3HMPA

Crystal structure of human mps1 catalytic domain in complex with a quinazolin ligand compound 4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
258
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMSQVGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Biophysical and X-ray crystallographic analysis of Mps1 kinase inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hmpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hmpA01
4AT5A 3DTCA 3DAKA 4QMLA 3Q6WA 4EOLA 3QZGA 4RGJA 4D4SA 4FX3A 3LCKA 4IANA 1LR4A 2Y7JA 4QYYA 1HOWA 3BQRA 4TZRA 5IG1A 4FT3A 3ID6C 3NUXA 5M08A 2XNEA 3ORPA 4RWLA 3ZM9A 1FVTA 3RZBA 4RPVA 2QHMA 5CNOA 3UTOA 5JK3A 2ITUA 4JDJA 4KWPA 2UZEA 2KULA 3TUCA 1XH9A 3CC6A 4ZZMA 4YR8A 4PDOA 2BTRA 4MBLA 5AAFA 3SG9A 1X8BA 3NYVA 4NW5A 2XK4A 3SAYA 3GXLA 2FO0A 2OU7A 1YWNA 3CGOA 4O21A 5LQFA 4M68A 5E90A 4XRLA 2Z2WA 3AT2A 3DK6A 2W4OA 3O50A 3KF4A 5DYJA 4DCAA 2WU6A 3HDMA 2VGOA 5E8TA 5ICPA 3CEKA 3UIXA 3OOMA 4K11A 2CJMA 4IAAA 2GNLA 5EH0A 4FYOA 3DAEA 4OTPA 1SM2A 3TEIA 4M15A 3EH9A 3AMBA 5HEZA 5FM3A 4I6HA 3BYSA 4Q2AA 5L8LA 2F49A 5IH5A 1T46A 1H24A 2BKZA 4IMYA 4MNFA 4TWOA 4AOTA 4CCUA 5IPJA 5JGAA 4P90A 3KREA 5HBJA 4Y73A 2X6EA 1FPUA 3E64A 1H1SA 3P5KA 5JT2A 3DXPA 4U80A 4MCVA 3OW3A 5KBQA 1OUKA 3U8WA 3KQ7A 3LFDA 4E4LA 2QI8A 3LFQA 1Q41A 2H9VA 2YIXA 3CQEA 4MXOA 4KKGA 5AV1A 3ZUVA 4FKSA 3E3BX 4J8NA 1Q8YA 2BZKB 3AMYA 1OB3A 4JXFA 4XX9A 5A4CA 3PLAE 1DS5A 4EK3A 3OT8A 2WAJA 5CLPA 5BYLA 3U54A 4J53A 5IA0A 5JGBA 5J9YA 2ITZA 2J5EA 3QQKA 4QMMA 5AV4A 4K2RA 4UB7A 3MN3A 2JEDA 4IDTA 4RX9A 4YTIA 2GNIA 4FT9A 5F20A 5LCKA 3OC1A 3VHKA 5HCXA 4MTAA 4O38A 3AC2A 4I20A 4BF2A 2UZTA 5I9YA 1XH5A 3MFRA 3VF8A 4E6CA 2ZM1A 4OAVB 3QTRA 4L52A 2GTNA 5M55A 3TT0A 2ZOQA 4ZJJA 4GJ2A 4MWHA 4S32A 4Y5QA 4CFXA 4UMUA 3Q4TA 4WSQA 1YXTA 4PL5A 3VF9A 3HP2A 1XBCA 3ALNA 2WEIA 3G2FA 2YABA 3G6HA 4IADA 3LCTA 4QPAA 4TNBA 4AN3A 3SLSA 3BV2A 5LWNA 4CG9A 1V0BA 3U9NA 4U44A 2G2IA 3VQUA 4C8BA 4CRSA 2YISA 3KFAA 5KMNA 3N4UA 2R3IA 3PUPA 5H2UA 2QOOA 3H0ZA 3LQ8A 5JRSA 5IQFA 5JFXA 3O7LD 2W4KA 1XKKA 1GNGA 2Z60A 3D5UA 4QMUA 2ETRA 2NO3A 2WQEA 3FPMA 5L8JA 3VQHA 2Z7RA 4LOPA 2OZAA 3L8XA 4UEUA 1OIUA 4EQCA 3R7YA 3PJ3A 2WMAA 3ZONA 3UODA 3PPJA 3H10A 2ITQA 1ATPE 4YZDA 5A4LA 1ZMUA 3I7CA 5EOLA 2VTQA 3C5UA 3AG9A 3COIA 4Y72A 4C58A 1YDRE 3H9RA 1R3CA 2C5YA 1KOBA 4I1ZA 3BHYA 3ROCA 1ZOEA 1IG1A 5CF8A 4CKRA 4IB1A 3F3ZA 4S34A 4MH7A 5CI6A 3EQHA 2BTSA 2GHGA 3QD2B 1WBNA 3FYKX 3MWUA 4HCTA 5A6OA 4JLCA 2PMOX 2VWBA 3UZRA 4AXAA 3OWPA 4E6DA 5BYYA 3VUTA 2VTSA 2JFMA 5EQYA 2C5VA 3COKA 3KXHA 4YNOA 1OBDA 3LJ2A 4O1PA 3V5TA 5A6NA 1PF8A 3FI2A 4EOSA 3PXFA 3TUDA 1STCE 1UVRA 4EH5A 4PTEA 2XNPA 3MFUA 4FZFB 3RTPA 3C4ZA 2EB2A 2PZRA 3ORKA 5E8YA 4J96A 4EK4A 4BIEA 5IH4A 3RPRA 3FBVA 4L44A 5AUXA 4GIIA 4FZ7A 3F3UA 5FXSA 3SOCA 5KUPA 1JSUA 3QQJA 3R28A 5J8IA 4CVAA 1R39A 2VUWA 5AUUA 2OWBA 5CX9A 2EWAA 4R1VA 2QR7A 4D58A 2V22A 4C62A 2WTIA 4QMNA 2JDRA 1Q62A 4FV7A 4YJVA 3SGCA 1Q3WA 3F5XA 3GCUA 3GC0A 4MD7E 5M57A 4IVDA 5K3YA 3BGQA 4L3PA 3QTZA 4PNIA 2VWIA 2WMUA 4L42A 3EN5A 3GU6A 4IFCA 3P7CA 4X3FA 4ZOGA 4ZTMA 5KCVA 3DDPA 3D5WA 3IGGA 4IX5A 4MNEB 4E6QA 1QCFA 4LQMA 5CQWA 3JYAA 1CKIA 1MRVA 4R7IA 3V6SA 3U6HA 3QKLA 5DR6A 4AT3A 2BKKA 3IGOA 2BZJA 3D5XA 4O91A 1RE8A 4U6RA 4KRDA 2YIQA 4HCVA 1ZYLA 3COHA 1YHVA 2YAAA 4F7SA 5CSHA 3LCOA 5EKNA 4APCA 1G8AA 4FKLA 3E7VA 2WB8A 2Z7QA 3HLLA 3NAXA 2PVKA 3Q32A 4G17A 3RAKA 2HXLA 3HP5A 1KE5A 1W98A 3OZ6A 4OBQA 4USDA 4B7TA 4CT2A 3GCPA 3KVXA 4I92A 4A9YA 5AIKA 3R00A 3FHRA 5HG5A 1Z5MA 5HX8A 3RBWA 3UJGA 3L8VA 1T45A 2P2HA 3DNEA 3IS5A 3RAWA 3RWPA 3MPTA 4C3PA 3FDNA 2YZLA 2QOBA 3PJCA 3UZTA 4RJ6A 1LPUA 1SYKA 5JRQA 5AR4A 2OW3A 5IISA 5C4KA 3EIDA 4MXYA 5EK7A 2CDZA 1UU7A 5AUVA 3DCVA 2QD9A 3PIYA 4BN1A 3ZS5A 4DEBA 3LLTA 3RGFA 5KMLA 3UNJA 4FG8A 4KIKB 3CD8A 5AUZA 4WHZA 1I44A 2WMRA 2VNYA 3PLSA 3QAME 3MYGA 3PE1A 4IZ5A 5LJJA 2H8HA 4HJOA 2CKEA 4M13A 5E1SA 4XOYA 5EYKA 2IPXA 2PZ5A 2VWVA 3F3VA 4XLIA 4O83A 3A7GA 3UDBA 4ENYA 5EW8A 3CD3A 4ZP5A 1ZYDA 2V0DA 4HVGA 3UO6A 2X9EA 3TDVA 3U55A 3IDPA 4HNIA 1GIJA 2W06A 5M56A 1KOAA 3Q9ZA 3ZEPA 3PJ8A 4V0GA 3RM7A 2QU5A 4WA9A 3GU8A 4FV3A 1KE9A 4ZTQA 1OPLA 4HNFA 4UN0C 5CSXA 4EH8A 5I4NA 2CNUA 5F4NA 3GU4A 5E8ZA 3GC8A 3AC1A 4EHEA 2X9FA 4X2FA 1M2RA 3H3CA 3HDNA 4Y95A 5IQIA 4WOVA 4E5WA 4MD8E 3EN4A 5M4IA 2QVSE 3TJCA 5DT3A 2QOIA 2BROA 1Z9XA 1I09A 3NYOA 3KCFA 3LZBA 5HG7A 3R9OA 4I41A 1W8CA 4FV4A 4NM5A 3KY2A 3V5JA 2JLDA 2YERA 4I0SA 4ZTNA 3NEWA 2UW8A 3C0HA 4CQEA 3H30A 3OBGA 4YJQA 3AC5A 3RP9A 4FKQA 2IVTA 2OJJA 1P4FA 3PXYA 3PZEA 1CKPA 4XG4A 3PSDA 4MXZA 1XBBA 3MIYA 3OFMA 3NNXA 2JDVA 4AW1A 5CEOA 3HUBA 3ZDUA 4GCJA 2WZJA 4ID7A 5HICA 1OKVA 1YXVA 2WU7A 1XJDA 2CMWA 1SNXA 3GVUA 5AP6A 3VW8A 1A9UA 3I6WA 4QQCA 4E4XA 3EHAA 5LMKC 4IWOA 3QLFA 3HRCA 2BHEA 1BKXA 2GNHA 4U45A 3TNQB 4TL0A 3F5UA 3SHEA 3TIYA 4DTKA 4AGDA 4F6WA 2B9FA 2EU9A 2YM8A 1H28A 4AGCA 4KSPA 1U54B 4IJPA 3W2OA 1SVHA 3W2CA 3ZYAA 3SW7A 1E9HA 4YHFA 2YIRA 2CGUA 4J8MA 1KE7A 4EONA 2R7BA 4CZTA 3C51A 3NS9A 3WE8A 4CFFA 4IFGA 5KHWA 2J50A 3TNIA 4ORKA 3IPHA 3MA6A 3PFQA 4PPBA 2HXQA 2JKKA 4WD5A 4ACHA 4AZVA 