 2ERZE 3LPBA 4ANMA 1Q61A 3HUCA 3DGKA 4JX7A 3FLWA 4UWCA 3DZOA 3RALA 5GZAA 4R5YA 2C5XA 4RX9A 3UPZA 4GT4A 3K5UA 4X2NA 3PDTA 5BQ0A 2WFYA 4UYNA 3UC4A 1UU9A 1CKJA 1ZYSA 3DBQA 1R0EA 2ZM4A 5ANGA 5LWNA 5CEOA 3DFAA 5T6KA 3SLSA 5CU4A 2BHEA 3DQXA 4X3FC 2OXDA 4EBVA 4RLKA 3VS0A 2Q0NA 4MNEA 2WQNA 4YBJA 4GUBA 2YIWA 5AX9A 3FMKA 2PZ5A 3LCSA 5TO8A 4DFZE 3DAJA 4DEHA 4IXPA 1UKIA 2PUUA 5JSMA 4Y5HA 1J91A 3F5UA 3MWUA 4Q5HA 3VS7A 3I0OA 4M69A 3F7WA 3NSZA 4ASXA 4KAOA 4D4SA 3O23A 2QODA 4FI1A 4L53A 3OCSA 3T9IA 4PMPA 4D1XA 5LMBA 4W8EA 3ZYAA 3U55A 2VX3A 2EUFB 5HBEA 1NXKA 4EC9A 1XH7A 2W4KA 3QYZA 3CGOA 3SV0A 2ZM1A 1SNXA 3JY9A 4CMTA 2XNPA 3ZUVA 4MXZA 4WSQA 2JD5A 3OOMA 1H8FA 4AGDA 2WIHA 3UNKA 3R6XA 5IUGA 1ZY4A 1OPLA 3QX4A 3IOKA 4EOIA 2QD9A 4KRDA 4YC6A 3S00A 4FEVA 2QG5A 4QQTA 2B1PA 3TG1A 3PG1A 3VW8A 1KWPA 2YJSA 1Q8WA 5DFPA 3MESA 2LAVA 5IDNA 5HTBA 4AZEA 3PRIA 3QQLA 2JITA 4J97A 3RP9A 3RPRA 5IISA 4D4VA 3ZC6A 4C4HA 2O0UA 2QR8A 3B2TA 4OBOA 3VF9A 4L3LA 2JEDA 5A54A 4RLLA 4FNXA 4O7LA 3U6IA 2HIWA 5J7BA 3ANQA 2BR1A 2WB8A 4YZMA 4F7JA 5A4QA 2OO8X 2W99B 1FMKA 3MIAA 5E8XA 1WBNA 2HK5A 2PHKA 3ORPA 4FKOA 4XYFA 2J0KA 4CTCA 4USFA 4GYGA 4CFMA 3LFQA 1RDQE 4PF4A 5DOSA 5CSXA 4YURA 1GZNA 3BGPA 3O51A 5IA3A 4LUDA 5FEEA 3LM0A 2JKQA 5FTQA 4DTKA 2EB2A 4S30A 5C03A 2PL0A 3KRLA 2OXYA 1XQZA 4PL5A 2BZJA 3BYUA 4Q9SA 4CFFA 5L2TA 4RSSA 2DWBA 3R00A 3EQPA 3KRWA 3O96A 4W4WA 2BIKB 3LQ3A 4W9WA 5CWZA 3ZRLA 1H26A 1BI8A 5EI8A 2Z7LA 3C4CA 2HWOA 3FZTA 4FOCA 3NUSA 5E92A 2OLCA 4KS7A 1YXTA 4A9YA 5L2IA 4PL4A 4YJSA 4E20A 5JZNA 2HZNA 1VR2A 5BMMA 3F3VA 1B39A 4QP8A 4MD9E 3W2RA 3Q53A 1LP4A 4LGGA 4RX7A 2JDRA 4FVRA 4KBCA 1IR3A 3CY2A 4H3PA 4UXQA 3BWJA 4IVDA 3EQFA 2A27A 2J51A 4OTWA 3WI6A 4AOIA 5IEYA 5KMJA 3DZQA 3EKNA 3Q5IA 3COMA 4ZS0A 3R7YA 1UNHA 4QMWA 5CEPA 3E93A 5ANIA 2G1TA 1GNGA 1Y6BA 4FX3A 3DKOA 5IEVA 3D0EA 4GS6A 4R1YA 5IKWA 1M7QA 3W8LA 3LFEA 4QQCA 4K1BA 4WIHA 3ALNA 2GHGA 3ZDUA 4BWKA 3VNTA 5E8WA 5HG8A 3RWPA 4CEGA 4ARKA 3W32A 5F20A 2ZV9A 5IQBA 1W0XC 2GU8A 4GW8A 4QPMA 2VO0A 3CXWA 3A7JA 2V62A 3POZA 4G9CA 4FEQA 4U80A 5CSVA 3UG1A 3GU8A 1TQMA 1M14A 4NIFA 2QG7A 4O81A 3LXPA 1H25A 2JKMA 3MV5A 5GJGA 3NW7A 4QMVA 4AACA 4XG2A 3S95A 4XBUA 5AEPA 2C30A 3QD3A 3OVVA 4IWQA 2IPXA 3U4WA 4O7ZA 3IW6A 1F3MC 3MY1A 3Q9XA 3PXYA 1YXVA 4DFNA 3PJ1A 3RHXA 5BVNA 2XS0A 4GL9A 5CU3A 4MYGA 4NH1A 4W4YA 5BVFA 5KBRA 1WVXA 3B8QA 3BZ3A 3V01A 3I6UA 5J87A 3QQFA 2G2HA 4D2PA 2XM8A 3A7GA 2BTRA 2YHVA 5HTIA 3GI3A 2FSLX 2UW0A 3V5LA 4CCUA 5AR3A 3CLYA 1SYKA 1ZARA 3OHTA 4HJOA 5GZ9A 4XX9A 4HYHA 4L7FA 3GB2A 4PPCA 3R7GA 3Q4CA 4JR7A 4UB7A 1XH6A 2HAKA 2ONLC 3CGFA 3IDPA 4QMUA 5EQPA 3LLAA 4C36A 2VWIA 3UDBA 5HLPA 2XKEA 3P4KA 2Z8CA 1M2RA 2VNYA 5CAUA 4ANOA 5KHXA 3QA8A 3VBYA 3H30A 4LQMA 1CKPA 5IG1A 2GNHA 3P5KA 1LEZA 4PNKA 1IA9A 5LQFA 5E8UA 1OKWA 2C1BA 3QZGA 3DK7A 1OM1A 2PVRA 4UEUA 4ANLA 3W8QA 2HOGA 2X8IA 5CAOA 5DE2A 4AA0A 3SKCA 2VUWA 3O8TA 4UXLA 4YR8A 4DEIA 1PXKA 5AIRA 4BGGA 4JIAA 3C5UA 4M7IA 5CU2A 4CFNA 3N9XA 2FO0A 3DQWA 4U6RA 3MVLA 4PPAA 5CSHA 3EB0A 4J8MA 2B9IA 4Z7HA 1SVGA 2F49A 3GENA 1KOBA 2KTYA 1Q24A 4QYGA 2B9HA 3QQHA 3VWAA 4B6LA 2YM5A 3QTZA 3CQEA 3PSDA 2WU7A 3R02A 4R5SA 4BFMA 3QTQA 4KIQA 3F3WA 4MF0A 5HVJA 5AV0A 3RM7A 3KREA 3VUGA 4FF8A 2WMSA 3E63A 3MB6A 3Q9WA 4WD5A 1YHWA 1A06A 5FWKK 4CFWA 1UWJA 2IZTA 1LPUA 2R3GA 4A9UA 3R0TA 2C5OA 3QU0A 4FOBA 2ZVAA 5CF4A 4C61A 2C6LA 3DAKA 5A9UA 2ZDUA 4KABA 2G01A 2OZOA 2XNGA 3BQRA 3EQGA 2BCJA 2PZPA 5LVPA 3R8UA 3DBCA 3NVKI 3FYJX 3JVSA 5EHLA 4EBWA 3SG8A 5IUIA 3ZUUA 5AP6A 2R7BA 4PPBA 4IEBA 3QGWA 4I92A 3FC1X 2X81A 4JDKA 3HMMA 5EFQA 4ENXA 3EOCA 3OT3A 4RWIA 3TXOA 5CENA 3WZUA 4E4LA 1KOAA 4J71A 2RFSA 2BZHB 4QO9A 3NYOA 4EHEA 2IN6A 3TKUA 1Q97A 1M2QA 3U9CA 4EQCA 5KMNA 4H05A 3GU6A 3ZRKA 3G6GA 2OJGA 3OP5A 4GYIA 5CI7A 2IW9A 4JXFA 2CNUA 4GVJA 4L44A 2ERKA 4OTPA 4TYHB 3ZLXA 4BKJA 1Q4LA 2PMOX 1W82A 3GCPA 3Q3BA 3Q32A 3QLFA 3R8VA 4WKQA 2IW8A 2AC3A 5JGAA 3AQVA 4YHTA 3A61A 1ZY5A 4IM3A 2P2IA 2QNJA 4H36A 5F94A 4EHVA 5M06A 2OJJA 3A7FA 4WSYA 3OWLA 3II5A 4C3PA 2W1IA 5DT4A 2PZRA 4U5JA 4KIKA 1Q99A 5IMEA 2QKRA 3O8PA 4ZJJA 1G3NA 3I81A 5M08A 3BHVA 5DR6A 4O0YA 2BHHA 2W0JA 3EN4A 5CTPA 1H24A 1JLUE 2VX0A 4RZVA 2UZNA 3ZSGA 3KK8A 4C4JA 3PP1A 1PMNA 2GMXA 4IC8A 4L7SA 4TZRA 4XV9A 5IZFA 1JKLA 3PJ3A 3DK3A 4I4FA 5HE0A 4PP7A 2XK8A 