3HMPA

Crystal structure of human mps1 catalytic domain in complex with a quinazolin ligand compound 4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
258
Chain Sequence
b'ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMSQVGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Biophysical and X-ray crystallographic analysis of Mps1 kinase inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hmpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hmpA01
3GUBA 4XV2A 3EQBA 4E6AA 5LQFA 5C4LA 2BIKB 4HJOA 4OR5A 4XOYA 2AYPA 3PLAE 2UW5A 4CFMA 1ZYJA 3BU6A 2WOUA 2JFMA 3MVMA 5L6PA 4WD5A 4M13A 3VS0A 4ALWA 1M52A 4JDIA 5F9EA 3BYOA 5FM3A 4PNKA 4LMUA 1Q5KA 4HPUE 4HVGA 3LMGA 3GGFA 4JX7A 4J95A 3R04A 1XR1A 3LFCA 4FT0A 4IW0A 4BIBA 4HVDA 4AZWA 5I9ZA 3TDWA 4MXCA 2JDRA 5FQDC 5K0KA 1R3CA 4WNPA 3OFMA 2VO0A 3UVRA 3NUUA 3NDMA 5KMNA 5KKRC 3EHAA 3QXOA 4KINA 4MXAA 4V01A 3W1FA 5H8BA 5DGZA 5HO7A 5FDPA 4GJ3A 1BL7A 1OKWA 4EZ7A 4APPA 5FM2A 4UMTA 4GYGA 4FSZA 4JQEA 2IJMA 3FSKA 4D2TA 4O0WA 3BLRA 3FQEA 2R3FA 3E87A 4M7IA 4CMTA 4EK8A 4D55A 3HP2A 3MVHA 3VJOA 3ZZEA 4E5AX 1HCKA 5J5TA 4FTJA 4X2FA 3VJNA 3QX4A 5FDXA 4H39A 3CP9A 2BILB 2R0IA 4BDKA 3A99A 5FEEA 2C3KA 2ZV2A 2BZKB 4FIIA 4GJ2A 2VTOA 4D2RA 3WE4A 5AX3A 4U3YA 2R0UA 5E8ZA 4WT6A 2J5FA 4I6QA 4DTBA 5M07A 3T3VA 4ZLOA 4BCHA 3BEGA 4EOKA 5IEVA 2PUIA 4WG4A 5GJDA 4CFNA 4BF2A 4Q5EA 3MA3A 3QQLA 2W1ZA 3BE2A 1M14A 3QCSA 4JIKA 2XIRA 4AT4A 3PVWA 1R39A 4F7LA 5J9LA 2ITZA 3UOHA 3DBEA 3DDQA 4L01A 5CAPA 5AM7A 3EZRA 3BE9A 3OC1A 4FZ7A 3O17A 1UU7A 2YM8A 3PZHA 4ANNA 4QP1A 3RK7A 4KBAA 2EU9A 2QO9A 3BU3A 3I6UA 4J71A 5D12A 3TV4A 2A0CX 4O1PA 2ZV8A 5ANGA 1WBSA 4NIFB 4O84A 3IW7A 3F61A 2Y8OA 3L1SA 5DE2A 5HG8A 4CCUA 3JS2A 4WG3A 5HEZA 2WTJA 3F88A 4FTOA 5HIDA 3R8PA 4CNHA 3HLLA 5EKOA 1LP4A 5A14A 2Z7QA 4PL3A 3TT0A 1YWNA 4JR3A 2IVVA 3NW6A 4I23A 2XCKA 2YACA 2HW6A 3NSZA 4KIQA 4BTFA 3M1SA 4GIHA 2PMIA 2W1EA 2BUJA 2WHBA 3ET7A 4FV4A 4LQMA 1L8TA 5IQAA 3IKAA 3SRVB 3D94A 4IZYA 5E8UA 2GNGA 4FV0A 4Z55A 3D7TB 2GHLA 5HCXA 4F65A 5AP3A 1IA8A 2ZMCA 5F4NA 4L43A 2NP8A 2VWVA 4BGQA 4D2VA 4R7BA 4EZ3A 3N51A 4M0ZA 3Q2JA 3KGAA 4XUFA 3UIUA 3VUIA 3E8DA 3FXZA 3ETAA 4C57A 2BAKA 4FEQA 3A7HA 1OGUA 4L42A 3WI6A 5M4CA 3C9WA 4IAZA 2XK6A 3IQ7A 3GCQA 4ZEGA 4DGNA 3VBYA 5CXZA 4EC9A 4QMQA 5K4IA 5AAFA 4FGRA 4IWPA 4DCEA 3PE1A 5EI8A 2Y6OA 2W5HA 1PF8A 2ITYA 4ZY4A 1IR3A 4XEYA 3ANQA 5IISA 1V0OA 2WNTA 3GB2A 4DFXE 4WUAA 1YHVA 2JLDA 3WE8A 4AW0A 2ETMA 4QRCA 2FA2A 2C5OA 3UG2A 1Z9XA 3V6RA 4TYIA 4R7HA 2VTHA 5LWNA 2Y4IB 5K5XA 4DBXA 4JOAA 4O38A 5AP2A 3MVJA 4FYOA 4BBFA 4DFUA 2OZAB 1MQBA 5EHOA 3KL8A 3Q4UA 3HMIA 4O7RA 2CN8A 2HOGA 2UZWE 3OZ6A 4IVAA 4TXCA 3OXTA 3QD3A 2VTSA 3F5XA 4QPAA 1AQ1A 4OT6A 4EH5A 4YO4A 3B2TA 3DKGA 3H9FA 3JPVA 4AF3A 2GHGA 3LQ5A 2A19B 5TO8A 2GNFA 4RVLA 3WARA 3ORNA 4A7CA 4KIOA 3ALNA 1UWHA 3E7OA 4QYGA 4E1ZA 5CEPA 3FPMA 1F0QA 3H3CA 4KS8A 2YISA 3POOA 3HRCA 2E9UA 4U7ZA 1ZYLA 3IDBA 3M42A 3QTIA 4C34A 4PPBA 4CV9A 5H9BA 2B52A 3A8XA 2CGUA 3EFJA 3PLSA 2A1AB 1BUHA 2BZJA 3SC1A 4F7NA 1DI8A 2F7ZE 5AX9A 3WILA 3PSBA 1OBDA 2Z02A 4U3ZA 5GIPE 2RGPA 4L7SA 3PRIA 5CXHA 4GIIA 4MXYA 5IQGA 2BRBA 3TJCA 3N4UA 3DLZA 2J50A 2SRCA 3DJ5A 5EM7A 4C35A 5C8KA 1M2PA 4RQKA 3COHA 4ZS0A 3F7ZA 3DBQA 3DQWA 4CGAA 3V5LA 3DCVA 1J7LA 1OUKA 2VGOA 3CGOA 2XB7A 2HZ4A 4ID7A 4U9AA 3RWPA 4E93A 5LJJA 4RC3A 5FD2A 2OJGA 5CVGA 2WMSA 1SM2A 3D83A 4XP2A 3PSCA 3R7VA 4D4YA 4L46A 3NIZA 4F99A 5CAVA 3POZA 2OF4A 3GQLA 3Q60A 4V0GA 4C3RA 3LCSA 2G2FA 4O2PA 5EI2A 2R3GA 3OMVA 4G3DA 2XBAA 3O8PA 4NK9A 4BCJA 4IDTA 2J5EA 3RHKA 3TIYA 4C3PA 3E8CA 3TV6A 3W2SA 4EK5A 2PHKA 4QQJA 4ACGA 3LFDA 2HXQA 1JSUA 3S0OA 2I0VA 3PRFA 4YBJA 4D58A 2VWYA 4XRJA 3UBDA 5EHYA 4RX5A 4NT4A 4OTFA 4AE9A 4UZHA 5KMIA 4HYIA 3MA6A 2I0YA 5HICA 5CEQA 5A9UA 1PJKA 4ZMEA 3MS9A 3OWLA 5I9UA 3FL5A 4MTAA 2C1BA 4O0VA 3KXZA 5K0XA 4BWXA 2R3KA 1K9AA 4KSQA 3AC8A 5T6KA 4K2RA 1RQQA 4UZDA 3OWPA 1H00A 3ORZA 5LCKA 4S32A 4EQCA 2YWPA 3PY3A 3PWDA 2XEYA 5HE1A 2YCFA 5L4QA 3QF9A 1GOLA 2GNHA 3AXWA 3R30A 3QGWA 2Y4IC 4I93A 5ANOA 4EI4A 4X3JA 4G5PA 4YPSA 4L68A 4QNAA 3W16A 4YJPA 5AP4A 3ZBXA 2OF2A 2CGWA 2VWXA 4IC8A 2DWBA 4TL0A 3C7QA 3QX2A 3OCBA 5E90A 2RFDA 4DFNA 3ROCA 3UNZA 3SLSA 3VS6A 4EUUA 1LEZA 2WMAA 3FXXA 3DTCA 2WMRA 2YWVA 5JFWA 2JKQA 2X7GA 3OROA 1E9HA 2PYWA 4PTCA 4ANMA 2XJ1A 2PUUA 5HCYA 2GQSA 2X7FA 5J7BA 3ERKA 4RMZA 3TKHA 1WBVA 3RAKA 1ZXEA 3SXSA 3H0ZA 2W5BA 4GRBA 4ZTSA 3ORXA 1ZOHA 5CT0A 3DXPA 5TKDA 3QC9A 2ITPA 4RA4A 1Q62A 3D5VA 1SVHA 2Y7JA 3HV7A 3QTSA 3A7FA 4DG3E 2XA4A 2YM5A 2JDSA 3P7AA 4AAAA 2WTVA 3KREA 3V3VA 5HKMA 4XG7A 3O7LB 4GU9A 3QTUA 3LM5A 4G2FA 4DFYA 2RF9A 3PXYA 5FTQA 4JJRA 1VZOA 3GCUA 4K9YA 4R3CA 5IQFA 3MIAA 4D2WA 3K3JA 3PXFA 4N0SA 4FNXA 3LFAA 3NW7A 5TT7A 1ATPE 1CKIA 4IM2A 1J1CA 2KTYA 4MQ1A 3CQUA 4BDCA 3UNKA 2VWIA 2C6LA 3D2IA 4YZDA 5HNBA 3WIGA 5HU3A 3V5WA 2XYUA 4KBCA 5HE3A 4YTHA 3FKLA 4AN2A 4YLLA 5BQ0A 2BVAA 4J1RA 3ORKA 3FMNA 3F5PA 3VBVA 3ZFXA 3FLSA 5IQEA 2GS6A 4AW1A 5DLSA 5ANIA 5HG5A 3UIBA 5K5NA 1J7IA 1ZY5A 2ZB1A 1XKKA 4GFGA 4NTSA 5CZHA 4MQ2A 1STCE 4FGBA 3MW1A 4O83A 4O0UA 3WZDA 5IQBA 3VBTA 4IWDA 1O6LA 