5IEXA 4WRSA 5ETAA 4L45A 2E2BA 1JKTA 4A9UA 2UZOA 4XBRA 4M12A 3DJ5A 4TYJA 5DI1A 3DQXA 3LPBA 4S33A 1YVJA 4EH7A 2VRXA 4FSTA 4LFIA 5EW3A 4F9CA 4W4VA 2OFUA 4EI4A 2B55A 3A2CA 3PY1A 4M7IA 4I6BA 4NZWB 5IH6A 2HZ0A 3HV3A 3AGMA 4R8QA 3WARA 3WBLA 2OI4X 4NCTC 4R6VA 3TIZA 2XZSA 4KINA 4WO5A 4PY1A 4X21A 3FXXA 4R5YA 4UXQA 4BIDA 4DFXE 4KKEA 5LXMA 5IF1A 1Q8ZA 4FL3A 3BU3A 2Y4PA 4EZ7A 5BVOA 4BBMA 4DGGA 4FC0A 4FNYA 4KB8A 4CZYB 4AA0A 2XMYA 2QODA 5FTQA 3DBEA 3RWQA 2GFSA 3U4UA 4NKSA 3WIKA 3ZSIA 4AF3A 5GJDA 2WKMA 3VO3A 4RT7A 5KMOA 4QP3A 3JVSA 4O2ZA 4GFMA 4BB4A 3OTUA 4EHZA 1FQ1B 2ZB1A 3QALE 2BFXA 3CKXA 3KXZA 3CTQA 5CY3A 3LXPA 5FTGA 5E4HA 5FBNC 4ACDA 3ZO4A 4I6FA 3SDJA 2YAKA 3CS9A 3ORIA 3QA0A 1YXSA 3BELA 4IE9A 3ERKA 3E62A 5CVHA 4Z7GA 4DFUA 4RA5A 3MVMA 3E8DA 3WOWA 3A4OX 3GU5A 3AC8A 3ACJA 4HGEA 4C0TA 4O0WA 2YM3A 2C1AA 3F5GA 4FTJA 2R4BA 4QMVA 1OBGA 2OH0E 4FTCA 2FB8A 1OL6A 4PP7A 1ZLTA 1H1RA 1ZY4A 1XHAA 4QMYA 4TYHB 3E5AA 5LMAA 2B52A 1MUOA 3I0OA 4QD6A 2R64A 2PZPA 4F1OA 3NWWA 2UVXA 2WPAA 2XVDA 4KRCA 3TZ7A 4X6RA 4QP4A 4YPSA 2EUFB 2ITWA 3R0TA 4I23A 4N70A 4TWCA 2HY0A 1RJBA 4QQ5A 3GUBA 3KULA 3GC7A 2VWXA 4OBOA 4NYEA 4FV5A 4DTAA 3H4JA 4EH4A 3IDBA 4M69A 3EMGA 5IQGA 1KE6A 3CGFA 3H9FA 5T6KA 2OGVA 1WVWA 4IX6A 3F2AA 2JKOA 3HUCA 2HENA 5BMSA 3FZPA 3R04A 3UQGA 2IVSA 2CNQA 3LKMA 5KBRA 1WFCA 3W55A 3L9LA 3FMLA 3MY0A 3QCQA 5HTBA 5TKDA 3O8PA 3KRXA 4ZSEA 5IMXA 4AAAA 3C50A 4EORA 4JQ7A 5CEIA 1WBOA 5FTOA 1QPEA 4I0RA 3EQIA 4EOOA 2OBJA 4F6SA 4W9WA 3VHEA 3OUKA 5B0XA 4DEAA 2C30A 2G2FA 1H01A 4QMWA 1NW1A 4ASDA 3QZIA 2F2CB 4FTIA 4CMOA 1DAYA 2VNWA 3VBVA 4AU8A 5GZ8A 3C0IA 1BI7A 3NCGA 3SW4A 1BLXA 3JXWA 2IO6A 2XCHA 2WQMA 1J1BA 1GAGA 1YDTE 3BYUA 4A9TA 2VTIA 4Z3VA 5C9CA 5IDNA 1H26A 3IW7A 3ZCLA 2I0YA 4ITHA 2W1GA 4FV9A 4MQ1A 1FBNA 2Z8CA 3HMMA 4KIQA 3FAAA 1BYGA 3MSSA 5BQ0A 2QQ7A 2UZWE 3E88A 4FSYA 5E9EA 4RQVA 2NRYA 1PXOA 1H0WA 2C6MA 4EOIA 2YCRA 2LAVA 5T3QA 4G6LA 2C5NA 3D5VA 2YA9A 4KD1A 5IUGA 1UA2A 2VO0A 2P2IA 4L8MA 2RFDA 5HNIX 1CMKE 3FKNA 4FEUA 3C7QA 4IM2A 4XCUA 3MVHA 4RZWA 5AEPA 5K0XA 4IM0A 4UZDA 3W2RA 5D7VA 1J91A 4QQTA 4R3PA 2XEZA 3DZQA 4OAUC 3P23A 4FKVA 2ONLA 5HTCA 4I24A 5H9BA 5IZFA 4DA5A 3EWHA 3FZTA 3KMMA 2IVVA 2C3KA 3BX5A 2HELA 4IB3A 4JQEA 4NM7A 3BQCA 4KUJA 3FL4A 4FTNA 4GK4A 4RFYA 1ZOHA 2WTWA 3SVVA 2Q0NA 3V04A 5FM2A 1NVRA 4BZNA 1R1WA 4FTRA 4FNWA 4I5CA 3EN6A 5E1EA 4E6AA 1NA7A 4CD0A 5AUYA 1WMKA 4PRJA 2BDFA 2IVUA 5KX8A 4KAOA 3RALA 5HLWA 1M17A 4F1MA 5E92A 5HGIA 5TR6A 4AZWA 3F2NA 3ZBXA 4HCUA 3VULA 4PQNA 4V01A 2UV2A 4IEBA 1XQZA 2JC6A 3TUBA 1OIRA 2OF2A 2HK5A 1UU3A 3QKMA 4JR7A 2WEVA 3U87A 5C1QB 2W1EA 4ZXTA 4FSRA 4BTMA 3GOKA 3F2RA 4RSSA 4LMNA 5B2LA 2FGIA 3OOGA 4IX4A 4DEIA 3BIZA 4YJPA 1PHKA 3F6XA 1V0PA 2OLCA 3N51A 1Z57A 1J7IA 5CS6A 3VBYA 3CIKA 4B99A 3UQCA 4RJ5A 3UBDA 2AUHA 3THBA 5BPYA 2JDSA 3P78A 1JOWB 3LFCA 3VS1A 1G5SA 1PMUA 2ETMA 3Q3BA 4Y46A 4BI2A 4NTSA 1GIHA 3QUEA 3R1YA 4AFEA 2I6LA 5M4FA 4D2RA 3PRIA 4PUZA 2DS1A 1H07A 2IJMA 3HV6A 3IONA 4I0TA 3VS4A 4RC4A 5HKMA 3GENA 2I0HA 2X7FA 3LXKA 3PY0A 4JG8A 4DCEA 5JSMA 3E92A 1KE8A 4O81A 3SA0A 3LFNA 3Q2JA 1PXMA 5CXZA 4O7RA 5HI2A 3PSBA 4DG0E 5AWMA 2ZDTA 4AN9A 2HY81 4CMUA 2WNTA 2WMBA 3IW6A 3S3IA 2BZHB 4ZY4A 4APPA 4IAYA 4CG8A 3NDMA 3OWLA 5J9LA 4IWPA 2QHNA 3FQEA 4PDPA 3KK9A 2BDWA 4MK0A 4AZEA 4R77A 3NW7A 2V7AA 5AX3A 5M53A 3UOHA 5IKWA 3ZC5A 3GOPA 2XK9A 5B2MA 1TVOA 4MBIA 1M7QA 4KSQA 5K9IA 2WMVA 5IMEA 3KF7A 1ZAOA 3CCNA 4JIKA 3UVQA 2VX0A 3M42A 1OM1A 4FI1A 3OBJA 4LM5A 4YJRA 3EYGA 3C4WA 3FMEA 3ORNA 4IAZA 5AV2A 5FQDC 4E93A 5EM5A 3NSZA 3HMNA 4IJ9A 3DXNA 3LHJA 4K6ZA 2B9IA 1Q8UA 3PG3A 5CENA 3TNWA 5M44A 3IOPA 3O7LB 4U42A 3F69A 2YJSA 3QC9A 4CLIA 2J51A 3MIAA 3VS5A 3UO5A 5DG5A 3Q9WA 3VBTA 3QA8A 5AAEA 4GT5A 1PMEA 4NW6A 4BDJA 4BCKA 5HNBA 5LVMA 4FOCA 5A4QA 3ALOA 3M1SA 1MQBA 4ZSLA 1IRKA 3R1SA 3O2MA 4AA5A 3MFSA 4NK9A 4QYFA 3K54A 2BRGA 4PMMA 5AFVA 3L9NA 1L3RE 1PXJA 4FV1A 5HLNA 3ZH8A 1CM8A 2QO7A 3FLYA 4RIXA 4A9RA 3FE3A 1GY3A 4BCGA 5L8KA 4J71A 2UW0A 4V04A 4HVHA 4A7CA 3UIBA 4BCFA 2UZLA 1YWVA 4EJ7A 3OTVA 4XV9A 2UW3A 3OXTA 4IVCA 1CDKA 3DA6A 4JR3A 4XRJA 3ZZWA 4BHZA 3ENHA 4WIHA 4BI1A 2VTHA 2PHKA 5A4TA 3EZVA 2W0JA 2ITNA 4JDIA 4JRNA 2XNNA 4RIYA 2QOCA 3KGAA 4OTFA 4FTKA 1FMOE 4HYUA 5FEQA 3ATSA 5DOSA 1PKDA 4CEGA 2VAGA 4XV2A 3SKCA 1Q97A 3FWQA 4FICA 5BVKA 4WG5A 5K5NA 3PIZA 5LMBA 1Y91A 1XR1A 4QTCA 4GH2A 4K9YA 2J0LA 4OTGA 5E8SA 2ZMDA 4QYEA 5AV3A 5I9WA 2O5KA 4IZ7A 1OKYA 4F7JA 3T8OA 3WE4A 5ANOA 1A06A 3A4PA 2WELA 3OW4A 4G16A 4YNEA 4Z55A 4R78A 4O6EA 2REIA 4M3QA 4MBJA 4QMPA 3W2PA 3VAPA 3R2YA 5CAVA 3BE9A 1PXPA 2BHHA 4J98A 2I40A 2WOUA 1KV2A 4X2NA 5EI8A 3BU6A 2XIKA 4JAJA 3KVWA 3C4XA 2UUEA 1OL5A 4YLJA 4FGRA 4ASEA 3DU8A 3I4BA 4S2ZA 1REKA 3FYJX 4YSJA 4RIWB 4GS6A 1NT2A 4X0MA 2X8DA 4BDFA 2IN6A 4FT7A 2XK6A 4ONAA 4AT4A 4NWMA 4E4MA 2YFXA 4I5PA 4I6QA 4RFZA 3NVMB 3QFVA 1H25A 1SVGA 1MRYA 3DKOA 4YBJA 3DDQA 3ZTXA 4U9AA 3KEXA 4ANMA 2J9MA 4C4FA 2WTJA 4IB0A 4CFNA 1R78A 4ITJA 1JPAA 4GW8A 5M4CA 1Y6BA 3MV5A 1ERKA 3PYYA 4II5A 4FT5A 4F63A 3QCXA 4K0YA 3WF8A 4UX9A 3ATTA 4UWCA 2X7OA 4S31A 5IDPA 4AOIA 3VUHA 3ZFYA 4Z16A 3HRBA 1R0EA 3VRZA 