4BR3A 3V5TA 2G15A 2I40A 2GQRA 1VEBA 5EHYA 4WO5A 3BIZA 4G6NA 4C37A 4F1MA 3D7ZA 4ZSEA 3ZOSA 1B6CB 1HCKA 2WELA 2JDTA 4XP3A 3SXRA 5IA1A 3P7CA 3RCJA 1MQBA 3LCTA 3P08A 5AM6A 4KKHA 1OPKA 3T3VA 3ALOA 5L3AA 4HNIA 2YM6A 3SDJA 3ZZWA 2BROA 5CLPA 2XBAA 3SX9A 4E6DA 4JBVA 4M8TA 4FVPA 5AX3A 4X7QA 2F7ZE 3OWPA 3WIGA 4CLIA 4USEA 4IB5A 4G6LA 2WQMA 2CGWA 3IW4A 4Z16A 4F9BA 4C2VA 3UVPA 3NR9A 2ZAZA 4Y95A 3C13A 4G34A 4BYIA 4FTUA 3ZLYA 2C69A 1VJYA 1ZMVA 3LOKA 3OCBA 4QQJA 5A6NA 3U54A 5L8JA 3TDWA 4FBXA 1DI9A 4CKRA 4TL0A 1CDKA 2PU8A 4MD8E 4CFUA 3TNHA 3GCUA 5IU2A 3MFTA 2WQOA 1UU3A 5IF1A 2CNQA 5CI6A 4EI4A 2ZM3A 4HYIA 3BHHA 4S33A 4BDIA 2YCSA 1U5QA 3IG7A 5I3RA 2IZUA 2VAGA 3GU4A 4FSQA 4EYMA 4BDEA 3EQRA 4FV3A 1ZMUA 1J7LA 1DS5A 4YHJA 4YTCA 5FDPA 4RIYB 5BUIA 3GQLA 4FTTA 4OLIA 5F9EA 4UV0A 3F2AA 5KMIA 2PK9A 3KCKA 2PPQA 2EVAA 1QMZA 3OMVA 3DLSA 3KXZA 2Y4IB 3AC8A 5D10A 4O2PA 4BDJA 4DLJA 4F63A 3PYYA 2GNIA 2YITA 2R3JA 2ZB1A 2XRUA 3AT2A 4Q5EA 2PMLX 2X9EA 4IC7A 4JLCA 4KB8A 4YJVA 4ZAUA 1H1SA 3SGCA 4Z55A 2C4GA 4ZIMA 4CMOA 2I0EA 3DBDA 4QMSA 4GV1A 2UW3A 4NZWB 1KE7A 3SHEA 2PVMA 4P90A 4F9YA 4IADA 3TNWA 2R3OA 4JI9A 4XEYA 2W5AA 4BZNA 4FKTA 4I6BA 2OF2A 2UVXA 1FBNA 3MGYA 4HPTE 3E8DA 4N6YA 3WOWA 4OGRA 5IUHA 5B7VA 2YJRA 2VV9A 3EN7A 2W4JA 5LCKA 3CQUA 4MKCA 3QQJA 4FKWA 4E6QA 5ITAA 4OTRA 3Q52A 5GNKA 5FTOA 3VUIA 5JRQA 3CBLA 1O6YA 2YLFA 1WZYA 3MVHA 2JDVA 3FJQE 3F7ZA 3SD0A 4O7VA 3QCYA 5B2LA 4QT1A 5DR9A 5T68A 3TCPA 3VC4A 2VO6A 3OD6X 1W83A 3FV8A 3FI2A 4M0ZA 4JBOA 4NU1A 4AT4A 5J8IA 4AA4A 3D2IA 2QOKA 1OIUA 2VGPA 1BKXA 3FKLA 3LFFA 3MI9A 1M7NA 5BVDA 5M57A 4KA3A 3LCKA 2ITVA 2X7GA 3IKAA 3PG3A 2YM3A 1YXXA 4CVAA 1XBCA 2WZJA 3ORIA 5EDRA 3NUUA 3LXNA 3UO6A 5ETFA 1E9HA 1UVRA 1PRYA 2JIUA 4GH2A 5ANOA 3B2WA 4EOMA 5JK3A 3QRKA 3V8WA 3BPRA 2XKDA 3QWKA 4FSTA 2ITWA 2BDWA 3QX2A 2R5TA 3TWJA 4LI5A 2ITQA 5CT0A 2XIZA 4ENYA 4E93A 2R3HA 4ZJVA 2HELA 5AR5A 5B2KA 5DHJA 5HOAA 4LL5A 3V04A 2EB3A 3MFRA 4GT3A 1OKYA 5L6OA 5C4KA 2BKZA 3R71A 3DA6A 3MJ1A 4I6HA 2VTJA 4UMUA 2VWXA 4UZDA 5AFVA 3EN6A 3GCSA 1CMKE 4NSTA 2AYPA 3BU6A 4MCVA 5ANKA 5CF8A 3MJ2A 3ANRA 5E1EA 4USDA 4XLVA 3OS3A 5C8KA 3FSFA 1FVTA 3FUPA 1LR4A 2XNBA 4RA5A 3ELJA 1W7HA 5M09A 5FD2A 5JEBA 2B52A 4XOZA 3THBA 3KF7A 4FV5A 3ZRMA 5IQAA 4IHPA 3T8OA 3ZC5A 5M56A 1Q41A 1UWHA 2QO9A 3VVHA 4BCJA 3C50A 1W84A 3D4QA 3BLHA 4UWBA 5JQ5A 1OUKA 3TIYA 1ZXEA 3UNJA 4WRSA 3W16A 4DAWA 3SRVB 3A7HA 4PDOA 4XCUA 4C59A 3KMMA 2WMWA 5CU6A 4IM0A 3FLNC 2XK3A 3TEIA 2WTJA 2H34A 4A9RA 1Y57A 3RBWA 3QC9A 2IZSA 4FIJA 1GAGA 2FGIA 2NRUA 3BKBA 4YZBA 4ZSAA 3O71A 1PXNA 4R3CA 3FY2A 1Z9XA 5HD7A 3LJ0A 3HRCA 3UOKA 3VAPA 3HDMA 3PE1A 3I5NA 2WMVA 2OBJA 3EL7A 2O3PA 2VTTA 4M14A 3OG7A 2YEXA 4R3RA 3FC2A 3UO4A 3U8WA 4AW5A 4O96A 2PTKA 3PIZA 4NUSA 5A4TA 1MUOA 3I5ZA 2W7XA 4FZDB 4IB0A 4ZTNA 2NO3A 4FKLA 1ZZ2A 4KINA 2R9SA 4QYYA 2QOIA 4FKIA 4AN2A 4BCGA 3LAUA 3MVJA 3HA8A 3KEXA 2VWYA 4EOPA 5I5ZA 4E5AX 3KRRA 4RRVA 3UG2A 4E4MA 3E7VA 3QQUA 4M97A 4X3JA 3QRIA 5HIDA 3K3JA 2X9FA 2HZ4A 4RFZA 4CCBA 3G0EA 3COIA 1KE6A 2W1FA 4FYNA 2WTVA 2EXCX 5KKRB 1SVHA 3OY1A 5EW9A 3FMDA 2CKQA 5ANDA 3NGAA 2I0HA 5C4LA 2GPHA 4D28A 3KXNA 3IOPA 2I6LA 4MNEB 4QMNA 4KNBA 1GZ8A 2WMUA 3A7IA 4IVCA 5HIEA 4ERWA 3RPOA 3R7OA 4RC3A 4GEOA 4MH7A 5D12A 3IK3A 3TZ8A 4BTFA 3OXZA 4HCUA 4NJ3A 2C5YA 4X6QC 3RPYA 3ZU7A 3JR1A 3BCEA 1PXIA 1WVYA 4DH3A 4NYEA 5DN3A 4ANBA 3PLAE 1GIHA 1YOJA 1NA7A 1Y6AA 2WIPA 3JXWA 4IIRA 5LMKC 5AUXA 3KXMA 3FYKX 3QTIA 3A8XA 4QNYA 4AZTA 2VWWA 2GNGA 2XK7A 4FIGA 1YWVA 2V7OA 4MBJA 3F2RA 4LOOA 4DCEA 4LYNA 4BI1A 2XNOA 5GINE 3CD8A 1KE8A 4F64A 4R77A 3SW4A 2VWZA 2BRGA 4EK8A 3NIEA 3MSSA 5JFWA 3DJ6A 3FI4A 4EH7A 5EK7A 1NW1A 1OGUA 4ZMEA 3FLSA 3D83A 4EUTA 5ETAA 3F5PA 4MK0A 5C1QB 4G3EA 5IDPA 4U9AA 3U87A 3BI6A 3TUCA 1JKTA 4GMYA 3LCDA 4NKSA 2F4JA 3W10A 3N4VA 3VQUA 1E1VA 2QOFA 4G5PA 4DFLA 1QL6A 3G51A 3NPCA 4QMOA 4TNDA 3RMFA 2R4BA 1KE5A 3UMWA 2RFDA 3G9LX 3AD6A 3GOKA 3HV7A 1AGWA 4FKSA 4MXXA 1PMEA 3PRFA 3RK9A 4EOOA 2XK9A 4F99A 5C8MA 3QBNA 2B0QA 2JDSA 3CP9A 5CF5A 3MH1A 3SVVA 4V05A 2R7IA 3D5XA 3O7LB 5KE0A 3DJ5A 5M4IA 4JG6A 1P14A 3TNQB 4FSMA 4YSJA 3FZ1A 2HY0A 3UC3A 5IMXA 4MWHA 1JNKA 4HCVA 4MX9A 2PVLA 2XRWA 3QCQA 3QQGA 4IFCA 4TNBA 3VUHA 3ZUTA 5KNJA 4L52A 4KD1A 5C8NA 4O82A 3C0HA 4XJ0A 5K0XA 2OJIA 3AGMA 5IQEA 3SRVA 5AV2A 2BKKA 3WF8A 