3HMPA

Crystal structure of human mps1 catalytic domain in complex with a quinazolin ligand compound 4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMSQVGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Biophysical and X-ray crystallographic analysis of Mps1 kinase inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hmpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hmpA01
2O5KA 3ERKA 3D2IA 3R1YA 4TXCA 4I5CA 4NT4A 4AAAA 4RPVA 4G5PA 3GU5A 4OTRA 3ZDIA 1K9AA 1XBAA 2YM4A 3FMKA 3DT1A 4XCUA 4CMUA 4CZYB 3KMMA 3MSSA 3OCTA 4I5MA 4IWDA 3FYJX 2W1FA 4NM3A 3S3IA 4YTFA 2C1BA 1J7IA 1IASA 3EFKA 3QD4A 3MVLA 5DN3A 4DH7A 4O0VA 3VBWA 1H1SA 3ROCA 4DCEA 3FI2A 4H1JA 5JGAA 2PZYA 5CSVA 2H6DA 4ZSGA 5K0KA 5I0BA 3RZFA 3ZXTA 4F1MA 3DXPA 3R0TA 4C4GA 3OY1A 4ALUA 4AW0A 5ITAA 5FTGA 3EFJA 3LXKA 3TUCA 1Y8GA 2EUFB 2JITA 4FGBA 4ZXTA 4DFYA 3ORPA 4UMPA 2GSFA 3V51A 3ZZWA 2X4ZA 2WPAA 3LFQA 2Z2WA 2O8YA 4WSYA 4JAIA 1FVTA 3RWPA 3RAHA 4EH6A 4HVHA 2XNBA 4W8DA 4FKSA 4PUZA 4RVMA 3HV4A 2RF9A 4BR3A 1R3CA 3OG7A 4R3CA 2REIA 3DDPA 3BYUA 3C4WA 1M14A 2DQ7X 5B7VA 2I6LA 3FC2A 1Q8ZA 3SG8A 1YDSE 2QO7A 4MWHA 3IDPA 5HX8A 4I5HA 5L6WL 5CANA 4CYIA 2EXMA 2YDJA 4UX9A 3OS3A 1H0WA 2VUWA 4FSUA 5LMKA 5KMOA 4IANA 4I92A 5L3AA 2J0LA 3K5VA 4L00A 5IQDA 4C59A 4C33A 4AFEA 2P55A 5AV1A 3ZM9A 3QKKA 4FK6A 5CTPA 5FP5A 5E8ZA 1B38A 4ZLOA 2OIDA 2C47A 4UMQA 4NW6A 3SOAA 4FTOA 1XKKA 3Q4TA 4GRBA 5JRSA 3JY9A 5CZIA 4D4VA 4DTBA 3HRBA 2UW4A 2G2HA 3LMIA 1YHWA 2VWYA 3P0MA 4JRNA 3OP5A 1NA7A 2BKKA 2VTIA 4W4XA 3EWHA 4G5JA 4BKYA 2I0HA 5HG5A 2HIWA 2GNIA 3SRVB 4UYNA 3F66A 5IH5A 3D7ZA 2V7OA 4R3PA 4QMPA 3M2WA 1LP4A 4NYEA 4ZY5A 4FL2A 3RINA 3RM6A 1CMKE 5T3QA 3K5UA 4M14A 4G6OA 4QPMA 3Q60A 3PY3A 4NKAA 3GC8A 4XLVA 3HX4A 3R2YA 2YAAA 3BE2A 3COIA 3FKOA 3IDCA 3HV6A 3QTXA 3QX4A 3TCPA 4RJ5A 2WTCA 4MF1A 5I3RA 3ID6C 3PY0A 3OWJA 2ZV7A 4I0SA 3BCEA 3FUPA 4AE6A 4O7ZA 3R63A 4FA2A 5KMKA 3QZHA 4NFNA 3TNWA 5A4TA 4LL5A 2DS1A 3DLSA 4GYGA 1E1VA 3FQSA 5D9HA 5AP5A 4DLIA 4DAWA 2XCHA 2F49A 3WF6A 3VQUA 3PLSA 4RIOA 4ZSEA 4AS0A 4EH8A 5D1JA 5IUIA 5DEYA 3GVUA 5AUXA 2XEYA 4JT3A 4FV0A 2XNGA 5EM8A 2IN6A 1HCKA 2X8DA 3QA0A 4TYJA 4XYFA 4DH5A 2J9MA 4LOPA 2NP8A 5GNKA 5BPYA 3TNIA 1XQZA 3LCDA 4J53A 1PF8A 1V0PA 3G6GA 4IDTA 4A9UA 3V8SA 3OF0A 4C2WA 3MVJA 4BCKA 3BU6A 1YWVA 5AX3A 2C0OA 1GZKA 2HWOA 3UVPA 5KZ0A 3ZRMA 2JDSA 5ANDA 2XNEA 2FSOX 3D5VA 2VX0A 3LMHA 2PZPA 3PA5A 4YZ9A 2X4FA 3COMA 3GCUA 4O0UA 4KD1A 1PKDA 4JDIA 4OTPA 5K4IA 5HZNA 4DLJA 5DT0A 4O6LA 5DPVA 3G6HA 5HIDA 5GJDA 4AZTA 4G3CA 2WOTA 2WU7A 3IOKA 4ACDA 4E1ZA 4TYHA 5CY3A 3NYVA 3R8ZA 4BDKA 2OLCA 5CSPA 2G2IA 1SYKA 3DV3A 2VN9A 3OXIA 3ACKA 4MAOA 3MPTA 3QUDA 4YHJA 3ORIA 4A4OA 4AN3A 1VYZA 3JYAA 4QMNA 4AWIA 3IW5A 2BMCA 1E1XA 3LFCA 2WTVA 4HZRA 4NCTA 2PHKA 3SXFA 4LYNA 2OH0E 1NVSA 4P2KA 3DQXA 4O83A 3QXPA 2JKMA 3I6WA 4MQ1A 3UZPA 3NUAA 3VNTA 4KRCA 3E87A 2X8IA 4LG4A 4ONAA 4XUFA 5HHWA 2FSLX 4FIJA 5K5XA 2VWZA 3HMMA 4L46A 3QWKA 4O0SA 1MRUA 1W84A 4ZJVA 3JR1A 3DK6A 3FJQE 2PMLX 5CQUA 4C2VA 5IH6A 2B55A 5F4NA 4KSQA 4C4EA 5KMMA 2VTHA 1ZRZA 2GHLA 4IW0A 4NJDA 2XIZA 3OFMA 3FEGA 4FEWA 4FNZA 5CI6A 3DAJA 4LOOA 5CF8A 5LVPA 3LIJA 4CSVA 3QCSA 4AZFA 2GHMA 4OBQA 4CKJA 4FT0A 4KIOA 4FSTA 5EM6A 5BVKA 4CCBA 3P5KA 4GFOA 4EHGA 2UZBA 1I44A 3OOMA 2OF4A 4BI2A 1DS5A 4C58A 1IG1A 4IX3A 4OBPA 2ITNA 3NNUA 4XV1A 3ZEWA 4HPTE 2OXYA 3TZMA 5LMAA 3VS6A 4BWXA 4YR8A 4EORA 4UY9A 4D2PA 5HNBA 4CZTA 2YABA 4ACMA 5L8LA 1URCA 2BRGA 5LWMA 3SHEA 3UQFA 3LXLA 2BILB 3ZC6A 3QC4A 1PMUA 3H9FA 4BDGA 5I9WA 4JQ7A 2CCIA 3ZXZA 2PU8A 4IE9A 4DFUA 3RK5A 5K5NA 3DLZA 2C6OA 4UWBA 1MRYA 4DBXA 2A2AA 2R64A 1JQHA 1F3MC 2Z7LA 2ZM3A 3FMLA 3V04A 4MD7E 3RP9A 3UIUA 3D2KA 4K9YA 3ULIA 4BDJA 1PXPA 2PVRA 1J91A 2C6KA 3QA8A 3ZFYA 3LJ0A 3QD2B 4X21A 3SW4A 4EZ3A 5AM6A 4B8MA 3DDQA 3UQGA 1BL7A 5H3QA 3T3VA 3V5TA 2YIWA 3VULA 2PVNA 5KMIA 2C5XA 4BIBA 5JN2A 2HY0A 2VWVA 4IB0A 3U6IA 3CCNA 2R3NA 4FL1A 3WF8A 5FEEA 4LGDA 1SVGA 4IM0A 2VX3A 2A1AB 4C3RA 5FP6A 4KIKB 4W8EA 4BDBA 3LM5A 4F6SA 4S34A 3U51A 1PXJA 2F2UA 4O27B 3MY1A 2W1CA 1ZOHA 4FZ6A 5EOLA 5HVYA 3V5QA 4P7EA 5J1VA 1W82A 2W1IA 3C7QA 3R00A 3C4EA 1Q61A 4IAKA 4RT7A 2DUVA 4GS6A 3PSDA 3VRYA 5AJQA 5KCVA 3OXZA 1JVPP 4BC6A 4TN6A 4OAUC 4FEQA 3KK9A 4CNHA 2C6TA 2W4JA 4RVKA 5AMNA 1PRYA 2OFVA 1PXMA 3FSFA 3W33A 4KWPA 4N70A 2QONA 3D7TB 4W4YA 4C4IA 3MI9A 1A9UA 3GC7A 2BROA 2O0UA 2YZAA 3OC1A 1OBDA 3AGMA 3ANRA 3DCVA 4TZRA 3JPVA 3L9MA 4RJ7A 3BHVA 4OW8A 1GZ8A 3EKNA 4XV3A 3V3VA 4EK3A 4MNFA 4IBMA 5D11A 3PZHA 3GOPA 4DGGA 2OXXA 2W17A 4O1OA 3R9DA 4ASDA 3MFSA 2GQGA 3RJCA 2WTKB 3GC9A 3CJFA 2PE2A 3UYTA 3ZBXA 3R9NA 3OEFX 4FNYA 4MXCA 2EU9A 1JLUE 3FLNC 4K18A 1WVXA 3QQLA 2OIBA 4RVLA 5FD2A 4NU1A 2R3GA 4XG9A 4IVBA 1DM2A 4DEEA 2AC3A 2V55A 3PJ1A 4E6CA 2GNGA 3IW6A 2RKUA 3ODYX 4GCJA 5IQGA 2GS7A 5H9BA 2PZIA 4D5KA 5AV0A 2I1MA 3UMWA 5EDQA 4F70A 3BYSA 4FV9A 3L8PA 2W96B 4I41A 2QOIA 1QPCA 4TYHB 5L8JA 2WMQA 3FWQA 4MX9A 1G5SA 3WIGA 1UU7A 4HGSA 4BZDA 3QXOA 5DLSA 3DBEA 4WG5A 5DR9A 4UMUA 5B2LA 5M4UA 2AUHA 2GMXA 1PXKA 3PVWA 4F09A 3KULA 5BVWA 1MP8A 3ENHA 2WXVA 2GDOA 3ZU7A 1VYWA 5J9LA 2VO6A 2F57A 