4EZ3A 3RZFA 2RF9A 3AD6A 4DEEA 5CSPA 1OL2A 3PJ1A 3HX4A 3B2WA 4PF4A 4YUQA 4LRKA 1FOTA 2QC6A 2FSMX 2YCSA 3EOCA 3ODYX 5GHVA 3NNUA 2F57A 4FTQA 3U4WA 3GNIB 2FSLX 2XM8A 3MA3A 4FSNA 4W4WA 2XK7A 3L9PA 4RJ4A 1PJKA 4IBMA 2FUMA 4PPAA 2GMXA 1TQIA 4NM0A 5EOBA 2J0IA 2OKRA 4O2PA 4OTWA 5CSVA 2PK9A 3DBQA 2YLFA 1ZYCA 3A7JA 2HWPA 4IB5A 3TV4A 2WQNA 3MBLA 5C4LA 3NMUF 3F9NA 1QPJA 3S95A 2JBOA 4EOJA 3RK7A 2RG6A 2CPKE 2PVFA 3DBDA 4ZLZA 2OJIA 4W8DA 3V8TA 4FTMA 3R6XA 3ZRKA 3R8PA 2QKRA 5CAQA 3ORTA 3NLBA 3HMIA 3P1AA 3W18A 1REJA 3DGKA 4C4EA 4ZEGA 3CPCA 5GZ9A 1J7LA 3R7OA 2IZTA 5F94A 3OXIA 5BVEA 1VZOA 2OFVA 2QG5A 4ITIA 3UVPA 2X8EA 4FTOA 2F9GA 4EEVA 2GS2A 4N0SA 4QP1A 2PUPA 2GHMA 3EFWA 3GC9A 1OZ1A 4N4SA 2R3QA 3TZMA 3DV3A 1MQ4A 3V8WA 2XIYA 1W7HA 3ET7A 4GIHA 4WG3A 3V8SA 3A62A 5EKOA 3Q4CA 1UKHA 4DBNA 3GP0A 2J6MA 2FA2A 4HYHA 3CY3A 2W5HA 3KK8A 3UG1A 1RW8A 4RWIA 5ETCA 3UPZA 4D1XA 2O65A 4O7LA 1W83A 3QRUA 3D7ZA 4QMQA 4USFA 2KTYA 3LXNA 1SZMA 2WHBA 5EHOA 5HO8A 5ACBC 3UMXA 4BDGA 4F7NA 5L6OA 4R7BA 3L8SA 3COMA 5CZHA 5AP3A 3WI6A 2C0OA 2FSOX 2VTLA 3F82A 2PVMA 4JRVA 2JGZA 3NCZA 4IIRA 4M97A 1K3AA 1U59A 2W5AA 3UPXA 3E63A 2ZV7A 3MW1A 4I4EA 2SRCA 2ZV8A 5HD7A 3R7IA 2WD1A 3QQLA 3AC3A 3V6RA 5AP0A 1B39A 4AG8A 4DEHA 2QOQA 1H1WA 2HOGA 2EVAA 3C9WA 2HCKA 2YN8A 2HW7A 4MXCA 3RPOA 4XH6A 2XKCA 4JDKA 4OGRA 2UW9A 4XOZA 1OPJA 4BGGA 2VTNA 3ORMA 5HLPA 2XIXA 3HL7A 3IECA 3N9XA 5DFPA 3HNGA 5L2QA 5LVPA 3DLSA 5FRIA 3RAHA 3VJOA 5GJFA 3HA8A 2C6TA 2YHVA 2WMWA 3ZOSA 3MESA 4WNOA 2ITTA 3LOKA 2WXVA 4JS8A 2J0KA 5CF6A 2YM5A 2OXXA 4FNXA 4EQMA 3GQLA 4FSUA 5IEYA 4FNZA 3FEGA 1PMNA 4W9XA 4E8AA 2FVDA 2IZUA 4TRLA 3FV8A 5LVLA 5KKRC 4LOOA 3EZRA 3QD4A 4HYSA 4TXCA 2WTVA 4QT1A 3S00A 3R30A 1Y57A 4QP2A 3DNDA 4BCNA 5IA1A 5GNKA 3LM5A 4KBCA 5ANIA 2UW4A 4Q5EA 4QTAA 5KMMA 4Q9SA 4DG3E 3P7BA 4Y8DA 1APME 4A07A 3ZLYA 3GT8A 3PG1A 2R3PA 3D2IA 4W4XA 4XJ0A 1CKJA 4D9UA 4LRMA 5BMMA 3DY7A 4R1YA 1PMVA 4BCQA 1NVSA 2BAJA 3FXWA 4F70A 2OO8X 5E7RA 3HMPA 3EN9A 2RIOA 3R9NA 4DAWA 4BFMA 2VU3A 1IA9A 4H3QA 4HVSA 2V5QA 4O7SA 1A48A 1KUTA 1NXKA 4O7WA 3QGWA 4BC6A 5F1ZA 2JIVA 2PE2A 3II5A 2PMIA 5HOAA 2CGVA 3G9NA 4ENXA 4B6LA 5JQ5A 2ACXA 3OCBA 4TN6A 5BUJA 5CVFA 2I0EA 4G31A 3V01A 3BHUA 5KKRB 4IACA 4KBKA 2PMNX 3Q53A 3ZSGA 3I7BA 2BVAA 4BDCA 3HKOA 5AR3A 2BRNA 4UWYA 4BDIA 3LE6A 2Q0BA 3QTSA 5EM8A 4CXAA 4CKJA 3B8QA 3S4QA 3UP2A 4IAKA 3UOLA 4E20A 4IWDA 4IAFA 4BVUA 5M4UA 3PA4A 4YTHA 4EL9A 4F9AA 3OVVA 3FLSA 3I79A 2XRWA 3D7TA 5L3AA 1M7NA 4QRCA 3ULIA 1WBWA 1F0QA 4XBUA 3DKGA 3GB2A 2DYLA 5DT4A 3UC4A 4CKIA 2CKOA 4EBVA 4FEQA 2VV9A 4JL9A 4AZFA 3W8LA 1PXIA 4AA4A 5CSWA 4DFZE 4DBXA 4LV8A 4O7TA 4A9SA 4D55A 2BZIB 1UWHA 2GHLA 2JBPA 2ERZE 4L53A 2UZUE 5EFQA 3RCDA 3M11A 3AMAA 4A06A 1F5QA 4PL4A 4NL0A 4TYIA 5DEWA 2XF0A 3E87A 3OXZA 4W4YA 5T68A 3PIXA 3JVRA 4ZK5A 5I9UA 4D1ZA 4HW7A 4DN5A 3GFWA 5CF5A 4L67A 3QF9A 2VWZA 4AFJA 3CJFA 4JT3A 3KXGA 4ZTHA 4JNWA 3VN9A 5KZ0A 1U46A 4ZMEA 2FYSA 3QTUA 4ACMA 2JIUA 3MI9A 4DGOA 2B53A 5DVRA 3BCEA 5H8BA 2F7ZE 4FYNA 2PVHA 3UMWA 4C02A 1FGKA 2GNJA 5G6VA 5GZAA 4ZJIA 3SD0A 5HBHA 3FI8A 5EW9A 2GNGA 2EXEA 4DEGA 1YI4A 4FIIA 4RC3A 3T3UA 4B9DA 3Q4ZA 2OIBA 3NUPA 3Q96A 2C3LA 3DTWA 4YC6A 4F6UA 3PY3A 2PYWA 5CU6A 5IQEA 4GSBA 1GZOA 2VWWA 4Y83A 3F88A 4FG7A 5BUEA 2YDKA 3R1QA 4Q5HA 3WZDA 3HA6A 4P2KA 4R7HA 4DLJA 4FSMA 3D83A 5FP5A 2BILB 2C68A 4BKJA 4E5BA 5EI2A 3F66A 2H6DA 1DI8A 3OS3A 5L2SA 4YHJA 2ITOA 1WCCA 4L9IA 3KRWA 2XNGA 3ANQA 3RPVA 5L6PA 4YU2A 4ZLOA 4OLIA 1VR2A 2XRUA 4G6OA 5JFVA 3BLHA 3PRFA 1E1VA 1JSTA 1DAWA 2C69A 4JIAA 3LMGA 4FK6A 4BL1A 3DT1A 1M14A 3QTIA 5IA5A 4O22A 3KN5A 1OKWA 2A2AA 4BTFA 4RA4A 2RSVA 4WUNA 3BGZA 3LFSA 3SRVA 5C03A 3FC2A 3PTGA 3Q9YA 4FF8A 3BHTA 4XG2A 5IUIA 4C2WA 5I9VA 2XK8A 4DH8A 4L43A 3UIUA 3G90X 2O0UA 4IWQA 3QD0A 4WRGA 5AP1A 3H0YA 3JR1A 2XM9A 4Y5HA 2B7AA 4UMQA 2O64A 4NIFA 5AP2A 3VBXA 3RPYA 4LUEA 4BWKA 4ANLA 2B0QA 5AX9A 5IUHA 4GV1A 2XJ1A 4ZLYA 5IA4A 1PXKA 4MKCA 3LMHA 2CNVA 3RM6A 5I3RA 3LFBA 4PX6A 5DPVA 3TM0A 4BWXA 3FMDA 4ZS4A 3ZSHA 4L46A 3S2PA 3RINA 1M2PA 3R01A 5JMSA 2GQSA 4GRBA 3OP5A 2RL5A 2CN8A 3OCTA 5LWMA 2Z02A 5L6WL 1KV1A 1OIQA 4G5JA 4I94A 2VWUA 3CE3A 4HVDA 3WZJA 4QMSA 5AP5A 3FKLA 4LOQA 4ZSGA 4CTCA 2PVJA 3P4KA 4PP9A 4RX7A 3QRJA 4H3BA 4XG6A 3R9DA 4AE6A 2JAMA 3QD3A 5CVGA 5JEBA 2VO3A 5JZJA 5DE2A 1P4OA 4GUBA 4TW9A 1Q5KA 3A8WA 4O27B 2W4JA 4U0IA 1XBAA 2WMQA 2WMSA 4PMTA 3TKHA 4FE2A 5IQHA 2FSTX 3G9LX 2R3MA 4KIPA 3BLRA 4BWPA 3O96A 5I0BA 3EQFA 2HYYA 2O8YA 2YCFA 4FK3A 3K5UA 4XP0A 3QGYA 4AGUA 1IAJA 4YO6A 3WF7A 5BNJA 3MDYA 5HG8A 2W5BA 4O96A 4AGWA 5HCZA 2R0IA 3SOAA 4FA2A 5D12A 4JOAA 4DT9A 5GIOE 5CU4A 4LV5A 4NT4A 4RIWA 2WMTA 4ZSAA 2I0VA 4QPMA 3RI1A 4DLIA 2ZV2A 4X6QC 1Q4LA 4WBBB 2XIZA 1TQMA 2VWYA 4YZ9A 4ZTLA 3VUMA 2Y9QA 3DBFA 3PA3A 4GKHA 3FZOA 5DWRA 3PVGA 4IH8A 3KKVA 5FUTA 4AACA 3EJ1A 3TKUA 1UNLA 4NTTA 5AMNA 4RVLA 3JUHA 2HZ4A 3R71A 2HZNA 2B1PA 2UW5A 5EM6A 2VTJA 2YLEA 4I93A 4ACCA 5AAGA 2Y8OA 3HAMA 2R3HA 1OL1A 3QTXA 5E8WA 3FMKA 4RLKA 4DH5A 1VJYA 2B9HA 4LMUA 3UGCA 1KSWA 2WFYA 5JQ8A 1M2QA 3ZRMA 4O84A 2ETKA 1Q24A 4ERKA 2PU8A 2PVRA 1W82A 3O51A 3D2KA 2OG8A 3D9VA 4JBOA 3A7IA 4U40A 