5BVOA 3R2YA 1VYZA 2IVUA 1F5QA 2WGJA 4HVIA 4ANSA 5HNIX 4FSNA 5HLNA 4FT5A 4DBNA 3EYGA 5FG8A 1ZYJA 3PWDA 3S0OA 1ZLTA 4DGNA 3BHUA 4BCQA 2WO6A 4DH1A 4HGEA 3QGYA 5EH0A 3AT3A 2ITZA 3MVMA 2RKUA 3BEAA 4TPTA 1OBDA 2VO3A 2XNNA 4MQ2A 2OIDA 3AGLA 1BUHA 3UQGA 4J52A 5AA9A 3ZBXA 2B9JA 3QUEA 4KBKA 4BZOA 3BLQA 2C1AA 4DG0E 3U6HA 4M3QA 4RIXA 5HVKA 4D1SA 5AWMA 3RWQA 1LEWA 2W5HA 2ZB0A 2WU6A 4G16A 4LMNA 3VUTA 2V22A 3I6WA 3F88A 4FG8A 2WTKB 4GIHA 4XUFA 3V5PA 4O86A 3LVPA 5K0KA 3GGFA 4HPUE 2OH0E 3WZDA 3FHIA 3BHTA 4JQ7A 4BTKA 4ACGA 4AOTA 1PHKA 4E73A 4FYOA 5JT2A 3PUPA 4YLLA 4RPVA 4HYUA 3TKHA 4ID7A 1NVQA 4PUZA 5M07A 4UWYA 4NIFB 4OTDA 2BILB 1NY3A 3OTVA 4NM5A 3RK5A 4AQCA 3QRTA 3VS2A 5EW8A 1XJDA 1G8AA 1XO2B 2W1GA 5HO8A 3FWQA 3LXLA 3A99A 3GUBA 2C6IA 4I21A 3UBDA 4ORKA 2X7FA 2BFYA 2OSCA 1U54A 2XJ2A 3GQIA 2WMBA 4I0SA 4BYJA 4X2KA 3QCSA 5EYCA 4M67A 5AP7A 3R1SA 1VYWA 3Q04A 3R21A 1QPDA 2VTRA 3M11A 3EZVA 2OICA 3P9JA 4QMZA 4QPAA 4EK3A 2YIYA 5HE3A 2CLXA 1CTPE 4FT7A 4IDTA 4M15A 5E7RA 2HW7A 3WARA 2BZIB 3KFAA 3OUNB 3C0GA 3R30A 2O65A 4OTFA 3GFWA 3TNPC 3BX5A 3FBVA 3ZXTA 4CKIA 4FC0A 2BRHA 4XG7A 5HORA 4EH8A 3DXQA 3PJ2A 4I93A 5GIPE 2E9PA 2XK4A 1JQHA 4BDGA 3DKGA 3K54A 4I5CA 4QMMA 1PKDA 4YUQA 4W4VA 3Q6UA 4FTLA 2QLQA 3NLBA 3PLSA 4R3PA 3M2WA 4K77A 2VTIA 2C6MA 4CQEA 4YTIA 4O7WA 4GRBA 3NUXA 4HNFA 1YHVA 5IQHA 4DHFA 5DG5A 1JBPE 3DNEA 3C7QA 5DNRA 4D0XA 1XR1A 3I7BA 4O6LA 5HG9A 4F6WA 1OL6A 4QMXA 5E1SA 1ND4A 4K8AA 2UZWE 4YPDA 4ZSJA 2ITTA 4HVGA 4DC2A 4QP1A 2QONA 4I4EA 2J0MB 5HKMA 2I0YA 3TUBA 4EOLA 3COHA 4L8MA 1OECA 1XHAA 4WT6A 4C4GA 4Y73A 4GK2A 2W05A 4F7SA 4FKRA 3LZBA 4AE6A 2VTQA 2VTSA 3H0ZA 4ACMA 1J7UA 2VNWA 3TIZA 5E8TA 3FKOA 3NYNA 4C2WA 4GJ2A 3Q4UA 3F3ZA 4TYGA 4YJQA 2XIYA 1ZMWA 2WOTA 2GS6A 5HICA 2GTNA 2BDFA 1MP8A 1TQIA 3DPKA 3NVMB 2RFNA 3OXTA 3LM5A 4IZ7A 3VS4A 3WBLA 2VRXA 4H1JA 4DEAA 5E90A 3VO3A 1B38A 2VTLA 3TI1A 2ITPA 5H8BA 5JRSA 3VBQA 4DFXE 5HQ0A 3DTCA 3OC1A 5AV3A 5FLFA 4GK3A 3PSCA 4TY1A 3L8VA 5AAFA 5HU3A 5FBOA 4JDIA 2IW6A 2W06A 4QRCA 1JKKA 4PWNA 3FMHA 4JDJA 2XEZA 4YO6A 5I9ZA 2E2BA 2WMQA 3KN6A 5A4CA 4EORA 2RL5A 5EM6A 3HUBA 2YWVA 4DFBA 4EQMA 2WHBA 3IDCA 3RZBA 4F4PA 3FI8A 4UYAA 4Q2AA 3PZHA 2VU3A 1ZYLA 1YWNA 2XA4A 2WPAA 4IAFA 5CZHA 5EOLA 4ZSLA 4O7NA 4I22A 4FTCA 3ORZA 5AP2A 4AFJA 4U3YA 3A2CA 5J9ZA 1U4DA 1IAJA 3ROYA 4KKGA 1JWHA 3G33A 4BZDA 3A62A 4BCNA 2UZUE 1ERKA 3A60A 4YZNA 3V5QA 2F57A 3KQ7A 3D15A 5FRIA 4ZMFA 3OCTA 4CNHA 4KIKB 5HIBA 2PYWA 4N70A 2QO7A 2QURA 4O38A 3UQFA 4ZS4A 4L46A 1ZRZA 3E8CA 3F66A 3FZRA 5TKDA 4B8LA 1RE8A 5I9UA 2R3KA 2ITNA 4IWPA 4WHZA 5LVMA 4YNOA 2QOHA 2YWPA 2J7TA 5FP5A 4ANNA 3PFQA 4QD6A 4QPSA 5KKRC 2H6DA 3H3CA 3WE8A 4ZLYA 3QRUA 2YCQA 1X8BA 4FT0A 2XJ1A 3LLTA 4FTNA 5L2QA 4EK6A 3FL4A 3C0IA 3DBFA 2OU7A 5LMAA 3R9NA 4CG9A 4BGHA 4EHZA 2WD1A 2ETMA 3CCNA 4W8DA 4WOVA 4JIKA 1FVRA 4DGLC 4AXAA 4JNWA 4HOKA 3IECA 5T3QA 3EN5A 5EKNA 3PA5A 4RJ4A 4EOSA 4WNMA 1Z5MA 4EH5A 4F09A 3W1FA 5I9YA 5K4IA 5BVWA 2Z7QA 1W98A 4O0SA 4F7LA 4JQEA 4OTHA 5AP3A 4CD0A 1ZAOA 4R8QA 2VN9A 5HCZA 3FKNA 4CZUA 1WVWA 4ZK5A 3PY0A 3QTSA 4EH4A 4C7TA 4Y5QA 4S2ZA 4YJPA 3DV3A 4F6SA 3NUNA 2QU5A 3Q5ZA 3G90X 4XG3A 3VS6A 1G5SA 1OL1A 5CNNA 5CT7A 4BCHA 5BVKA 4BVUA 4HGLA 3ZTXA 4EZ5A 1K3AA 3O50A 5L6WL 3DKFA 5EYDA 3WYXA 2HXLA 1CM8A 3P78A 3VN9A 4XRLA 2R64A 3OZ6A 3KL8A 2FH9A 3LHJA 5IA2A 4QMPA 4FKVA 3RNIA 2EWAA 3OEZA 4RFYA 3LMIA 4AS0A 3JUHA 1PJKA 4HVHA 2QLUA 3TDVA 4BDAA 4BCOA 4QP6A 3IS5A 4G31A 1H08A 3N4UA 4LV5A 3HNGA 3UTOA 4E3CA 4PV0A 2BVAA 2YERA 3ULZA 4OTIA 1UA2A 1YRPA 4YP8A 3RPVA 4OBPA 2OW3A 2UUEA 3QCXA 4L45A 2YIRA 3P7AA 4GVAA 1WCCA 3FMJA 4MHAA 5CEIA 4IQ6A 4AAAA 2X0GA 4IB1A 1RW8A 3JVRA 2YIXA 2W9FB 3ACKA 3GT8A 2VO7A 2Z60A 1OI9A 4K18A 4MD7E 3ENHA 4XG9A 4AP7A 5E4HA 3N4TA 3KXXA 4JS8A 1MRYA 3ZHPC 4YSMA 3EQCA 4QMQA 2QOOA 3O7LD 1S9IA 3AC3A 3O17A 4J53A 3TZMA 4F1OA 3POOA 3SAYA 3ZBFA 5IPJA 4EKLA 2Y6OA 4QMTA 3R8PA 2J0IA 4OAUC 2R0UA 4I24A 3PXFA 1H0VA 4I5PA 4DTBA 3BEGA 4XMOA 4AW2A 4CV9A 4A7CA 3FXZA 3UZRA 1F0QA 3NNXA 4N0SA 3WILA 4E4NA 1SM2A 2RIOA 4EH9A 2VTMA 5HO7A 5HX8A 4FTAA 1UV5A 3QTUA 4E5BA 3HMIA 4I0TA 3ZZEA 5EQEA 3HMPA 3I1AA 4L43A 4TKSA 2IG7A 4EC8A 3CE3A 4DH5A 3ENMA 3R7IA 1O6KA 1R3CA 2OIBA 3MY0A 1E1XA 3U4UA 3NYXA 5AV1A 2WTKC 4M84A 2BAJA 3RVGA 4D9TA 4HZRA 4YHFA 4RGJA 4HGTA 2DYLA 4U3ZA 3EN9A 1RJBA 