3A7FA 2XS0A 1SNUA 3GGFA 1KSWA 3KN5A 2JAVA 2NRUA 3A7HA 3ZRKA 4Z7GA 1ZYDA 3AQVA 2YLEA 4B4LA 5EQEA 3ETAA 3CQUA 2A27A 5C4KA 2F7ZE 3QWJA 4JL9A 4DINA 3S0OA 4OTDA 4GG5A 3R7YA 4M8TA 5JK3A 2ZB0A 1J1CA 4AGWA 3WF7A 3TZ9A 5KNJA 3M42A 1H27A 4BTJA 3UNKA 4LV5A 2WEIA 2BRNA 3LXNA 3C0HA 4L6QA 5E8WA 3RNIA 4UEUA 1Y91A 3I79A 4EH3A 1PYEA 2ZB1A 3ET7A 2X81A 4IZAA 3K2LA 4D4YA 4EWQA 5IUGA 1H1WA 3MWUA 3HMIA 5CEMA 3R2BA 5GZ8A 5G6VA 4D0XA 5KX8A 3A7JA 3Q32A 2Y4PA 3PG1A 4FKWA 5LMKC 2C5VA 2A4LA 2UVZA 1V0OA 3R1NA 2JDVA 3RAIA 1JKLA 5FTOA 4TPTA 2FYSA 3CGOA 4AE9A 5C9CA 5EI2A 5E8UA 3QQGA 3C51A 3MH2A 4RX5A 5GJGA 4NH1A 2Y6MA 4KKGA 5IMXA 2P33A 4BTMA 3KN6A 4IAFA 4CRSA 5JQ5A 4YZDA 4BDCA 4DEIA 5KE0A 3OY3A 3SQQA 5CALA 2IJMA 2IZTA 3QQJA 4O0RA 5KMLA 3NS9A 1OVEA 5ETFA 3R8VA 1GZOA 3QTRA 2WNTA 2IVTA 1XH7A 5EDRA 3RM7A 4DEGA 4QMYA 4QTEA 5C26A 3TT0A 3NLBA 2GS6A 1W98A 3R7VA 2NO3A 4DFNA 4AT5A 3G90X 5GZ9A 4YGAA 5J9YA 4O0XA 5CAPA 3VWAA 4HVDA 2XNPA 1U5QA 3EOCA 1RJBA 5FBNC 1WCCA 3WZUA 2R3QA 3R8UA 4PX6A 4F0FA 2ZM1A 5M09A 1R1WA 2JKOA 3FPMA 2UUEA 4B7TA 5D7VA 4IB3A 3QF9A 5HG9A 4O91A 2WQNA 5JH6A 4QYEA 3WARA 2WHBA 4UBAA 2R3IA 5E1EA 2I7QA 3NW5A 4XOYA 4E3CA 4AG8A 2E9NA 4M69B 3MH1A 3Q96A 5HE1A 2UVYA 4MK0A 4NM0A 1OGUA 1ZY5A 2BTRA 3BHTA 3OT3A 1BI8A 4YJNA 3P7BA 3QKLA 4DEAA 3FYKX 1NT2A 4KS7A 4FUYA 3HEGA 3SA0A 2F7XE 5CX9A 2Y7JA 4JIAA 5KUPA 5M08A 4FIGA 2HWPA 1Y57A 5DVRA 1IEPA 4F1TA 4GFMA 5D12A 4BCOA 4U40A 2ETKA 2YJRA 4F9AA 4ENXA 5J87A 3DTCA 3W55A 4EH9A 2WTKC 4M3QA 1DI9A 4JI9A 4W9XA 1JKTA 4ZJIA 5KO1A 5LQFA 2C6DA 5HTIA 4PPAA 4ID7A 4DA5A 2ETRA 4O82A 5K4JA 3H0ZA 3WIKA 3OMVA 3C0GA 1GJOA 2OH4A 2ZMCA 3CY2A 2W5HA 4JLCA 5IKWA 4FTUA 4AZEA 4RZVA 3A8WA 1XH4A 3GU8A 4QP2A 3NUPA 5K0XA 3EL8A 3BRBA 3LCOA 3IQ7A 3Q5IA 3A7GA 3R04A 5I9YA 2PVLA 4FG7A 3N4UA 1ZYLA 3WZDA 1GIHA 5IQFA 4V01A 4NCTC 2G9XA 4RVTA 3VUDA 3NVMB 2OZAA 1R39A 4HJOA 4B0GA 1PXOA 4BCJA 5KMNA 3NNXA 3UTOA 1JPAA 5L6OA 2XF0A 4NFMA 4QMQA 5DR2A 4FT9A 1BLXA 2YDKA 5H8EA 3RZBA 4EH7A 4S32A 4M66A 4C61A 5AAEA 1ZYSA 5BX0A 5CSHA 4QYHA 3KULB 1WVYA 3BX5A 3K3IA 3O0GA 4NTSA 5CSWA 3R01A 5EDPA 5BVEA 4XG2A 3UE4A 2VTMA 4G9RA 2XKCA 3QFVA 3GBZA 4YJSA 4UXQA 3Q5ZA 4G9CA 4ZTRA 3Q2MA 3QHRA 5AUYA 4F9BA 4MBIA 5IG1A 3RNYA 5B2MA 3MPAA 1H1PA 4H1MA 1FOTA 4YBJA 4WNKA 4IAIA 4L68A 1Q99A 2OICA 2WMUA 4FKUA 4JX7A 4RRVA 5E8SA 5FQDC 1UVRA 4RZWA 3CE3A 5F1ZA 4AT3A 5BVOA 2RG6A 5BNJA 4E8AA 2C3KA 3A62A 4FSYA 3QRUA 1B6CB 2XKFA 1A06A 2XYUA 3NAYA 4AW5A 1WMKA 2HAKA 2J0JA 3P9JA 2UW9A 4IWQA 4RA4A 4AP7A 4YLKA 5E4HA 3F6XA 3U55A 1H08A 1ND4A 1BUHA 5HKMA 1IAHA 2B0QA 5C4LA 1B39A 4AZWA 3BHHA 2XK4A 3FKLA 3RHKA 3V6SA 4UZHA 2WFYA 5HEZA 4LGGA 1MRVA 2ERKA 4E5AX 1ZY4A 5IDNA 3MYGA 3NR9A 3KRLA 3IGOA 3PXRA 4QP3A 5CAQA 4CLJA 4Y72A 2EB3A 3AD5A 3VF8A 3DQWA 5F9EA 1G8AA 4JBVA 5C8KA 2FSTX 3EB0A 4F08A 3R7EA 3H4JA 4ZTMA 5HO8A 5FRIA 4JBPA 3PA4A 4QD6A 2OU7A 3CTQA 4YZBA 1PXNA 5T6KA 4X3FA 2ZAZA 4KKEA 4M12A 3VS0A 4H36A 3MFTA 3UOHA 2BRBA 3CTHA 3MA6A 5AAFA 4PDOA 4PDPA 4LM5A 4BFMA 3FMNA 3SXSA 5CQWA 5M44A 3VBQA 4YNOA 5AV3A 2F4JA 4XG6A 4X2NA 3EZVA 1GY3A 3QTQA 2YFXA 3NRMA 4FVRA 3NGAA 3OCBA 4QP4A 5AP4A 2G15A 4CTCA 1S9JA 4YJRA 2VWBA 3ZZEA 5K9IA 3QL8A 4QNAA 3NUUA 1W83A 4I5PA 2JDTA 5GIOE 2OWBA 2UZLA 1OI9A 4FYOA 1UNHA 1GNGA 3TZ7A 3KCKA 1UNGA 3DK3A 4QTDA 2B9HA 3NW6A 4C4FA 4MYGA 3MS9A 3EQPA 2WMVA 5FDPA 1OKVA 5LJJA 3H0YA 2WMRA 3W2QA 5IQEA 3HDNA 4TNBA 5DT3A 3FY2A 5ANJA 3E93A 3M11A 4JG8A 3OOGA 4U81A 4D4RA 2R3FA 3QC9A 3AT3A 2YLFA 3T8OA 4QMWA 5ETCA 2HELA 2CLQA 3HUBA 2PVJA 3U87A 5EQYA 4RWKA 4K77A 4PRJA 4ZSAA 4OR5A 4QMSA 5CT7A 3DAEA 5HLPA 3DY7A 3NUSA 4N4SA 4FT3A 4EH5A 4I0TA 4LOQA 1ZWSA 3KCFA 2V22A 5KMJA 5EW3A 3HV5A 3W2OA 4CQEA 4EUUA 2FA2A 4RWJA 4QMZA 1OUKA 4BL1A 4YU2A 2CNUA 1K3AA 4D1SA 2B9FA 5DBXA 3Q52A 4FSZA 2VTLA 5HE2A 2VO3A 3HVCA 1GIJA 4FUXA 5IEYA 4HNIA 3MV5A 3QRKA 5BYLA 3SOCA 1H4LA 3ZS5A 3VJNA 3F7WA 3V01A 3F3UA 3FI4A 4AUAA 4YSMA 1E9HA 3IGGA 4Y46A 3KRXA 4IX5A 4BGGA 4DT9A 2OZAB 4F9WA 4KKHA 5CF4A 2QOOA 1JNKA 4CFUA 1FQ1B 1VJYA 2X8EA 2H8HA 3D5XA 3L9LA 4O7VA 3LJ2A 5LWNA 2XYNA 4FIEA 4YTCA 3FMEA 3KXMA 4IWOA 5EYDA 3RPRA 3JUHA 4GVJA 4YC8A 2R5TA 5AUUA 4NIFA 3ZBFA 3TDWA 4RX9A 2WTIA 2GQSA 5E8VA 3C4CA 4JR7A 2WEVA 3R73A 4DG0E 2RFNA 4QYGA 3VBXA 3O2MA 2QU6A 3A60A 5FDXA 4EJNA 4KUJA 1TKIA 2HZ0A 4AA0A 3DZQA 4ASZA 2IZRA 4DH3A 3PZEA 2ZOQA 3R28A 5CAOA 5AR5A 2RFSA 4BCPA 4WNMA 2C69A 2ZV2A 4V05A 3VJOA 5FG8A 2J0KA 3QTIA 3ELJA 4TYEA 4R6VA 2XB7A 3O7LB 3A8XA 1WBSA 3BV3A 5FXQA 3VN9A 4O86A 4FSWA 5HIBA 4YZCA 3O23A 3EYHA 3JXWA 3DKCA 5DHJA 3Q4UA 3TV7A 3IONA 5IEXA 4GU9A 3P1AA 4DBNA 4QMOA 2V0DA 4CFXA 4YJPA 5AAGA 4RC3A 3S2PA 4DGNA 4FG8A 4EOKA 5BYYA 3TM0A 1UWHA 2B52A 2YCRA 1KV2A 4U79A 4BCMA 1H1QA 2C6EA 1O6YA 2WMWA 3BPRA 3NAXA 1JAMA 3MB7A 3O51A 4MWIA 4ASEA 1NVRA 4L7SA 5FM3A 4CMOA 4MF0A 4NJ3A 5L2TA 2PUIA 2C68A 3DNEA 1UV5A 2GU8A 2E9UA 3CGFA 4FC0A 2C6LA 4E20A 3HRFA 3EKKA 5AIRA 2VTRA 4QMMA 3DPKA 2OJIA 3CY3A 5AP7A 4ANQA 4Z7HA 3LMGA 3TUBA 2X6EA 1WZYA 4U3ZA 3ZCLA 5C8NA 3BWFA 1J7UA 4DHFA 1PJKA 4DEDA 4E4LA 4FT5A 4HW7A 4X3FB 4BBEA 4O1PA 3D4QA 3GOKA 4U3YA 4W4VA 4AOIA 4KRDA 5I3OA 4FGRA 3EQGA 4FIIA 