2RKUA 3LLAA 4D0WA 4XG9A 3ZLWA 4YJUA 4XHKB 5IQCA 1JWHA 2IZSA 4MXXA 3MB7A 5HE3A 1GZ8A 3C4CA 4ZTRA 2PY3A 5HQ0A 1VEBA 3GFEA 4L00A 4AZSA 4GU9A 4DYMA 5IU2A 3AD4A 4FIHA 4O0SA 1PXNA 4FKOA 4Z9LA 2XNOA 4CCBA 2B54A 5AJQA 2PVYA 4RX8A 4EBWA 4FKGA 3PPKA 4CSVA 2VZ6A 1Q61A 3BKBA 5AR2A 3BWFA 2BR1A 3CQWA 4I5MA 5JZNA 3WYXA 4ZZNA 1V1KA 4CYIA 1WVYA 4NFNA 3LFEA 4EC9A 1OL7A 2OSCA 5JFSA 3NRMA 5ETFA 1H1QA 2YWPA 4CNHA 3DZOA 3VRYA 2OK1A 3TCPA 2CKPA 1GIIA 1ZY5A 2XNMA 3DB6A 4PMPA 4XMOA 5JN2A 4FL2A 5KNJA 3IK3A 4NSTA 2R3JA 2QNJA 4PL3A 5ANGA 2XJ2A 4K18A 3FJQE 5FG8A 4RIOA 5L2IA 3MY5A 5M09A 3MH3A 2GTMA 2W17A 1BX6A 1XH7A 4OTDA 5A46A 1H8FA 3HV5A 3RAIA 4QMOA 5CZIA 3RK5A 2XBAA 2IZRA 1ZWSA 1CTPE 4D0XA 1J7UA 3QRKA 3TV7A 2XYNA 4O6LA 3LQ3A 4JJRA 4CGAA 2F7EE 3LVPA 3OG7A 3BPRA 5E8UA 4FSWA 4JAIA 4XG3A 1ZRZA 3SXRA 3HV4A 1ZMWA 3QQHA 5AM7A 3ZUTA 4DTBA 4IXPA 4K1BA 4WG4A 4F9BA 4WNKA 3GCVA 3MJ2A 3NR9A 3TDWA 5I3OA 3OCGA 2ZV9A 2DQ7X 3OD6X 2WQOA 5D41A 4G2FA 3MPAA 3QTQA 4I5HA 4X2KA 3O8TA 4GFGA 4IW0A 4OBPA 4RLLA 4GL9A 4UALA 1DI9A 4JBQA 3S1HA 2YM4A 3PP0A 3KB7A 5L2TA 4QPSA 3R7EA 3TACA 4TWNA 4I4FA 2XKFA 2XNBA 3A8XA 4RVKA 4FKPA 4UMPA 2XK3A 1Q8WA 4ZS0A 4KBAA 1JVPP 3R8ZA 1XH8A 5BX0A 3JS2A 4TY1A 1NVQA 2BIYA 4HZSA 3L9MA 4TYGA 5CNNA 3U9CA 2G2HA 3BYMA 3EL8A 3P9JA 5CU0A 2IW9A 3DFCB 3QXPA 4FEVA 3EB0A 5E91A 3BEGA 2QU6A 3ZDIA 2HZIA 3PXZA 3ZO2A 4AP7A 2VO6A 3RK9A 3R73A 5HVKA 2ZB0A 2BRMA 2CGXA 4FKJA 2OJFE 3FSKA 2NRUA 2F2UA 4FV2A 4FZ6A 4BDEA 3JY9A 3NUSA 3NW5A 4MNEA 3ZEWA 4A4LA 4RVMA 5EHLA 3FLNC 4O82A 4TYEA 4U43A 5FXRA 4QP8A 2IG7A 1OECA 3TG1A 1ZXEA 3MS9A 4FODA 4M8TA 4FSZA 3O71A 2X6DA 5DT0A 4DINA 5J1VA 2C0IA 3G6GA 3ENMA 2GU8A 3PXKA 4MYGA 4TKSA 4EUUA 4WBOA 1WZYA 4DC2A 4AS0A 4X2GA 5M51A 5G1XA 1HCLA 2ITPA 2R3GA 3NIZA 3F5PA 4M0ZA 4WNPA 4ZY6A 3FI4A 2R3NA 5HVYA 4O7YA 2J0JA 2V62A 1U4DA 4IVBA 3RMFA 3BGPA 5F95A 4C2VA 4N6ZA 2HW6A 4C4HA 4V0GB 3C1XA 3VS3A 4IAIA 3IW4A 2GSFA 2VTTA 3GEQA 2X7GA 3LQ5A 5AR8A 5H3QA 3KRLA 1YW2A 3MGYA 4USEA 4D1SA 3TJDA 4C3FA 3T9IA 5I9XA 4GK3A 4C4IA 1YXUA 3ZLSA 2PE1A 3VS0A 4DFBA 3D4QA 2AC3A 3MVLA 4YC3A 3E7OA 4M67A 5TO8A 2ZAZA 3UYSA 4J99A 5J5SA 3O8UA 5FWKK 3P08A 4RFMA 4KIKA 3ZU7A 4JI9A 3QYZA 5AP4A 3SX9A 2BAKA 5IEVA 2DUVA 4NJ3A 1L8TA 3E8CA 3FZSA 3KXNA 3W10A 2YIWA 2PVLA 3NAYA 3KXXA 1FINA 3NX8A 4ZTSA 5HO6A 2GQGA 3W2SA 4S30A 5DNRA 2GDOA 5IQAA 4LGHA 3VW6A 3LFFA 2EXCX 3DLZA 2XBJA 2W7XA 3EKKA 3ZC6A 5FDPA 1UNGA 3BYVA 3DBCA 5J79A 4DFLA 4FKTA 5M06A 4FG9A 3ZFMA 3SC1A 3F3TA 3LXLA 4L3LA 2CN5A 4N6YA 4BR3A 3DAJA 4OTIA 3K3IA 3Q9XA 4QYHA 3G5DA 4EK5A 3CTHA 4UZHA 4D5KA 2W1IA 3VC4A 4R5SA 3VUDA 2QO9A 3KCKA 4C33A 2JD5A 1UU9A 3GGFA 3M2WA 2EXMA 4IZAA 4RWJA 4LG4A 4MXAA 1PW2A 2GS7A 4FIGA 4IZYA 4C3RA 4DF3A 4Y85A 4EHVA 5CASA 4O7VA 4PDYA 2PUUA 3R21A 3C13A 4F1TA 3PP1A 4B8LA 2YDIA 4GEOA 5HBEA 5KO1A 3D0EA 3QTWA 4DE4A 4ALVA 3QX2A 3PDTA 4IDVA 4YBKA 3V5QA 2ERKA 4YTFA 3ZM4A 4QTDA 3CJGA 5JFWA 1URWA 1OVEA 1WBPA 5B2KA 2OIQA 3N4VA 3TXOA 4D2TA 4O7ZA 3QBNA 4O7NA 3KL8A 5DLSA 1JQHA 2E9UA 3R22A 4CMTA 4YLLA 4MVFA 1BL7A 3WZUA 2VO7A 3E8NA 2C3IB 4F64A 5AM6A 5HIDA 1OUYA 5DH3A 1K2PA 4YZCA 1WBTA 3AC4A 1SVEA 3NUAA 2UZVA 3A99A 5BUIA 2O63A 2PSQA 1U54A 3IW5A 3LMIA 2YACA 4HOKA 3GQIA 3T9TA 4EK8A 1BL6A 4MX9A 4BCOA 4ZY5A 1H0VA 2ZVAA 1P5EA 3PJ2A 5D10A 4RX5A 1OI9A 3B2TA 4FKRA 4O1OA 4BYIA 5L2WA 2XJ0A 2F7XE 2W1HA 3U6JA 3RJCA 2NPQA 3ORXA 3ZBFA 3C4FA 1GOLA 2YJRA 1GZKA 4CV9A 2C6LA 4KIOA 4KS7A 4AW0A 2BUJA 2ZM3A 5FEDA 2OH4A 3CP9A 1AGWA 4G3DA 4IM3A 1JNKA 5CEQA 5A9UA 5KHXA 3QKKA 4U79A 1UKIA 5J5TA 2J0MB 4BI0A 5LMKA 4FKIA 5HVJA 3FQSA 3NW6A 3QU0A 3TI1A 4J95A 3R8UA 4QOXA 3W16A 4EK6A 5DHJA 3O0GA 5CAPA 2LGCA 4FEXA 4YMJA 3OWJA 1YI6A 2ITVA 4FEWA 4WUAA 4C4JA 4OW8A 2A27A 1JLUE 1PY5A 5DEYA 3TTJA 4FVPA 3KULB 3IO7A 4P5ZA 3R7UA 3FMJA 3QYWA 5HIBA 3FZRA 3TN8A 4RVTA 4YJNA 4FR4A 1ZYSA 2J90A 4M69B 5D7AA 1IR3A 4AN2A 4EOQA 3I6UA 3S0OA 4TNDA 3QQUA 4L01A 3FXZA 4QNYA 4CLJA 1LEWA 2C6KA 4C38A 4CFWA 3HEGA 1B38A 4LRJA 3UNKA 3R83A 2BALA 5A54A 1WBVA 1W0XC 2R7IA 3Q52A 3VWAA 2OXYA 2OF4A 3I60A 5C01A 3ZXZA 1AD5A 4LL5A 4CFMA 5CQUA 2VTPA 4NUSA 2P3GX 4EWQA 4QP6A 4YURA 4ASXA 3U51A 4DITA 1B6CB 3LM0A 4G9CA 3UNZA 5LARA 3F7ZA 4AUAA 2X0GA 5EYCA 4ZAUA 4OR5A 4NCTA 4U97A 4NFMA 5KMKA 1JKKA 2W1ZA 3NZ0A 3WF5A 3BWJA 4O0XA 5HG9A 4BDDA 3CXWA 5IA3A 4WKQA 4AWIA 3NPCA 4RQKA 4ASZA 1QPCA 1YRPA 2PUNA 2VX1A 4FUXA 3ITZA 2ONLC 4TYHA 5AV0A 3POOA 4YO4A 3R9RA 5ANEA 2PL0A 3E8EA 3EQPA 4YZNA 3O17A 3FMNA 3HECA 4CFUA 3EFJA 1PKGA 3RKBA 5EQPA 1JKSA 3OEZA 2ZJWA 1SNUA 2P0CA 1YOJA 4LYNA 4O0VA 3DJ7A 4NM3A 2J7TA 1WBSA 5KMJA 3E3PA 5CEPA 5HZNA 4HVIA 4G3GA 5B7VA 4IC8A 3MY1A 3EQCA 3EQRA 4XP3A 2VGPA 2ESMA 4I22A 4XP2A 4EOMA 2ZDUA 5TT7A 4L7FA 4TTHB 2PTKA 4G3EA 3CY2A 1ZOGA 5CI7A 3QCYA 5K0KA 3Q5IA 1HCKA 4AZTA 3ELJA 5DRDA 4FIJA 4G3CA 5HHWA 4YC8A 2YWVA 1OMWA 2JAVA 3HZTA 3TWJA 3UC3A 3EFKA 2UVZA 5HIEA 1YOLA 2A0CX 2ITYA 2X4ZA 3RNYA 2J4ZA 3QHWA 4YSMA 2QONA 1XH6A 2ZMCA 5BVNA 5A4EA 4CV8A 3JY0A 4G3FA 5AADA 5D11A 4F0GA 4FV6A 3NNVA 4FGBA 4F9YA 5J7BA 5FDXA 4BZOA 1QL6A 1E1XA 2YITA 4F65A 3QCSA 2ITXA 4G34A 4BGQA 4UWBA 5DR9A 2V7OA 4AX8A 1WAKA 4QMTA 2BCJA 