1WBPA 4DYMA 3PA3A 4F08A 4UN0C 3AMAA 1OKVA 2ZYBA 3ORMA 4D1ZA 2JKKA 1GY3A 3NS9A 4EH6A 4LUEA 3FMMA 3PY3A 3R7UA 3E8EA 3VHKA 4QYEA 2P0CA 4GUEA 1O9UA 5J79A 3KULB 4V0GB 4ACDA 3V5WA 5LJJA 2C6TA 4L68A 3UVQA 3HV5A 4XBRA 2O64A 4M68A 2WQEA 4H39A 5JZJA 2YDIA 5B0XA 3HV4A 3KB7A 2ITXA 4FKQA 2XIRA 5J5SA 2X4ZA 2YCFA 1M2PA 2DS1A 2W1HA 4NM7A 1T45A 5FP6A 2Q83A 3R1NA 4KIOA 4DLIA 4IZYA 3NW6A 3TT0A 3F5GA 2CKOA 4DBXA 4FSRA 4AGUA 2FB8A 3QZFA 4KRCA 2P2HA 4Z9LA 5E91A 5FM2A 3FMNA 3FQEA 1XBAA 3Q2JA 3WIKA 4EQUA 3OBJA 3F3UA 4NFNA 4F1TA 2BZKB 3LFDA 2YM7A 4S34A 1WBWA 3MS9A 4G3CA 2ZV2A 3NX8A 5A3XA 3NUAA 4IX6A 5K9IA 3QWJA 3E3PA 3KXGA 4Y85A 4DH8A 3R28A 4CT2A 5BUEA 1TKIA 4P7EA 1GZKA 2UZEA 3DKCA 4ZEGA 4WUNA 4LRKA 4OAVB 4PY1A 3QL8A 4J1RA 1GIIA 4YZ9A 2GFCA 4ZSGA 1DM2A 4CRSA 3EFLA 3FAAA 3CD3A 2I7QA 3KC3A 4ALWA 2YAKA 3BLRA 4QNAA 4D58A 2IZRA 3DB6A 4TWOA 4X6RA 3LKMA 5IEXA 1YKRA 2CDZA 3D2KA 3PVBA 4ZZMA 2F7XE 3UIUA 3H4JA 4O0TA 3ZLSA 3IPHA 4ZY6A 4RC4A 4RJ7A 4QP2A 1GIJA 4L3JA 3AD5A 4FZAB 3QD2B 1PXOA 3MPAA 2YZAA 4DGOA 3BWFA 3EQIA 5DT3A 2E9OA 5IH5A 5HU9A 4O0UA 1IAHA 1J7IA 2VTAA 2XF0A 3HRBA 4G3DA 5AP1A 4ZY5A 4ZXTA 4CFXA 5TOZA 3RNYA 4RWJA 4TN6A 1AD5A 3SC1A 3A4OX 3AG9A 3MY5A 5DWRA 2P33A 4IAYA 4EH2A 4XV1A 3DOGA 4YJNA 5FEQA 3G15A 4I6QA 5AR4A 1Q3DA 2JAVA 2A19B 1ZOHA 5FXQA 2C47A 5AM7A 5AR8A 4MNFA 4PQNA 3CTHA 5AUZA 4FZFB 3BE2A 2JBOA 4I41A 3BGZA 4IAZA 4WNPA 4XH6A 4ZLZA 2OI4X 4ONAA 4CV8A 4WG4A 1YWRA 4YLKA 2PMIA 4U42A 5EM7A 2BAQA 5DRBA 3NWWA 4AFEA 2JIVA 2W1ZA 3KA0A 2GQGA 4OT6A 3DT1A 5IQDA 4M0YA 5IQFA 3MB7A 3JS2A 3JYAA 1K9AA 4F65A 4YMJA 4CXAA 4FT9A 4O6EA 2J9MA 3LFBA 4G3GA 2IJMA 3QUDA 4H1MA 5D7VA 4JRNA 2GNJA 2WTIA 5H2UA 4CGAA 4P5ZA 4RQKA 4RIOA 2E9NA 4XV3A 4F0FA 5AADA 5JQ8A 1TQPA 4JL9A 2JAMA 2QOBA 5L8LA 3R7VA 3ZCLA 1KV2A 4JAJA 5C26A 4QP3A 4G3FA 4Y72A 2RG6A 3PPKA 4NWMA 5KZIA 5LARA 4FEXA 5EM5A 4A4LA 3KULA 4V0GA 4YJUA 2YDKA 4AZVA 3GC9A 2OIQA 4XG4A 5AUWA 4BCIA 5DMZA 3ZO4A 3R2BA 4I1ZA 3UP2A 3KKVA 1J3HA 2VZ6A 5DPVA 1UU8A 3EYHA 3IGGA 4AOJA 4ZTQA 5CSPA 4DITA 3F69A 4YU2A 2R3QA 1KSWA 3UGCA 4BBMA 4EEVA 4KIPA 4ZLOA 3L8SA 2C3IB 5GZ8A 3CEKA 3UIMA 3HA6A 5IQGA 2RFEA 4O1PA 2FYSA 4R6VA 4X0MA 4H3QA 3P0MA 3R9DA 1JPAA 4C02A 1JOWB 3L9MA 2XUUA 1H1PA 1T46A 2C68A 3FDNA 4RVMA 2XH5A 4O22A 5IA5A 5DEYA 3C4XA 4C4EA 3UYTA 3VJNA 3DK6A 4D9UA 1YOMA 2R2PA 2XKCA 4LRJA 5HEZA 4FTMA 3UE4A 3ITZA 5TT7A 3FXWA 4PTEA 2QKWB 3EMGA 3RKBA 4BCFA 4NEUA 4EH3A 5M53A 1IASA 1FQ1B 2ACXA 4IJ9A 4LOPA 4ASDA 3A8WA 3ATSA 5E8YA 4QOXA 5KCVA 1Y8GA 1BLXA 2C6OA 2J4ZA 4IW0A 5AIKA 4ASEA 5CANA 4JQ8A 5AUTA 3R83A 1WAKA 5J7HA 2P55A 1OBGA 2X1NA 4ZTLA 4GG7A 2Y4PA 4FGBA 4CLJA 4D5HA 3VBWA 5JFVA 4RT7A 1JKSA 4U7ZA 1IG1A 2UW5A 5AUUA 1QPCA 1I44A 1JSUA 4BI0A 4DINA 4J98A 4TTHB 3RCDA 4J96A 4ERKA 4RIXB 4NJDA 3GOPA 5D11A 5I9WA 2WMRA 3CSVA 3NUPA 4H58A 3E87A 1YI4A 5DEWA 2JIIA 2YACA 3KF4A 3KMUA 3MW1A 4GK4A 4XRJA 3S2PA 3R01A 3ATTA 3U6JA 2WTDA 2P3GX 2QU6A 4KSPA 2LGCA 3MPTA 3O0GA 4YTFA 5JH6A 3R63A 3PXZA 4PMMA 4O0RA 3TNIA 5FXSA 4NM3A 3KN5A 1U5RA 1ZZLA 3MYGA 4ZTRA 3TACA 2YLEA 3NNUA 3QD0A 4AT5A 3PWYA 4K9YA 4QTCA 3NRMA 3P1AA 1PF8A 2XIKA 3OF0A 2JBPA 3KRXA 3NZ0A 4O91A 4X3FA 5DVRA 3BHYA 3GFEA 3F5XA 5IQCA 4R7HA 1U54B 3LMHA 3DB8A 3CJFA 4TYJA 4G17A 3RAHA 5CALA 2HW6A 2CMWA 4XLIA 5KMKA 4MXAA 4C34A 3SXSA 4FK6A 4QP4A 4U97A 4TWNA 5H8EA 4AZWA 3HEGA 3ZO2A 4O2ZA 4RC2A 4NKAA 1PMUA 4R7IA 4DFYA 2XCKA 5LOHA 3OXIA 3BU5A 3FSKA 5HI2A 5HNGA 4F0GA 4F6UA 1ZYDA 2WEIA 4DCAA 4R78A 1J1BA 4DGGA 4DFUA 4NCTC 5HZNA 1PY5A 4HZSA 3E8NA 2G2IA 5HE2A 5CVFA 5HLWA 1GJOA 4WBOA 1OIRA 2X4FA 2GFSA 4X2GA 4UALA 4U41A 4UMQA 3SOAA 3G0FA 3SOCA 1KV1A 3DNDA 4RQVA 4A9SA 4RJ6A 5ANEA 3KRJA 4L67A 3UP7A 4AA5A 5KO1A 3FHRA 1PYEA 2JFLA 2XBJA 3WE4A 4BIDA 2H8HA 4K2RA 4IDVA 3DJ7A 4LFIA 4E1ZA 4MVFA 5EYMA 1UU7A 5IH6A 5JMSA 2C3KA 2JKOA 3H9OA 4I5HA 2H9VA 4NW5A 5BUJA 3MDYA 3VBTA 3W2SA 1YXSA 5IQIA 5ACKA 4TW9A 2REIA 2O5KA 4MAOA 2WAJA 3C1XA 4Y83A 4F9WA 4O83A 4CRLA 4FIFA 2XKFA 4E26A 4ZTMA 4GKIA 5FTGA 4RX8A 1FPUA 4CKJA 3PIXA 4BRXA 5HTCA 3CKXA 4HCTA 4PP9A 4WUAA 4XS2A 3FPQA 4PNIA 3W18A 1H28A 3Q4TA 4XG6A 3L9NA 1H27A 1HCLA 5HHWA 3QYWA 4IX4A 5K3YA 4HVDA 5KX8A 3HKOA 3U51A 4ALUA 2OXXA 2E9UA 2BUJA 1YDTE 2Y9QA 3VUKA 3S1HA 3NNVA 2VTHA 4WNKA 4RVLA 4A4XA 1DAWA 3Q2MA 3Q9ZA 4OUCA 5BNJA 4AUAA 4FTIA 2R0IA 2Z2WA 