3OCSA 4GSBA 2VTTA 4FEXA 3TI1A 4FKLA 5IA4A 3U54A 3IW7A 4IFCA 4O0YA 5ETIA 3B2WA 4D5HA 3FI8A 3EMGA 5K3YA 3KRJA 2XK8A 2C6IA 4E7WA 2R3RA 1OPLA 2EXEA 3FY0A 3K3JA 2VV9A 4QP8A 3PP0A 3UO4A 3ATTA 1URWA 3LFEA 4I3ZA 5CAVA 2ZV8A 2ZYBA 3OUKA 4PMSA 4RJ4A 2J7TA 4IZYA 3Q53A 3FHRA 3W18A 4D55A 4EC9A 4KA3A 4BHZA 4R5SA 2J6MA 3DKOA 4NKSA 5CU6A 3CPBA 5HBEA 3BLHA 4H58A 3OROA 1JSTA 1SNXA 1Z9XA 1LEWA 3SAYA 4BZOA 4O7LA 3AC5A 4JQEA 3IG7A 4UN0C 3TDVA 5A3XA 5FTQA 4CZUA 4R77A 4JDKA 3W2PA 3DXNA 4C34A 1KOBA 2GFCA 2VO7A 3LE6A 5LCKA 1FINA 2XNNA 3UPXA 4ERWA 2YZLA 4GEOA 5DGZA 3V8WA 2V7AA 2VRXA 5D7AA 3B8QA 3H9RA 5CZHA 5M56A 4DCAA 2BFYA 1XH6A 2KTYA 4PNIA 3S00A 4QMLA 4YP8A 4C57A 1Q8UA 3SV0A 3GEQA 5KKRB 2WGJA 2X7OA 4G16A 4E6QA 1HOWA 4JG6A 3VS4A 2A19B 2GNFA 4E4NA 3KL8A 3PUPA 3KXZA 3PIXA 3UVRA 5CU4A 2YEXA 2C3JA 2JDRA 3MY0A 4XG7A 4AFJA 1LEZA 3HMOA 1M2QA 2QOLA 2Y0AA 4AGUA 5CF5A 5J7HA 5E8XA 2O63A 4O6EA 4KABA 1SZMA 4OT6A 5HCXA 4GIHA 4MH7A 4G6LA 3ZLYA 2BHHA 4EHZA 5FBOA 2JDOA 3W1FA 4BRXA 3HV7A 4EZ5A 3LQ5A 2QOKA 5EI8A 4D2VA 3UOJA 3FL4A 4PDSA 3C0IA 3UC4A 5HO7A 4G31A 1O6KA 4IAZA 4RG0A 1P4FA 1RDQE 2R0UA 4LUDA 3TTJA 4EL9A 3UODA 3WI6A 2YCFA 3HMPA 4CXAA 4EJ7A 4RSSA 2W1EA 5DI1A 2NRYA 4IC8A 2I0VA 4PY1A 2O2UA 3FMDA 4RIYA 5AWMA 3ZLXA 4AX8A 3OWKA 4CFWA 4NK9A 5D10A 5E92A 4TKSA 2V5QA 3TV6A 2XK3A 1P5EA 4CLIA 1QPJA 2OGVA 3KKVA 3V6RA 2G2FA 5KZIA 4C7TA 4OGRA 5G1XA 2JLDA 1L8TA 3EQRA 5HBHA 1XBCA 2C3LA 3FZ1A 3BWJA 4MNEA 2QC6A 4DITA 2BFXA 2PK9A 5AR3A 5IA0A 3DBCA 2ITWA 4H3QA 4YUQA 5CEPA 1U59A 3RK9A 2Z8CA 5GIPE 2OW3A 3FKNA 4G3FA 2XA4A 4U80A 4GMYA 4WO5A 3QCQA 2W06A 4WG4A 4WG3A 2QLQA 3UIBA 4AOTA 4EOMA 4IC7A 4GKIA 4FODA 4J96A 2I0YA 3CR0A 2EVAA 5CEOA 4RMZA 3R8PA 4EKLA 4IM2A 5JGDA 4RQKA 4X2JA 4ANSA 3PG3A 3G9LX 3R8MA 3OW3A 1OIUA 2XIYA 4R7BA 2BRHA 4EYMA 4J7BA 5C03A 1NW1A 2XVDA 3D14A 3QU0A 4LUEA 4EOPA 2VNWA 3HECA 3EFLA 4BGHA 4USEA 3UZRA 5DWRA 3UG1A 1WBNA 4XLIA 5C01A 2VWWA 2YM5A 4BN1A 4X3FC 4AGDA 4FIHA 3F82A 4GK2A 3F5PA 5FXSA 5HQ0A 3ULZA 3HZTA 4Q9SA 2OJGA 2X39A 4EOSA 2C0IA 3G33A 3PSCA 3A2CA 3DJ7A 3OEZA 5CEKA 2JIVA 3FLYA 2CGXA 1ZLTA 4O0TA 4CT1A 2W4KA 4TW9A 3NUNA 5AR7A 1KUTA 3CP9A 1RW8A 3QD3A 2PVYA 4DN5A 3QQHA 2CKOA 3SXRA 2PVHA 3ZTXA 5AIKA 3LFBA 4ALVA 2GNJA 3NX8A 4YHFA 3U4WA 2ITTA 3GC0A 3MN3A 3PJCA 4DEHA 3LVPA 5KHWA 4FV3A 4WRSA 2XJ2A 4IMYA 4J99A 3E8NA 2VWXA 2H34A 3O71A 4Y83A 4YTHA 4BTKA 3MJ1A 1YWNA 4EONA 3NNVA 3GU7A 2P0CA 4M7IA 4R8QA 1EH4A 4EOQA 4K8AA 3ZLSA 4P5QA 3A99A 4FV6A 4TWCA 1PKGA 4I21A 3ORZA 3COHA 4F7LA 1IA8A 3PLAE 5BVDA 1OL7A 4NTTA 5CEIA 5T68A 4B9DA 4FEVA 3BU3A 4E26A 3R22A 2I40A 4RX7A 3TNHA 1H25A 4V04A 3BYMA 4HCTA 2CMWA 3DS6A 4RFMA 3ZH8A 2Z02A 5DH3A 2OIQA 4O81A 5ETAA 3VUTA 3AOXA 4L53A 3ZSGA 5AADA 3C13A 3PXYA 3LFAA 5CI7A 5KKRC 4P90A 2XK7A 5KHXA 5M4IA 2HXLA 5CWZA 4K0YA 2BR1A 2C6MA 4D28A 4DT8A 2YIQA 2Q0BA 5ANIA 2Y4IB 3P08A 3QZFA 1XBBA 3VW8A 3LPBA 4FV2A 4GJ3A 4L43A 2B7AA 2YM6A 4YLLA 3RGFA 4CVAA 1O6LA 3VS7A 3ORMA 4G1WA 5FLFA 2OFUA 4X6RA 3POZA 5DE2A 5JFVA 4NL0A 4F7JA 3ZYAA 4EHVA 4LMNA 3VBTA 2WELA 4HVGA 3QUEA 2J5FA 3TZ8A 4AACA 5J1WA 4X3JA 1CKJA 3KC3A 3T9IA 2QQ7A 4I6BA 5CLPA 5EK7A 4FSNA 3UMXA 1ZARA 2CSNA 3QYWA 4Q2AA 3LM0A 3AMAA 3ROYA 3IPHA 2YM7A 2PE1A 5E7RA 4BB4A 2BZIB 4L3JA 4ACGA 4B8LA 1JSUA 3HNGA 3FXWA 3Q4ZA 1PW2A 2CGWA 1U54A 3VUIA 3E8DA 4D1ZA 4FZFB 4APPA 2RFEA 2BDFA 4L01A 3UDBA 2VTAA 2QOQA 3H3CA 5M07A 3HRCA 5HD7A 1VEBA 3KMWA 5E8YA 2IVSA 2OJJA 4AW2A 5BVNA 2KULA 3BE9A 2QOFA 4KB8A 1YRPA 5AP6A 5ANEA 1STCE 3QGWA 3MB6A 5ANGA 5EYMA 3MH3A 3PXZA 5D41A 4IXPA 1ZOGA 2IW6A 5TR6A 1Y6AA 2HK5A 4CD0A 3PWDA 4IZ7A 3THBA 4AN2A 4H05A 2IW8A 4C3FA 2FSMX 4IEBA 3P4KA 4IHPA 4YC6A 5EM5A 1XHAA 3VHEA 3EQHA 3MFRA 3PP1A 2Z60A 4YO4A 5AUTA 3LOKA 3IDBA 4U9AA 4HNFA 3WE4A 1ZMUA 2ERZE 3DGKA 3FMJA 4D2RA 4ERKA 2XCKA 2HW6A 4XV2A 5JMSA 3GQIA 3QLGA 3OVVA 4DFXE 3F88A 1M17A 3QTZA 4LGHA 4EYJA 4J8NA 3TJCA 2FUMA 4KNBA 4JNWA 3DAKA 3QLFA 3EN6A 2VX1A 4BF2A 4JS8A 4R1VA 3LCSA 4IWPA 3N4TA 1F0QA 3KU2A 3AD6A 5LARA 1CM8A 3U6HA 3EN9A 5AR2A 3F7ZA 3I5NA 4L45A 3R83A 5JZJA 5L8KA 2WO6A 3C9WA 1ZYJA 1OITA 1OL6A 3KGAA 2WMAA 3II5A 3RPVA 3NEWA 4EOLA 2YERA 3GU6A 1YXXA 2QO9A 3EQFA 3Q4CA 3UNJA 5GHVA 4TWNA 3ORLA 4GYIA 3PXFA 3VUMA 4UMRA 4ASXA 3F5UA 4BCNA 5CYIA 5FEDA 4N57A 2JIIA 2PMNX 4L7FA 1UWJA 3LCKA 4U0IA 3W2SA 4HCUA 3LQ8A 4YPSA 1Z57A 2PL0A 4Z16A 3W32A 3U4UA 2CNQA 4CT2A 4HVSA 2OK1A 3EL7A 3WF9A 4LRKA 1MQ4A 3Q9WA 4FK3A 5DNRA 5HICA 3OWLA 2GPHA 5AR8A 1OUYA 4MTAA 4UALA 1JKSA 3G15A 3PRIA 3FZRA 3KQ7A 4JAJA 3I1AA 3MESA 3CBLA 2CKQA 3FC1X 3D5UA 2WIHA 3GB2A 4KINA 3R7OA 3RPYA 4DFLA 4UV0A 2IPXA 4FOCA 4QP1A 1J7LA 2J4ZA 1XH5A 3P78A 4AZSA 4KBCA 4K2RA 1LPUA 4NZWB 3RALA 2ONLA 4EOOA 2VWUA 5HLWA 5HG8A 3JY0A 5A4CA 2QKRA 3UQCA 3OCGA 1YOJA 3BEAA 3NYNA 5DYJA 2XBJA 4I4EA 4F4PA 4LRMA 2VNYA 3FXXA 3NW7A 4N6ZA 1OB3A 3F5XA 3DKGA 4DYMA 4IJPA 4JXFA 3ZMMA 2EB2A 2Z7QA 1YKRA 3FMMA 4QP9A 4GIIA 3DK7A 1IAJA 1NXKA 3MTFA 4J98A 2CJMA 2FVDA 4A06A 4L3LA 4R7HA 3RPSA 2ITPA 2UV2A 3FLWA 4Q9ZA 2CN5A 3LLAA 3HA6A 5I9ZA 4H39A 4I6QA 2W0JA 2Y4IC 2HYYA 4XJ0A 4CG8A 2P2IA 1UA2A 2FH9A 5AA9A 3F5GA 4JQ8A 1BKXA 3KVXA 5HE3A 