2FYSA 1YOLA 2HZNA 5HD7A 2XEZA 3CD8A 4G6LA 4MD7E 2RG5A 3NVKI 1YQJA 3FJQE 3DAJA 3A8WA 3QRKA 3UYTA 4B0GA 5C26A 3G6GA 2WMUA 4GT3A 3UIMA 2IVUA 2XNBA 4N6YA 3ALOA 4QYEA 5F20A 3RM7A 3QUEA 4OAUC 1W84A 3OOMA 4GUEA 1UWJA 2BZIB 2IVSA 2XIZA 4E4XA 5HLPA 5IQCA 4BKYA 5JGDA 4FTCA 2JGZA 4NFMA 4PV0A 1FOTA 5E92A 3IDCA 5ACKA 4DFZE 4YLKA 2O5KA 4OAVB 3G5DA 4Y73A 3UNJA 2J2IB 3DU8A 3JY9A 2WMVA 2XZSA 2GMXA 3OTVA 3KC3A 3UVPA 3VBXA 3F5GA 2VN9A 5E7RA 2PE1A 2QU5A 2YDKA 2R3RA 3C51A 5CT7A 5IA4A 2CLQA 4YC3A 4JX3A 4CFWA 5GZ9A 2ACXA 4QTCA 5CALA 3PY0A 2ZM1A 4FZ6A 2WQOA 3RAHA 2QR8A 3BWFA 3DK7A 3ZRLA 3R01A 4I0TA 3ZXZA 3FQSA 2OJJA 2QHMA 3PIYA 4X21A 5BVKA 5HZNA 5L2WA 2IW8A 3TL8A 4FYNA 4DEEA 2X9FA 3QQUA 1SYKA 4WIHA 2WO6A 4FT3A 3EMGA 2P2IA 4V0GB 4MXXA 5CNNA 3LM0A 5B0XA 3NNWA 4F9WA 4G3CA 5DN3A 2PL0A 1H1WA 3MY0A 3LLTA 5HQ0A 5E4HA 3MB6A 4O22A 3GU6A 1OPLA 3U54A 4W9XA 5E1SA 2GS7A 3U9CA 2G01A 4CFVA 4U79A 1WAKA 1PKDA 4GS6A 4HZSA 3QZGA 4ALVA 5HTCA 4NTTA 4F64A 4QP4A 2I1MA 3O23A 3D9VA 2PMOX 2QOCA 3OWJA 3EQCA 3R9HA 1M2QA 2O3PA 4YJRA 4I0RA 2UW9A 3TNHA 2ZAZA 1PXJA 2UW4A 3R83A 3KA0A 3NNXA 3FI4A 3IOKA 2WKMA 3D2KA 3FC2A 4FT7A 2Z2WA 3PXRA 4AN9A 1ZYDA 4OUCA 2B9IA 3LXLA 4C4IA 1YI4A 3C0GA 4QMXA 3S2PA 3LCKA 4FKIA 2C6IA 3DK3A 2X39A 3I4BA 3RP9A 4RWLA 5JFVA 3AD5A 2R5TA 2OICA 1PRYA 1AD5A 1CKPA 3L9LA 4YJSA 3L9NA 1CDKA 3EN4A 4JAJA 4LG4A 4D0XA 4R5YA 3UO6A 4NW6A 5FGKA 4FTTA 4O7WA 3QKMA 4AZVA 4IB3A 4EH7A 1A06A 4HZRA 4J8NA 3D14A 4O91A 4UX9A 4MWHA 2WEVA 2PVJA 2ITQA 1GAGA 5I5ZA 5KZIA 4YGAA 3UPXA 3KMMA 3R7OA 4MF1A 3AC3A 3QTXA 5BVEA 4C4EA 1NT2A 5HX6A 5F94A 1Q8ZA 4C02A 4MWIA 4GMYA 3VRZA 5E8SA 4YZ9A 4EHZA 4GL9A 3RVGA 3Q32A 3QWKA 3UOLA 3ZXTA 3S3IA 4LOQA 5M57A 4MVFA 1CMKE 2UZUE 4TZRA 4FSNA 4UMPA 4GCJA 2CGXA 3PXZA 2W9ZB 1BKXA 3T9TA 4X6RA 5M55A 4DH5A 2QO2A 4U41A 2QQ7A 3BPRA 2W1IA 3E63A 5HCZA 3OTUA 3T8OA 5IDPA 3EYGA 3R7IA 3ORTA 4UYAA 2WTKB 3KN5A 3LCOA 4KABA 5BMSA 1WBPA 3VUGA 4WUNA 4QMUA 4IANA 1WVWA 2C0OA 4WBBB 3UIXA 4L3LA 2HWOA 3CJGA 1H08A 4AFJA 3PY1A 4U45A 2CKPA 3HVCA 2JKKA 2XNGA 4IZ5A 4IEBA 2E9NA 4KB8A 1ZWSA 3FMHA 4FICA 4YTFA 4FIFA 5AR8A 2WMXA 5KNJA 1QPEA 1OZ1A 4PL4A 4XMOA 5ETFA 3QXPA 1OECA 4ZTQA 3QGYA 3QYZA 2PZYA 2X6DA 4DFBA 4MBLA 2PE2A 2FSOX 1P4FA 2GCDA 5GNKA 4PMSA 3ZU7A 2BAJA 1YW2A 5EH0A 5AM6A 3QQFA 4EBVA 5A46A 3F6XA 1OKZA 2GFCA 3UODA 3NYNA 4RZWA 3OEZA 4HVIA 4KUJA 1OKYA 4RWIA 1EH4A 5IH6A 2BROA 3ORLA 4QMVA 3Q53A 1Z57A 1UNLA 3PFQA 3DJ6A 3H30A 4DH1A 1Q4LA 5J95A 2X9EA 2PVFA 3QA8A 4JBPA 4LFIA 5AV3A 5KMJA 4MK0A 3MWUA 2VTLA 3FPQA 2ITVA 5K4JA 5HVJA 4QMYA 4F0IA 4HYHA 1P5EA 1OL2A 1URCA 5AWMA 3TNQB 4NZWB 3AGMA 4BZNA 1J3HA 2OO8X 2QLQA 4AGCA 2WOTA 4MHAA 2YABA 4PX6A 2ONLA 3EQHA 3BIZA 4BKJA 2H9VA 5KX8A 5CEOA 4M14A 3KXNA 5ETCA 4ACCA 3G0EA 4JG6A 2QOOA 4C7TA 3C4EA 1SMHA 2GQGA 3IOPA 5CSHA 3NZ0A 3R9DA 4XHKB 5DRBA 4LV5A 3PA3A 4HNFA 3ZO1A 4M12A 5ETAA 2EXCX 4DEBA 3PIXA 4F9AA 3CJFA 4DT8A 1GZOA 2ZDUA 2CPKE 3UC3A 2OBJA 3OF0A 3Q2MA 4ENXA 1ZMWA 5LARA 1H24A 3ZLWA 3H0YA 3D5XA 2PY3A 4HW7A 3MSSA 4GFMA 4B8MA 2YCQA 2Y6MA 4FSWA 4UB7A 4TWOA 3VS1A 3Q52A 3SW7A 3FI3A 3ZUVA 4C61A 5DR9A 3LOKA 5AMNA 5KCVA 3Q9WA 3FBVA 4EOLA 5DT0A 4XLIA 5KMLA 4FV2A 2HWPA 2C3LA 3BU5A 4Y5QA 1XBAA 2RIOA 5ANKA 1WVXA 3O8TA 5D11A 3RPOA 4FX3A 4FC0A 2X2LA 3OD6X 3DLSA 4ITJA 2X2KA 2GU8A 4X6QC 2JFLA 5HO8A 5DH3A 3VBWA 1K3AA 3ZLSA 4F1MA 5JKGA 2CDZA 3HV4A 5M53A 4NM7A 1O9UA 3BQRA 1Q8TA 5CZIA 4FSRA 3UO4A 3L9MA 4L52A 3HRFA 3I6WA 4L3JA 2XH5A 3V01A 3KY2A 4WRGA 5J1VA 3TTIA 2QHNA 2OIBA 4KIKA 1IEPA 2QLUA 2HELA 2NRYA 5EQEA 2HK5A 4NCTA 2G2IA 2WQNA 2E9VA 2X2MA 1S9IA 3GI3A 1XH9A 1YWVA 2EWAA 3C4WA 4MD9E 4Y5HA 2HXLA 2YLFA 1J1BA 2QR7A 4W4VA 5AUWA 1YI3A 4O7YA 1FMOE 4FIHA 2X4ZA 1XH7A 2W0JA 4O82A 5F1ZA 2W5AA 5EM5A 2VTAA 3EFWA 4AFEA 4IWQA 4S34A 4PTGA 2IZSA 5DA3A 4AW5A 3R2YA 4L00A 5EFQA 3V8TA 5M4UA 2QOQA 3I5ZA 3L8PA 5FUTA 4IB1A 3U55A 2GS2A 5DPVA 3S95A 3MJ2A 3ZEWA 1NA7A 3EFLA 5JT2A 4FOCA 2FH9A 4FKLA 3E92A 4EYJA 1PMEA 1UU9A 3PXKA 2R7BA 4B6LA 4YNOA 3SAYA 4BIEA 2J0LA 3F82A 2OG8A 4JVGA 1XH5A 4MBJA 3GXLA 5AUUA 2ETKA 1QMZA 3GCPA 4M8TA 4NJDA 2ITXA 5IDNA 3OG7A 3NIEA 3TZMA 3HDMA 3R1YA 1Q8UA 3R73A 3BGPA 4E6DA 2R3QA 4EL9A 4AWIA 2X8IA 4I5MA 5IPJA 3FMJA 3OY1A 2PSQA 2B0QA 1PYEA 3QZIA 4NKSA 2PMLX 5CF8A 1R0EA 2WTCA 3S4QA 4YMJA 4YJVA 4MNEB 2PPQA 3CY3A 2UZEA 4FL2A 4L53A 4RPVA 5EDPA 2UW6A 3MB7A 5T3QA 4APCA 4YSJA 2PWLA 4FODA 1GZ8A 2ZYBA 4WSYA 3VN9A 3RHXA 3MH1A 4M15A 2WB8A 4ZLZA 4GG5A 4IH8A 2UW7A 4XP3A 3VQUA 4YHTA 3W10A 5I9XA 4O6LA 3GU8A 4C4JA 4P7EA 4IX6A 3VUDA 5KO1A 3H4JA 3DNDA 4KD1A 3E3BX 3QCYA 2PVRA 2PTKA 3I7BA 4MKCA 3K5UA 5AIRA 4F09A 4OLIA 2ZOQA 5JRQA 5BVDA 3U51A 3K2LA 1JSTA 3F3WA 4FSMA 4M69B 1JAMA 2JDVA 5IA2A 3ORIA 2PZ5A 4GK2A 4JS8A 4F0FA 3KVWA 1G3NA 4RJ6A 4BCNA 3AMBA 4OTDA 3VBQA 4BDHA 3NAYA 4NW5A 4BGGA 5D10A 3DKFA 4BVUA 3KXHA 3GFEA 3LXKA 3ZFYA 1K2PA 4AZEA 3QZFA 3UP2A 2J51A 2C0IA 3DTWA 3EQGA 3QD2B 3TNIA 4TWNA 5HLWA 3G15A 3LHJA 3R7EA 4D28A 3O7LD 4WG5A 3RCDA 1OMWA 1U54B 2ETRA 4E20A 3BZ3A 3HV5A 2BKZA 5AUVA 4YTCA 3HKOA 4B7TA 3F3VA 2X8DA 2WGJA 2WU7A 5GJFA 1PXIA 5D7AA 4IBMA 1WCCA 3CTQA 4X0MA 4C37A 4II5A 4ZZMA 3SKCA 2CSNA 