4R1VA 4YLJA 2QHMA 3COKA 5ANJA 2NNWB 4BCPA 4BB4A 3TTJA 3NCGA 2WTCA 4AGWA 1DI8A 1H07A 4D55A 2GQSA 4XP2A 3Q4ZA 3EH9A 4M13A 4BDBA 1YOLA 2J5EA 2RSVA 4D2SA 5LVNA 4IB3A 5L6PA 4A4OA 3EFWA 1URWA 2VTNA 3QAME 3GC0A 3FZPA 4ANQA 4Z7GA 2BDJA 5I0BA 5JN2A 4RJ3A 5DA3A 5ETCA 1YHSA 3ZS5A 5E9EA 3A4PA 4DEEA 3OWJA 1O6LA 4G1WA 5ETIA 5CEMA 3PIYA 5KUPA 2FSTX 4WA9A 4FV6A 4OBQA 3O2MA 4WG5A 4QP9A 4OW8A 5DIAA 4ZTSA 3BBTB 4FV9A 2R3LA 3ZLWA 5FGKA 5M44A 1OIYA 1AQ1A 4FV8A 3P7BA 5LXMA 3V8TA 1FMOE 2QOLA 3ERKA 4NM0A 2ZJWA 1WBOA 4BCMA 5EQYA 2IVVA 2OG8A 2Y4IC 4IWOA 4L01A 2V5QA 1SVEA 3SQQA 2UVYA 3HDNA 4E6AA 5CAVA 2ITYA 2CJMA 3D7TA 4NTTA 2HCKA 2SRCA 4CZTA 3NAXA 4EJNA 4LGHA 1Q3WA 3TN8A 3W2PA 5KBQA 2ITUA 2X2LA 2B55A 3QHWA 3QRJA 3GEQA 4LV8A 3VHEA 3DY7A 4FIHA 4C4FA 4U40A 4W9XA 1A48A 4FKUA 1Y8YA 3PXKA 3I4BA 3R04A 2YM8A 5L2WA 3G2FA 2V7AA 3OY3A 3NW5A 3D9VA 4RG0A 4F0IA 3TL8A 2UZBA 3MA3A 5A4EA 4DGMA 4FSYA 4YO4A 4KBAA 4O21A 3QTWA 2QR7A 3ZEPA 5F1ZA 4U44A 4BICA 2YABA 2C0IA 3G5DA 3ZMMA 1JAMA 4EUUA 5K5NA 3LE6A 3DLZA 4AF3A 3F3TA 5CZIA 2J2IB 4FTOA 1PXJA 3R9OA 2WXVA 2ONLA 4RIWA 4IX5A 2A4LA 1MQ4A 5E8VA 4YZDA 1IEPA 4RWKA 4F9AA 3H9FA 3ORNA 3GC8A 1SZMA 4O0VA 3OTUA 1OB3A 2XZSA 4IAAA 2GS2A 4C57A 3SW7A 2A0CX 5CQWA 4YBKA 3FL5A 4M12A 1H1RA 2UVZA 3WF7A 2C6KA 3R8ZA 4O7SA 5HBHA 2EXEA 4EOQA 5J1WA 2BIYA 3MTLA 5AMNA 3E7OA 4NTSA 4QYFA 1U59A 4C35A 2W17A 1OL2A 2AUHA 2CHLA 3QQKA 3DBEA 2X6EA 4IBMA 1FOTA 4YJOA 5HBJA 3QUPA 5M4FA 4LRMA 4DA5A 5AV4A 1BMKA 3DXNA 3PE2A 2HY81 1JVPP 1H00A 2CKEA 4O1OA 4TWPA 4V01A 5HESA 3HGKA 3GBZA 3L8XA 2GDOA 4XNEA 2W96B 2QOCA 3QLGA 2GCDA 3V6RA 2OK1A 3C4EA 4K11A 4FODA 4C58A 2W1DA 5FDXA 1CKIA 1IRKA 3PSBA 4BC6A 4BCKA 2OJ9A 3FLYA 5AJQA 2PUPA 2X2KA 3AC4A 2ZMDA 5CQUA 4U43A 4AN3A 5TE0A 4MWIA 2C6EA 4NW6A 4CTBA 2BFXA 4KKEA 4MEDA 4YC3A 4I3ZA 3RAIA 4G9RA 3W2CA 3DXPA 3KGAA 4B8MA 4L9IA 5DYJA 5CASA 1JSTA 2G9XA 4PX6A 1V0BA 3UO5A 1H01A 4FTJA 4FTQA 3ULIA 3KU2A 2J5FA 3OW4A 3WF6A 4F7NA 4UMTA 2QOQA 1IA8A 4AW1A 2NPQA 4J99A 4K0YA 3PZEA 4PMSA 3DAEA 2BRBA 3OFMA 2WMTA 4FZ7A 4JG8A 5DR2A 5EDQA 3TJDA 4BF2A 4H3BA 3EL8A 3EKKA 1BL6A 4GCJA 3U9NA 4L3PA 5L2SA 2ETKA 4YNEA 1QCFA 3UZPA 4D4RA 2R3PA 4TRLA 3EQDA 5DBXA 5BMSA 4I5MA 3ZM4A 5H3QA 5FUTA 5M51A 4CMUA 3L1SA 4AWIA 3FQHA 2Z02A 5TR6A 2Y6MA 3I0QA 3UPXA 2R3NA 3AOXA 1YDSE 2CSNA 2OKRA 2PZYA 1BI7A 2UZOA 3D5VA 2UW9A 4I6FA 5CY3A 4EWHA 2PULA 4BHNA 2ZOQA 1Q8YA 5CAPA 5AA8A 4GU9A 4TT7A 2FA2A 4BL1A 3BYVA 4XP0A 2W1CA 5IH4A 4RZWA 4IZ5A 3R1QA 4FK3A 1UKHA 5AAEA 3FI3A 4ITHA 3RTPA 3OCGA 3QKMA 3AMYA 3H9RA 4YTHA 5M4UA 3BYMA 2OZAA 2WMXA 3GXLA 1STCE 4JBPA 4MBIA 5F4NA 4UMPA 5FXRA 2V55A 3DDPA 4CZYB 4B7TA 2YISA 2C0TA 5C27A 5DH3A 1V0PA 5B2MA 3VQHA 3VS3A 3HRFA 2Y8OA 3GCVA 4F70A 5K4JA 4RVKA 4O0WA 3TZ9A 2GHMA 4DT8A 2WQBA 3I7CA 5JKGA 1R39A 1APME 4FL3A 3GNIB 1XBBA 3TZ7A 2WNTA 2R3MA 2FVDA 2ZV8A 3F9NA 3VS5A 3HV6A 1I09A 4U81A 3R9HA 3HLLA 1OZ1A 3PP0A 3MH2A 3WZEA 2HZIA 4Y8DA 1PXMA 4TXCA 4HW7A 3BV2A 3LJ2A 5AP5A 1H0WA 5BYYA 4FG9A 5J95A 3VRYA 4EJ7A 2Y0AA 4MQ1A 3NUYA 3TUDA 4AG8A 4LMUA 5C01A 3SG9A 3QZIA 2CGVA 4P5QA 5J1VA 4B0GA 3Q96A 4FEWA 2PMNX 2ZDTA 3I60A 3D5WA 3QKLA 4DN5A 4KUJA 1URCA 5I3OA 4PDYA 2J0LA 5L4QA 3C4FA 4AN9A 3ZXZA 2JGZA 3M1SA 3IW7A 2WEVA 2CCIA 2BAKA 1BYGA 2C0OA 4FA2A 3QALE 4YC8A 2XP2A 1LUFA 5F95A 3KY2A 4FSUA 2CGXA 2A1AB 3L9PA 4O7YA 3NEWA 4UY9A 5AP4A 5TF9A 3HMOA 3FMEA 4KWPA
chains in the Genus database with same CATH superfamily
3Q60A 4NK9A 2IWIA 2VTOA 4RWLA 5HGIA 3EWHA 4RJ8A 5K5XA 4FKGA 3IW5A 3VJOA 2QO2A 3BELA 3AMBA 4JX3A 5EYKA 2JLDA 2YM4A 3EFJA 4G5JA 4XG8A 3FZOA 3T9TA 4UX9A 2B4SB 3FE3A 3QZHA 4ZZOA 4DG3E 3CJGA 4L42A 3D94A 4BIEA 3GP0A 4BGQA 2WKMA 2VWBA 1NT2A 4G2FA 3VIDA 3Q9YA 5GHVA 3E5AA 5KHWA 3E3BX 3HP2A 2O2UA 2XIXA 5CAQA 2HENA 4BDFA 5KMLA 4IAKA 4QTAA 5JFXA 2XB7A 1ATPE 3PXRA 2P4IA 1Z57A 3VULA 4RFMA 4FJVA 1Q8ZA 1RQQA 1YXUA 3CQWA 3RJCA 4MTAA 4FKPA 3WZJA 4D5KA 3T3UA 3UQCA 4GFGA 3OW3A 4DDGA 2A2AA 2DQ7X 3QXPA 3PTGA 4JVGA 3WF9A 3RPSA 4ACCA 1QPJA 4O0XA 5HO6A 4I0RA 3ZM9A 4LGDA 5BYZA 4O4DA 2CPKE 2HWPA 3OROA 3REPA 3MFSA 1M52A 5HNBA 2C6DA 4GKHA 4K33A 4IM2A 3BYSA 1TVOA 4N4SA 4AX8A 1VZOA 1WBTA 3C4WA 3R8LA 2XNEA 3NMUF 5DLSA 5IA4A 4LOQA 4QQ5A 4ASZA 4JT3A 4RBLA 3K5VA 1L8TA 1NVSA 2F2CB 1OL7A 3R73A 3NCZA 4ZZNA 3OBGA 3ZFMA 3GC7A 5A6OA 4Q9ZA 5M4CA 3M42A 