2VU3A 3FMHA 4ANLA 3QTSA 4BCHA 4WRGA 3VBVA 2OJFE 4DTKA 4HYSA 4XEYA 4KBAA 3DB8A 4XBUA 1BMKA 3E5AA 3UVQA 4DFZE 5BUEA 4D2TA 4GT3A 1Z5MA 4ZOGA 4C8BA 4U43A 3HV3A 5AUVA 3ZFXA 4QP7A 1BYGA 4EI4A 3R7GA 4TWPA 2O65A 5GJFA 2J2IB 4FVPA 4O7RA 1QPDA 1Q62A 1WBPA 1OM1A 1J3HA 3ODZX 3R6XA 2XNMA 4GJ2A 1KE6A 4I24A 3MA3A 5A14A 2R3LA 3KMUA 1G3NA 2WMBA 4U41A 3F3TA 5A6OA 2XBAA 3W2CA 4PMPA 3LAUA 3KB7A 5BUIA 3FLSA 4ZEGA 5HVKA 3BV2A 4C38A 2QG7A 4USFA 3GI3A 4J95A 5JFWA 3EQCA 3P23A 1BI7A 3EH9A 3R71A 4XG3A 4FV4A 1TVOA 2BRMA 2C30A 3NPCA 3MVMA 4NSTA 4TTHB 3LFSA 3REPA 3BELA 5TO8A 3D83A 4FSQA 1XR1A 2Y9QA 1SVHA 3Q6WA 3BBTB 3NUYA 3BEGA 3R1QA 4II5A 5HCYA 4AGCA 3ANQA 3CSVA 4ACCA 4G3GA 4CFMA 1CTPE 4AQCA 4FYNA 3L9PA 1Q4LA 2X7GA 5CS6A 4P5ZA 4O2PA 4IIRA 4I20A 5CU2A 1M52A 4YURA 3TIZA 2WQMA 1WBWA 4JBQA 2WMXA 4FKRA 5HO6A 3C5IA 1YDTE 4QMVA 5HNIX 4ZTSA 1PXIA 3ZFMA 2PMIA 4ITHA 3UIMA 1R0PA 4JJRA 3SX9A 2YIXA 3V5JA 4K6ZA 2F2CB 4OTIA 4C37A 5EM7A 4FBXA 1OL2A 4TRLA 2YJSA 4YNEA 4PV0A 2QLUA 5I4NA 4QOXA 2PUUA 3HYHA 1U46A 5CNNA 3S4QA 3EQIA 4DH8A 4FL3A 5CXZA 1OZ1A 4G2FA 5IA1A 4EQCA 1OKZA 3R7IA 4MXZA 2YACA 2WQOA 5C27A 5HU9A 1YXVA 4F99A 4WBBB 4QYYA 2WMTA 5HX6A 4FICA 4FKQA 2OF2A 1H1RA 2YDIA 4DGMA 4CG9A 2XEZA 2B9IA 4MKCA 3RTPA 3R1SA 4A07A 3CIKA 2W5AA 5DMZA 4CEGA 3I5ZA 2YA9A 3ZEPA 4O22A 3OTVA 5EH0A 2BAKA 4OTQA 4I6FA 3RKBA 3LKMA 5M4CA 1OL5A 1AD5A 3CD8A 4DC2A 3GCVA 5IPJA 2R3MA 4A9TA 3UZTA 3CXWA 3OW4A 2ITZA 2GTNA 2O64A 2R2PA 3MJ2A 1Q8YA 4L8MA 4HYIA 5AP0A 4BDHA 3I4BA 4EKKA 5LVOA 4BCQA 2UZWE 4A9RA 4FKOA 4GT4A 2HCKA 2ESMA 3GU4A 5BQ0A 3COKA 4UB7A 1I09A 3HL7A 3HMNA 3LJ1A 4I4FA 4PP9A 1PY5A 5IEVA 2CKEA 4PP7A 2BDWA 4QQ5A 2FB8A 3KXNA 3ZO2A 3KRWA 3CS9A 4S31A 3A4OX 3O50A 3KEXA 4LFIA 3SRVA 4CFFA 5GINE 3GFWA 5EYCA 3TEIA 3QKMA 3G0FA 3PPZA 3RCDA 2VAGA 3ITZA 2LAVA 2UW8A 2OZOA 3DFCB 4DH1A 4F63A 2GCDA 1CSNA 4FTAA 4OTFA 3NMUF 1AQ1A 1OIQA 3TXOA 5JEBA 4Y5HA 4DGOA 4UMTA 4PL3A 4FTTA 3ORKA 2UZUE 3VQHA 3WOWA 4E6AA 5JKGA 3NDMA 4ZP5A 1YXUA 4BYJA 2QHNA 4C4HA 4Z55A 2X2MA 3R9HA 1YHVA 5EG3A 4EK4A 5IQAA 2BUJA 2WZJA 4C62A 2XIRA 3QX2A 3CKXA 3F2NA 3OUNB 1ZAOA 3QTWA 3UOKA 4DG3E 3M1SA 4FKIA 1T45A 5DOSA 4A7CA 5M53A 5EKNA 5E9EA 4AT4A 2Y8OA 3HDMA 3MVHA 3QCYA 1UU9A 4YTIA 4ARKA 1KE5A 4BIDA 4HVIA 3HLLA 4EUTA 3N51A 3E64A 3W8LA 3A4PA 3QAME 1PHKA 4HYUA 4GUBA 1TQMA 3EQBA 4FV7A 3GCPA 4ZSJA 2DYLA 4ZSLA 3RAWA 4A9SA 2W1GA 5HU3A 1L3RE 4CTBA 3MW1A 4TYGA 5JSMA 2ITXA 4FG9A 3OXTA 1TQPA 4M97A 4EH2A 1JWHA 3CJGA 2G01A 2HW7A 1Q3WA 3FE3A 4N0SA 3VW6A 1Y8YA 3ZUUA 2YWPA 4R5YA 2X2KA 4KAOA 2QOHA 4MBJA 4I0RA 4FE2A 1FVRA 4TT7A 3EN5A 4GK4A 3PA3A 3QTUA 2WTDA 4QP6A 3BKBA 3DOGA 2ZJWA 3RVGA 2W9FB 5EFQA 2XRUA 3BZ3A 3EFWA 4QT1A 3A7IA 2PUNA 4F64A 1GAGA 4FNWA 4I6HA 3WZEA 5F95A 4JDJA 3GUBA 3MDYA 5I9XA 3VS2A 4BDIA 4TNDA 2P3GX 5HBJA 2VTJA 5IUHA 2B1PA 2OBJA 2PE0A 2OKRA 4GU6A 4IVAA 4JG7A 3DBDA 5CVFA 4FSMA 2W7XA 4ZMFA 5E1SA 1W0XC 3WZKA 4BWKA 4EBWA 2HZ4A 4CFNA 3PPJA 4FR4A 2JFMA 4I1ZA 3G2FA 4ZJJA 5EHLA 3WBLA 3ZO4A 4F7NA 5LVLA 3MY5A 3T9TA 3PXQA 4YPDA 3NYXA 3R9RA 2XK9A 3BQRA 3UPZA 2VTNA 4FTNA 5CXHA 2C5NA 3E7VA 3O96A 5DR6A 1YI3A 4JOAA 3FLZA 3G9NA 3QYZA 3KK8A 4WHZA 3BBWA 3QBNA 4KBKA 3ZSHA 5BUJA 2ZM4A 5B0XA 4NM5A 3UOLA 4L9IA 3LFNA 4GG7A 4EK5A 2EWAA 1J1BA 3ZOSA 4LV8A 3FDNA 4WUNA 3C1XA 2R7BA 3BLQA 5F20A 5M51A 5L2IA 3RCJA 2B4SB 4USDA 5HE0A 1Q97A 5IF1A 2C0TA 2XM8A 3KREA 3CQWA 1QMZA 4RJ3A 1ZMVA 4FTKA 1A48A 1H01A 3ZDUA 4F6UA 4RGJA 4ZTQA 5CENA 3FXZA 2ITVA 3LFDA 2J5EA 2X9FA 3AC4A 3PE1A 4X2FA 4C36A 4D2WA 2UW7A 4MD9E 4ZY6A 3SLSA 4MVFA 4DFBA 3Q9YA 3H30A 4RIXA 4GKHA 3BGZA 1NY3A 4AF3A 1CDKA 1WBVA 3N9XA 2W4OA 3BI6A 4IDVA 4U97A 3UP7A 4ORKA 4FV8A 5LVMA 4IH8A 4EHEA 4P4CA 3UG2A 4K33A 3VUHA 4BCFA 4CCUA 5IMEA 3PXKA 2CHLA 5A4QA 2O3PA 2UVXA 2VTQA 4IJ9A 4FKPA 4YJUA 5IA5A 3UP2A 2C1AA 3VVHA 4QYFA 3PJ3A 4ANOA 3VAPA 5DFPA 3KF7A 3QHWA 4XP0A 4DE4A 1WVWA 2HY81 5HGIA 3TV4A 2BZJA 3KY2A 4PF4A 5DG5A 2ONLC 2R3JA 3FI3A 5H2UA 4EK8A 4F0IA 1ZZLA 2IZUA 3QUPA 3DBFA 5M55A 3ORNA 4BDEA 3SG9A 3E8EA 3UJGA 1MQBA 2IVVA 3OHTA 3B8RA 5HNGA 3DB6A 5KBRA 3AMBA 4Y8DA 4Z9LA 3JVRA 3EYGA 4BZNA 3BQCA 1ZOEA 5BYZA 3TWJA 2BAQA 2VZ6A 4OUCA 3UGCA 3LCTA 3DNDA 4X2GA 4KIKA 1S9IA 4CRLA 1PMNA 1H00A 3KF4A 1XWSA 5J9ZA 5H8GA 4IADA 2CLXA 2PVMA 5EYKA 2GTMA 4Z3VA 5AA8A 3QALE 5LCJA 4PDYA 4IFGA 2ZMDA 5J79A 2X2LA 1DAYA 1KOAA 2HZNA 4FTJA 4QQJA 2Q0NA 1OIRA 2YITA 1DAWA 1X8BA 4YJTA 1ZMWA 2PTKA 3CEKA 3DJ6A 3TNPC 5CAUA 5IISA 4DF3A 4FV1A 3ZC5A 4C4JA 2BTSA 2J51A 3RWQA 1KWPA 3D7TA 5J95A 4FOBA 4ZLYA 5IQBA 1OL1A 3HGKA 4PL4A 4EOJA 4MCVA 1JKKA 1UKHA 2JBOA 3FV8A 1UKIA 4CMTA 5GZAA 4HOKA 5HLNA 5L2WA 3UO5A 2PZ5A 2GFSA 1IRKA 5EI6A 4APCA 4CKIA 3PSBA 4RFZA 4PMTA 4UWCA 3EQDA 5J5SA 4X2KA 1ATPE 1Q24A 4JBOA 4FV5A 4D4SA 4EZ7A 4ZMEA 1YDRE 4QO9A 3CKWA 2IWIA 4FMQA 2YCSA 4ZS0A 4YC3A 5KBQA 4AN9A 1GOLA 3FHIA 3CLYA 1CKPA 1HCLA 3TTIA 4OT5A 5IQHA 1YI6A 3EJ1A 3ZUVA 3BYVA 1YW2A 2XKDA 2XZSA 3TJDA 1YXTA 2OI4X 4NIFB 5I9VA 4NWMA 2WIPA 5HORA 3P79A 1KV1A 3C4XA 4J1RA 4KIQA 3WYXA 3C4FA 4ZY4A 2CKPA 2UW5A 3TKIA 1M7QA 2QKWB 3D5WA 3QRTA 4GL9A 4ZTNA 3E63A 2VGOA 3E8CA 4NW5A 1M7NA 2ETMA 1OMWA 3R9OA 