5HG7A 4BTKA 4ZJJA 4Z7HA 4RIXA 1JQHA 4FSUA 2BFXA 2C6TA 2WPAA 3VAPA 3EJ1A 4TWCA 3RPVA 4RG0A 5IQIA 3OXIA 4RX7A 1TQIA 2W1GA 4CQEA 4IAKA 4DITA 2X4FA 3ZEPA 2BIYA 4EORA 1DAWA 4EUTA 3HV3A 4DT9A 2PVLA 5B2LA 4O2ZA 3FDNA 5I3OA 5L2QA 2C5YA 1YXSA 2IPXA 3NW5A 1OIYA 4EC8A 2QD9A 3QRUA 3B8QA 4G31A 2XBJA 2YCRA 1Z5MA 3RZBA 4FSYA 3I79A 2FB8A 3H10A 4UXQA 4JRNA 4G17A 1XHAA 2OW3A 4IAFA 2ITWA 5HHWA 2C47A 2JIUA 5J9YA 4U80A 4XG3A 3WYXA 4YZMA 3GC7A 4G3FA 3UOJA 3EFKA 2FSMX 4W4YA 4BTJA 3T9IA 4AZTA 4N70A 2VTPA 4UWBA 3B8RA 5FXSA 3RK9A 1KOBA 2VO3A 2JITA 4IX5A 4OTWA 5DG5A 4TYHA 2XNPA 4JR7A 1LEWA 4ANBA 4ZSLA 4GKIA 2GNJA 3HDNA 4H05A 3RNIA 3ZC5A 4CYJA 3NCZA 4FV3A 3QQKA 4PRJA 4RQVA 3RK5A 3KCFA 4CT2A 5L2IA 4N57A 1REJA 3NNUA 4J97A 3VS7A 2X1NA 3EWHA 4BZDA 2F49A 4FKVA 4PWNA 2G1TA 4RIWB 4QYFA 3H9OA 4RVKA 2EXEA 4HNIA 5G6VA 3DB6A 3FI8A 2F7EE 5CEKA 1MRUA 4KIKB 3SA0A 3QLFA 5C4KA 2YFXA 2UVXA 2ZB0A 3Q6UA 4YBKA 2OZOA 3MIYA 2IWIA 2C30A 2B53A 2G15A 4USDA 1BX6A 4TT7A 3C4FA 4U6RA 4QPSA 4X3FB 5EQPA 1WVYA 3W2OA 3L8SA 2PVKA 3A7IA 2C0TA 3LXPA 5HTBA 3BHUA 1WBWA 4AU8A 2F2CB 4G9CA 4X2GA 1KSWA 4PDSA 4UMUA 3KRXA 4OBOA 4H3PA 4K33A 3FE3A 3FLNC 3OBJA 4FMQA 4YJTA 2QG7A 4C62A 4HCTA 3E5AA 3PUPA 4O1OA 4XV1A 3ULIA 3PE2A 2CCIA 5FP6A 1RW8A 3F5UA 3HP5A 2Z8CA 4DH3A 4IFCA 2XS0A 2LGCA 5HOAA 2F9GA 4BI0A 5L2TA 1G8AA 4MD8E 4QMLA 3LIJA 5BUJA 3V6SA 4BDDA 5BNJA 2RFEA 4CD0A 3FI2A 5IUGA 5ANDA 1UKIA 5H8EA 5GJGA 5ANJA 1P14A 1W83A 3EQPA 4UALA 2OXYA 3RAWA 4PP7A 5JMSA 4U42A 4FZFB 4H3BA 3PWYA 3ULZA 4GU6A 4LOPA 2OIDA 4A4XA 3G33A 4BBMA 4B9DA 4BYIA 1YDSE 2BHHA 2UW3A 3FLQA 5AADA 3D4QA 3N9XA 3R0TA 4EEVA 2BCJA 3BGQA 2VNYA 4RC2A 5CLPA 1R0PA 4KKHA 2W17A 3PVUA 4IJ9A 4BDFA 4E26A 4ZZOA 4FEWA 1ZZLA 3D5WA 5G1XA 4FEXA 3NUXA 1VJYA 2LAVA 3LFNA 2R2PA 3GCSA 4A9RA 4FKSA 5H3QA 3OOGA 4KA3A 5IA5A 4QMWA 4EQMA 3R2BA 4Z3VA 1VYZA 5EYMA 2IW9A 2V22A 3U4WA 3ACJA 4QYYA 2VO6A 3E8NA 3U9NA 5LXMA 2PMNX 4X2JA 5LWMA 4EJNA 3RPYA 1PKGA 3NVMB 1KE6A 2OI4X 2JIIA 3W32A 4AUAA 2WQBA 4ERKA 2F2UA 3I7CA 4YUQA 3V5QA 5BVFA 4ZMFA 5HI2A 3VC4A 5DEWA 1OUYA 5BPYA 3PG1A 3FMLA 3MFUA 2X81A 4PF4A 2QKRA 3UC4A 4IM3A 2REIA 1OKVA 5HTIA 3VUKA 1XWSA 3BQCA 4FV8A 3IONA 4ZY5A 1FMKA 5L3AA 4DG0E 4XYFA 3KKVA 3TUBA 4W4XA 1U59A 2GHMA 2BTSA 3H9RA 4RJ3A 3JVSA 5CSWA 5ANEA 3ZZWA 4A4OA 1IA9A 2V55A 4FKJA 3CCNA 4J98A 3IGOA 5IUHA 2UW8A 1JKLA 2P0CA 3K54A 2YJRA 4RJ5A 3BYVA 4XP0A 4F9CA 3MH0A 3SDJA 3LFFA 4X3FC 4FF8A 1GNGA 3LZBA 1P2AA 2J0IA 3GEQA 5CVFA 4F4PA 4L45A 5GINE 4YNEA 4I5HA 4FZDB 1H4LA 5A4CA 4USFA 2CNQA 3BCEA 1ZARA 1OL6A 2C6OA 4F9YA 4YHFA 4B99A 4F7SA 4TRLA 3IDPA 4FTKA 3ZMMA 3N4VA 1ZLTA 4AW2A 4AGDA 4ZSGA 4FKUA 4JQ7A 4XRLA 4EOIA 3U6HA 4DLIA 5AUYA 5HBHA 2VTRA 3NYVA 1OPKA 4FVQA 4A06A 4O0TA 3C4ZA 4H36A 3SG8A 4WBOA 2VX1A 3QD4A 4FT5A 4Y85A 4GW8A 5DHJA 3GFWA 3FMMA 3DGKA 3AD6A 4K6ZA 2XNMA 4M68A 3SW4A 4LRKA 4BIDA 3W2CA 4E6CA 5IG1A 4CT1A 2XNOA 4U97A 4HGTA 4C8BA 3COIA 3LJ1A 4JQ8A 5L8LA 4DYMA 4XG6A 2YM3A 4W4WA 2CMWA 3IECA 4PQNA 2GQRA 3Q4TA 1Q97A 3I60A 4QQ5A 4R3RA 4A9YA 1U5QA 3GU7A 3FY0A 4QYHA 5HU9A 1DAYA 3IPHA 4IAAA 3QQGA 5CF4A 1RE8A 3QRJA 5B7VA 4ZTRA 3MDYA 5CS6A 4UWYA 5D9HA 3Q3BA 3BHTA 3NX8A 4O96A 1FPUA 2ITOA 4HGSA 5FEDA 3WYYA 4ASEA 4ZZNA 3LXNA 1UA2A 3DNEA 1B39A 3CY2A 2E9PA 3FZOA 5F95A 5AA9A 1PMNA 3VW6A 5JH6A 4ANSA 1T45A 2WIPA 2OIQA 4PPAA 3VHEA 4IVBA 1NW1A 5DR2A 2ZJWA 4LV8A 3Q4ZA 4CFUA 1LPUA 3P4KA 1JSVA 3I5NA 4TNDA 5IEXA 2C6EA 1ZOGA 5DIAA 4MXOA 3QBNA 3AMAA 5A54A 3TZ7A 3TM0A 4FEVA 3HGKA 3GCVA 4P90A 4RFMA 3F66A 3RBWA 3VS5A 5A6OA 5IA3A 2WQEA 3CPCA 4GKHA 3HEGA 3BELA 4O0SA 2XP2A 1Y91A 4BCPA 3LAUA 1OL5A 4EZ5A 5E9EA 3JR1A 3GC8A 3PPJA 4DINA 3OXZA 2E2BA 1YHSA 3DBCA 2VTIA 4LRMA 4ZOGA 2R64A 4J8MA 4X2KA 3ORMA 3TZ9A 3FMEA 1LUFA 3PZEA 3DAEA 5CU2A 4FV1A 3WZJA 2QG5A 4CSVA 3ANRA 1JKSA 5IF1A 4DTAA 4BY9E 3SOAA 4CRLA 4D1SA 4C3FA 2B9HA 4JDHA 3RM6A 4PDYA 3BX5A 1DS5A 1ZMUA 2BRHA 2YJSA 4FV5A 4AACA 3KF7A 3CTHA 4BWPA 2OFUA 3HAVA 4LYNA 2BKKA 2P33A 4YZCA 2WELA 1YDRE 5IH5A 4FIGA 4FR4A 4M66A 3UQCA 4ZLYA 4K0YA 4I21A 2EVAA 3V5JA 4CLJA 2QOBA 2CN5A 4QP6A 4DEHA 2I0EA 4A9UA 5GHVA 2QKWB 3MTFA 4WKQA 4CLIA 3KMUA 4MXZA 4FT9A 3GOKA 4DEIA 5IU2A 4EOSA 4O0RA 4NJ3A 5CQWA 4RT7A 1DM2A 4FA2A 1GY3A 1BL6A 4O6EA 3LMIA 4D2SA 4KWPA 4IJPA 5DWRA 5EOBA 5DI1A 3R8MA 3ZSGA 2P4IA 4EH3A 4QPMA 4IB5A 5JRSA 4QT1A 4ACMA 4F70A 1PW2A 3KFAA 3MJ1A 3R1SA 1URWA 2C6MA 2BALA 3IW8A 3QHRA 5LVLA 3TKUA 4NUSA 3Q5IA 5BVWA 3F3UA 4BI2A 5CEMA 2W05A 4GT4A 2YDJA 4Q5HA 1TVOA 2XKEA 4XV3A 1YXVA 3UO5A 4IHPA 4M84A 1JKKA 2JDOA 4PDPA 1KE9A 2QOKA 1UNHA 3GP0A 3QFVA 4HOKA 4IZAA 3QKKA 2QOIA 4YJNA 3PVGA 4GK3A 4WNMA 2XF0A 3NRMA 4RBLA 4PTEA 4IX3A 1PXKA 3P9JA 2EXMA 1IRKA 2BRMA 3L9PA 2JBPA 2PZRA 4YR8A 5J8IA 1B6CB 4XG9A 5M08A 4DGMA 1NVSA 1YOJA 5KUPA 1Q8YA 5BYZA 3LCTA 4KBKA 3QKLA 3PSDA 3E62A 3GC9A 4NYEA 4BCQA 3AOXA 3KCKA 2VGPA 3ZSIA 3CQEA 2W1HA 3F2AA 4CG9A 1Q61A 2WU6A 3IW4A 2P55A 5KE0A 3MVLA 3RI1A 2VTMA 2YITA 4XCUA 4F6UA 2OJIA 3M2WA 4X2NA 4AP7A 1QPDA 4Z16A 3KEXA 5KHWA 2GDOA 3OHTA 3A4OX 4FTQA 1G5SA 3EN7A 3OBGA 1MRYA 4JAIA 3CS9A 2OU7A 5EW3A 4L67A 2FSTX 5J79A 4LL0A 2QNJA 5L2SA 4F63A 5HD4A 1OIUA 1DI9A 4FG8A 