4WNOA 1V0OA 1P4FA 5EI6A 5DT0A 3QTXA 2VTPA 2CCHA 5HE1A 1XH9A 3LFAA 4C62A 3BQCA 2J50A 4D4YA 3RZFA 2OFVA 2UW8A 2UZDA 1U46A 3AC5A 3BGQA 4II5A 3UMXA 4PDSA 2X8EA 3VBXA 2JFMA 2ZMCA 1ZYCA 3IO7A 4I94A 4Z3VA 1REKA 2WTWA 3TMOA 2GTMA 4AGCA 5LCJA 3LW0A 1KE9A 4FIEA 5D41A 4EZ3A 4QTDA 2CLQA 1YW2A 3G9NA 3EQHA 2B54A 3NNWA 3JPVA 4J8NA 3ZSHA 2KULA 2X8DA 3EZRA 4LM5A 2E9VA 4RA4A 4E4XA 1J1CA 2RGPA 2UW4A 3FPMA 2GNFA 2OWBA 3E64A 5AR2A 4BKZA 4A06A 4EYJA 3ODYX 3DDQA 4LG4A 2XNMA 4CQGA 4IVAA 2C3JA 2ZFYA 1UNGA 1HOWA 4CSVA 3W2OA 1SMHA 4DEBA 1FINA 3CY3A 5CS6A 4X2FA 2FUMA 3ORXA 4E5WA 1XKKA 3TJCA 4TYIA 3KMWA 5D9HA 3UIXA 3WF5A 2X0PA 4EKKA 4LL0A 4CYJA 2XEYA 2X7OA 4PMTA 4OT5A 5J9LA 3TV6A 4APCA 2HYYA 2OF4A 5CEQA 1WMKA 2IVSA 3CR0A 3VUDA 3HAMA 2XYNA 3UOLA 3AC1A 4BDCA 3EFKA 5J9YA 3ET7A 2C3LA 4NFMA 5FEDA 4D2WA 3MTFA 4HGSA 2BRMA 3CS9A 2OFUA 3KXHA 3ORLA 5G1XA 3CTJA 2GSFA 3HZTA 3F82A 2PVNA 3V6SA 5ACBC 4EK5A 5ICPA 4HYSA 2UZTA 3ZO1A 5KZ0A 4FEUA 3NAYA 3R22A 4O7RA 3W33A 4F9CA 5CU0A 3C51A 2IEWA 2BTSA 2EXMA 4FG7A 4FICA 4QYHA 4BTJA 5HCYA 3PXQA 2DUVA 3OOGA 4GIIA 2J6MA 3SXFA 3KVWA 3BLAA 4CT1A 3VF8A 4AZSA 2CNVA 5AAGA 2PZIA 4W4XA 4M66A 4ALVA 3ZFXA 4C38A 5CVGA 3ZFYA 4IE9A 2Y7JA 2VX1A 3EQBA 5EDPA 1XH8A 4YZCA 2NP8A 5HCXA 1GOLA 2YDJA 5CEKA 2GNLA 5EG3A 2QC6A 4O4BB 2BRNA 2GS7A 4IFGA 3S3IA 3AKJA 3E92A 3PPJA 4BN1A 1NVRA 2Z7SA 4AW0A 3F6XA 3H0YA 4YGAA 5CNOA 4ZOGA 2H96A 4IVBA 5FM3A 4GU6A 2PUIA 3CPBA 3FLQA 3ORKA 3PJCA 2PWLA 4FTRA 4XHKB 3RI1A 4D2VA 5CXZA 2XALA 3IGOA 2PE2A 1R78A 2QQ7A 5BVEA 4U45A 2F9GA 1P5EA 2I0VA 3E88A 4L00A 3IQ7A 4EHGA 4JR3A 4S31A 3L8PA 2UW6A 4EZ7A 2FSOX 1PXLA 2AC5A 5HVYA 3DU8A 3AC2A 1JSVA 3MBLA 2ESMA 2VWUA 3PVUA 4X3FB 4DH7A 4FR4A 2XK6A 4FKJA 4P2KA 3D5UA 3HL7A 3I79A 4IH8A 2W1EA 2X6DA 4GJ3A 4DTAA 3FY0A 3DTWA 2YA9A 2OJFE 1XH5A 2R3FA 4U0IA 5HG7A 3B8RA 3HP5A 4K6ZA 1G8SA 2B7AA 2FSMX 4QTBA 4RJ5A 2ZV7A 3MA6A 1Q5KA 5KMMA 4GT5A 3W55A 1YDRE 5LVOA 3VS1A 5HG5A 5DGZA 1BL7A 5LMKA 3S4QA 1SNUA 4QTEA 2F2UA 4AT3A 3CC6A 3MIYA 4GG5A 4NCTA 3LIJA 4TYHA 3TTIA 3UOHA 4U8ZA 4BTMA 5HX6A 3LCOA 1ST0A 4C4IA 4EOJA 1XH4A 3N51A 2A98A 4WG3A 1UNLA 3UYSA 1H4LA 3OWKA 1YI6A 4PTCA 3ZSIA 3QF9A 1L3RE 5H8GA 3BE9A 1M17A 3ROCA 4BIBA 4J7BA 4O27B 4QP7A 4BBFA 3FEGA 3UIBA 5JGBA 5EHOA 3LFSA 4WBBB 3PJ8A 5AUYA 3HX4A 3MFUA 3QKKA 3AXWA 4ZTHA 2QVSE 3LFCA 3MH0A 3L9LA 3NYVA 3TV7A 4BWPA 3NFGB 3FQSA 3HV3A 3PVGA 4DE4A 2G2FA 4FV7A 1YI3A 5KMOA 4EWQA 5CF6A 5BV3A 4GFMA 4ITIA 3BV3A 3QA0A 3QFVA 3F61A 5BYLA 3TKIA 3AD4A 2CN5A 1PYXA 2YAAA 3IW8A 4DF3A 1Q8TA 1OUYA 4BDDA 3RHKA 2BALA 4MXYA 4X21A 5EKOA 2HZ0A 5AP0A 5CXHA 3LQ5A 4FV1A 4JBQA 3TV4A 5JFSA 1FGIA 5HD4A 2ITOA 2X39A 3HYHA 2HXQA 4PDPA 2JDOA 4C0TA 2PVJA 4C8BA 4ZY4A 3R9RA 4V04A 4FNWA 4FV0A 4UBAA 1V1KA 4OR5A 4IX3A 2W4OA 3VUMA 3EIDA 1GZOA 2NRYA 4BI2A 1H1WA 5LWMA 5GIOE 2ETRA 3JY0A 4NL0A 3NIZA 3QTRA 3UVRA 3AT4A 2Z7RA 2YN8A 2J0JA 4G6OA 5CVHA 2QI8A 4A9TA 3R8MA 1P4OA 2XCHA 2VGOA 3C9WA 3K2LA 3ORTA 3RAKA 4FV2A 4E6CA 5A14A 1EH4A 5LVLA 3IDBA 4XOYA 3VRZA 5EM8A 4BHZA 4FE2A 1WFCA 4XV2A 1ZOGA 2BMCA 1ZOEA 2PVFA 4B99A 4JOAA 4UMRA 5I9VA 3UOJA 4JRVA 2UW7A 4JJRA 3GVUA 2WMAA 3MN3A 4KS8A 4DHJA 4YPSA 3ZONA 3V3VA 2V0DA 3HMNA 4APPA 3ZDIA 5BPYA 3LXKA 4L6QA 2IVTA 2O8YA 4RIYA 2B9FA 2CN8A 3HAVA 5A4LA 4RVTA 1S9JA 4FNYA 4MBLA 3CPCA 3PY1A 3BRBA 4E8AA 3ACJA 4P4CA 4EONA 5BX0A 4RX5A 1PW2A 1REJA 3D7TB 2UZVA 3DS6A 4WRGA 3LFNA 2VWVA 3EJ1A 5CX9A 3RINA 3DCVA 3ZH8A 4BDHA 4GSBA 4CYIA 3R7EA 3KCFA 4FV4A 4JAIA 4CG8A 2IO6A 3MPMA 3FXXA 3R1YA 5I4NA 4DEDA 4D2RA 5G6VA 1KUTA 4UZHA 3LJ1A 5H9BA 1WBVA 4FGRA 3FLZA 2BPMA 4N57A 5D7AA 3FMLA 3Q6WA 3UJGA 5EW3A 3QD4A 3PA4A 4CFVA 1OPJA 4J95A 4C33A 3QHRA 2B53A 4B9DA 4QMYA 4FL2A 2PE1A 4X2JA 2EU9A 4IMYA 4MXOA 2CGUA 2C5VA 4HVSA 4FUXA 2R3IA 3NDMA 4PL3A 4DG2E 2GHLA 3CKWA 4RIWB 2PSQA 2PVHA 2YIQA 4FT3A 1OITA 3GU5A 3QC4A 4IANA 4KSQA 5M55A 4A07A 5JGDA 4RMZA 2PE0A 4Y46A 3VONA 2XYUA 4M69B 4EL9A 1Q8UA 1P2AA 4AZFA 2C5NA 4DEGA 4IAIA 4QDEA 4BBEA 1OL5A 1R0PA 3LQ8A 4N6ZA 1XWSA 5CSWA 1OMWA 3OEFX 1BX6A 5D1JA 3SA0A 3O8UA 3IONA 5FQDC 2UV2A 3WYYA 3WZKA 4DT9A 3V51A 4C3RA 2VD5A 1WBSA 3VBVA 1DAYA 2RF9A 4YJTA 5DRDA 1K2PA 3TM0A 4FTKA 1OKZA 3ETAA 4FSWA 5E8SA 3P86A 4ZP5A 3E62A 1Q62A 2YFXA 3VW6A 4O7TA 2I1MA 2Q0BA 3C5IA 3DFCB 2F7EE 4I23A 4C3FA 1Y91A 3LMGA 4U79A 3ZEWA 4R7BA 3HVCA 