4J71A 3ZONA 2QR7A 4XX9A 3UNZA 5L6PA 3O8TA 4G17A 4ZS4A 4D58A 3E3BX 4JX3A 3DKFA 4I22A 3GP0A 5EW8A 1Q3DA 4FVQA 3MFUA 2W5BA 3ATSA 2B9JA 5FXRA 1RQQA 2QNJA 3G5DA 4HGLA 2Z7RA 4TY1A 4KIPA 2XRWA 4C02A 4BBFA 1YHSA 1ERKA 3PYYA 3QD0A 4XBRA 3POOA 3HP5A 4ITIA 2OG8A 4IZ5A 5DT4A 4PWNA 3NZ0A 1JOWB 5JQ8A 3PIZA 2UZDA 2XMYA 4AU8A 3CPCA 4O84A 3QCXA 4HPUE 3ZHPC 4D1XA 1KE8A 3FLQA 4ANNA 3RI1A 5A54A 5BVFA 3L9NA 3PIYA 2WQEA 2XK6A 3BLRA 5TE0A 1CKIA 2WQBA 3ALOA 3GCSA 3VUGA 1YVJA 5EHYA 4DGLC 4XMOA 3DZOA 3U9NA 2F9GA 2W99B 3OBGA 1NVQA 1Q5KA 3NIEA 4F9CA 2B53A 2Z7SA 3Q9ZA 1RE8A 2VTSA 4XH6A 4R1YA 5I5ZA 3BYOA 3U6JA 1UU3A 1QPEA 3IECA 3OD6X 3TUDA 4UZDA 4WUAA 3OWPA 4RIWA 3QRIA 4YSJA 5JRQA 3AC3A 4X6QC 5L2QA 2QURA 3PVBA 4QNYA 3I60A 5TF9A 5TKDA 2HENA 3PE2A 4RIXB 4MXYA 4JDHA 5AM7A 4BKZA 5A46A 2AYPA 2XJ1A 4G3EA 4L44A 4ENYA 2JEDA 3V5WA 1ZXEA 4E5BA 3DXQA 3CC6A 2CDZA 2CN8A 1YXSA 2R3KA 4A4XA 4FTCA 2H96A 3ZLWA 1GIIA 4G6NA 1SM2A 3VC4A 4IAYA 4BIEA 3JS2A 2C4GA 3KVWA 3GNIB 3GCQA 4YO6A 1V0BA 2J0MB 3ZRLA 3HAVA 4GH2A 5IA3A 4WNPA 4BY9E 2YAKA 2CCHA 4JVGA 4BVUA 1P14A 3PVUA 4PTEA 3WILA 3LLTA 3R30A 1H24A 5AEPA 2GQRA 3FAAA 5AV2A 1WBTA 3I0QA 4IQ6A 3MTLA 4ZZMA 2JAMA 2X7FA 3PJ2A 2IW9A 4EWHA 3AC2A 3EHAA 3WZJA 4BCIA 2BIKB 3ALNA 4MD8E 4AZVA 2C5YA 3FZOA 4OTWA 4O7NA 4XP3A 3PFQA 4M13A 4GVAA 2QG5A 2ACXA 4CYJA 4XHKB 3RBWA 4E6DA 5AP1A 2IO6A 3UIXA 3GFEA 3NSZA 1REKA 4FTQA 5EKOA 3BHUA 2DWBA 2P4IA 4FKVA 4GW8A 1YOLA 2CGVA 4M69A 4RWLA 4ZTLA 2WMSA 5I9UA 5ACBC 3NUXA 5TOZA 1W8CA 4EBVA 1M2PA 5AUZA 3TG1A 4RX8A 3D0EA 2BVAA 1FMOE 2JGZA 2UW6A 3PTGA 2ZVAA 2WU6A 2E9PA 3CTJA 4S2ZA 2YWVA 2BAJA 2B54A 1MUOA 2XJ0A 4HGTA 2PSQA 4ALWA 2QHMA 2QCSA 2ZDUA 3JVSA 2XIXA 4F6WA 5M4FA 4O0WA 4I23A 1DI8A 4QTAA 4QTCA 4RC2A 2Y6OA 5JZNA 4CQGA 2PUPA 4BGQA 4HGEA 4K11A 2EXCX 5CVGA 4D0WA 4QRCA 1QCFA 3B2TA 4BICA 3SC1A 3ZM4A 4S33A 2YIRA 1OECA 3ACJA 4HCVA 4MEDA 2XKEA 1YI4A 3NYOA 3OBJA 3QZGA 4YBKA 2HZIA 2XIKA 5BMMA 2BZKB 3IW4A 3UBDA 3EIDA 3FQHA 4F7SA 3LXPA 5A9UA 1FBNA 5LOHA 2R9SA 3Q6UA 4YZNA 2UZOA 3PY1A 3A61A 2RIOA 3FZPA 4E93A 1H8FA 1QL6A 2UZNA 3KA0A 2A0CX 3BU5A 4A4LA 2OXDA 4TYIA 1TQIA 1XH9A 4F9YA 3LW0A 3TN8A 3W8QA 1T46A 2VTPA 4U5JA 4BHNA 5A4EA 3U8WA 1P4OA 4L42A 3OTUA 4HYHA 5J8IA 2XUUA 4K1BA 4FX3A 4O7WA 3SKCA 2R4BA 2VO0A 2GNLA 3HUCA 4QQCA 5JFSA 4U7ZA 2X6DA 5AX9A 3FZTA 3E92A 5DIAA 4ACHA 4TWOA 3AC1A 4RIYB 1H26A 5LVNA 1Q8WA 1XJDA 3LQ3A 2QO2A 4EK6A 4LL0A 3C4ZA 5J7BA 5HG7A 4BDAA 3D9VA 4M68A 1K2PA 4WSQA 3AD4A 3F61A 4FTIA 3TKUA 3V8TA 4H3BA 4NUSA 2P2HA 2XP2A 4D9UA 1XO2B 3DU8A 4A9YA 5AFVA 4PQNA 4Y95A 3RMFA 3L8VA 4PL5A 4MNEB 1OKWA 3MPMA 4GT5A 2C5OA 2BKZA 2IVUA 1H07A 1OPJA 1W7HA 5E8TA 4ANBA 2JKQA 3F2RA 4EOIA 5M06A 4LRJA 5L2SA 3OT8A 4IVDA 4GV1A 3VS5A 4UXLA 1YQJA 2BALA 2YM8A 3QQKA 3P7AA 4RFYA 5EQPA 1U4DA 3Q3BA 5C1QB 5ICPA 2UZEA 4ZIMA 2RSVA 2XH5A 2AC5A 1O9UA 3KXHA 4B6LA 1WAKA 4FTMA 3MIYA 3Q9XA 3VIDA 3H9OA 4FIFA 3D94A 1SMHA 4EQMA 3T3UA 4GUEA 4BDFA 3N4VA 2YISA 5DRDA 3S95A 4WT6A 2QD9A 4BBMA 4LQMA 2CPKE 4R3RA 5CSXA 1ZZ2A 3G51A 5IZFA 4C3PA 3G0EA 3I7BA 4U42A 4QQTA 4JRVA 5ACKA 3F2AA 4B99A 3EN7A 5CEQA 4RIWB 4CGAA 5JFXA 5HIEA 3DTWA 4R7IA 3UO6A 3QZIA 4FKTA 4CV9A 4ZZOA 4O21A 5AV4A 3VHKA 3WE8A 4BCGA 4H3PA 2W05A 3TNQB 4U45A 3R8LA 4V0GA 2SRCA 2V62A 3U9CA 4PPCA 3V5LA 4RLLA 4FTRA 2LGCA 3FSKA 3L8XA 5FEQA 3F3ZA 4X0MA 3OZ6A 2YN8A 2PVKA 3FZSA 4FI1A 3I81A 4E73A 2WTWA 5LMBA 2BDJA 5JGBA 3HP2A 3ZO1A 3IKAA 1YWRA 4D2SA 2GHGA 3KFAA 4I94A 2NNWB 2W1DA 4XNEA 2YIYA 2HXQA 2BIYA 2I0EA 5IDPA 2PVFA 3SGCA 1U5RA 4O7YA 4IX6A 2XNOA 4YLJA 4FSRA 5HD4A 4AXAA 2CGUA 2HOGA 2BHEA 3ZUTA 4FT7A 2J90A 3S1HA 4R78A 2FO0A 2E2BA 5AP3A 1PXLA 5IH4A 2IZSA 4RLKA 1F5QA 5FUTA 4YHTA 2X0GA 3DJ5A 3PVGA 2VTOA 4Q5EA 1REJA 2GNHA 3R21A 4LMUA 4WIHA 3GXLA 4WA9A 2QR8A 5TT7A 5EW9A 4ZK5A 3VO3A 1Y6BA 3QQFA 3NNWA 3VUKA 4QTBA 4M15A 1ZYCA 4IB1A 4IB5A 3GT8A 3F3VA 2JFLA 2R3HA 1WBOA 4MXAA 5EOBA 1OIYA 4EH4A 4AA4A 3NWWA 3FBVA 3R7UA 1R78A 4OTHA 4GK3A 2ITOA 2PULA 4YJVA 2YCQA 4IM3A 5CT0A 3E88A 4PNKA 3W16A 4J97A 4IAAA 5ANKA 3RK7A 3HAMA 4D9TA 3LFFA 3MIAA 2ZV9A 4MHAA 1UU8A 4XRJA 3F3WA 4UYAA 4EEVA 4FZ7A 3O17A 2YM3A 4FKJA 4BI1A 4BKJA 4XRLA 3O8UA 2CNVA 4IVCA 3PWYA 1PYXA 4OBOA 4MXXA 1H28A 1P2AA 2BCJA 5IA2A 1YOMA 2NPQA 2C3IB 1Q41A 4RWIA 1U54B 4YZMA 4BDDA 3Q04A 1M2RA 4HZSA 4IACA 4ZZNA 4CKRA 2QI8A 3W2RA 1LR4A 3R02A 4G34A 4M84A 4EQUA 3KXGA 1H0VA 3SD0A 2UW3A 2E9VA 1FGKA 5M57A 2JIUA 1G8SA 5AP2A 3Q2JA 4EC8A 3AXWA 3C50A 3O8PA 3P86A 3TIYA 2ITUA 5HTBA 4QMXA 5HTCA 2QODA 2PYWA 2PMOX 1PMVA 2WD1A 2OJ9A 5BMSA 3FQEA 2PWLA 4FNXA 5HVJA 4NM7A 4GFGA 3PJ8A 3E3PA 3EZRA 5ANOA 5J5TA 1XH8A 4WBOA 1VR2A 4E5WA 4F1OA 5HCZA 2J0IA 3AC8A 4U8ZA 1PMEA 4YMJA 4M67A 4Q5HA 3WYYA 2PZRA 4AOJA 4OTGA 5DEWA 4BWPA 5CU0A 2X1NA 5IU2A 2PPQA 2QOCA 4QMTA 3LHJA 1BL6A 5AR4A 3ORXA 3FPQA 2JBPA 4U44A 3UC3A 2UZVA 4BI0A 4WNOA 2FGIA 3NIZA 1V1KA 3QRJA 3RAKA 2JC6A 3SW7A 3L1SA 2R0IA 4RC4A 3MH0A 1AGWA 3V5PA 5F94A 4C0TA 5CASA 3HA8A 2UZTA 1OBGA 3AMYA 4UWYA 2W1ZA 4JIKA 4CV8A 4X7QA 4E4XA 3NCGA 2F7EE 3K54A 3ZSIA 2X9EA 2RG5A 4O38A 4N6YA 4NEUA 3LZBA 5JT2A 4IX4A 1FVVA 4G3DA 3VS3A 3ENMA 4FF8A 4MQ2A 4XP2A 