3TKIA 4TY1A 3QU0A 4I0SA 4ANQA 2Z7SA 1T46A 2EUFB 4B4LA 4KRDA 5AUZA 3R7GA 4L3PA 2QU6A 2J90A 3ZBFA 5M4IA 4CXAA 4C38A 2YIYA 4BDIA 5HNIX 1XH8A 2QCSA 3NWWA 4XV9A 5A4TA 1Q3DA 1V0PA 2XJ0A 4JRVA 3BYUA 5CENA 4CTBA 5EK7A 3ZM9A 5CTPA 4R5SA 2AC3A 4ZP5A 5K3YA 3CSVA 2VTNA 3COMA 3WZKA 4BKZA 4ZTNA 4ORKA 3K5VA 1UNGA 4FKRA 4NWMA 2XM8A 4UMRA 4O7SA 2FUMA 3AGLA 4QQCA 5CAQA 4S33A 4RX8A 3DXQA 5HORA 2H34A 3F7WA 3PXQA 4WA9A 3PA5A 4M97A 5HVYA 4FL1A 3DBFA 4M3QA 4EK6A 2F4JA 4QP9A 2GFSA 2IN6A 3OCSA 3MFSA 4JDKA 3NS9A 4DFLA 2VWUA 5FEQA 3V5PA 3P23A 4HPTE 2R3PA 4YU2A 1ERKA 4J53A 2XM9A 2ERKA 3ODZX 3KK9A 5TF9A 3TG1A 4CCBA 2J0MB 3ZSHA 4XBUA 4I5PA 2PVMA 3THBA 2WFYA 3HZTA 4CZUA 2IG7A 2B54A 3QA0A 4XX9A 4DH8A 3PTGA 4FTUA 4JNWA 1NVQA 4I5CA 5FG8A 4NU1A 3GU5A 1NY3A 1YRPA 3F9NA 4FSQA 2VWWA 3OW3A 4BCGA 2XK3A 5CVHA 4EOOA 3KN6A 4QMSA 4IACA 4E5WA 3NMUF 3VUHA 3EL7A 3A61A 4BDEA 2ZVAA 2OFVA 3NUYA 5LVNA 3NLBA 1Y57A 4DF3A 4CVAA 3JY0A 3ZHPC 2GTNA 1PXLA 3P1AA 2C6DA 4FOBA 4O81A 3KVXA 2R3LA 3C4XA 1H01A 1H27A 1PHKA 4D9TA 5K9IA 4EKLA 4EH6A 5M44A 3FZSA 5DBXA 4R77A 2XUUA 4NIFA 5IMEA 4BDAA 3ZTXA 3ZFMA 4W8DA 5AEPA 5IQDA 2ERZE 3HA6A 4UBAA 3ODYX 4DLJA 2WTDA 4H1MA 4OTQA 4OTPA 4YP8A 4L6QA 1SNUA 4B8LA 2WTKC 4P5QA 1OPJA 5CNOA 1OBGA 1W82A 3QD0A 3OEFX 3TNPC 1YOMA 2R3IA 5EDQA 2Z60A 3C5UA 3AC5A 1SVGA 2XNEA 4AXAA 2YERA 3OCGA 2BFYA 4YURA 1TQPA 3DZQA 3PPKA 4YJQA 3TI1A 2I40A 1XQZA 3P0MA 2O64A 2X0GA 3ZDUA 3EQRA 3EKNA 3SRVA 4KRCA 4RX9A 2R3HA 2C68A 3D7TA 5CQUA 4RLLA 2CGVA 1M7NA 3KMWA 2A27A 3FXWA 3O96A 4QP7A 4F6WA 5HE2A 2XIYA 3QWJA 3R6XA 3R9OA 3TJDA 4EQUA 1FVRA 3LCDA 3TEIA 3ATTA 5HBJA 4Z9LA 5BVNA 3R22A 1QPJA 4XS2A 3ZS5A 4HVHA 2I7QA 4H58A 3O0GA 4ZY6A 5AFVA 4D0WA 3AQVA 4ZXTA 1P4OA 3QAME 5JZJA 1YHWA 3OY3A 3RJCA 4MF0A 3DOGA 3TCPA 3VUTA 5BYLA 5IKWA 4RGJA 3F3TA 3EQIA 4RRVA 5GZAA 4L9IA 4FV9A 4IAYA 4QNYA 5FBNC 4MX9A 4RVTA 2PVYA 3Q04A 3M11A 4QOXA 5IMXA 3G0FA 2O2UA 1H1RA 4KAOA 4R3PA 4ZTLA 2C3IB 5I9YA 1ZRZA 1B38A 1KV1A 2HZ0A 3EYHA 3QRIA 4NM5A 2UZVA 3VNTA 4BRXA 4DE4A 3NYOA 2OJ9A 3R8ZA 3U8WA 4D4SA 1Q24A 4I20A 3UMWA 2O63A 4CEGA 3QZHA 4KKGA 4DGLC 2JD5A 3ACKA 3UGCA 2C1AA 3GENA 4EH4A 3ATSA 4EJ7A 5AA8A 5BUEA 5C01A 4UY9A 3UQGA 2B1PA 1MP8A 1Y8GA 2YZAA 5DEYA 1YWRA 2WMTA 3D7ZA 4Y72A 5A6NA 3WIKA 1REKA 2OZAA 3U87A 3A4PA 2CHLA 2V5QA 3FYKX 2YM4A 4TYJA 3LFEA 2OH4A 3NEWA 1APME 3R71A 4S30A 4LUEA 2PUNA 3IO7A 4G3GA 5HESA 2WZJA 2W9FB 4FUYA 4OTGA 3EZVA 3TACA 2XIKA 4V04A 2RL5A 3BRBA 2QOFA 3OUNB 4WHZA 3HA8A 3TXOA 4X7QA 2QI8A 4E6QA 5EQYA 3UJGA 1XO2B 3RINA 5IQHA 2WAJA 4L7FA 4G5JA 5BMMA 2ZMDA 1NVRA 3PPZA 2PULA 4R1YA 3OW4A 4YC6A 5CI7A 5J87A 4D5KA 4EKKA 2P3GX 3QTRA 2RG6A 3V5TA 1ZY4A 2VRXA 3ZLYA 4AZFA 2W1CA 5AR2A 3ZLXA 4O7LA 2B7AA 2OK1A 4R78A 5I3RA 3SD0A 5M09A 3TWJA 4D5HA 3O8UA 4BTMA 5BVOA 3DQXA 4C4HA 4WSQA 4EBWA 1OB3A 4GH2A 3JXWA 4KIPA 3DK6A 4BHNA 4C2WA 1ZZ2A 3ENMA 4DEGA 2YIQA 2V0DA 4J52A 2YAAA 4BCIA 2NO3A 4HYUA 4YSMA 3BBTB 2VWZA 3FZPA 4AA0A 4D1XA 4QTBA 3C4CA 3CR0A 3RAIA 4AA4A 4ARKA 5JGBA 4NEUA 4BZOA 4I22A 4IX4A 5E8XA 2YDIA 1YDTE 2G9XA 5EM6A 1GIIA 5JN2A 4ZTHA 2W1FA 3ZO4A 4WOVA 4DTKA 5JQ5A 2AUHA 2YN8A 3MFRA 3TIZA 1GIHA 3E64A 2J0KA 1OIRA 4LOOA 2JAVA 3G9NA 2UZOA 3WF7A 1UVRA 3LE6A 3RALA 3JVRA 3QL8A 3FL4A 4Y8DA 2DQ7X 2RFNA 5CANA 3CBLA 4E5BA 4F08A 3PDTA 2BDWA 1Q99A 3FZRA 4OW8A 2AC5A 4MNFA 3HUBA 4UXLA 5I4NA 1PMVA 3RKBA 4YTIA 4AOTA 2KULA 4FI1A 2IO6A 3DY7A 5FBOA 4ALUA 5EOLA 1PXNA 3CPBA 4OBQA 5HG9A 3W2RA 4GT5A 3KK8A 2A2AA 3VS3A 5AV4A 2QC6A 2C69A 2CNVA 3T3UA 4C4GA 1H26A 5L8KA 2CNUA 3P86A 3Q5ZA 4EOJA 1RDQE 2JC6A 4A4LA 5J5SA 1CTPE 4PMTA 4U43A 3A62A 5HIBA 3R9NA 4AQCA 4FKGA 3NR9A 3DS6A 2PE0A 4I6BA 4C33A 2OLCA 3O51A 3AC4A 3GOPA 3ELJA 4U40A 2E9OA 1KWPA 4MEDA 1Q3WA 1FVTA 3COKA 4LGGA 4I6FA 4Q2AA 2XCHA 4DH7A 3HMPA 3CGFA 1F3MC 3QC4A 5AP5A 4GVJA 2W1DA 4YJOA 2XNNA 3R9RA 2B9FA 3IG7A 2A4LA 5CX9A 5HVKA 1H0VA 3DKCA 4QP8A 4LRJA 1I09A 1J91A 1VR2A 2JBOA 3QTWA 2RKUA 3ZH8A 1X8BA 1XJDA 3TN8A 1J7UA 5HO6A 4FKPA 5D7VA 4MAOA 4I92A 1YXXA 3KULA 4TYEA 4EHEA 4O7VA 2J7TA 1IAHA 3LVPA 1KUTA 2CKQA 1Q41A 4GUBA 3G9LX 4KSPA 3SOCA 1R78A 4RIYA 3SX9A 2V7OA 1ZYSA 5FXQA 3U6JA 4WO5A 2R3MA 2JEDA 2XK4A 3NAXA 4JBQA 3SXFA 3FWQA 5AP0A 3TNWA 4ZJVA 3CKWA 4FUXA 3V8WA 4IADA 3AT4A 3Q6WA 3UOKA 1JPAA 4GK4A 3ZDIA 4E3CA 1WBNA 3TZ8A 5C8NA 4CKRA 2WD1A 2F57A 3EN5A 1JWHA 3BHYA 2OGVA 1W8CA 3MBLA 3MFTA 4TWPA 4BL1A 5AV2A 4CYIA 4AA5A 1BMKA 3D5UA 4EH9A 3BV2A 4QTAA 5EM8A 4O0YA 1MRVA 4QP2A 3E88A 4FG9A 4C0TA 4D4RA 3UPZA 3MESA 4IVDA 1OIQA 3DFCB 1YXUA 4TNBA 4G9RA 3DPKA 4FL3A 5FLFA 1XH6A 2QOHA 2RSVA 4FKTA 2HW7A 3CQWA 2BDFA 4G1WA 4XG4A 1BI7A 4C36A 3BLQA 4DEAA 2XK9A 3NUPA 4DAWA 2P2HA 3CD3A 4BHZA 3DXNA 5T68A 1CSNA 4ZTMA 5C27A 4AZSA 3JYAA 4TKSA 4RFZA 4U5JA 5L8JA 4ZIMA 5IEYA 4RFYA 5J9ZA 3CKXA 2VZ6A 1TKIA 3OWKA 4HGLA 4N4SA 4PMPA 3BYMA 2YAKA 2PZIA 3BWJA 4RWJA 5CSXA 4AOJA 4XJ0A 4BCOA 2HY0A 2XYNA 5FRIA 4AGUA 3LLAA 2ONLC 1OI9A 2G2HA 2J9MA 2UZTA 3ORPA 4YO6A 3W8QA 2C6KA 1V0BA 3BI6A 2DUVA 4R8QA 3VF9A 4ANOA 4C59A 4P4CA 2HYYA 4MH7A 4UN0C 3QYWA 3R21A 2QOLA 4F9BA 1FGKA 5I9VA 3E93A 4AGWA 4R6VA 3BV3A 5CY3A 5ACBC 3MV5A 4O27B 3UP7A 4FKOA 3TTJA 