4TYEA 4BDKA 5EI2A 3K3IA 4FL1A 2O63A 3G6HA 3MH3A 4PTGA 5GJFA 2J90A 2YCRA 5C9CA 4E7WA 5IA0A 1H1QA 3KK9A 3V5JA 4ACHA 5A46A 5L8KA 5I9XA 4FZ6A 2W5BA 2UZLA 1PXPA 4IACA 4PRJA 4AE9A 4ITJA 4AU8A 1A9UA 2X2MA 4FIIA 2WOUA 3OUKA 3OT8A 1OIQA 1OVEA 2R3RA 2QHNA 2XMYA 4I20A 2PVYA 3F2NA 2YZLA 5CYIA 3ZO3A 2PVKA 1CSNA 3BU3A 4FVQA 4TWCA 3FZSA 5FBNC 4FSZA 4D2TA 1QPEA 4EK4A 1R1WA 4IZAA 3KVXA 4YJRA 3UNZA 4BKYA 3ID6C 3GU7A 4FNZA 4MXCA 3EHAA 1YQJA 3RM6A 4OTQA 3D14A 5AUVA 3BYOA 3UODA 1PMVA 2XM9A 1MRVA 3GCQA 3PPZA 2XVDA 5EOBA 3CTQA 2PY3A 2XJ0A 2W9ZB 1MRUA 4B4LA 4FMQA 3V8SA 2OH4A 4FUYA 4OTGA 4NT4A 5GJDA 3BBWA 4GFOA 4QMLA 3RK7A 4S32A 3P23A 4EOKA 3RGFA 4JDHA 5DI1A 4BWXA 2QCSA 2RG5A 4AAYA 3PVWA 3W2QA 4D0WA 3HECA 3QXOA 4MF1A 3RAWA 5E8ZA 4JG7A 4IWDA 1FGKA 3UZTA 4IJPA 2CKPA 1FVVA 3C4ZA 2PUNA 1PKGA 4ZJIA 2OGVA 1ZWSA 3CIKA 1YVJA 1W8CA 3H10A 4O84A 3ODZX 4BY9E 2OZAB 3P79A 5AR7A 2JC6A 2ERZE 3LPBA 4ANMA 1Q61A 3HUCA 3DGKA 4JX7A 3FLWA 4UWCA 3DZOA 3RALA 5GZAA 4R5YA 2C5XA 4RX9A 3UPZA 4GT4A 3K5UA 4X2NA 3PDTA 5BQ0A 3W0PA 2WFYA 4UYNA 3UC4A 1UU9A 1CKJA 1ZYSA 3DBQA 1R0EA 2ZM4A 5ANGA 5LWNA 5CEOA 3DFAA 5T6KA 1W2DA 3SLSA 5CU4A 2XANA 2BHEA 3DQXA 4X3FC 2OXDA 4EBVA 4RLKA 3VS0A 2Q0NA 4MNEA 2WQNA 4YBJA 4GUBA 2YIWA 5AX9A 3FMKA 2PZ5A 3LCSA 5TO8A 4DFZE 3DAJA 4DEHA 4IXPA 1UKIA 2PUUA 5JSMA 4Y5HA 1J91A 3F5UA 3MWUA 4Q5HA 3VS7A 3I0OA 4M69A 3F7WA 3NSZA 4ASXA 4KAOA 4D4SA 3O23A 2QODA 4FI1A 4L53A 3OCSA 3T9IA 4PMPA 4D1XA 5LMBA 4W8EA 3ZYAA 3U55A 2VX3A 2EUFB 5HBEA 1NXKA 4EC9A 1XH7A 2W4KA 3QYZA 3CGOA 3SV0A 2ZM1A 1SNXA 3JY9A 4CMTA 2XNPA 3ZUVA 4MXZA 4WSQA 2JD5A 3OOMA 1H8FA 4AGDA 2WIHA 3UNKA 3R6XA 5IUGA 1ZY4A 1OPLA 3QX4A 3IOKA 4EOIA 2QD9A 4KRDA 4YC6A 3S00A 4FEVA 2QG5A 4QQTA 2B1PA 3TG1A 3PG1A 3VW8A 1KWPA 2YJSA 1Q8WA 5DFPA 3MESA 2LAVA 5IDNA 5HTBA 4AZEA 3PRIA 3QQLA 2JITA 4J97A 3RP9A 3RPRA 5IISA 4D4VA 3ZC6A 4C4HA 2O0UA 2QR8A 3B2TA 4OBOA 3VF9A 4L3LA 2JEDA 5A54A 4RLLA 4FNXA 4O7LA 3U6IA 2HIWA 5J7BA 3ANQA 2BR1A 2WB8A 4YZMA 4F7JA 5A4QA 2OO8X 2W99B 1FMKA 3MIAA 5E8XA 1WBNA 2HK5A 2PHKA 3ORPA 4FKOA 4XYFA 2J0KA 4CTCA 4USFA 4GYGA 4CFMA 3LFQA 1RDQE 4PF4A 5DOSA 5CSXA 4YURA 1GZNA 3BGPA 3O51A 5IA3A 4LUDA 5FEEA 3LM0A 2JKQA 5FTQA 4DTKA 2EB2A 4S30A 5C03A 2PL0A 3KRLA 2OXYA 1XQZA 4PL5A 2BZJA 3BYUA 4Q9SA 4CFFA 5L2TA 4RSSA 2DWBA 3R00A 3EQPA 3KRWA 3O96A 4W4WA 2BIKB 3LQ3A 4W9WA 5CWZA 3ZRLA 1H26A 1BI8A 5EI8A 2Z7LA 3C4CA 2HWOA 3FZTA 4FOCA 3NUSA 5E92A 2OLCA 4KS7A 1YXTA 4A9YA 3NFFB 5L2IA 4PL4A 4YJSA 4E20A 5JZNA 2HZNA 1VR2A 5BMMA 3F3VA 1B39A 4QP8A 4MD9E 3W2RA 3BL7A 3Q53A 1LP4A 4LGGA 4RX7A 2JDRA 4FVRA 4KBCA 1IR3A 3CY2A 4H3PA 4UXQA 3BWJA 4IVDA 3EQFA 2A27A 2J51A 4OTWA 3WI6A 4AOIA 5IEYA 5KMJA 3DZQA 3EKNA 3Q5IA 3COMA 4ZS0A 3R7YA 1UNHA 4QMWA 5CEPA 3E93A 5ANIA 2G1TA 1GNGA 1Y6BA 4FX3A 3DKOA 5IEVA 3D0EA 4GS6A 4R1YA 5IKWA 1M7QA 3W8LA 3LFEA 4QQCA 4K1BA 4WIHA 3ALNA 2GHGA 3ZDUA 4BWKA 3VNTA 5E8WA 5HG8A 3RWPA 4CEGA 4ARKA 3W32A 5F20A 2ZV9A 5IQBA 1W0XC 2GU8A 4GW8A 4QPMA 2VO0A 3CXWA 3A7JA 2V62A 3POZA 4G9CA 4FEQA 4U80A 5CSVA 3UG1A 3GU8A 1TQMA 1M14A 4NIFA 2QG7A 3KIOC 3LXPA 1H25A 2JKMA 3MV5A 5GJGA 3NW7A 4QMVA 4AACA 4XG2A 3S95A 4XBUA 5AEPA 2C30A 3QD3A 3OVVA 4IWQA 2IPXA 3U4WA 4O7ZA 3IW6A 1F3MC 3MY1A 3Q9XA 3PXYA 4AXCA 1YXVA 3AKKA 4DFNA 3PJ1A 3RHXA 5BVNA 2XS0A 4GL9A 5CU3A 4MYGA 4NH1A 4W4YA 5BVFA 5KBRA 3BL9A 1WVXA 3B8QA 3BZ3A 3V01A 3I6UA 5J87A 3QQFA 2G2HA 4D2PA 2XM8A 3A7GA 2BTRA 4AQKA 2YHVA 5HTIA 3GI3A 2FSLX 2UW0A 3V5LA 4CCUA 5AR3A 3CLYA 1SYKA 1ZARA 3OHTA 4HJOA 5GZ9A 4XX9A 4HYHA 4L7FA 3GB2A 4PPCA 3PFYA 3R7GA 3Q4CA 4JR7A 4UB7A 1XH6A 2HAKA 2ONLC 3CGFA 3IDPA 4QMUA 5EQPA 3LLAA 4C36A 2VWIA 3UDBA 5HLPA 2XKEA 3P4KA 2XAMA 2Z8CA 1M2RA 2VNYA 5CAUA 4ANOA 5KHXA 3QA8A 3VBYA 3H30A 4LQMA 1CKPA 5IG1A 2GNHA 3P5KA 1LEZA 4PNKA 1IA9A 5LQFA 5E8UA 1OKWA 2C1BA 3QZGA 3DK7A 1OM1A 2PVRA 4UEUA 4ANLA 3W8QA 2HOGA 2X8IA 5CAOA 5DE2A 4AA0A 3SKCA 2VUWA 3O8TA 4UXLA 4YR8A 4DEIA 1PXKA 5AIRA 4BGGA 4JIAA 3C5UA 4M7IA 5CU2A 4CFNA 3N9XA 2FO0A 3DQWA 4U6RA 3MVLA 4PPAA 5CSHA 3EB0A 4J8MA 2B9IA 4Z7HA 1SVGA 2F49A 3GENA 1KOBA 2KTYA 1Q24A 4QYGA 2B9HA 3QQHA 3VWAA 4B6LA 2YM5A 3QTZA 3CQEA 3PSDA 2WU7A 3R02A 4R5SA 4BFMA 3QTQA 4KIQA 3F3WA 4MF0A 5HVJA 5AV0A 3RM7A 3KREA 3VUGA 4FF8A 2WMSA 3E63A 3MB6A 3Q9WA 4WD5A 1YHWA 1A06A 5FWKK 4CFWA 1UWJA 2IZTA 1LPUA 2R3GA 4A9UA 