4EQUA 2RFEA 4EWHA 4ALUA 2G15A 1CSNA 3N4TA 3WYYA 1U5QA 4H1MA 2XA4A 3R1NA 4K8AA 1S9JA 3RPSA 2ZYBA 3AOXA 4PV0A 3QL8A 1OIYA 4BCIA 3HMOA 3R63A 4F9WA 2R3RA 2CSNA 1U5RA 2QOLA 5CU2A 4YLKA 2W05A 1AQ1A 4GU6A 4LUDA 4NU1A 4GT4A 4PDSA 3ZZEA 5DIAA 2W96B 5FLFA 1QMZA 5J87A 3QZHA 1PYXA 4BCHA 3I81A 1UV5A 3HYHA 3E93A 3Q6UA 2F4JA 2XUUA 3FLQA 3TZ8A 4BKZA 2X2KA 3PXRA 4G1WA 4FTUA 5EM7A 2X8IA 3SQQA 1LEZA 5HCYA 3HV7A 3VJNA 4GMYA 4C35A 3RCJA 4JBPA 5IQBA 5FP6A 4O86A 3UP7A 4FT0A 3UOKA 1OKZA 4YGAA 4O0RA 2XB7A 3ZLXA 4RRVA 3TKIA 2V55A 4MF0A 4U7ZA 1DM2A 1PRYA 4RBLA 4JX3A 4D2PA 4DGLC 5DMZA 4DEDA 4GVAA 4BIBA 3LCDA 3PZHA 2WTKC 2PZYA 5ITAA 2QOKA 4RJ3A 3R8MA 3I0QA 2JKQA 4DH7A 2PWLA 4AOJA 4U3ZA 5K5XA 2AC5A 4CZUA 3PSCA 4HYIA 3A60A 4YHTA 2QOFA 4UXLA 2E9PA 5A3XA 2QLUA 2G9XA 3G0FA 3MFTA 3QWJA 5FEEA 3MH2A 5HNGA 5KMIA 2PPQA 3W33A 4D5HA 3R8LA 1IAHA 3MH1A 4NH1A 3AQVA 1OPKA 4FUYA 3OUNB 1O6KA 1YWRA 2VTOA 1QPDA 1FVRA 4P4CA 2C3JA 4QO9A 4V05A 4ZSJA 4BRXA 4GYIA 3ZRLA 4D4VA 4L7SA 4AW2A 3BLQA 2VX3A 3OEFX 1YKRA 3V51A 3VIDA 2GPHA 3OY1A 4YJOA 4BDAA 1SMHA 2CGWA 5EDPA 3BYOA 4U81A 4C59A 2I7QA 4GJ3A 4H3PA 3LFAA 4HZRA 4CT1A 1Q99A 2WTKB 5CU3A 4E1ZA 3VVHA 3W1FA 4N57A 1F3MC 3GI3A 3UO4A 4FSQA 5JKGA 4D2WA 4U5JA 4F7LA 4GG5A 3OY3A 3VS6A 3TNHA 4EOPA 2Q83A 4GKIA 1IEPA 5CXHA 2E9NA 4BDKA 4LI5A 3FC1X 2YM7A 4D9TA 2UZDA 3BBTB 2WGJA 1GJOA 4QQJA 1OGUA 1JKLA 1RDQE 2R2PA 2VN9A 4DFYA 1MP8A 3EL7A 5DRBA 4ANQA 3JPVA 4FVQA 1J1CA 3BI6A 3LW0A 3CBLA 1BMKA 3HAVA 3ORZA 4GUEA 4R3CA 3AT3A 3P0MA 4D28A 3I1AA 2H96A 2JFLA 4H58A 4RJ7A 4RIXB 2FH9A 2C0TA 4YTCA 2Y6OA 3EQDA 1P2AA 1EH4A 3O23A 5LVOA 3MTLA 2XS0A 3KMUA 4MQ2A 4UMRA 4OT6A 3RHXA 5K4IA 2O2UA 4L68A 5D1JA 4A4XA 4EH2A 2BPMA 5CEKA 1ZARA 3UE4A 4EJNA 4C34A 3CSVA 3ROYA 5C8NA 2A4LA 5CTPA 2CLQA 3BV3A 3R9HA 3TTIA 4EYMA 2WTCA 4H05A 4B4LA 3PXQA 3FZ1A 4XG7A 5E8XA 4K77A 2R3FA 3EQBA 4RIYB 1ZYJA 2R9SA 4F99A 5D9HA 2R3KA 4ARKA 4D4RA 3VUKA 3KU2A 2CHLA 4GFOA 4X2JA 3IOKA 2X2LA 1K9AA 3G33A 4WNMA 2YZAA 4DH3A 2WIPA 3MB6A 4H1JA 2X39A 3ORLA 2C4GA 3T3VA 4E73A 2XKDA 1H1PA 5JGDA 3R7VA 3HGKA 3FQHA 4I21A 4BZDA 4MAOA 4IHPA 2BAQA 3EYHA 2NP8A 1YI3A 3I5NA 4FTTA 4QTEA 3EKNA 3K5VA 3FLZA 4BKYA 3FHIA 3C4EA 3PVWA 4M66A 4EH9A 1UU8A 4GYGA 3OMVA 4FBXA 4JVGA 4FV8A 1BI8A 5DGZA 1BUHA 2BMCA 2JKMA 3DFAA 3VNTA 5HTIA 3CTJA 5HU9A 3OCSA 4GG7A 3REPA 4MEDA 2IW8A 5FD2A 4DG2E 4PNKA 4IC7A 5IQDA 2CCHA 4J52A 5J95A 4F4PA 4HPUE 1O9UA 1RQQA 1ZMVA 1YHWA 3Q60A 4IX3A 4OTHA 3WF6A 2Z7SA 4E3CA 2VTMA 4RWKA 5ANDA 3KA0A 4KABA 4XG8A 3GBZA 4HGSA 4FZAB 4ZMFA 2AYPA 2E9OA 3GU7A 1M52A 1W84A 2G01A 3QUPA 5CT7A 4FTAA 3TZ9A 4BDHA 3U6IA 3VBWA 1Y8GA 3BHVA 3UQFA 2CLXA 2PUIA 4IVAA 3V5PA 4J97A 4ANBA 2A19B 5KE0A 2BDJA 2C47A 2P33A 5BYZA 2C1BA 5JH6A 3C5IA 2GNFA 3DJ6A 3FPQA 5IA2A 2OJGA 3EQGA 1Y6AA 3EFLA 3NYXA 4ERWA 3K3JA 1PYEA 2PZIA 2OZOA 1TQPA 2H34A 5F9EA 2UZNA 2YEXA 3TNPC 3ZO1A 1ND4A 3NUYA 3FMMA 1V0OA 3IQ7A 2XEYA 3QWKA 3CKWA 4PTCA 2DWBA 1JSVA 1H00A 3OF0A 1YHSA 4J7BA 3MVJA 4RMZA 4P7EA 4MF1A 1YQJA 2VTRA 3G51A 3QLGA 2GQRA 3D94A 5CANA 5ANJA 2HWOA 4P5QA 5HD4A 4FV0A 4FZDB 5H8EA 4B8MA 2IWIA 3KMWA 4E4NA 4HGTA 3ULZA 3WIGA 1PXLA 3L1SA 5CT0A 3A7FA 3ODZX 3UVRA 5HESA 5CAUA 3BEAA 3Q04A 4RG0A 5DBXA 3ZHPC 5EYDA 2R3OA 1JAMA 5HO7A 4BBEA 3CLYA 3FL5A 1ZZLA 4R3RA 4X3JA 5HX6A 1O6LA 1Q3DA 2XP2A 3I5ZA 2A1AB 4H36A 4K33A 5CWZA 4CRLA 4O0YA 2X1NA 3FSFA 4EHGA 2P4IA 1IA8A 3SXFA 2J2IB 2OJ9A 2W9FB 2YIYA 3PVBA 4TWPA 5BVDA 4ANSA 4CTBA 4BCMA 5K4JA 4YZBA 3GCSA 4RJ8A 4YJSA 3W2QA 3CQUA 2PVNA 4GK2A 4WT6A 4D4YA 1TKIA 2OZAB 5I9ZA 2C6IA 2Y0AA 2WOTA 4FL1A 1JBPE 3AXWA 1XO2B 3W8QA 2B4SB 4F09A 3QRTA 3DQWA 4J1RA 3KC3A 1LP4A 4MD9E 5EDRA 3NYNA 5L4QA 3CPBA 3ZFXA 3V3VA 1FMKA 3WZEA 3AGLA 1G3NA 2UW6A 4DT8A 2Z7LA 4XV1A 2C5XA 2X4FA 1P14A 2QOHA 4KKHA 4BBFA 3BBWA 4FIFA 2RFNA 3RVGA 4X3FC 2WIHA 5HE0A 2QURA 4F08A 5GIPE 4QTBA 3V5WA 4EOKA 5J1WA 5FGKA 2QKWB 5AR5A 3KRRA 4OUCA 4L3JA 3QRIA 4UV0A 4D2SA 3SV0A 3D14A 4E26A 4L6QA 3DK7A 2R3LA 2P55A 3V5LA 4ANNA 3MPMA 5CAOA 2JIIA 3DKFA 3FUPA 4CFVA 1NY3A 2OICA 5HE1A 3VBQA 3ACKA 2JITA 4JDHA 1GZNA 3R2BA 4H39A 3QXOA 4PMSA 4YJTA 5ETIA 5C27A 4XS2A 3KXMA 5EG3A 1MRUA 3C0GA 4M14A 1VYWA 3IDCA 1FVVA 4AW5A 4XYFA 2WMXA 5AUWA 2XIRA 5LVNA 4GT3A 2RFSA 2J5FA 4TPTA 1Q8TA 4A4OA 4BDBA 5AUTA 3OWKA 3W32A 5CEMA 4FOBA 3QQFA 1WVXA 4X3FB 3NUUA 4NEUA 3RNIA 1LUFA 3MJ1A 3KN6A 4Q9ZA 5I5ZA 3DKCA 2IW6A 2PE0A 5LCJA 2W1CA 3QQGA 3OROA 3F61A 4I3ZA 4F0IA 3UG2A 5EDQA 4QP9A 2XYUA 4ALWA 5CALA 3P7AA 3FLWA 4GVJA 4XLVA 5EHYA 3BRBA 4DH1A 4PPCA 3VUIA 5TE0A 4E7WA 3EN7A 3MTFA 3PPZA 4LL0A 2YDJA 4C37A 2O3PA 2XCKA 3R8VA 4QYGA 5HORA 1Y8YA 4LGDA 5C8KA 2QLQA 4U3YA 4W8EA 3OT3A 2QCSA 3NVKI 4EC8A 3NNWA 3PWYA 3TV6A 4EZ5A 3QZFA 4AE9A 3F7WA 2X81A 4C7TA 4B0GA 4Z7HA 1J3HA 3LJ0A 2BRHA 1O6YA 2GCDA 3L8PA 5EI6A 2PMLX 3A61A 3D15A 4HGLA 4JX7A 4FKUA 3R7GA 4YZMA 2QO2A 4JG7A 3UIMA 1YOMA 2CKQA 4OT5A 2WTDA 5AR7A 4G5PA 3VUGA 2C6EA 4KA3A 3PWDA 4KNBA 5KZIA 3AT4A 4FIEA 2ZM4A 2BFYA 3TL8A 2XH5A 4EKLA 4QMZA 3UOJA 5AIRA 1KWPA 2YM6A 3QUDA 3D7TB 5FXQA 4IQ6A 2W99B 4UYAA 4MWIA 3ZMMA 1VYZA 3G0EA 4QNAA 4EUTA 4EH6A 2NNWB 2BIKB 4EYJA 2C6OA 5E8VA 5TOZA 4YP8A 