3FY2A 3ITZA 4GV1A 4N6ZA 2GSFA 3BKBA 4HYSA 5L6WL 5LVPA 1A48A 4ASDA 4G16A 4FTAA 3RMFA 4OBPA 1KOAA 4JBVA 2UVZA 3BHHA 4KNBA 4OTHA 4RVMA 4F0GA 3UQFA 3II5A 3P79A 2B9JA 1E1XA 4IDVA 4WNKA 2R3NA 4DN5A 2X6EA 2XIXA 3AT3A 3PP1A 4WRSA 4LUDA 3HMNA 3TUCA 4GSBA 5EDRA 4C58A 2XJ2A 2NNWB 2HIWA 4I24A 2IW6A 4XBRA 2JKMA 4DG2E 4I94A 5LMBA 3V04A 2YHVA 1WZYA 5CEIA 3ID6C 4QO9A 2VD5A 3BHVA 2BRGA 2J0JA 4ZSJA 5AUTA 2QO7A 2CCHA 3DFAA 4HCVA 1L3RE 4K77A 2BHEA 5JQ8A 4EOMA 4FVPA 2YIRA 4FK3A 4FTMA 4DHFA 4ACHA 4QP3A 2DS1A 3KXMA 4W9WA 5EYCA 2UVYA 1FBNA 4CV8A 4O7ZA 5KBRA 2O65A 3OT3A 4ONAA 3VF8A 3AT2A 4D4VA 3VVHA 4UMQA 1Q8WA 4NCTC 4D9UA 2UV2A 4YC8A 2OSCA 4FKQA 2HY81 4QMZA 4YJUA 3DDPA 4M67A 2I6LA 3F2RA 1O6KA 2BZHB 3V51A 3ZOSA 3DAKA 4IFGA 1H28A 4RIXB 3ZYAA 5KBQA 5CSVA 1UU8A 4H1JA 4BDGA 4E7WA 2BMCA 4FNYA 2UZLA 4IIRA 5CU4A 4ASXA 2VTQA 4ITHA 3F3ZA 5LMKC 1M2RA 1H1QA 1OVEA 5B2KA 3UG1A 1XH4A 3DB8A 4QTEA 4J99A 4A07A 3NPCA 4LGHA 4Q9ZA 2QODA 4JT3A 3MY5A 3GC0A 4YHJA 3PJCA 3FLYA 3I1AA 3BGZA 4EH2A 2JKOA 5AR5A 3BEAA 5TR6A 3GT8A 4BI1A 2OKRA 4PMMA 5EG3A 3ROYA 4BYJA 3WF6A 3FLWA 3SQQA 3CLYA 4R7IA 2C4GA 3FC1X 4BICA 3FV8A 4FKWA 3L8VA 3FZTA 4G6OA 1KE5A 4AT3A 3BYSA 5M06A 3KXXA 4FSTA 2XRWA 4NSTA 5DNRA 1O6YA 3EH9A 5EW8A 3UZTA 3UZPA 4AN3A 1YVJA 5A4QA 5CF6A 5HBEA 2GNIA 3DA6A 1H25A 2VNWA 1OL1A 3PP0A 4OTIA 1QL6A 1WFCA 1ZMVA 1IASA 5JSMA 3UZRA 3FQHA 4ACDA 4NFNA 3WF5A 4C4FA 4NL0A 2WTWA 5DOSA 5HGIA 5CAOA 4RC4A 4H3QA 4TYHB 2YIXA 4BCKA 3N4TA 1M7QA 1GIJA 3R7YA 5HLNA 4FE2A 3KRRA 3KULB 3Q4CA 4EHGA 1H8FA 3TUDA 5I9WA 4RIYB 3DZOA 4AE6A 4CKJA 3HRBA 2Z7RA 3FHIA 5H8GA 4IWOA 2R3JA 5FP5A 2RFSA 3R28A 3QALE 3QRTA 4I1ZA 4OT5A 2B55A 3ZRMA 4EONA 3E3PA 3S1HA 5C03A 2VV9A 3IW5A 3EB0A 4I3ZA 4IXPA 4CMUA 3F2NA 2X7OA 1JOWB 2F7XE 3NUNA 3P7BA 4Z7GA 4JI9A 5L6OA 1SVEA 2CLXA 4W8EA 3SXRA 4XLVA 3IGGA 2VX0A 3D15A 3VS4A 2WMBA 3HMOA 5EKNA 1W98A 4V05A 4BWKA 4CFFA 3RCJA 3ZUTA 1OL7A 1UKHA 2C5XA 2O0UA 4PL5A 2JAMA 5C9CA 4QMOA 1H07A 4K18A 3G6HA 4BDBA 1MUOA 3V8SA 4EH8A 5HX8A 2PVHA 5I0BA 1PXMA 4NM0A 5AP7A 3RTPA 4O7NA 4QD6A 2CJMA 5H2UA 4MYGA 5E8WA 5TOZA 2YCSA 3KXGA 4FK6A 4AOIA 4RWKA 4BN1A 5M56A 4FIJA 2NPQA 3DT1A 1F5QA 3QTZA 1FQ1B 3CC6A 3MTLA 2UW0A 3QCQA 3HECA 2OJFE 1G8SA 3G2FA 5FTOA 3OS3A 1YXTA 3O2MA 5CASA 1V1KA 2ESMA 3SHEA 4CQGA 1ND4A 3O71A 3AMYA 3CTJA 2WXVA 4EWQA 3HAMA 2V62A 4PY1A 2OXDA 4G34A 2XK7A 4PDOA 4EHVA 4K11A 4CKIA 3O50A 5ETIA 3VW8A 5AV0A 4EYMA 5KMOA 4O21A 2W96B 5AP1A 4QQTA 5A4EA 2FVDA 2VTJA 4Y95A 5AR7A 4A9TA 4CZYB 4BCFA 2CKOA 5BYYA 4RSSA 2YZLA 2XK8A 3FUPA 2YA9A 3C13A 3UYSA 5DRDA 4FVRA 5CAUA 3GBZA 4EOPA 3QUPA 2PVNA 3BBWA 3VO3A 1PXOA 2Y4PA 3LFQA 4DCAA 1XBCA 4HVSA 3ZCLA 4Q9SA 2YLEA 4KKEA 4Y46A 3SVVA 2OWBA 3RGFA 4GVAA 3EL8A 3R02A 4YPDA 3W8LA 3VUMA 4FTLA 2R4BA 3PJ1A 3MYGA 4BBEA 5EI6A 4UV0A 1U4DA 3C1XA 3Q9ZA 4FTNA 2C5VA 2XKDA 3HNGA 4K8AA 4IB0A 1Y8YA 2IZRA 4PPCA 4GFOA 3A60A 4E8AA 2OXXA 2PZPA 2Q0BA 2ZV7A 5B2MA 1SNXA 5C1QB 2HAKA 2VU3A 5KMMA 3OP5A 4UEUA 3GVUA 1BYGA 3ENHA 3KRJA 4IVCA 3RZFA 3U6IA 4JG7A 1H0WA 3PJ8A 4XG2A 5J1WA 3GNIB 4E4NA 3W2QA 4UWCA 4I4FA 5FXRA 2VWBA 1FVVA 2PK9A 1WMKA 4FZAB 2EB2A 4KS7A 5ITAA 1ZAOA 4AT5A 5KMKA 5J7HA 4XNEA 2W4KA 2YEXA 3P5KA 5LCJA 3KU2A 2GPHA 1VYWA 4WNOA 4F6SA 3AC1A 4DGGA 2XKFA 5LVMA 2YM6A 4O86A 3MN3A 4DEDA 4FV7A 4YLJA 1KE7A 5E8TA 4PNIA 1HOWA 1JNKA 3WF8A 3FKOA 2HCKA 5KHXA 3C50A 3LJ0A 4F1OA 5AJQA 5DYJA 4LGDA 4RLKA 1H1SA 2I0HA 2IVTA 2GNLA 4EK4A 2DYLA 2JIVA 4FEUA 3C0HA 2CKEA 4IC7A 4OTRA 3ZRKA 3A7GA 3UMXA 3U4UA 2ZM3A 1UU3A 1UV5A 5JGAA 3OCTA 2YM7A 2UUEA 4I6HA 3P78A 4G6NA 2Y0AA 4JBOA 2HENA 2ZDTA 3EQFA 4L44A 4P2KA 1OITA 4TYGA 3VIDA 3FEGA 3HX4A 1ZYCA 4ANLA 4EK3A 3PYYA 2ITTA 3R8UA 3REPA 3DBDA 3VRYA 4E4MA 2H8HA 3KQ7A 5LVOA 3PIZA 4L8MA 2YIWA 5AUXA 1GZNA 5D41A 3PJ2A 4LM5A 4UYNA 5EW9A 3B2WA 3SG9A 4CTCA 2HZIA 3E7VA 4GG7A 4Y83A 4ERWA 2VX3A 3HMMA 5BX0A 4NKAA 4QMTA 5FWKK 5JEBA 1ZOEA 4E4LA 3MPMA 3DJ7A 5DT4A 2C5NA 1QCFA 5E8VA 4D1ZA 4K1BA 3ZO3A 2IZTA 2R9SA 4FNWA 2PU8A 2UZNA 5D1JA 5AP6A 3HYHA 3MY1A 2WTIA 5DT3A 4ENYA 3GU4A 4PUZA 3W2PA 3EIDA 5CSPA 2WEIA 4TPTA 4FTRA 5HE0A 3AG9A 3CXWA 3G90X 4FG7A 3VS2A 5FTGA 3PVBA 3TV7A 1I44A 4P5ZA 5AAGA 3JUHA 3P08A 4MNEA 1R1WA 1WBTA 4U8ZA 1U46A 3FAAA 1W0XC 1YKRA 5E1EA 3MI9A 4RIOA 1BLXA 5A3XA 5CU0A 3NNVA 3WBLA 4ZJIA 4GYIA 3FYJX 3EN6A 5IZFA 1BI8A 4ASZA 4CMOA 1A9UA 5IA1A 3UDBA 3NGAA 5IUIA 3K3IA 3L8XA 2J6MA 4BC6A 4E73A 2BDJA 3HUCA 3Q9XA 3UVQA 4AG8A 3LFSA 3C5IA 3F69A 5AR4A 3NUAA 1FGIA 3BLHA 4M69A 1JVPP 4IZ7A 2X8EA 3Q9YA 3R8LA 3W33A 3LJ2A 3NCGA 2Y9QA 4JL9A 3NYXA 5DFPA 3IW6A 4S31A 3VQHA 1CM8A 4EWHA 4C2VA 5JFXA 4JIAA 1HCLA 5AIKA 3RNYA 4BFMA 1GZKA 2BR1A 2IZUA 4FTIA 4IAIA 4TW9A 3ZM4A 3KF4A 3SV0A 4QMNA 2R7IA 3VWAA 2XKCA 2ZV9A 3I81A 5HIEA 4U81A 5AV1A 4U0IA 2VUWA 1U54A 4DBNA 2Z7LA 3UTOA 3PA4A 5CI6A 4GEOA 4YZNA 2BRNA 5HNGA 2W4OA 4JLCA 2BPMA 2ITUA 3RWQA 3W55A 2UZDA 4M0YA 1LR4A 2WMWA 3CIKA 4CRSA 2J4ZA 2XRUA 2V7AA 4FNZA 2ZM4A 3KRLA 3R1QA 4BDJA 5CF5A 2BAQA 3QTQA 4RZVA 3RPSA 3WZEA 4USEA 4JG8A 1E1VA 2PUPA 4RA5A 4XH6A 3CEKA 2XVDA 5GIOE 2OH0E 3S00A 5EYKA 4BB4A 1OM1A 4HGEA 3ZO2A 4D2PA 3LQ8A 3WOWA 3D0EA 5A4LA 3PJ3A 3UE4A 1RJBA 