3TKHA 1KE7A 3ORTA 2Q83A 3AGLA 3IO7A 4DG2E 4F65A 4WD5A 3QQUA 4O96A 5CVHA 3FL5A 1IR3A 3NCZA 2RFDA 3CD3A 5L4QA 4ANMA 4WOVA 4WKQA 4Y5QA 4CFVA 2ITQA 5A6NA 2JKKA 3DFAA 4U6RA 2QOBA 2G1TA 2OSCA 4YJQA 4XS2A 5CF6A 3I7CA 3KXXA 2UW0A 2R7IA 3I6UA 4Y73A 3RPOA 4E4MA 2R3PA 5CNOA 4J8MA 4V0GB 4FKGA 1BX6A 1FMKA 1VZOA 3C5UA 2GS2A 4JR3A 4PPBA 3E7OA 4QPAA 4RJ6A 4ZAUA 3SVVA 5E90A 3PRFA 4O7SA 1UNLA 4PTGA 3L8SA 4RA5A 2H9VA 1WFCA 2PY3A 4M0ZA 3WF5A 4RBLA 3ZO3A 4BYIA 3D15A 4XOZA 4OLIA 4PMMA 3IK3A 5LXMA 5FWKK 3PDTA 2ITYA 2J50A 3QGYA 4M0YA 4AW1A 2VGPA 5HOAA 3SDJA 3BGPA 2W9ZB 2WOUA 2VD5A 4TL0A 3IW8A 4AA5A 4XG8A 3IOPA 4Y85A 4W9WA 3DA6A 4O2ZA 4S30A 3BIZA 3HKOA 4FEUA 2WAJA 2XM9A 3P7CA 1GZNA 3VS1A 2WTJA 3MBLA 4ZTHA 2JD5A 5A4LA 3GENA 3UYSA 2RGPA 2IG7A 2E9OA 4QPSA 4KS8A 4L67A 2RL5A 4LI5A 4KSPA 4MBLA 4YJOA 5IQCA 3NVKI 4OAVB 1JBPE 2QVSE 3DBQA 1SVEA 3H10A 1IA9A 3RHXA 1OPKA 4W4WA 4DTAA 3W10A 4O7TA 3AT4A 4L52A 1LUFA 3CQEA 3O7LD 3BHYA 2WKMA 5HESA 4C35A 4DEBA 3GQLA 3E62A 2R3OA 5H8BA 4BTFA 2WB8A 3MGYA 4F0GA 5IQIA 3BGQA 1FGIA 3F9NA 4FZDB 3I0OA 3IS5A 4FZAB 1R0EA 4ZLZA 4FTLA 1APME 5FGKA 5CU3A 5EHOA 2BPMA 2QU5A 5DA3A 5HI2A 2W1HA 5C8MA 1KE9A 3TACA 3EN4A 3AG9A 4RJ8A 4I93A 4ITJA 2BZHB 5AUWA 4QMUA 3PPKA 3VBYA 4PTCA 4MXOA 3F69A 3TL8A 4XG4A 5DRBA 4J52A 2YHVA 5FM2A 3AT2A 1JSVA 2VWIA 1FPUA 4RQVA 3VF9A 5B2KA 2OO8X 1OKYA 4L3PA 3KRRA 4XV9A 5E91A 2ZDTA 3VRZA 1Q8TA
chains in the Genus database with same CATH superfamily
2O5KA 3ERKA 3D2IA 3R1YA 4TXCA 4I5CA 4NT4A 4AAAA 4RPVA 4G5PA 3GU5A 4OTRA 3ZDIA 1K9AA 1XBAA 2YM4A 3FMKA 3DT1A 4XCUA 4CMUA 4CZYB 3KMMA 3MSSA 3OCTA 4I5MA 4IWDA 3FYJX 2W1FA 4NM3A 4DHZA 3S3IA 4YTFA 2C1BA 1J7IA 1IASA 3EFKA 3QD4A 3MVLA 5DN3A 4DH7A 4O0VA 3VBWA 1H1SA 3ROCA 4DCEA 3FI2A 4H1JA 5JGAA 2PZYA 5CSVA 2H6DA 4ZSGA 5K0KA 5I0BA 3RZFA 3ZXTA 4F1MA 3DXPA 3R0TA 4C4GA 3OY1A 4ALUA 4AW0A 5ITAA 5FTGA 3EFJA 3LXKA 3TUCA 1Y8GA 2EUFB 2JITA 4FGBA 4ZXTA 4DFYA 3ORPA 4UMPA 2GSFA 3V51A 3ZZWA 2X4ZA 2WPAA 3LFQA 2Z2WA 2O8YA 4WSYA 4JAIA 4BJJB 1FVTA 3RWPA 3RAHA 4EH6A 4HVHA 2XNBA 4W8DA 4FKSA 4PUZA 4RVMA 3HV4A 2RF9A 1XMMA 4BR3A 1R3CA 3OG7A 4R3CA 2REIA 3DDPA 3BYUA 3C4WA 1M14A 2DQ7X 5B7VA 2I6LA 3FC2A 1Q8ZA 3SG8A 1YDSE 2QO7A 4MWHA 3IDPA 5HX8A 4I5HA 5L6WL 5CANA 4CYIA 2EXMA 2YDJA 4UX9A 3OS3A 1H0WA 2VUWA 4FSUA 5LMKA 5KMOA 4DHIB 4IANA 4I92A 5L3AA 2J0LA 3K5VA 4L00A 5IQDA 4C59A 4C33A 4AFEA 4AXCA 2P55A 5AV1A 3ZM9A 3QKKA 4FK6A 5CTPA 5FP5A 5E8ZA 1B38A 4ZLOA 2OIDA 2C47A 4UMQA 4NW6A 3SOAA 4FTOA 1XKKA 3Q4TA 4GRBA 5JRSA 3JY9A 5CZIA 4D4VA 4DTBA 3HRBA 2UW4A 2G2HA 4QDVA 3LMIA 1YHWA 2VWYA 3P0MA 4JRNA 2X0OA 3OP5A 1NA7A 2BKKA 2VTIA 4W4XA 3EWHA 4G5JA 4BKYA 2I0HA 5HG5A 2HIWA 2GNIA 3SRVB 4UYNA 3F66A 5IH5A 3D7ZA 2V7OA 4R3PA 4QMPA 3M2WA 1LP4A 4NYEA 4ZY5A 4FL2A 3RINA 3RM6A 1CMKE 5T3QA 3K5UA 4M14A 4G6OA 4QPMA 3Q60A 3PY3A 4NKAA 4AXFA 3GC8A 4XLVA 3HX4A 3R2YA 2YAAA 3BE2A 3COIA 3FKOA 3IDCA 3HV6A 3QTXA 3QX4A 3TCPA 4RJ5A 2WTCA 4MF1A 5I3RA 3ID6C 3PY0A 3OWJA 2ZV7A 4I0SA 3BCEA 3FUPA 4AE6A 4O7ZA 3R63A 4FA2A 5KMKA 3QZHA 4NFNA 3TNWA 5A4TA 4LL5A 2DS1A 3DLSA 4GYGA 1E1VA 3FQSA 5D9HA 5AP5A 4DLIA 4DAWA 2XCHA 2F49A 3WF6A 3VQUA 3PLSA 4RIOA 4ZSEA 4AS0A 4EH8A 5D1JA 5IUIA 5DEYA 3GVUA 5AUXA 2XEYA 4JT3A 4FV0A 2XNGA 5EM8A 2IN6A 1HCKA 2X8DA 3QA0A 4TYJA 4XYFA 4DH5A 2J9MA 4LOPA 4AQKA 2NP8A 5GNKA 5BPYA 3TNIA 1XQZA 3LCDA 4J53A 1PF8A 1V0PA 3G6GA 4IDTA 4A9UA 3V8SA 3OF0A 4C2WA 3MVJA 4BCKA 3BU6A 1YWVA 5AX3A 2C0OA 1GZKA 2HWOA 3UVPA 5KZ0A 4LV7A 3ZRMA 2JDSA 5ANDA 2XNEA 2FSOX 3D5VA 2VX0A 3LMHA 2PZPA 3PA5A 4YZ9A 2X4FA 3COMA 3GCUA 4O0UA 4KD1A 1PKDA 4JDIA 4OTPA 5K4IA 5HZNA 4DLJA 5DT0A 4O6LA 5DPVA 3G6HA 5HIDA 5GJDA 4AZTA 4G3CA 2WOTA 2WU7A 3IOKA 4ACDA 4E1ZA 4TYHA 5CY3A 3NYVA 3R8ZA 4BDKA 2OLCA 5CSPA 2G2IA 1SYKA 3DV3A 2VN9A 3OXIA 3ACKA 4MAOA 3MPTA 3QUDA 4YHJA 3ORIA 4A4OA 4AN3A 1VYZA 3JYAA 4QMNA 4AWIA 3IW5A 2BMCA 1E1XA 3LFCA 2WTVA 4HZRA 4NCTA 2PHKA 3SXFA 4LYNA 2OH0E 1NVSA 4P2KA 3DQXA 4O83A 3QXPA 2JKMA 3I6WA 4MQ1A 3UZPA 3NUAA 3VNTA 4KRCA 3E87A 2X8IA 4LG4A 4ONAA 4XUFA 5HHWA 2FSLX 4FIJA 5K5XA 2VWZA 3HMMA 2AQXA 4L46A 1W2DA 3QWKA 4O0SA 1MRUA 1W84A 4ZJVA 3JR1A 3DK6A 3FJQE 2PMLX 5CQUA 4C2VA 5IH6A 2B55A 5F4NA 3W0SA 4KSQA 4C4EA 5KMMA 2VTHA 1ZRZA 2GHLA 4IW0A 4NJDA 2XIZA 3OFMA 3FEGA 4FEWA 4FNZA 5CI6A 3DAJA 4LOOA 5CF8A 5LVPA 3LIJA 4CSVA 3QCSA 4AZFA 2GHMA 4OBQA 4CKJA 4FT0A 4KIOA 4FSTA 5EM6A 5BVKA 4CCBA 3P5KA 4GFOA 4EHGA 2UZBA 1I44A 3OOMA 2OF4A 4BI2A 1DS5A 4C58A 1IG1A 4IX3A 4OBPA 2ITNA 3NNUA 4XV1A 3ZEWA 4HPTE 2OXYA 3TZMA 5LMAA 3VS6A 4BWXA 4YR8A 4EORA 4UY9A 4D2PA 5HNBA 4CZTA 2YABA 4ACMA 5L8LA 1URCA 2BRGA 5LWMA 3SHEA 3UQFA 3LXLA 2BILB 3ZC6A 3QC4A 1PMUA 3H9FA 4BDGA 5I9WA 4JQ7A 2CCIA 3ZXZA 2PU8A 4IE9A 4DFUA 3RK5A 5K5NA 3DLZA 2C6OA 4UWBA 1MRYA 4DBXA 2A2AA 2R64A 1JQHA 1F3MC 2Z7LA 2ZM3A 3FMLA 3V04A 4MD7E 3RP9A 3UIUA 3D2KA 4K9YA 3ULIA 4BDJA 1PXPA 2PVRA 1J91A 2C6KA 3QA8A 3ZFYA 3LJ0A 3QD2B 4X21A 3SW4A 4EZ3A 5AM6A 4B8MA 3DDQA 3UQGA 1BL7A 5H3QA 3T3VA 3V5TA 2YIWA 3VULA 2PVNA 5KMIA 2C5XA 4BIBA 5JN2A 2HY0A 2VWVA 4IB0A 3U6IA 3CCNA 2R3NA 4FL1A 3WF8A 5FEEA 4LGDA 1SVGA 4IM0A 2VX3A 2A1AB 4C3RA 5FP6A 