3R0TA 2C5OA 3QU0A 4FOBA 2ZVAA 5CF4A 4C61A 2C6LA 3DAKA 5A9UA 2ZDUA 4KABA 2G01A 2OZOA 2XNGA 3BQRA 3EQGA 2BCJA 4AXDA 2PZPA 5LVPA 3R8UA 3DBCA 3NVKI 3FYJX 3JVSA 5EHLA 4EBWA 3SG8A 5IUIA 3ZUUA 5AP6A 2R7BA 4PPBA 4IEBA 3QGWA 4I92A 3FC1X 2X81A 4JDKA 3HMMA 5EFQA 4ENXA 3EOCA 3OT3A 4RWIA 3TXOA 5CENA 3WZUA 4E4LA 1KOAA 4J71A 2RFSA 2BZHB 4QO9A 3NYOA 4EHEA 2IN6A 3TKUA 1Q97A 1M2QA 3U9CA 4EQCA 5KMNA 4H05A 3GU6A 3ZRKA 3G6GA 2OJGA 3OP5A 4GYIA 5CI7A 2IW9A 4JXFA 2CNUA 4GVJA 4L44A 2ERKA 4OTPA 4TYHB 3ZLXA 4BKJA 1Q4LA 2PMOX 1W82A 3GCPA 3Q3BA 3Q32A 3QLFA 3R8VA 4WKQA 2IW8A 2AC3A 5JGAA 3AQVA 4YHTA 3A61A 1ZY5A 4IM3A 2P2IA 2QNJA 4H36A 5F94A 4EHVA 5M06A 2OJJA 3A7FA 4WSYA 3OWLA 3II5A 4C3PA 2W1IA 5DT4A 2PZRA 4U5JA 4KIKA 1Q99A 5IMEA 2QKRA 3O8PA 4ZJJA 1G3NA 3I81A 5M08A 3BHVA 5DR6A 4O0YA 2BHHA 2W0JA 3EN4A 5CTPA 1H24A 1JLUE 2VX0A 4RZVA 2UZNA 3ZSGA 3KK8A 4C4JA 3PP1A 1PMNA 2GMXA 4IC8A 4L7SA 4TZRA 4XV9A 4LV7A 5IZFA 1JKLA 3PJ3A 3DK3A 4I4FA 5HE0A 4PP7A 2XK8A 4BR3A 3V5TA 2G15A 2I40A 2GQRA 1VEBA 5EHYA 4WO5A 3BIZA 4G6NA 4C37A 4F1MA 3D7ZA 4ZSEA 3ZOSA 1W2FA 1B6CB 1HCKA 2WELA 2JDTA 4XP3A 3SXRA 5IA1A 3P7CA 3RCJA 1MQBA 3LCTA 3P08A 5AM6A 4KKHA 1OPKA 3T3VA 3ALOA 4FRFA 5L3AA 4HNIA 2YM6A 3SDJA 3ZZWA 2BROA 5CLPA 2XBAA 3SX9A 4E6DA 4JBVA 4M8TA 4FVPA 5AX3A 4X7QA 2F7ZE 3OWPA 3WIGA 4CLIA 4USEA 4IB5A 4G6LA 2WQMA 2CGWA 3IW4A 4Z16A 4F9BA 4C2VA 3UVPA 3NR9A 3AKLA 2ZAZA 4Y95A 3C13A 4G34A 4BYIA 4FTUA 3ZLYA 2C69A 1VJYA 1ZMVA 3LOKA 3OCBA 4QQJA 5A6NA 3U54A 5L8JA 3TDWA 4FBXA 1DI9A 4CKRA 4TL0A 1CDKA 2PU8A 4MD8E 4CFUA 3TNHA 3GCUA 5IU2A 3MFTA 2WQOA 1UU3A 5IF1A 2CNQA 5CI6A 4EI4A 2ZM3A 4HYIA 3BHHA 4S33A 4BDIA 2YCSA 1U5QA 3IG7A 5I3RA 2IZUA 2VAGA 3GU4A 4FSQA 3P5JC 4EYMA 4BDEA 3EQRA 4FV3A 1ZMUA 1J7LA 1DS5A 4YHJA 4YTCA 5FDPA 4RIYB 5BUIA 3GQLA 4FTTA 4OLIA 5F9EA 4UV0A 3F2AA 5KMIA 2PK9A 3KCKA 2PPQA 4O4EA 2EVAA 1QMZA 3OMVA 3DLSA 3KXZA 2Y4IB 3AC8A 5D10A 4O2PA 4BDJA 4DLJA 4F63A 3PYYA 2GNIA 2YITA 2R3JA 2ZB1A 3W0MA 2XRUA 3AT2A 4Q5EA 2PMLX 2X9EA 4IC7A 4JLCA 4KB8A 4YJVA 4ZAUA 1H1SA 3SGCA 4Z55A 2C4GA 4ZIMA 4CMOA 2I0EA 3DBDA 4QMSA 4GV1A 2UW3A 4NZWB 1KE7A 3SHEA 2PVMA 4P90A 4F9YA 4IADA 3TNWA 2R3OA 4JI9A 4XEYA 2W5AA 4BZNA 4FKTA 4I6BA 2OF2A 2UVXA 1FBNA 3MGYA 4HPTE 3E8DA 4N6YA 3WOWA 4OGRA 5IUHA 5B7VA 2YJRA 5J5TA 2VV9A 3EN7A 2W4JA 5LCKA 3CQUA 4MKCA 3QQJA 4FKWA 4E6QA 5ITAA 4OTRA 3Q52A 5GNKA 5FTOA 3VUIA 5JRQA 3CBLA 1O6YA 2YLFA 1WZYA 3MVHA 2JDVA 3FJQE 3F7ZA 3SD0A 4O7VA 3QCYA 5B2LA 4QT1A 5DR9A 5T68A 3TCPA 3VC4A 2VO6A 3OD6X 1W83A 3FV8A 3FI2A 4M0ZA 4JBOA 4NU1A 4AT4A 5J8IA 4O4CA 4AA4A 3D2IA 2QOKA 1OIUA 2VGPA 1BKXA 3FKLA 3LFFA 3MI9A 1M7NA 5BVDA 5M57A 4KA3A 3LCKA 1XMMA 2ITVA 2X7GA 3IKAA 3PG3A 2YM3A 1YXXA 4CVAA 1XBCA 2WZJA 3ORIA 5EDRA 3NUUA 3LXNA 3UO6A 5ETFA 1E9HA 1UVRA 1PRYA 2JIUA 4GH2A 5ANOA 3B2WA 4EOMA 5JK3A 3QRKA 3V8WA 3BPRA 2XKDA 3QWKA 4FSTA 2ITWA 2BDWA 3QX2A 2R5TA 3TWJA 4LI5A 2ITQA 5CT0A 2XIZA 4ENYA 4E93A 2R3HA 4ZJVA 2HELA 5AR5A 5B2KA 5DHJA 5HOAA 4LL5A 3V04A 2EB3A 3MFRA 4GT3A 1OKYA 5L6OA 5C4KA 2BKZA 3R71A 3DA6A 3MJ1A 4I6HA 2VTJA 4UMUA 2VWXA 4UZDA 4LDTA 5AFVA 3EN6A 3GCSA 1CMKE 4NSTA 2AYPA 3BU6A 4MCVA 5ANKA 5CF8A 3MJ2A 3ANRA 5E1EA 4USDA 4XLVA 3OS3A 5C8KA 3FSFA 1FVTA 3FUPA 1LR4A 2XNBA 4RA5A 3ELJA 1W7HA 5M09A 5FD2A 5JEBA 2B52A 4XOZA 3THBA 3KF7A 4FV5A 3ZRMA 5IQAA 4IHPA 3T8OA 3ZC5A 5M56A 1Q41A 1UWHA 2QO9A 3VVHA 4BCJA 3C50A 1W84A 3D4QA 3BLHA 4UWBA 5JQ5A 1OUKA 3TIYA 1ZXEA 3UNJA 4WRSA 3W16A 4DAWA 3SRVB 3A7HA 4PDOA 4XCUA 4C59A 3KMMA 2WMWA 5CU6A 4IM0A 3FLNC 2XK3A 3TEIA 2WTJA 2H34A 4A9RA 1Y57A 3RBWA 3QC9A 2IZSA 4FIJA 1GAGA 2FGIA 2NRUA 3BKBA 4YZBA 4ZSAA 3O71A 1PXNA 4R3CA 3FY2A 1Z9XA 5HD7A 3LJ0A 3HRCA 3UOKA 3VAPA 3HDMA 3PE1A 3I5NA 2WMVA 2OBJA 3EL7A 2O3PA 2VTTA 4M14A 3OG7A 2YEXA 4R3RA 3FC2A 3UO4A 3U8WA 4AW5A 4O96A 2PTKA 3PIZA 4NUSA 5A4TA 1MUOA 3I5ZA 2W7XA 4FZDB 4IB0A 4ZTNA 2NO3A 4FKLA 1ZZ2A 4KINA 2R9SA 4QYYA 2QOIA 4FKIA 4AN2A 4BCGA 3LAUA 3MVJA 3HA8A 3KEXA 2VWYA 4EOPA 5I5ZA 4E5AX 4F78A 3KRRA 4RRVA 3UG2A 4E4MA 3E7VA 3QQUA 4M97A 4X3JA 3QRIA 5HIDA 3K3JA 2X9FA 2HZ4A 4RFZA 4CCBA 3G0EA 3COIA 1KE6A 2W1FA 4FYNA 2WTVA 2EXCX 5KKRB 1SVHA 3OY1A 5EW9A 3FMDA 2CKQA 5ANDA 3NGAA 2I0HA 5C4LA 2GPHA 4D28A 3KXNA 3IOPA 2I6LA 4MNEB 4QMNA 4KNBA 1GZ8A 2WMUA 3A7IA 4IVCA 5HIEA 4ERWA 3RPOA 3R7OA 4RC3A 4GEOA 4MH7A