1PY5A 4TN6A 5CU6A 3EOCA 4QTDA 2FSLX 3IK3A 3TDVA 3AD4A 1VEBA 1Y6BA 3MGYA 4ZSAA 5DR6A 4DC2A 3R7UA 1JBPE 1XBBA 2FGIA 4FV6A 4HCUA 4I41A 1JKTA 4QMPA 3AC2A 2Q0NA 5JZNA 1MQ4A 1QPCA 2ITNA 3ZONA 5KKRB 2VO7A 3C0IA 3OT8A 3PG3A 3FLZA 3R00A 3GQIA 3KRWA 5CU3A 3Q96A 5C8MA 5ICPA 4IQ6A 4J96A 2QURA 4XG8A 2VTTA 1S9JA 4DA5A 3R63A 4AS0A 1U5RA 4IM0A 1WBOA 4FIEA 4RJ8A 3R8VA 4BGHA 5AR3A 3QHWA 3EKKA 1Y6AA 3FMKA 3HL7A 4IMYA 4XOZA 3I0QA 1JLUE 3MH3A 4LI5A 3ZUUA 3LQ3A 3FZ1A 3FKNA 4MBIA 4DGOA 1KE8A 3WF9A 4ZS4A 5LOHA 1IG1A 1M17A 5EYDA 1CKJA 4I4EA 2R3OA 4EOQA 2Q83A 4O7TA 5M51A 3MPTA 3QLGA 4YZBA 4CG8A 3G51A 4F1TA 1AGWA 2XMYA 3QQHA 1IAJA 2GTMA 4O0XA 3SGCA 4LL5A 2EB3A 4JDJA 5DVRA 5E8YA 3WZUA 3EQDA 4BR3A 2W7XA 3DKOA 1KV2A 4A9SA 3FSFA 3QCXA 2H6DA 4RIWA 4NM3A 1W7HA 5M4FA 2VAGA 3FMDA 2QONA 4QMMA 5CWZA 1PXPA 1H1PA 5TE0A 4ZSEA 5AAEA 4OGRA 1YI6A 3I0OA 4ZK5A 4R1VA 3IS5A 4BCMA 5JFSA 3KB7A 2WMQA 2FO0A 3MPAA 1GJOA 3DV3A 4CFXA 3OUKA 4X3FA 3A7JA 4TTHB 4RJ4A 2W06A 1TQMA 2NRUA 3FHRA 2JDTA 4U44A 3QQJA 3E8EA 4LMNA 3R1NA 5E91A 3RPRA 2H96A 3LPBA 1FINA 2B4SB 2C3JA 2W99B 3NUSA 4J7BA 4F7JA 5BUIA 4G3EA 1PMUA 2O8YA 4ITIA 4PP9A 5EHLA 5LMKA 2QVSE 3CE3A 2WQMA 3OVVA 3A2CA 5GZ8A 1SZMA 5LMAA 5CYIA 2UZBA 2W4JA 3LFBA 4ZAUA 4S2ZA 3VULA 4AX8A 3LW0A 3P7CA 3W18A 5JK3A 5IH4A 3LKMA 1NXKA 2WIHA 4JXFA 5IA0A 4NH1A 3VHKA 3LMHA 3MH2A 2BTRA 4RJ7A 3HV6A 4MCVA 3ZC6A 5KZ0A 5DMZA 4CZTA 4IE9A 3QUDA 4FBXA 1PYXA 3EN9A
chains in the Genus database with same CATH superfamily
3GUBA 4XV2A 3EQBA 4E6AA 5LQFA 5C4LA 2BIKB 4HJOA 4OR5A 4XOYA 2AYPA 3PLAE 2UW5A 4CFMA 1ZYJA 3BU6A 2WOUA 2JFMA 3MVMA 5L6PA 4WD5A 4M13A 3VS0A 4ALWA 1M52A 4JDIA 5F9EA 3BYOA 2AQXA 5FM3A 4PNKA 4LMUA 1Q5KA 4HPUE 4HVGA 3LMGA 3GGFA 4JX7A 4J95A 3R04A 1XR1A 3LFCA 4FT0A 4IW0A 4BIBA 4HVDA 4AZWA 5I9ZA 3TDWA 4MXCA 2JDRA 5FQDC 5K0KA 1R3CA 4WNPA 3OFMA 2VO0A 3UVRA 3NUUA 3NDMA 5KMNA 5KKRC 3EHAA 3QXOA 4KINA 4MXAA 4V01A 3W1FA 5H8BA 5DGZA 5HO7A 5FDPA 4GJ3A 1BL7A 1OKWA 4EZ7A 4APPA 5FM2A 4UMTA 4GYGA 4FSZA 4JQEA 2IJMA 3FSKA 4D2TA 4O0WA 3BLRA 3FQEA 2R3FA 3E87A 4M7IA 4CMTA 4EK8A 4D55A 3HP2A 3MVHA 3VJOA 3ZZEA 4E5AX 1HCKA 5J5TA 4FTJA 4X2FA 3VJNA 3QX4A 5FDXA 4H39A 3CP9A 2BILB 2R0IA 4BDKA 3A99A 5FEEA 2C3KA 2ZV2A 2BZKB 4FIIA 4GJ2A 2VTOA 4D2RA 3WE4A 5AX3A 4U3YA 2R0UA 5E8ZA 4WT6A 2J5FA 4I6QA 4DTBA 5M07A 3T3VA 4ZLOA 4BCHA 3BEGA 4EOKA 5IEVA 2PUIA 4WG4A 5GJDA 4CFNA 4BF2A 4Q5EA 3MA3A 3QQLA 2W1ZA 3BE2A 1M14A 3QCSA 4JIKA 2XIRA 4AT4A 3PVWA 1R39A 4F7LA 5J9LA 2ITZA 3UOHA 3DBEA 3DDQA 4L01A 5CAPA 5AM7A 3EZRA 3BE9A 3OC1A 4FZ7A 3O17A 1UU7A 2YM8A 3PZHA 4ANNA 4QP1A 3RK7A 4KBAA 2EU9A 2QO9A 3BU3A 3I6UA 4J71A 5D12A 3TV4A 2A0CX 4O1PA 2ZV8A 5ANGA 1WBSA 4NIFB 4O84A 3IW7A 3F61A 2Y8OA 3L1SA 5DE2A 5HG8A 4CCUA 3JS2A 4WG3A 5HEZA 2WTJA 3F88A 4FTOA 5HIDA 3R8PA 4CNHA 3HLLA 5EKOA 1LP4A 5A14A 4JMQA 2Z7QA 4PL3A 3TT0A 1YWNA 4JR3A 2IVVA 3NW6A 4I23A 2XCKA 2YACA 2HW6A 3NSZA 4KIQA 4BTFA 3M1SA 4GIHA 2PMIA 2W1EA 2BUJA 2WHBA 3ET7A 4FV4A 4LQMA 1L8TA 5IQAA 3IKAA 3SRVB 3D94A 4IZYA 5E8UA 2GNGA 4FV0A 4Z55A 3D7TB 2GHLA 5HCXA 4F65A 5AP3A 1IA8A 2ZMCA 5F4NA 4L43A 2NP8A 2VWVA 4BGQA 4D2VA 4R7BA 4EZ3A 3N51A 4M0ZA 3Q2JA 3KGAA 4XUFA 3UIUA 3VUIA 3E8DA 3FXZA 3ETAA 4C57A 2BAKA 4FEQA 3A7HA 1OGUA 4L42A 3WI6A 5M4CA 3C9WA 4IAZA 2XK6A 3IQ7A 3GCQA 4ZEGA 4DGNA 2NYAA 3VBYA 5CXZA 4EC9A 4QMQA 5K4IA 5AAFA 4FGRA 4IWPA 4DCEA 3PE1A 5EI8A 2Y6OA 2W5HA 1PF8A 2ITYA 4ZY4A 1IR3A 4XEYA 3ANQA 5IISA 1V0OA 2WNTA 3GB2A 4DFXE 4WUAA 1YHVA 2JLDA 3WE8A 1VLRA 4AW0A 2ETMA 4QRCA 2FA2A 2C5OA 3UG2A 1Z9XA 3V6RA 4TYIA 4R7HA 2VTHA 5LWNA 2Y4IB 5K5XA 4DBXA 4JOAA 4O38A 5AP2A 3MVJA 4FYOA 3BL9A 4BBFA 4DFUA 2OZAB 1MQBA 5EHOA 3KL8A 3Q4UA 3HMIA 4O7RA 2CN8A 2HOGA 2UZWE 3OZ6A 4IVAA 4TXCA 3OXTA 3QD3A 2VTSA 3F5XA 4QPAA 1AQ1A 4OT6A 4EH5A 4YO4A 3B2TA 3DKGA 3H9FA 3JPVA 4AF3A 2GHGA 3LQ5A 2A19B 5TO8A 2GNFA 4RVLA 3WARA 3ORNA 4A7CA 4KIOA 3ALNA 1UWHA 3E7OA 4QYGA 4E1ZA 5CEPA 3FPMA 1F0QA 3H3CA 4KS8A 2YISA 3POOA 3HRCA 2E9UA 4U7ZA 1TZDA 1ZYLA 3IDBA 3M42A 3QTIA 4C34A 4PPBA 4CV9A 5H9BA 2B52A 3A8XA 2CGUA 3EFJA 3PLSA 2A1AB 1BUHA 2BZJA 3SC1A 4F7NA 1DI8A 2F7ZE 5AX9A 3WILA 3PSBA 1OBDA 2X0QA 4U3ZA 2Z02A 5GIPE 2RGPA 4L7SA 3PRIA 5CXHA 4GIIA 4MXYA 5IQGA 2BRBA 3TJCA 3N4UA 3DLZA 2J50A 2SRCA 3DJ5A 5EM7A 4C35A 5C8KA 1M2PA 4RQKA 3COHA 4ZS0A 3F7ZA 3DBQA 3DQWA 4QDVA 3V5LA 4CGAA 3DCVA 1J7LA 1OUKA 2VGOA 3CGOA 2XB7A 2HZ4A 4ID7A 4U9AA 3RWPA 4E93A 5LJJA 4RC3A 5FD2A 2OJGA 5CVGA 2WMSA 1SM2A 3D83A 4XP2A 3PSCA 3R7VA 4D4YA 1XMMA 4L46A 3NIZA 4F99A 5CAVA 3POZA 2OF4A 3GQLA 3Q60A 4V0GA 4C3RA 3LCSA 2G2FA 4O2PA 5EI2A 2R3GA 3OMVA 4G3DA 2XBAA 3O8PA 4NK9A 4BCJA 4IDTA 2J5EA 3RHKA 3TIYA 4C3PA 3E8CA 3TV6A 3W2SA 4EK5A 2PHKA 4QQJA 4ACGA 3LFDA 2HXQA 1JSUA 3S0OA 2I0VA 3PRFA 4YBJA 4D58A 2VWYA 4XRJA 3UBDA 5EHYA 4RX5A 4NT4A 4OTFA 4AE9A 4UZHA 5KMIA 4HYIA 3MA6A 2I0YA 5HICA 5CEQA 5A9UA 1PJKA 4ZMEA 3MS9A 3OWLA 5I9UA 3FL5A 4MTAA 2C1BA 4O0VA 3KXZA 5K0XA 4BWXA 2R3KA 1K9AA 4KSQA 3AC8A 5T6KA 4K2RA 1RQQA 4UZDA 3OWPA 1H00A 3ORZA 5LCKA 4S32A 4EQCA 2YWPA 3PY3A 3PWDA 2XEYA 5HE1A 2YCFA 5L4QA 3QF9A 1GOLA 2GNHA 3AXWA 3R30A 3QGWA 2Y4IC 4I93A 5ANOA 4EI4A 