4KIKB 4W8EA 4BDBA 3LM5A 4F6SA 4S34A 3U51A 1PXJA 2F2UA 4O27B 3MY1A 2W1CA 1ZOHA 4FZ6A 5EOLA 5HVYA 3V5QA 4P7EA 5J1VA 1W82A 2W1IA 3C7QA 3R00A 3C4EA 1Q61A 4IAKA 4RT7A 2DUVA 4GS6A 3PSDA 3VRYA 5AJQA 5KCVA 3PFYA 3OXZA 1JVPP 4BC6A 4TN6A 4OAUC 4FEQA 3KK9A 4DHJA 4CNHA 2C6TA 2W4JA 4RVKA 5AMNA 1PRYA 2OFVA 1PXMA 3FSFA 3W33A 4KWPA 4N70A 2QONA 3D7TB 3W0PA 4W4YA 4C4IA 3MI9A 1A9UA 3GC7A 2BROA 2O0UA 2YZAA 3OC1A 1OBDA 3AGMA 3ANRA 3DCVA 4TZRA 3JPVA 3L9MA 4RJ7A 3BHVA 4OW8A 3NFGB 1GZ8A 3EKNA 4XV3A 3V3VA 4EK3A 4MNFA 4IBMA 5D11A 3PZHA 3GOPA 4DGGA 2OXXA 2W17A 4O1OA 3R9DA 4ASDA 3MFSA 2GQGA 3RJCA 2WTKB 3GC9A 3CJFA 2PE2A 3UYTA 3ZBXA 3R9NA 3OEFX 4FNYA 4MXCA 2EU9A 1JLUE 3FLNC 4K18A 1WVXA 3QQLA 2OIBA 4RVLA 5FD2A 4NU1A 2R3GA 4XG9A 4IVBA 1DM2A 4DEEA 2AC3A 2V55A 3PJ1A 4E6CA 2GNGA 3IW6A 2RKUA 3ODYX 4GCJA 5IQGA 2GS7A 5H9BA 2PZIA 4D5KA 5AV0A 2I1MA 3UMWA 5EDQA 4F70A 3BYSA 4FV9A 3L8PA 2W96B 4I41A 2QOIA 1QPCA 4TYHB 5L8JA 2WMQA 3FWQA 4MX9A 1G5SA 3WIGA 1UU7A 4HGSA 4BZDA 3QXOA 2X0QA 3DBEA 4WG5A 5DLSA 5DR9A 4UMUA 5B2LA 5M4UA 2AUHA 2GMXA 1PXKA 3PVWA 4F09A 3KULA 5BVWA 1MP8A 3ENHA 2WXVA 2GDOA 3ZU7A 1VYWA 5J9LA 2VO6A 2F57A 3A7FA 2XS0A 1SNUA 3GGFA 1KSWA 3KN5A 2JAVA 2NRUA 3A7HA 3ZRKA 4Z7GA 1ZYDA 3AQVA 2YLEA 4B4LA 5EQEA 3ETAA 3CQUA 2A27A 5C4KA 2F7ZE 3QWJA 4JL9A 4DINA 3S0OA 4OTDA 4GG5A 3R7YA 4M8TA 5JK3A 2ZB0A 1J1CA 4AGWA 3WF7A 3TZ9A 5KNJA 3M42A 1H27A 4BTJA 3UNKA 4LV5A 2WEIA 2BRNA 3LXNA 3C0HA 4L6QA 5E8WA 3RNIA 4UEUA 1Y91A 3I79A 4EH3A 1PYEA 2ZB1A 3ET7A 2X81A 4IZAA 3K2LA 4D4YA 4EWQA 5IUGA 1H1WA 3MWUA 3HMIA 5CEMA 3R2BA 5GZ8A 5G6VA 4D0XA 5KX8A 3A7JA 3Q32A 2Y4PA 3PG1A 4FKWA 5LMKC 2C5VA 2A4LA 2UVZA 1V0OA 3R1NA 2JDVA 3RAIA 1JKLA 5FTOA 4TPTA 2FYSA 3CGOA 4AE9A 5C9CA 5EI2A 5E8UA 3QQGA 3C51A 3MH2A 4RX5A 5GJGA 4NH1A 2Y6MA 4KKGA 5IMXA 2P33A 4BTMA 3KN6A 4IAFA 4CRSA 5JQ5A 4YZDA 4BDCA 4DEIA 5KE0A 3OY3A 3SQQA 5CALA 2IJMA 2IZTA 3QQJA 4O0RA 5KMLA 3NS9A 1OVEA 5ETFA 3R8VA 1GZOA 3QTRA 2WNTA 2IVTA 1XH7A 5EDRA 3RM7A 4DEGA 3AKJA 4QMYA 4QTEA 5C26A 3TT0A 3NLBA 2GS6A 1W98A 3R7VA 2NO3A 4DFNA 3UDTA 4AT5A 3G90X 5GZ9A 4YGAA 5J9YA 4O0XA 5CAPA 3VWAA 4HVDA 2XNPA 1U5QA 3EOCA 1RJBA 5FBNC 1WCCA 3WZUA 2R3QA 3R8UA 4PX6A 4F0FA 2ZM1A 5M09A 1R1WA 2JKOA 3FPMA 2UUEA 4B7TA 5D7VA 4IB3A 3QF9A 5HG9A 4O91A 2WQNA 5JH6A 4QYEA 3WARA 2WHBA 4UBAA 2R3IA 5E1EA 2I7QA 3NW5A 4XOYA 4E3CA 4AG8A 2E9NA 4M69B 3MH1A 3Q96A 5HE1A 2UVYA 4MK0A 4NM0A 1OGUA 1ZY5A 2BTRA 3BHTA 3OT3A 1BI8A 4YJNA 3P7BA 3QKLA 4DEAA 3FYKX 1NT2A 4KS7A 4FUYA 3HEGA 3SA0A 2F7XE 5CX9A 2Y7JA 4JIAA 5KUPA 5M08A 4FIGA 2HWPA 1Y57A 5DVRA 1IEPA 4F1TA 4GFMA 5D12A 4BCOA 4U40A 2ETKA 2YJRA 4F9AA 4ENXA 5J87A 3DTCA 3W55A 4EH9A 2WTKC 4M3QA 1DI9A 4JI9A 4W9XA 1JKTA 4ZJIA 5KO1A 5LQFA 2C6DA 5HTIA 4PPAA 4ID7A 4DA5A 2ETRA 4O82A 5K4JA 3H0ZA 3WIKA 3OMVA 3C0GA 1GJOA 2OH4A 2ZMCA 3CY2A 2W5HA 4JLCA 5IKWA 4FTUA 4AZEA 4RZVA 3A8WA 1XH4A 3GU8A 4QP2A 3NUPA 5K0XA 3EL8A 3BRBA 3LCOA 3IQ7A 3Q5IA 3A7GA 3R04A 1ST0A 5I9YA 2PVLA 4FG7A 3N4UA 1ZYLA 3WZDA 1GIHA 5IQFA 4V01A 4NCTC 2G9XA 4RVTA 3VUDA 3NVMB 2OZAA 1R39A 4HJOA 4B0GA 1PXOA 4BCJA 5KMNA 3NNXA 3UTOA 1JPAA 5L6OA 2XF0A 4NFMA 4QMQA 5DR2A 4FT9A 1BLXA 2YDKA 5H8EA 3RZBA 4EH7A 4S32A 4M66A 4C61A 5AAEA 1ZYSA 5BX0A 5CSHA 4QYHA 3KULB 1WVYA 3BX5A 3K3IA 3O0GA 4NTSA 5CSWA 3R01A 5EDPA 5BVEA 4XG2A 3UE4A 2VTMA 4G9RA 2XKCA 3QFVA 3GBZA 4YJSA 4UXQA 3Q5ZA 4G9CA 4ZTRA 3Q2MA 3QHRA 5AUYA 4F9BA 4MBIA 5IG1A 3RNYA 5B2MA 3MPAA 1H1PA 4H1MA 1FOTA 4YBJA 4WNKA 4IAIA 4L68A 1Q99A 2OICA 2WMUA 4FKUA 4JX7A 4RRVA 5E8SA 5FQDC 1UVRA 4RZWA 3CE3A 5F1ZA 4AT3A 5BVOA 2RG6A 5BNJA 4E8AA 2C3KA 3A62A 4FSYA 3QRUA 1B6CB 2XKFA 1A06A 2XYUA 3NAYA 4AW5A 1WMKA 2HAKA 2J0JA 3P9JA 2UW9A 4IWQA 4RA4A 4AP7A 4YLKA 5E4HA 3F6XA 3U55A 1H08A 1ND4A 1BUHA 5HKMA 1IAHA 2B0QA 5C4LA 1B39A 4AZWA 3BHHA 2XK4A 3FKLA 3RHKA 3V6SA 4UZHA 2WFYA 5HEZA 4LGGA 1MRVA 2ERKA 4E5AX 1ZY4A 5IDNA 3MYGA 3NR9A 3KRLA 3IGOA 3PXRA 4QP3A 5CAQA 4CLJA 4Y72A 2EB3A 3AD5A 3VF8A 3DQWA 5F9EA 1G8AA 4JBVA 5C8KA 2FSTX 3EB0A 4F08A 3R7EA 3H4JA 4ZTMA 5HO8A 5FRIA 4JBPA 3PA4A 4QD6A 2OU7A 3CTQA 4YZBA 1PXNA 5T6KA 4X3FA 2ZAZA 4KKEA 4M12A 3VS0A 4H36A 3MFTA 3UOHA 2BRBA 3CTHA 3MA6A 5AAFA 4PDOA 4PDPA 4LM5A 4BFMA 3FMNA 3SXSA 5CQWA 5M44A 3VBQA 4YNOA 5AV3A 2F4JA 4XG6A 4X2NA 3EZVA 1GY3A 3QTQA 2YFXA 3NRMA 4FVRA 3NGAA 3OCBA 4QP4A 5AP4A 2G15A 4CTCA 1S9JA 4YJRA 2VWBA 3ZZEA 5K9IA 3QL8A 4QNAA 3NUUA 1W83A 4I5PA 2JDTA 5GIOE 2OWBA 2UZLA 1OI9A 4FYOA 1UNHA 1GNGA 3TZ7A 3KCKA 1UNGA 3DK3A 4QTDA 2B9HA 3NW6A 4C4FA 4MYGA 3MS9A 3EQPA 2WMVA 5FDPA 1OKVA 5LJJA 3H0YA 2WMRA 3W2QA 5IQEA 3HDNA 4TNBA 5DT3A 3FY2A 5ANJA 3E93A 3M11A 4JG8A 3OOGA 4U81A 4D4RA 2R3FA 3QC9A 3AT3A 2YLFA 3T8OA 4QMWA 5ETCA 2HELA 2CLQA 3HUBA 2PVJA 3U87A 5EQYA 4RWKA 4K77A 4PRJA 4ZSAA 4OR5A 4QMSA 5CT7A 3DAEA 5HLPA 3DY7A 3NUSA 4N4SA 4FT3A 4EH5A 4I0TA 4LOQA 1ZWSA 3KCFA 2V22A 5KMJA 5EW3A 3HV5A 3W2OA 4CQEA 4EUUA 2FA2A 4RWJA 4QMZA 1OUKA 4BL1A 4YU2A 2CNUA 1K3AA 4D1SA 2B9FA 5DBXA 3Q52A 4FSZA 2VTLA 5HE2A 2VO3A 3HVCA 3O5AA 1GIJA 4FUXA 5IEYA 4HNIA 3MV5A 3QRKA 5BYLA 3SOCA 1H4LA 3ZS5A 3VJNA 3F7WA 3V01A 3F3UA 3FI4A 4AUAA 4YSMA 1E9HA 3IGGA 4Y46A 