5HU3A 2HAKA 2W1FA 4UYNA 4C61A 4PWNA 4JQ8A 4JG6A 3SG8A 3IKAA 3WF9A 5M07A 2WO6A 4MHAA 4BCJA 4RZVA 2Y4IC 1URCA 3LJ1A 3BZ3A 2BRBA 5BVWA 2X2MA 2G1TA 4UBAA 4ZJVA 4JBVA 4WSYA 2UW7A 5GJGA 4BYJA 2C6DA 3Q4UA 3HVCA 2OIDA 4LGGA 3VS7A 3ZUUA 4BGHA 4C36A 2HIWA 3DPKA 3CR0A 1YDSE 2GS6A 3ZXTA 4DGMA 4BTKA 5GINE 4KS8A 5FBOA 4M0YA 5HE2A 3P86A 2OXDA 3NUNA 2VD5A 2XKEA 4DHFA 4ZZOA 3SXSA 3AD5A 1UNHA 3LAUA 4PTGA 4DFNA 4G6NA 5AA8A 3IW8A 2YCQA 3BU5A 2R5TA 4UY9A 4X7QA 4XNEA 3BE2A 2QG7A 4E5AX 5EYMA 5EQEA 2GFCA 4EKKA 2RGPA 4NKAA 5TF9A 2JDOA 4FMQA 4QP7A 5J9ZA 3POZA 3QX4A 2Y4IB 5DN3A 4OTQA 3KRJA 2PULA 2CCIA 3HRFA 3BHHA 3QC4A 3R02A 5DR2A 3DXQA 2R0UA 3FMHA 2WQBA 1UWJA 5C8MA 4D2VA 4C4GA 1XWSA 1H08A 2EB3A 2VTAA 3DS6A 3VS2A 3WILA 1H4LA 3PVUA 5LOHA 2E9VA 3PA5A 3UZPA 4NJDA 3NGAA 3UYTA 3P79A 4BHNA 3IG7A 3MH0A 4FKWA 5H8GA 4G9RA 2JDTA 1XH4A 2UZBA 4O0TA 3Q5ZA 3DK3A 3H9OA 4RC2A 4O0UA 2UVYA 4BCPA 1H27A 3LIJA 4M84A 4XV3A 4BTJA 1YXXA 3GCQA 3OHTA 2C5OA 4DGNA 5CF4A 3DOGA 1S9IA 2W1DA 4U41A 3SRVB 3FY2A 5BVFA 3B8RA 3Q2MA 4BICA 4OTRA 4XEYA 5CYIA 5A14A 5J7HA 5C26A 3ZO3A 2B9JA 4ACGA 4AQCA 5ANKA 4F0FA 1OITA 2W9ZB 3LCSA 5DA3A 3FY0A 3QHRA 4ZIMA 4U8ZA 3PE2A 4UMTA 4YPDA 3RHKA 3A7HA 3ETAA 4ANOA 3FKOA 3K2LA 4NIFB 4XUFA 5AA9A 3ANRA 5ACKA 4FVRA 4C57A 1FGIA 2QR8A 2RG5A 4TT7A 1IASA 1G8SA 5AP7A 4CYJA 4BY9E 3G15A 3FI3A 1ZZ2A 2Y6MA 1R0PA 4HPTE 4EH3A 4QMXA 3F3WA 4FTLA 2I1MA 3DB8A 4CQGA 3WZKA 3NIEA
chains in the Genus database with same CATH superfamily
4AT5A 3DTCA 3DAKA 4QMLA 3Q6WA 4EOLA 3QZGA 4RGJA 4D4SA 4FX3A 3LCKA 4IANA 1LR4A 2Y7JA 4QYYA 1HOWA 3BQRA 4TZRA 5IG1A 4FT3A 3ID6C 3NUXA 5M08A 2XNEA 3ORPA 4RWLA 3ZM9A 1FVTA 3RZBA 4RPVA 2QHMA 5CNOA 3UTOA 5JK3A 2ITUA 4JDJA 4KWPA 2UZEA 2KULA 3TUCA 1XH9A 3CC6A 4ZZMA 4YR8A 4PDOA 2BTRA 4MBLA 5AAFA 3SG9A 1X8BA 3KIOC 3NYVA 4NW5A 2XK4A 3SAYA 3GXLA 2FO0A 2OU7A 1YWNA 3CGOA 4O21A 5LQFA 4M68A 5E90A 4XRLA 2Z2WA 3AT2A 3DK6A 2W4OA 3O50A 3KF4A 5DYJA 4DCAA 2WU6A 3HDMA 2VGOA 5E8TA 5ICPA 3CEKA 3UIXA 3OOMA 4K11A 2CJMA 4IAAA 2GNLA 5EH0A 4FYOA 3DAEA 4OTPA 1SM2A 3TEIA 4M15A 3EH9A 3AMBA 5HEZA 5FM3A 4I6HA 3BYSA 4Q2AA 5L8LA 2F49A 5IH5A 1T46A 1H24A 2BKZA 4IMYA 4MNFA 4TWOA 4AOTA 4CCUA 5IPJA 5JGAA 4P90A 3KREA 5HBJA 4Y73A 2X6EA 1FPUA 3E64A 1H1SA 3P5KA 5JT2A 3DXPA 4U80A 4MCVA 3OW3A 5KBQA 1OUKA 3U8WA 3KQ7A 3LFDA 4E4LA 2QI8A 3LFQA 1Q41A 2H9VA 2YIXA 3CQEA 4MXOA 4KKGA 5AV1A 3ZUVA 4FKSA 3E3BX 4J8NA 5BV3A 1Q8YA 2BZKB 3AMYA 1OB3A 4JXFA 4XX9A 5A4CA 3PLAE 1DS5A 4EK3A 3OT8A 2WAJA 5CLPA 5BYLA 3U54A 4J53A 5IA0A 5JGBA 5J9YA 2X0QA 2ITZA 2J5EA 3QQKA 4QMMA 5AV4A 4K2RA 4UB7A 3MN3A 2JEDA 4IDTA 4RX9A 4YTIA 2GNIA 4FT9A 5F20A 5LCKA 3OC1A 3VHKA 5HCXA 4MTAA 4O38A 3AC2A 4I20A 4BF2A 2UZTA 5I9YA 1XH5A 3MFRA 3VF8A 4E6CA 2ZM1A 4OAVB 3QTRA 4L52A 2GTNA 5M55A 3TT0A 2ZOQA 4ZJJA 4GJ2A 4MWHA 4S32A 4Y5QA 4CFXA 4UMUA 3Q4TA 4WSQA 1YXTA 4PL5A 3VF9A 3HP2A 1XBCA 3ALNA 2WEIA 3G2FA 2YABA 3G6HA 4IADA 3LCTA 4QPAA 4TNBA 4AN3A 3SLSA 3BV2A 5LWNA 4CG9A 1V0BA 3U9NA 4U44A 2G2IA 3VQUA 4C8BA 4CRSA 2YISA 3KFAA 5KMNA 3N4UA 2R3IA 3PUPA 5H2UA 2QOOA 3H0ZA 3LQ8A 5JRSA 5IQFA 5JFXA 3O7LD 2W4KA 1XKKA 1GNGA 2Z60A 3D5UA 4QMUA 2ETRA 2NO3A 2WQEA 3FPMA 4JMQA 5L8JA 3VQHA 2Z7RA 4LOPA 2OZAA 3L8XA 4UEUA 1OIUA 4EQCA 3R7YA 3PJ3A 2WMAA 3ZONA 3UODA 3PPJA 3H10A 2ITQA 1ATPE 4YZDA 5A4LA 1ZMUA 3I7CA 5EOLA 2VTQA 3C5UA 3AG9A 3COIA 4Y72A 4C58A 1YDRE 3H9RA 1R3CA 2C5YA 1KOBA 4I1ZA 3BHYA 3ROCA 1ZOEA 1IG1A 5CF8A 4CKRA 4IB1A 3F3ZA 4S34A 4MH7A 5CI6A 3EQHA 2BTSA 2GHGA 3QD2B 1WBNA 3FYKX 3MWUA 4HCTA 5A6OA 4JLCA 2PMOX 2VWBA 3UZRA 4AXAA 3OWPA 4E6DA 5BYYA 3VUTA 2VTSA 2JFMA 5EQYA 2C5VA 3COKA 3KXHA 4YNOA 1OBDA 3LJ2A 4O1PA 3V5TA 5A6NA 1PF8A 3FI2A 4EOSA 3PXFA 3TUDA 1STCE 1UVRA 4EH5A 4PTEA 2XNPA 3MFUA 4FZFB 3RTPA 4F78A 3C4ZA 2EB2A 2PZRA 3ORKA 5E8YA 4J96A 4EK4A 4BIEA 5IH4A 3RPRA 3FBVA 4L44A 5AUXA 4GIIA 4FZ7A 3F3UA 5FXSA 3SOCA 5KUPA 1JSUA 3QQJA 3R28A 5J8IA 4CVAA 1R39A 2VUWA 5AUUA 2OWBA 5CX9A 4DDGA 2EWAA 4R1VA 2QR7A 4D58A 2V22A 4C62A 2WTIA 4QMNA 2JDRA 1Q62A 4FV7A 4YJVA 3SGCA 1Q3WA 3F5XA 3GCUA 3GC0A 4MD7E 5M57A 4IVDA 5K3YA 3BGQA 4L3PA 3QTZA 4PNIA 2VWIA 2WMUA 2IEWA 4L42A 3EN5A 3GU6A 4IFCA 3P7CA 4X3FA 4ZOGA 4ZTMA 5KCVA 3DDPA 3D5WA 3IGGA 4IX5A 4MNEB 4E6QA 1QCFA 4LQMA 5CQWA 3JYAA 1CKIA 1MRVA 4R7IA 3V6SA 3U6HA 3QKLA 5DR6A 4AT3A 2BKKA 3IGOA 2BZJA 3D5XA 4O91A 3PFYA 1RE8A 4U6RA 4KRDA 4AAYA 2YIQA 4HCVA 1ZYLA 3COHA 1YHVA 2YAAA 4F7SA 5CSHA 3LCOA 5EKNA 4APCA 1G8AA 4FKLA 3E7VA 2WB8A 2Z7QA 3HLLA 3NAXA 2PVKA 3Q32A 4G17A 3RAKA 2HXLA 3HP5A 1KE5A 1W98A 3OZ6A 4DHIB 4OBQA 4USDA 4B7TA 4CT2A 3GCPA 3KVXA 4I92A 4A9YA 5AIKA 3R00A 3FHRA 5HG5A 1Z5MA 5HX8A 3RBWA 3UJGA 3L8VA 1T45A 2P2HA 3DNEA 3IS5A 3RAWA 3TMOA 3RWPA 3MPTA 4C3PA 3FDNA 2YZLA 2QOBA 3PJCA 3UZTA 4RJ6A 1LPUA 1SYKA 5JRQA 5AR4A 2OW3A 5IISA 2XAMA 5C4KA 3EIDA 4MXYA 5EK7A 2CDZA 1UU7A 5AUVA 3DCVA 2QD9A 3PIYA 4BN1A 3ZS5A 4DEBA 3LLTA 3RGFA 5KMLA 3UNJA 4FG8A 4KIKB 3CD8A 5AUZA 4WHZA 1I44A 2WMRA 2VNYA 3PLSA 3QAME 3MYGA 3PE1A 4IZ5A 5LJJA 2H8HA 4HJOA 2CKEA 4M13A 5E1SA 4XOYA 5EYKA 2IPXA 2PZ5A 2VWVA 3F3VA 4XLIA 4O83A 3A7GA 3UDBA 4ENYA 5EW8A 3CD3A 4ZP5A 1ZYDA 2V0DA 