4X3JA 4G5PA 4YPSA 4L68A 4QNAA 3W16A 4O4BB 4YJPA 5AP4A 3ZBXA 2OF2A 2CGWA 2VWXA 4IC8A 2DWBA 4TL0A 3C7QA 3QX2A 3OCBA 5E90A 2RFDA 4DFNA 3ROCA 3UNZA 3SLSA 3VS6A 4EUUA 1LEZA 2WMAA 3FXXA 3DTCA 2WMRA 2YWVA 5JFWA 2JKQA 2X7GA 3OROA 1E9HA 2PYWA 4PTCA 4ANMA 2XJ1A 2PUUA 5HCYA 2GQSA 2X7FA 5J7BA 3ERKA 4RMZA 3TKHA 1WBVA 3RAKA 1ZXEA 3SXSA 3H0ZA 2W5BA 4GRBA 4ZTSA 3ORXA 1ZOHA 5CT0A 3DXPA 5TKDA 3QC9A 2ITPA 4RA4A 1Q62A 3D5VA 1SVHA 2Y7JA 3HV7A 3QTSA 3A7FA 4DG3E 2XA4A 2YM5A 2JDSA 3P7AA 4AAAA 2WTVA 3KREA 3V3VA 5HKMA 4XG7A 3O7LB 4GU9A 3QTUA 3LM5A 4G2FA 4DFYA 2RF9A 3PXYA 5FTQA 4JJRA 1VZOA 3GCUA 4K9YA 4R3CA 5IQFA 3MIAA 4D2WA 3K3JA 3PXFA 4N0SA 4FNXA 3LFAA 3NW7A 5TT7A 1ATPE 1CKIA 4IM2A 1J1CA 2KTYA 4MQ1A 3CQUA 4BDCA 3UNKA 2VWIA 2C6LA 3D2IA 4YZDA 5HNBA 3WIGA 5HU3A 3V5WA 2XYUA 4KBCA 5HE3A 4YTHA 3FKLA 4AN2A 4YLLA 5BQ0A 2BVAA 4J1RA 3ORKA 3FMNA 3F5PA 3VBVA 3ZFXA 3FLSA 5IQEA 2GS6A 4AW1A 5DLSA 5ANIA 5HG5A 3UIBA 5K5NA 1J7IA 1ZY5A 2ZB1A 1XKKA 4GFGA 4NTSA 5CZHA 4MQ2A 1STCE 4FGBA 3MW1A 4O83A 4O0UA 3WZDA 5IQBA 3VBTA 4IWDA 1O6LA 2FYSA 1YOLA 2HZNA 5HD7A 2XEZA 3CD8A 4G6LA 4MD7E 2RG5A 3NVKI 1YQJA 3FJQE 3DAJA 3A8WA 3QRKA 3UYTA 4B0GA 5C26A 3G6GA 2WMUA 4GT3A 3UIMA 2IVUA 2XNBA 4N6YA 3ALOA 4QYEA 5F20A 3RM7A 3QUEA 4OAUC 1W84A 3OOMA 4GUEA 1UWJA 2BZIB 2IVSA 2XIZA 4E4XA 5HLPA 5IQCA 4BKYA 5JGDA 4FTCA 2JGZA 4NFMA 4PV0A 1FOTA 5E92A 3IDCA 5ACKA 4DFZE 4YLKA 2O5KA 4OAVB 3G5DA 4Y73A 3W0SA 3UNJA 2J2IB 3DU8A 3JY9A 2WMVA 2XZSA 2GMXA 3OTVA 3KC3A 3UVPA 3VBXA 3F5GA 2VN9A 5E7RA 2PE1A 2QU5A 2YDKA 2R3RA 3C51A 5CT7A 5IA4A 2CLQA 4YC3A 4JX3A 4CFWA 5GZ9A 3AKKA 2ACXA 4QTCA 5CALA 3PY0A 2ZM1A 4FZ6A 2WQOA 3RAHA 2QR8A 3BWFA 3DK7A 3ZRLA 3R01A 4I0TA 3ZXZA 3FQSA 2OJJA 2QHMA 3PIYA 4X21A 5BVKA 5HZNA 5L2WA 2IW8A 3TL8A 4FYNA 4DEEA 2X9FA 3QQUA 1SYKA 4WIHA 2WO6A 2XANA 4FT3A 3EMGA 2P2IA 4V0GB 4MXXA 5CNNA 3LM0A 5B0XA 3NFFB 3NNWA 4F9WA 4G3CA 5DN3A 2PL0A 1H1WA 3MY0A 3LLTA 5HQ0A 5E4HA 3MB6A 4O22A 3GU6A 1OPLA 3U54A 4W9XA 5E1SA 2GS7A 3U9CA 2G01A 4CFVA 4U79A 1WAKA 1PKDA 4GS6A 4HZSA 3QZGA 4ALVA 5HTCA 4NTTA 4F64A 4QP4A 2I1MA 3O23A 3D9VA 2PMOX 2QOCA 3OWJA 3EQCA 3R9HA 1M2QA 2O3PA 4YJRA 4I0RA 2UW9A 3TNHA 2ZAZA 1PXJA 2UW4A 3R83A 3KA0A 3NNXA 3FI4A 3IOKA 2WKMA 3D2KA 3FC2A 2XAMA 4FT7A 2Z2WA 3PXRA 4AN9A 1ZYDA 4OUCA 2B9IA 3LXLA 4C4IA 1YI4A 3C0GA 4QMXA 3S2PA 3LCKA 4FKIA 2C6IA 3DK3A 2X39A 3I4BA 3RP9A 4RWLA 5JFVA 3AD5A 1W2CA 2R5TA 2OICA 1PRYA 1AD5A 1CKPA 3L9LA 4AAYA 4YJSA 3L9NA 1CDKA 3EN4A 4JAJA 4LG4A 4D0XA 4R5YA 3UO6A 4NW6A 5FGKA 4FTTA 4O7WA 3QKMA 4AZVA 4IB3A 4EH7A 1A06A 4HZRA 4J8NA 3D14A 4O91A 4UX9A 4MWHA 2WEVA 2PVJA 2ITQA 1GAGA 5I5ZA 5KZIA 4YGAA 3UPXA 3KMMA 3R7OA 4MF1A 3AC3A 3QTXA 5BVEA 4C4EA 1NT2A 5HX6A 5F94A 1Q8ZA 4C02A 4MWIA 4GMYA 3VRZA 5E8SA 4YZ9A 4EHZA 4GL9A 3RVGA 3Q32A 3QWKA 3UOLA 3ZXTA 3S3IA 4LOQA 5M57A 4MVFA 1CMKE 2UZUE 4TZRA 4FSNA 4UMPA 4GCJA 2CGXA 3PXZA 2W9ZB 1BKXA 3T9TA 4X6RA 5M55A 4DH5A 2QO2A 4U41A 2QQ7A 3BPRA 2W1IA 3E63A 5HCZA 3OTUA 3T8OA 5IDPA 3EYGA 3R7IA 3ORTA 4UYAA 2WTKB 3KN5A 3LCOA 4KABA 5BMSA 1WBPA 3VUGA 4WUNA 4QMUA 4IANA 1WVWA 2C0OA 4WBBB 3UIXA 4L3LA 2HWOA 3CJGA 1H08A 4AFJA 3PY1A 4U45A 2CKPA 3HVCA 2JKKA 2XNGA 4IZ5A 4IEBA 2E9NA 4KB8A 1ZWSA 3FMHA 4FICA 4YTFA 4FIFA 5AR8A 2WMXA 5KNJA 1QPEA 1OZ1A 4PL4A 4XMOA 5ETFA 3QXPA 1OECA 4ZTQA 3QGYA 3QYZA 2PZYA 2X6DA 4DFBA 4MBLA 2PE2A 2FSOX 1P4FA 2GCDA 5GNKA 4PMSA 3ZU7A 2BAJA 1YW2A 5EH0A 5AM6A 3QQFA 4EBVA 5A46A 3F6XA 1OKZA 2GFCA 3UODA 3NYNA 4RZWA 3OEZA 4HVIA 4KUJA 1OKYA 4RWIA 1EH4A 5IH6A 2BROA 3ORLA 4QMVA 3Q53A 4DDGA 1Z57A 1UNLA 3PFQA 3DJ6A 3H30A 4DH1A 1Q4LA 5J95A 2X9EA 3VONA 2PVFA 3QA8A 4JBPA 4LFIA 5AV3A 5KMJA 4MK0A 3MWUA 2VTLA 3FPQA 2ITVA 5K4JA 5HVJA 4QMYA 4F0IA 4HYHA 1P5EA 1OL2A 1URCA 5AWMA 3TNQB 4NZWB 3AGMA 4BZNA 4LV7A 1J3HA 2OO8X 2QLQA 4AGCA 2WOTA 4MHAA 2YABA 4PX6A 2ONLA 3EQHA 3BIZA 4BKJA 3PFYA 2H9VA 5KX8A 5CEOA 4M14A 3KXNA 5ETCA 4ACCA 3G0EA 4JG6A 2QOOA 4C7TA 3C4EA 1SMHA 2GQGA 3IOPA 5CSHA 3NZ0A 3R9DA 4XHKB 5DRBA 4LV5A 3PA3A 4HNFA 3ZO1A 4M12A 5ETAA 2EXCX 4DEBA 3PIXA 4F9AA 3CJFA 4DT8A 1GZOA 2ZDUA 2CPKE 3UC3A 2OBJA 3OF0A 3Q2MA 4ENXA 1ZMWA 5LARA 1H24A 3ZLWA 3H0YA 3D5XA 2PY3A 4HW7A 4LDTA 3MSSA 4GFMA 4B8MA 2YCQA 2Y6MA 4FSWA 4UB7A 4TWOA 3VS1A 3Q52A 3SW7A 3FI3A 3ZUVA 4C61A 5DR9A 3LOKA 5AMNA 5KCVA 3Q9WA 3FBVA 4EOLA 5DT0A 4XLIA 5KMLA 4FV2A 2HWPA 2C3LA 3BU5A 4Y5QA 1XBAA 2RIOA 5ANKA 1WVXA 3O8TA 5D11A 3RPOA 4FX3A 4FC0A 2X2LA 3OD6X 3DLSA 4ITJA 2X2KA 2GU8A 4X6QC 2JFLA 5HO8A 5DH3A 3VBWA 1K3AA 3ZLSA 4F1MA 5JKGA 2CDZA 3HV4A 5M53A 4NM7A 1O9UA 3BQRA 1Q8TA 5CZIA 4FSRA 3UO4A 3L9MA 4L52A 3HRFA 3I6WA 4L3JA 2XH5A 3V01A 3KY2A 4WRGA 5J1VA 3TTIA 2QHNA 2OIBA 4KIKA 1IEPA 2QLUA 2HELA 2NRYA 5EQEA 2HK5A 4NCTA 2G2IA 2WQNA 2E9VA 2X2MA 1S9IA 3GI3A 1XH9A 1YWVA 2EWAA 3C4WA 4MD9E 4Y5HA 2HXLA 2YLFA 1J1BA 2QR7A 4W4VA 5AUWA 1YI3A 4O7YA 1FMOE 4FIHA 2X4ZA 1XH7A 2W0JA 4O82A 5F1ZA 2W5AA 5EM5A 2VTAA 3EFWA 5BV3A 4AFEA 4IWQA 4S34A 4PTGA 2IZSA 5DA3A 4AW5A 3R2YA 4L00A 5EFQA 3V8TA 5M4UA 2QOQA 3I5ZA 3L8PA 5FUTA 4IB1A 3U55A 2GS2A 5DPVA 3S95A 3MJ2A 3ZEWA 1NA7A 3EFLA 5JT2A 4FOCA 2FH9A 4FKLA 3E92A 4EYJA 1PMEA 1UU9A 3PXKA 2R7BA 4B6LA 