3KRXA 4IX5A 4BGGA 4DT9A 2OZAB 4F9WA 4KKHA 5CF4A 2QOOA 1JNKA 4CFUA 1FQ1B 1VJYA 3TYKA 2X8EA 2H8HA 3D5XA 3L9LA 4O7VA 3LJ2A 5LWNA 2XYNA 4FIEA 4YTCA 5BV3A 3FMEA 3KXMA 4IWOA 5EYDA 3RPRA 3JUHA 4GVJA 4YC8A 2R5TA 5AUUA 4NIFA 3ZBFA 3TDWA 4RX9A 4QDEA 2WTIA 2GQSA 5E8VA 3C4CA 4JR7A 2WEVA 3R73A 4DG0E 2RFNA 4QYGA 3VBXA 3O2MA 2QU6A 3A60A 5FDXA 4EJNA 4KUJA 1TKIA 2HZ0A 4AA0A 3DZQA 4ASZA 2IZRA 4DH3A 3PZEA 2ZOQA 3R28A 5CAOA 3VONA 5AR5A 2RFSA 4BCPA 4WNMA 2C69A 2ZV2A 4V05A 3VJOA 5FG8A 2J0KA 3QTIA 3ELJA 4TYEA 4R6VA 2XB7A 3O7LB 3UDZA 3A8XA 1WBSA 3BV3A 5FXQA 3VN9A 4O86A 4FSWA 5HIBA 4YZCA 3O23A 3EYHA 3JXWA 3DKCA 5DHJA 3Q4UA 3TV7A 3IONA 5IEXA 4GU9A 3P1AA 4DBNA 4QMOA 2V0DA 4CFXA 4YJPA 5AAGA 4RC3A 3S2PA 4DGNA 4FG8A 4EOKA 5BYYA 3TM0A 1UWHA 2B52A 2YCRA 1KV2A 4U79A 4BCMA 1H1QA 2C6EA 1O6YA 2WMWA 3BPRA 3NAXA 1JAMA 3MB7A 3O51A 4MWIA 4ASEA 1NVRA 4L7SA 5FM3A 4CMOA 1OGYA 4MF0A 4NJ3A 5L2TA 2PUIA 2C68A 3DNEA 1UV5A 2GU8A 2E9UA 3CGFA 4FC0A 2C6LA 4E20A 3HRFA 1XMLA 3EKKA 5AIRA 1W2CA 2VTRA 3DPKA 4QMMA 2OJIA 3CY3A 5AP7A 4ANQA 4Z7HA 3LMGA 3TUBA 2X6EA 1WZYA 4U3ZA 3ZCLA 5C8NA 3BWFA 1J7UA 1G8KA 4DHFA 1PJKA 4DEDA 4E4LA 4FT5A 4HW7A 4X3FB 4BBEA 4O1PA 3D4QA 3GOKA 4U3YA 4W4VA 4AOIA 4KRDA 5I3OA 4FGRA 3EQGA 4FIIA 3OCSA 4GSBA 2VTTA 4FEXA 3TI1A 4FKLA 5IA4A 3U54A 3IW7A 4IFCA 4O0YA 5ETIA 3B2WA 4D5HA 3FI8A 3EMGA 5K3YA 3KRJA 2XK8A 2C6IA 4E7WA 2R3RA 1OPLA 2EXEA 3FY0A 3K3JA 2VV9A 4QP8A 3PP0A 3UO4A 3ATTA 1URWA 3LFEA 4I3ZA 5CAVA 2ZV8A 2ZYBA 3OUKA 4PMSA 4RJ4A 2J7TA 4IZYA 3Q53A 3FHRA 3W18A 4D55A 4EC9A 4KA3A 4BHZA 4R5SA 2J6MA 3DKOA 4NKSA 5CU6A 3CPBA 5HBEA 3BLHA 4H58A 3OROA 1JSTA 1SNXA 1Z9XA 1LEWA 3SAYA 4BZOA 4O7LA 3AC5A 4JQEA 3IG7A 4UN0C 3TDVA 5A3XA 5FTQA 4CZUA 4R77A 4JDKA 3W2PA 3DXNA 4C34A 1KOBA 2GFCA 2VO7A 3LE6A 5LCKA 1FINA 2XNNA 3UPXA 4ERWA 2YZLA 4GEOA 5DGZA 3V8WA 2V7AA 2VRXA 5D7AA 3B8QA 3H9RA 5CZHA 5M56A 4DCAA 2BFYA 1XH6A 2KTYA 4PNIA 3S00A 4QMLA 4YP8A 4C57A 1Q8UA 3SV0A 3GEQA 5KKRB 2WGJA 2X7OA 4G16A 4E6QA 1HOWA 4JG6A 3VS4A 2A19B 2GNFA 4E4NA 3KL8A 3PUPA 3KXZA 3PIXA 3UVRA 5CU4A 2YEXA 2C3JA 2JDRA 3MY0A 4XG7A 4AFJA 1LEZA 3HMOA 1M2QA 2QOLA 2Y0AA 4AGUA 5CF5A 5J7HA 5E8XA 2O63A 4O6EA 4KABA 1SZMA 4OT6A 5HCXA 4GIHA 4MH7A 4G6LA 3ZLYA 2BHHA 4EHZA 5FBOA 2JDOA 3W1FA 4BRXA 4F78A 3HV7A 4EZ5A 3LQ5A 2QOKA 5EI8A 4D2VA 3UOJA 3FL4A 4PDSA 3C0IA 3UC4A 5HO7A 4G31A 1O6KA 4IAZA 4RG0A 1P4FA 1RDQE 2R0UA 4LUDA 3TTJA 4EL9A 3UODA 3WI6A 2YCFA 3HMPA 4CXAA 4EJ7A 4RSSA 2W1EA 5DI1A 2NRYA 4IC8A 2I0VA 4PY1A 2O2UA 3FMDA 4RIYA 5AWMA 3ZLXA 4AX8A 4DDGA 3OWKA 4O4CA 4NK9A 4CFWA 5D10A 5E92A 4TKSA 2V5QA 3TV6A 2XK3A 1P5EA 4CLIA 1QPJA 2OGVA 3KKVA 3V6RA 2G2FA 5KZIA 4C7TA 4OGRA 5G1XA 2JLDA 1L8TA 3EQRA 5HBHA 1G8JA 1XBCA 2C3LA 3FZ1A 3BWJA 4MNEA 2QC6A 4DITA 2BFXA 2PK9A 5AR3A 5IA0A 3DBCA 2ITWA 4H3QA 4YUQA 5CEPA 1U59A 3RK9A 2Z8CA 5GIPE 2OW3A 3FKNA 4G3FA 2XA4A 4U80A 4GMYA 4WO5A 3QCQA 2W06A 4WG4A 4WG3A 2QLQA 3UIBA 4AOTA 4EOMA 4IC7A 4GKIA 4FODA 4J96A 2I0YA 3CR0A 2EVAA 5CEOA 4RMZA 3R8PA 4EKLA 4IM2A 5JGDA 4RQKA 4X2JA 4ANSA 3PG3A 3G9LX 3R8MA 3OW3A 1OIUA 2XIYA 4R7BA 2BRHA 4EYMA 4J7BA 5C03A 1NW1A 2XVDA 3D14A 3QU0A 4LUEA 4EOPA 2VNWA 3HECA 3EFLA 4BGHA 2X0PA 4USEA 3UZRA 5DWRA 3UG1A 1WBNA 4XLIA 5C01A 2VWWA 2YM5A 4BN1A 4X3FC 4AGDA 4FIHA 3F82A 4GK2A 4AXDA 3F5PA 5FXSA 2IEWA 5HQ0A 3ULZA 3HZTA 4Q9SA 2OJGA 2X39A 4EOSA 2C0IA 3G33A 3PSCA 3A2CA 3DJ7A 3OEZA 5CEKA 2JIVA 3FLYA 2CGXA 1ZLTA 4O0TA 4CT1A 2W4KA 4TW9A 3NUNA 5AR7A 1KUTA 3CP9A 1RW8A 3QD3A 2PVYA 4DN5A 3QQHA 2CKOA 3SXRA 2PVHA 3ZTXA 5AIKA 3LFBA 4ALVA 2GNJA 3NX8A 4YHFA 3U4WA 2ITTA 3GC0A 3MN3A 3PJCA 4DEHA 3LVPA 5KHWA 4FV3A 4WRSA 2XJ2A 4IMYA 4J99A 3E8NA 2VWXA 2H34A 3O71A 4Y83A 4YTHA 4BTKA 3MJ1A 1YWNA 4EONA 3NNVA 3GU7A 2P0CA 4M7IA 4R8QA 1EH4A 4EOQA 4K8AA 3ZLSA 4P5QA 3A99A 4FV6A 4TWCA 2XAMA 1PKGA 4I21A 3ORZA 3COHA 4F7LA 1IA8A 3PLAE 5BVDA 4O4BB 1OL7A 4NTTA 5CEIA 5T68A 4B9DA 4FEVA 3BU3A 4E26A 3R22A 2I40A 4RX7A 3TNHA 1H25A 4V04A 3BYMA 4HCTA 2CMWA 3DS6A 4RFMA 3ZH8A 2Z02A 4O4FA 2OIQA 5DH3A 4O81A 5ETAA 3VUTA 3AOXA 4L53A 3ZSGA 5AADA 3C13A 3PXYA 3LFAA 5CI7A 5KKRC 4P90A 2XK7A 5KHXA 5M4IA 2HXLA 5CWZA 4K0YA 2BR1A 2C6MA 4D28A 4DT8A 2YIQA 2Q0BA 5ANIA 2Y4IB 3P08A 3QZFA 1XBBA 3VW8A 3LPBA 4FV2A 4GJ3A 4L43A 2B7AA 2YM6A 4YLLA 3RGFA 4CVAA 1O6LA 3VS7A 3ORMA 4G1WA 5FLFA 2OFUA 4X6RA 3POZA 5DE2A 5JFVA 4NL0A 4F7JA 3ZYAA 4EHVA 4LMNA 3VBTA 2WELA 4HVGA 3QUEA 2J5FA 3TZ8A 4AACA 5J1WA 4X3JA 1CKJA 3KC3A 3T9IA 2QQ7A 4I6BA 5CLPA 5EK7A 4FSNA 3UMXA 1ZARA 2CSNA 3QYWA 4Q2AA 3LM0A 3AMAA 3ROYA 3IPHA 2YM7A 2PE1A 5E7RA 4BB4A 2BZIB 4L3JA 4ACGA 4B8LA 1JSUA 3HNGA 3FXWA 3Q4ZA 1PW2A 2CGWA 3NFFB 1U54A 3VUIA 3E8DA 4D1ZA 4FZFB 4APPA 2RFEA 2BDFA 4L01A 3UDBA 2VTAA 2QOQA 3H3CA 5M07A 3HRCA 5HD7A 1VEBA 3KMWA 5E8YA 2IVSA 2OJJA 4AW2A 5BVNA 2KULA 3BE9A 2QOFA 4KB8A 1YRPA 5AP6A 5ANEA 1STCE 3QGWA 3MB6A 5ANGA 5EYMA 3MH3A 3PXZA 5D41A 4IXPA 1ZOGA 2IW6A 5TR6A 1Y6AA 2HK5A 4CD0A 3PWDA 4IZ7A 3THBA 4AN2A 4H05A 2IW8A 4C3FA 2FSMX 4IEBA 3P4KA 4IHPA 4YC6A 5EM5A 1XHAA 3VHEA 3EQHA 3MFRA 3PP1A 2Z60A 4YO4A 5AUTA 3LOKA 3IDBA 4U9AA 4HNFA 3WE4A 1ZMUA 2ERZE 3DGKA 3FMJA 4D2RA 4ERKA 2XCKA