4HVGA 3UO6A 2X9EA 3TDVA 3U55A 3IDPA 4HNIA 1GIJA 2W06A 5M56A 1KOAA 3Q9ZA 3ZEPA 3PJ8A 4V0GA 3RM7A 2QU5A 4WA9A 3GU8A 4FV3A 1KE9A 4ZTQA 1OPLA 4HNFA 4UN0C 5CSXA 4EH8A 5I4NA 2CNUA 5F4NA 3GU4A 5E8ZA 3GC8A 3AC1A 4EHEA 2X9FA 4X2FA 1M2RA 3H3CA 3HDNA 4Y95A 5IQIA 4WOVA 4E5WA 4MD8E 3EN4A 5M4IA 2QVSE 3TJCA 5DT3A 2QOIA 2BROA 1Z9XA 1I09A 3NYOA 3KCFA 3LZBA 5HG7A 3R9OA 4I41A 1W8CA 4FV4A 4NM5A 3KY2A 3V5JA 2JLDA 2YERA 4I0SA 4ZTNA 3NEWA 2UW8A 3C0HA 4CQEA 3H30A 1TZDA 3OBGA 4YJQA 3AC5A 3RP9A 4FKQA 2IVTA 2OJJA 1P4FA 3PXYA 3PZEA 1CKPA 4XG4A 3PSDA 4MXZA 1XBBA 3MIYA 3OFMA 3NNXA 2JDVA 4AW1A 5CEOA 3HUBA 3ZDUA 4GCJA 2WZJA 4ID7A 5HICA 1OKVA 1YXVA 2WU7A 1XJDA 2CMWA 1SNXA 3GVUA 5AP6A 3VW8A 1A9UA 3I6WA 4QQCA 4E4XA 3EHAA 5LMKC 4IWOA 3QLFA 3HRCA 2BHEA 1BKXA 2GNHA 4U45A 3TNQB 4TL0A 3F5UA 3SHEA 3TIYA 4DTKA 4AGDA 4F6WA 2B9FA 2EU9A 2YM8A 1H28A 4AGCA 4KSPA 1U54B 4IJPA 3W2OA 1SVHA 3W2CA 3ZYAA 3SW7A 1E9HA 4YHFA 2YIRA 2CGUA 4J8MA 1KE7A 4EONA 2R7BA 4CZTA 3C51A 3NS9A 3WE8A 4CFFA 4IFGA 5KHWA 2J50A 3TNIA 4ORKA 3IPHA 3MA6A 3PFQA 4PPBA 2HXQA 2JKKA 4WD5A 4ACHA 4AZVA 4AQKA 5IEXA 4WRSA 5ETAA 4L45A 2E2BA 1JKTA 4A9UA 2UZOA 4XBRA 4M12A 3DJ5A 4TYJA 5DI1A 3DQXA 3LPBA 4S33A 1YVJA 4EH7A 2VRXA 4FSTA 4LFIA 5EW3A 4F9CA 4W4VA 2OFUA 4EI4A 2B55A 3A2CA 3PY1A 4M7IA 4I6BA 4NZWB 5IH6A 2HZ0A 3HV3A 3AGMA 4R8QA 3WARA 3WBLA 2OI4X 4NCTC 4R6VA 3TIZA 2XZSA 4KINA 4WO5A 4PY1A 4X21A 3FXXA 4R5YA 4UXQA 4BIDA 4DFXE 4KKEA 5LXMA 5IF1A 1Q8ZA 4FL3A 3BU3A 2Y4PA 4EZ7A 5BVOA 4BBMA 4DGGA 4FC0A 4FNYA 4KB8A 4CZYB 4AA0A 2XMYA 2QODA 5FTQA 3DBEA 3RWQA 2GFSA 3U4UA 4NKSA 3WIKA 3ZSIA 4AF3A 5GJDA 2WKMA 3VO3A 4RT7A 5KMOA 4QP3A 3JVSA 4O2ZA 4GFMA 4BB4A 3OTUA 4EHZA 1FQ1B 2ZB1A 3QALE 2BFXA 3CKXA 3KXZA 3CTQA 5CY3A 3LXPA 5FTGA 5E4HA 5FBNC 4ACDA 3ZO4A 4I6FA 3SDJA 2YAKA 3CS9A 3ORIA 3QA0A 1YXSA 3BELA 3PUFC 4IE9A 3ERKA 3E62A 5CVHA 4Z7GA 4DFUA 4RA5A 3MVMA 3E8DA 3WOWA 3A4OX 3GU5A 3AC8A 3ACJA 4HGEA 4C0TA 4O0WA 2YM3A 2C1AA 3F5GA 4FTJA 2R4BA 4QMVA 1OBGA 2OH0E 4FTCA 2FB8A 1OL6A 4PP7A 1ZLTA 1H1RA 1ZY4A 1XHAA 4QMYA 4TYHB 3E5AA 5LMAA 2B52A 1MUOA 3I0OA 4QD6A 2R64A 2PZPA 4F1OA 3NWWA 2UVXA 2WPAA 2XVDA 4KRCA 3TZ7A 4X6RA 4QP4A 4YPSA 2EUFB 2ITWA 3R0TA 4I23A 4N70A 4TWCA 2HY0A 1RJBA 4QQ5A 3GUBA 3KULA 3GC7A 2VWXA 4OBOA 4NYEA 1TFFA 4FV5A 4DTAA 3H4JA 4EH4A 3IDBA 4M69A 3EMGA 5IQGA 1KE6A 3W0NA 3CGFA 3H9FA 5T6KA 2OGVA 1WVWA 4IX6A 3F2AA 2JKOA 3HUCA 2HENA 5BMSA 3FZPA 3R04A 3UQGA 1ST0A 2IVSA 2CNQA 3LKMA 5KBRA 1WFCA 3W55A 3L9LA 3FMLA 3MY0A 3QCQA 5HTBA 5TKDA 3O8PA 3KRXA 4ZSEA 5IMXA 4AAAA 3C50A 4EORA 4JQ7A 5CEIA 1WBOA 5FTOA 1QPEA 4I0RA 3EQIA 4EOOA 2OBJA 4F6SA 4W9WA 3VHEA 3OUKA 5B0XA 4DEAA 2C30A 2G2FA 1H01A 4QMWA 1NW1A 4ASDA 3QZIA 2F2CB 4FTIA 4CMOA 1DAYA 2VNWA 3VBVA 4AU8A 5GZ8A 3C0IA 1BI7A 3NCGA 3SW4A 1BLXA 3JXWA 2IO6A 2XCHA 2WQMA 1J1BA 1GAGA 1YDTE 2X0PA 3BYUA 4A9TA 2VTIA 4Z3VA 5C9CA 5IDNA 1H26A 3IW7A 3ZCLA 4QDEA 2I0YA 4ITHA 2W1GA 4FV9A 4MQ1A 1FBNA 2Z8CA 3HMMA 4KIQA 3FAAA 1BYGA 3MSSA 5BQ0A 2QQ7A 2UZWE 3E88A 4FSYA 5E9EA 4RQVA 2NRYA 1PXOA 1H0WA 2C6MA 4EOIA 2YCRA 2LAVA 5T3QA 4G6LA 2C5NA 3D5VA 2YA9A 4KD1A 5IUGA 3NFGB 1UA2A 2VO0A 2P2IA 4L8MA 2RFDA 5HNIX 1CMKE 3FKNA 4FEUA 3C7QA 4IM2A 4XCUA 3MVHA 4RZWA 5AEPA 5K0XA 4IM0A 4UZDA 3W2RA 5D7VA 1J91A 4QQTA 4R3PA 2XEZA 3DZQA 4OAUC 3P23A 4FKVA 2ONLA 5HTCA 4I24A 5H9BA 5IZFA 4DA5A 3EWHA 3FZTA 3KMMA 2IVVA 2C3KA 3BX5A 2HELA 4IB3A 4JQEA 4NM7A 3BQCA 4KUJA 3FL4A 4FTNA 4GK4A 4RFYA 1ZOHA 2WTWA 4FRFA 3SVVA 2Q0NA 3V04A 5FM2A 1NVRA 4BZNA 1R1WA 4FTRA 4FNWA 4I5CA 3EN6A 5E1EA 4E6AA 1NA7A 4CD0A 5AUYA 1WMKA 4PRJA 2BDFA 2IVUA 5KX8A 4KAOA 3RALA 5HLWA 1M17A 4F1MA 5E92A 5HGIA 5TR6A 4AZWA 3F2NA 3ZBXA 4HCUA 3VULA 4PQNA 4V01A 2UV2A 4IEBA 1XQZA 2JC6A 3TUBA 1OIRA 2OF2A 2HK5A 1UU3A 3QKMA 4JR7A 2WEVA 3U87A 5C1QB 2W1EA 4ZXTA 4FSRA 4BTMA 3GOKA 3F2RA 4RSSA 4LMNA 5B2LA 2FGIA 3OOGA 4IX4A 4DEIA 3BIZA 4YJPA 1PHKA 3F6XA 1V0PA 2OLCA 3N51A 1Z57A 1J7IA 5CS6A 3VBYA 3CIKA 4B99A 3UQCA 4RJ5A 3UBDA 2AUHA 3THBA 5BPYA 2JDSA 3P78A 1JOWB 3LFCA 3VS1A 1G5SA 1PMUA 2ETMA 3Q3BA 4Y46A 4BI2A 4NTSA 1GIHA 3QUEA 3R1YA 4AFEA 2I6LA 5M4FA 4D2RA 3PRIA 4PUZA 2DS1A 1H07A 3BLAA 2IJMA 3HV6A 3IONA 4I0TA 3VS4A 4RC4A 5HKMA 3GENA 2I0HA 2X7FA 3LXKA 3PY0A 4JG8A 4DCEA 5JSMA 3E92A 1KE8A 4O81A 3SA0A 3LFNA 3Q2JA 1PXMA 5CXZA 4O7RA 5HI2A 3PSBA 4DG0E 5AWMA 2ZDTA 4AN9A 2HY81 4CMUA 2AQXA 2WNTA 2WMBA 3IW6A 3S3IA 2BZHB 4ZY4A 4APPA 4IAYA 4CG8A 3NDMA 3OWLA 5J9LA 4IWPA 2QHNA 3FQEA 4PDPA 3KK9A 2BDWA 4MK0A 4AZEA 4R77A 3NW7A 2V7AA 5AX3A 5M53A 3UOHA 5IKWA 3ZC5A 3GOPA 2XK9A 5B2MA 1TVOA 4MBIA 1M7QA 4KSQA 5K9IA 2WMVA 5IMEA 3KF7A 1ZAOA 3CCNA 4JIKA 3UVQA 2VX0A 3M42A 1OM1A 4FI1A 3OBJA 4LM5A 4YJRA 3EYGA 3C4WA 3FMEA 3ORNA 4IAZA 5AV2A 5FQDC 4E93A 5EM5A 3NSZA 3HMNA 4IJ9A 3DXNA 3LHJA 4K6ZA 2B9IA 1Q8UA 3PG3A 5CENA 3TNWA 5M44A 3IOPA 3O7LB 4U42A 4DDIA 3F69A 2YJSA 3QC9A 4CLIA 2J51A 3MIAA 3VS5A 3UO5A 5DG5A 3Q9WA 3VBTA 2XARA 3QA8A 5AAEA 4GT5A 1PMEA 4NW6A 4BDJA 4BCKA 5HNBA 5LVMA 4FOCA 5A4QA 3ALOA 3M1SA 1MQBA 4ZSLA 1IRKA 3R1SA 3O2MA 4AA5A 3MFSA 4NK9A 4QYFA 3K54A 2BRGA 4PMMA 5AFVA 3L9NA 1L3RE 1PXJA 4FV1A 5HLNA 4DHJA 3ZH8A 1CM8A 2QO7A 3FLYA 