4YNOA 3SAYA 4BIEA 2J0LA 3F82A 2OG8A 4JVGA 1XH5A 4MBJA 3GXLA 5AUUA 2ETKA 1QMZA 3GCPA 4M8TA 4NJDA 2ITXA 5IDNA 3OG7A 3NIEA 3TZMA 3HDMA 3R1YA 1Q8UA 3R73A 3BGPA 4E6DA 2R3QA 4EL9A 4AWIA 2X8IA 4I5MA 5IPJA 3FMJA 3OY1A 2PSQA 2B0QA 1PYEA 3QZIA 4NKSA 2PMLX 5CF8A 1R0EA 2WTCA 1W2FA 4O4DA 3S4QA 4YMJA 4YJVA 4MNEB 2PPQA 3CY3A 2UZEA 4FL2A 4L53A 4RPVA 5EDPA 2UW6A 3MB7A 5T3QA 4APCA 4YSJA 2PWLA 4FODA 1GZ8A 2ZYBA 4WSYA 3VN9A 3RHXA 3MH1A 4M15A 2WB8A 4ZLZA 4GG5A 4IH8A 2UW7A 4XP3A 3VQUA 4YHTA 3W10A 5I9XA 4O6LA 3GU8A 4C4JA 4P7EA 4IX6A 3VUDA 5KO1A 3H4JA 3DNDA 4KD1A 3E3BX 3QCYA 2PVRA 2PTKA 3I7BA 4MKCA 3K5UA 5AIRA 4F09A 4OLIA 2ZOQA 5JRQA 5BVDA 3U51A 3K2LA 1JSTA 3F3WA 4FSMA 4M69B 1JAMA 2JDVA 5IA2A 3ORIA 2PZ5A 4GK2A 4JS8A 4F0FA 3KVWA 1G3NA 4RJ6A 4BCNA 3AMBA 4OTDA 3VBQA 4BDHA 3NAYA 4NW5A 4BGGA 5D10A 3DKFA 4BVUA 3KXHA 3GFEA 3LXKA 3ZFYA 1K2PA 4AZEA 3QZFA 3UP2A 2J51A 2C0IA 3DTWA 3EQGA 3QD2B 3TNIA 4TWNA 5HLWA 3G15A 3LHJA 3R7EA 4D28A 3O7LD 4WG5A 3RCDA 1OMWA 1U54B 2ETRA 4E20A 3BZ3A 3HV5A 2BKZA 5AUVA 4YTCA 3HKOA 4B7TA 3F3VA 2X8DA 2WGJA 2WU7A 5GJFA 1PXIA 5D7AA 4IBMA 1WCCA 3CTQA 4X0MA 4C37A 4II5A 4ZZMA 3SKCA 2CSNA 5HG7A 4BTKA 4ZJJA 4Z7HA 4RIXA 1JQHA 4FSUA 2BFXA 2C6TA 2WPAA 3VAPA 3EJ1A 4TWCA 3RPVA 4RG0A 5IQIA 3OXIA 4RX7A 1TQIA 2W1GA 4CQEA 4IAKA 4DITA 2X4FA 3ZEPA 2BIYA 4EORA 1DAWA 4EUTA 3HV3A 4BJJA 4DT9A 2PVLA 5B2LA 4O2ZA 3FDNA 5I3OA 5L2QA 2C5YA 1YXSA 2IPXA 3NW5A 1OIYA 4EC8A 2QD9A 3QRUA 3B8QA 4G31A 2XBJA 2YCRA 1Z5MA 3RZBA 4FSYA 3I79A 2FB8A 3H10A 4UXQA 4JRNA 4G17A 1XHAA 2OW3A 4IAFA 2ITWA 5HHWA 2C47A 2JIUA 5J9YA 4U80A 4XG3A 3WYXA 4YZMA 3GC7A 4G3FA 3UOJA 3EFKA 2FSMX 4W4YA 4BTJA 3T9IA 4AZTA 4N70A 2VTPA 4UWBA 3B8RA 5FXSA 3RK9A 1KOBA 2VO3A 2JITA 4IX5A 4OTWA 5DG5A 4TYHA 2XNPA 4JR7A 1LEWA 4ANBA 4ZSLA 4GKIA 2GNJA 3HDNA 3O5AA 4H05A 3RNIA 3ZC5A 4CYJA 3NCZA 4FV3A 3QQKA 4PRJA 4RQVA 3RK5A 3KCFA 4CT2A 5L2IA 4N57A 1REJA 3NNUA 4J97A 3VS7A 2X1NA 3EWHA 4BZDA 2F49A 4FKVA 4PWNA 2G1TA 4RIWB 4QYFA 3H9OA 4RVKA 2EXEA 4HNIA 5G6VA 3DB6A 3FI8A 2F7EE 5CEKA 1MRUA 4KIKB 3SA0A 3QLFA 5C4KA 2YFXA 2UVXA 2ZB0A 3Q6UA 4YBKA 2OZOA 3MIYA 2IWIA 2C30A 2B53A 2G15A 4USDA 1BX6A 4TT7A 3C4FA 4U6RA 4QPSA 4X3FB 5EQPA 1WVYA 3W2OA 3L8SA 2PVKA 3A7IA 2C0TA 3LXPA 5HTBA 3BHUA 1WBWA 4AU8A 2F2CB 4G9CA 4X2GA 1KSWA 4PDSA 4UMUA 3KRXA 4OBOA 4H3PA 4K33A 3FE3A 3FLNC 3OBJA 4FMQA 4YJTA 2QG7A 4C62A 4HCTA 3E5AA 3PUPA 4O1OA 4XV1A 3ULIA 3PE2A 2CCIA 5FP6A 1RW8A 3F5UA 3HP5A 2Z8CA 4DH3A 4IFCA 2XS0A 2LGCA 5HOAA 2F9GA 4BI0A 5L2TA 1G8AA 4MD8E 2ZFYA 4QMLA 3LIJA 5BUJA 3V6SA 4BDDA 5BNJA 2RFEA 4CD0A 3FI2A 5IUGA 5ANDA 1UKIA 5H8EA 5GJGA 5ANJA 1P14A 4QDEA 1W83A 3EQPA 4UALA 2OXYA 3RAWA 4PP7A 5JMSA 4U42A 4FZFB 4H3BA 3PWYA 3ULZA 4GU6A 4LOPA 2OIDA 4A4XA 3G33A 4BBMA 4B9DA 4BYIA 1YDSE 2BHHA 2UW3A 3FLQA 5AADA 3D4QA 3N9XA 3R0TA 4EEVA 2BCJA 3BGQA 2VNYA 4RC2A 5CLPA 1R0PA 4KKHA 2W17A 3PVUA 4IJ9A 4BDFA 4E26A 4ZZOA 4FEWA 1ZZLA 3D5WA 5G1XA 4FEXA 3NUXA 1VJYA 2LAVA 3LFNA 2R2PA 3GCSA 4A9RA 4FKSA 5H3QA 3OOGA 4KA3A 5IA5A 4QMWA 4EQMA 3R2BA 4Z3VA 1VYZA 5EYMA 2IW9A 2V22A 3U4WA 3ACJA 4QYYA 2VO6A 3E8NA 3U9NA 5LXMA 2PMNX 4X2JA 5LWMA 4EJNA 3RPYA 1PKGA 3NVMB 1KE6A 2OI4X 2JIIA 3W32A 4AUAA 2WQBA 4ERKA 2F2UA 3I7CA 4YUQA 3V5QA 5BVFA 4ZMFA 5HI2A 3VC4A 5DEWA 1OUYA 5BPYA 3PG1A 3FMLA 3MFUA 2X81A 4PF4A 2QKRA 3UC4A 4IM3A 2REIA 1OKVA 5HTIA 4O4EA 3VUKA 1XWSA 3BQCA 4FV8A 3IONA 4ZY5A 1FMKA 5L3AA 4DG0E 4XYFA 3KKVA 3TUBA 4W4XA 1U59A 2GHMA 2BTSA 3H9RA 4RJ3A 3JVSA 5CSWA 5ANEA 3ZZWA 4A4OA 1IA9A 2V55A 4FKJA 3CCNA 4J98A 3IGOA 5IUHA 2UW8A 1JKLA 2P0CA 3K54A 2YJRA 4RJ5A 3BYVA 4XP0A 4F9CA 3MH0A 3SDJA 3LFFA 4X3FC 4FF8A 1GNGA 3LZBA 1P2AA 2J0IA 3GEQA 5CVFA 4F4PA 4L45A 5GINE 4YNEA 4I5HA 4FZDB 1H4LA 5A4CA 4USFA 2CNQA 3BCEA 1ZARA 1OL6A 2C6OA 4F9YA 4YHFA 4B99A 4F7SA 4TRLA 3IDPA 4FTKA 3ZMMA 3N4VA 1ZLTA 4AW2A 4AGDA 4ZSGA 4FKUA 4JQ7A 4XRLA 4EOIA 3U6HA 4DLIA 5AUYA 5HBHA 2VTRA 3NYVA 1OPKA 4FVQA 4A06A 4O0TA 3C4ZA 4H36A 3SG8A 4WBOA 2VX1A 3QD4A 4FT5A 4Y85A 4GW8A 5DHJA 3GFWA 3FMMA 3DGKA 3AD6A 4K6ZA 2XNMA 4M68A 3SW4A 4LRKA 4BIDA 3W2CA 4E6CA 5IG1A 4CT1A 2XNOA 4U97A 4HGTA 4C8BA 3COIA 3LJ1A 4JQ8A 5L8LA 4DYMA 4XG6A 2YM3A 4W4WA 2CMWA 3IECA 4PQNA 2GQRA 3Q4TA 1Q97A 3I60A 4QQ5A 4R3RA 4A9YA 1U5QA 3GU7A 3FY0A 4QYHA 5HU9A 1DAYA 3IPHA 4IAAA 3QQGA 5CF4A 1RE8A 3QRJA 5B7VA 4ZTRA 4FRFA 3MDYA 5CS6A 4UWYA 5D9HA 3Q3BA 3BHTA 3NX8A 4O96A 1FPUA 2ITOA 4HGSA 5FEDA 3WYYA 4ASEA 4ZZNA 3LXNA 1UA2A 3DNEA 1B39A 3CY2A 2E9PA 3FZOA 5F95A 5AA9A 1PMNA 3VW6A 5JH6A 4ANSA 1T45A 2WIPA 2OIQA 4PPAA 3VHEA 4IVBA 1NW1A 5DR2A 2ZJWA 4LV8A 3Q4ZA 4CFUA 1LPUA 3P4KA 1JSVA 3I5NA 4TNDA 5IEXA 2C6EA 1ZOGA 5DIAA 4MXOA 3QBNA 3AMAA 5A54A 3TZ7A 3TM0A 4FEVA 3HGKA 3GCVA 4P90A 4RFMA 3F66A 3RBWA 3VS5A 5A6OA 5IA3A 2WQEA 3CPCA 4GKHA 3HEGA 3BELA 4O0SA 2XP2A 1Y91A 4BCPA 3LAUA 1OL5A 4EZ5A 5E9EA 3JR1A 4DHJA 3GC8A 3W0QA 3PPJA 4DINA 3OXZA 2E2BA 1YHSA 3DBCA 2VTIA 4LRMA 4ZOGA 2R64A 4J8MA 4X2KA 3ORMA 3TZ9A 2X0OA 3FMEA 1LUFA 3PZEA 3DAEA 5CU2A 4FV1A 3WZJA 2QG5A 4CSVA 3ANRA 1JKSA 5IF1A 4AXCA 4DTAA 3SOAA 4BY9E 4CRLA 4D1SA 4C3FA 2B9HA 4JDHA 3RM6A 4PDYA 3BX5A 1DS5A 1ZMUA 2BRHA 2YJSA 4FV5A 4AACA