4RIXA 4A9RA 3FE3A 1GY3A 4BCGA 5L8KA 4J71A 2UW0A 4V04A 4HVHA 4A7CA 3UIBA 4BCFA 2UZLA 1YWVA 4EJ7A 3OTVA 4XV9A 2UW3A 3OXTA 4IVCA 1CDKA 3DA6A 4JR3A 4XRJA 3ZZWA 4BHZA 3W0OA 3ENHA 4WIHA 4BI1A 2VTHA 2PHKA 5A4TA 3EZVA 2W0JA 2ITNA 4JDIA 4JRNA 2XNNA 4RIYA 2QOCA 3KGAA 4OTFA 4FTKA 1FMOE 4HYUA 5FEQA 3ATSA 5DOSA 1PKDA 4CEGA 2VAGA 4XV2A 3SKCA 1Q97A 3FWQA 4FICA 5BVKA 4WG5A 5K5NA 3PIZA 5LMBA 1Y91A 1XR1A 4QTCA 4GH2A 4K9YA 2J0LA 4OTGA 5E8SA 2ZMDA 4QYEA 5AV3A 5I9WA 2O5KA 4IZ7A 1OKYA 4F7JA 3T8OA 3WE4A 5ANOA 1A06A 3A4PA 2WELA 3OW4A 4G16A 4YNEA 4Z55A 4R78A 4O6EA 2REIA 4M3QA 4MBJA 4QMPA 3W2PA 3VAPA 3R2YA 5CAVA 3BE9A 1PXPA 2BHHA 4J98A 2I40A 2WOUA 1KV2A 4X2NA 5EI8A 3BU6A 2XIKA 4JAJA 3KVWA 3C4XA 2UUEA 1OL5A 4YLJA 4FGRA 4ASEA 3DU8A 3I4BA 4S2ZA 1REKA 3FYJX 4YSJA 4RIWB 4GS6A 1NT2A 4X0MA 2X8DA 4BDFA 2IN6A 4FT7A 2XK6A 4ONAA 4AT4A 4NWMA 4E4MA 2YFXA 4I5PA 4I6QA 4RFZA 3NVMB 3QFVA 1H25A 1SVGA 1MRYA 3DKOA 4YBJA 3DDQA 3ZTXA 4U9AA 3KEXA 4ANMA 2J9MA 4C4FA 2WTJA 4IB0A 4CFNA 1R78A 4ITJA 1JPAA 4GW8A 5M4CA 1Y6BA 3MV5A 4MUQA 1ERKA 2XAOA 3PYYA 4II5A 4FT5A 4F63A 3QCXA 4K0YA 3WF8A 4UX9A 3ATTA 4UWCA 2X7OA 4S31A 5IDPA 4AOIA 3VUHA 3ZFYA 4Z16A 3HRBA 1R0EA 3VRZA 4EZ3A 3RZFA 2RF9A 3AD6A 4DEEA 5CSPA 1OL2A 2ZFYA 3PJ1A 3HX4A 3B2WA 4PF4A 4YUQA 4LRKA 1FOTA 2QC6A 2FSMX 2YCSA 3EOCA 3ODYX 5GHVA 3NNUA 2F57A 4FTQA 3U4WA 3GNIB 2FSLX 2XM8A 3MA3A 4FSNA 4W4WA 2XK7A 3L9PA 4RJ4A 1PJKA 4IBMA 2FUMA 4PPAA 2GMXA 1TQIA 4NM0A 5EOBA 2J0IA 2OKRA 4O2PA 4OTWA 5CSVA 2PK9A 3DBQA 2YLFA 1ZYCA 3A7JA 2HWPA 4IB5A 3TV4A 2WQNA 3MBLA 5C4LA 3NMUF 3F9NA 1QPJA 3S95A 2JBOA 4EOJA 3RK7A 2RG6A 2CPKE 2PVFA 3DBDA 4ZLZA 2OJIA 4W8DA 3V8TA 4FTMA 3R6XA 3ZRKA 3R8PA 2QKRA 5CAQA 3ORTA 3NLBA 3HMIA 3P1AA 3W18A 1REJA 3DGKA 4C4EA 4ZEGA 3CPCA 5GZ9A 1J7LA 3R7OA 2IZTA 5F94A 3OXIA 5BVEA 1VZOA 2OFVA 2QG5A 4ITIA 3UVPA 2X8EA 4AXFA 4FTOA 2F9GA 4EEVA 2GS2A 4N0SA 4QP1A 2PUPA 2GHMA 3EFWA 3GC9A 1OZ1A 4N4SA 2R3QA 3TZMA 3DV3A 1MQ4A 3V8WA 2XIYA 1W7HA 3ET7A 4GIHA 4WG3A 3V8SA 3A62A 5EKOA 3Q4CA 1UKHA 4DBNA 3GP0A 2J6MA 2FA2A 4HYHA 3CY3A 2W5HA 3KK8A 3UG1A 1RW8A 4RWIA 5ETCA 3UPZA 4D1XA 2O65A 4O7LA 1W83A 3QRUA 3D7ZA 4QMQA 4USFA 2KTYA 3LXNA 1SZMA 2WHBA 5EHOA 5HO8A 5ACBC 3UMXA 4BDGA 4F7NA 5L6OA 4R7BA 3L8SA 3COMA 5CZHA 5AP3A 3WI6A 2C0OA 2FSOX 2VTLA 3F82A 2PVMA 4JRVA 2JGZA 3NCZA 4IIRA 4M97A 1K3AA 1U59A 2W5AA 3UPXA 3E63A 2ZV7A 3MW1A 4I4EA 2SRCA 2ZV8A 5HD7A 3R7IA 2WD1A 3QQLA 3AC3A 3V6RA 5AP0A 1B39A 4AG8A 4DEHA 2QOQA 1H1WA 2HOGA 2EVAA 3C9WA 4LDTA 2HCKA 2YN8A 2HW7A 4MXCA 3RPOA 4XH6A 2XKCA 4JDKA 4BJJA 4OGRA 2UW9A 4XOZA 1OPJA 4BGGA 2VTNA 3ORMA 5HLPA 2XIXA 3HL7A 3IECA 3N9XA 5DFPA 3HNGA 5L2QA 5LVPA 3DLSA 5FRIA 3RAHA 3VJOA 5GJFA 3HA8A 2C6TA 2YHVA 2WMWA 3ZOSA 3MESA 4WNOA 2ITTA 3LOKA 2WXVA 4JS8A 2J0KA 5CF6A 2YM5A 2OXXA 4FNXA 4EQMA 3GQLA 4FSUA 5IEYA 4FNZA 3FEGA 1PMNA 3AKLA 4W9XA 4E8AA 2FVDA 2IZUA 4TRLA 3FV8A 5LVLA 5KKRC 4LOOA 3EZRA 3QD4A 4HYSA 4TXCA 2WTVA 4QT1A 3S00A 3R30A 1Y57A 4QP2A 3DNDA 4BCNA 5IA1A 5GNKA 3LM5A 4KBCA 5ANIA 2UW4A 4Q5EA 4QTAA 5KMMA 4Q9SA 4DG3E 3P7BA 4Y8DA 1APME 4A07A 3ZLYA 3GT8A 3PG1A 2R3PA 3D2IA 4W4XA 4XJ0A 1CKJA 4D9UA 4LRMA 5BMMA 3DY7A 4R1YA 1PMVA 4BCQA 1NVSA 2BAJA 3FXWA 4F70A 2OO8X 5E7RA 3HMPA 3EN9A 2RIOA 3R9NA 4DAWA 4BFMA 2VU3A 1IA9A 4H3QA 4HVSA 2V5QA 4O7SA 1A48A 1KUTA 1NXKA 4O7WA 3QGWA 4BC6A 5F1ZA 2JIVA 2PE2A 3II5A 2PMIA 5HOAA 2CGVA 3G9NA 4ENXA 4B6LA 5JQ5A 2ACXA 3OCBA 4TN6A 5BUJA 5CVFA 2I0EA 4G31A 3V01A 3BHUA 5KKRB 4IACA 4KBKA 2PMNX 3Q53A 3ZSGA 3I7BA 2BVAA 4BDCA 3HKOA 5AR3A 2BRNA 4UWYA 4BDIA 3LE6A 2Q0BA 3QTSA 5EM8A 4CXAA 4CKJA 3B8QA 3S4QA 3UP2A 4IAKA 3UOLA 4E20A 4IWDA 4IAFA 4BVUA 5M4UA 3PA4A 4YTHA 4EL9A 4F9AA 3OVVA 3FLSA 3I79A 2XRWA 3D7TA 5L3AA 1M7NA 4QRCA 3ULIA 1WBWA 1F0QA 4XBUA 3DKGA 3GB2A 2DYLA 5DT4A 3UC4A 4CKIA 2CKOA 4EBVA 4FEQA 2VV9A 4JL9A 4AZFA 3W8LA 1PXIA 2X0OA 5CSWA 4AA4A 4DFZE 4DBXA 4LV8A 4O7TA 4A9SA 4D55A 2BZIB 1UWHA 2GHLA 2JBPA 2ERZE 4L53A 2UZUE 5EFQA 3RCDA 3M11A 3AMAA 4A06A 1F5QA 4PL4A 4NL0A 4TYIA 5DEWA 2XF0A 3E87A 3OXZA 4W4YA 5T68A 3PIXA 3JVRA 4ZK5A 5I9UA 4D1ZA 4HW7A 4DN5A 3GFWA 5CF5A 4L67A 3QF9A 2VWZA 4AFJA 3CJFA 4JT3A 3KXGA 4ZTHA 4JNWA 3VN9A 5KZ0A 1U46A 4ZMEA 2FYSA 3QTUA 4ACMA 3UDZA 2JIUA 3MI9A 4DGOA 2B53A 5DVRA 3BCEA 5H8BA 2F7ZE 4FYNA 2PVHA 3UMWA 4C02A 1FGKA 2GNJA 5G6VA 5GZAA 4ZJIA 3SD0A 5HBHA 3FI8A 5EW9A 2GNGA 2EXEA 4DEGA 1YI4A 4FIIA 4RC3A 3T3UA 4B9DA 4O4CA 3Q4ZA 2OIBA 3NUPA 3Q96A 2C3LA 3DTWA 4YC6A 4F6UA 3PY3A 2PYWA 5CU6A 5IQEA 4GSBA 1GZOA 2VWWA 4Y83A 3F88A 4FG7A 5BUEA 2YDKA 3R1QA 4Q5HA 3WZDA 3UDSA 3HA6A 4P2KA 4R7HA 4DLJA 4FSMA 3D83A 5FP5A 2BILB 2C68A 4BKJA 4E5BA 5EI2A 3F66A 2H6DA 1DI8A 3OS3A 5L2SA 4YHJA 2ITOA 1WCCA 4L9IA 3KRWA 2XNGA 3ANQA 3RPVA 5L6PA 4YU2A 4ZLOA 4OLIA 1VR2A 2XRUA 4G6OA 5JFVA 3BLHA 3PRFA 1E1VA 1JSTA 1DAWA 2C69A 4JIAA 3LMGA 4FK6A 4BL1A 3DT1A 1M14A 3QTIA 5IA5A 4O22A 3KN5A 1OKWA 2A2AA 4BTFA 4RA4A 1XMLA 2RSVA 4WUNA 3BGZA 3LFSA 3SRVA 5C03A 3FC2A 3PTGA 3Q9YA 4FF8A 3BHTA 4XG2A 5IUIA 4C2WA 5I9VA 2XK8A 4DH8A 4L43A 3UIUA 3G90X 2O0UA 4IWQA 3QD0A 4WRGA 5AP1A 3H0YA 3JR1A 2XM9A 4Y5HA 2B7AA 4UMQA 2O64A 4NIFA 5AP2A 3VBXA 3RPYA