4FV3A

Crystal structure of the erk2 complexed with ek6
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
346
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ERK2 complexed with EK6
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 105
structure length 346
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv3A01
4CG9A 3LXPA 3V5PA 5BVFA 4O7LA 3BHHA 3TM0A 5DEWA 3IGGA 4JAJA 4AA5A 4YNOA 4EJ7A 3AMAA 3UIBA 3EWHA 4FSWA 4I0RA 4EOOA 4DBXA 4NTSA 1OL6A 2GHLA 4JT3A 5JGDA 2B9FA 3BX5A 4FKUA 4WKQA 3CS9A 1UV5A 2HOGA 3ENHA 5CS6A 5DOSA 3IG7A 4IANA 4YJRA 3EFJA 1KE8A 5FTGA 5CQWA 5DPVA 3W2SA 5FBNC 4IH8A 2XS0A 3VIDA 2HCKA 4R3CA 5HE3A 4ASEA 4U81A 5IA0A 2OBJA 3FLQA 2CNVA 4HZRA 2Y4IC 2YIXA 3D5UA 3D9VA 3RWPA 4O22A 3VBYA 4HW7A 1Z5MA 4BIEA 3GC9A 1JWHA 2XRUA 5C26A 4QP7A 3B8RA 4XX9A 4QYHA 5L2IA 1U54B 2XNPA 4RZWA 5BVKA 4EHVA 1KE5A 2X7FA 4C4EA 4ZS4A 4ACHA 3EQBA 3FV8A 4GFOA 4CFMA 1BYGA 4JQ7A 2XKCA 4LGHA 2WGJA 5EOLA 3VUKA 3OP5A 3A7JA 3KRXA 5J8IA 2A19B 3EKKA 4C36A 2C1AA 2J50A 3SGCA 4F70A 2GMXA 3W2RA 5M06A 1OBDA 5LCJA 2HXLA 2VTNA 2I1MA 4F0IA 3O7LD 1RE8A 4TKSA 4KUJA 3QL8A 4ZY4A 3BEGA 4BZOA 5FEDA 4F9BA 3QU0A 1A06A 3QYZA 4M0YA 3HV7A 2QO9A 5M53A 4MAOA 2VAGA 2O3PA 3SDJA 4OAVB 2WAJA 2B0QA 5F9EA 1NW1A 3RHKA 2FVDA 4BBMA 2ZDTA 3SHEA 4FT3A 1LEWA 3P7BA 4C58A 3DK3A 4FOBA 4I41A 4QQTA 3QGYA 3Q9WA 4ZTSA 2C6MA 2WOUA 5AEPA 2VTHA 5JGBA 3DDPA 5FLFA 4BCFA 3MH1A 3DK7A 4DEEA 3KVXA 2QU5A 3MY1A 5HNBA 3RTPA 4FTUA 4DTAA 3W16A 1ZY4A 4DEHA 3O8PA 3EQGA 1M7NA 4IEBA 4RLKA 5A6NA 1YRPA 1BMKA 5CLPA 1OIUA 2WQMA 1VYZA 3EKNA 3MA3A 3LFEA 3PA3A 3ZLWA 2YLEA 4KD1A 3R04A 4QTBA 4RSSA 3UMWA 2YWVA 3ZONA 3TXOA 5LWNA 2QODA 4JI9A 2LAVA 3TNPC 3SVVA 1TKIA 3PIXA 4GVAA 2VGOA 4GUEA 4IJPA 1KE6A 5AR8A 4I94A 4D4SA 1NVSA 3QQKA 4FSQA 4UMRA 5JMSA 3WI6A 4ZSEA 3GI3A 5EHLA 3EHAA 4YR8A 5CX9A 4K8AA 4F7LA 5HTBA 1IRKA 4I0SA 4JLCA 4A9TA 2R4BA 5IH5A 4L46A 3E8NA 3DB8A 1Q4LA 4H39A 1UKHA 3UPXA 4WG5A 4FE2A 3GUBA 1AD5A 3T8OA 3BYUA 1MQBA 2W5AA 3MIAA 4RC4A 4YUQA 1PMNA 5J95A 1ZRZA 3DLZA 4U40A 4FNZA 3RHXA 3TT0A 4ANQA 3LFQA 3E63A 5DE2A 1ZAOA 4DC2A 2WTKC 4UMUA 3FYKX 2RG6A 3V5LA 5LWMA 5DH3A 2QKWB 2C6IA 4HNFA 1SNUA 3KCKA 5TT7A 3OHTA 4J96A 4IX3A 4EBVA 5ACBC 5AR7A 5IMEA 1BKXA 4GK2A 4IDVA 4FTIA 3VW8A 5HBHA 1OPLA 3IW7A 2GTMA 2XK9A 3E5AA 4DHFA 3QCQA 4NCTA 5AA9A 3N4UA 3FLYA 4OTPA 2JDRA 3ORZA 4L68A 4G31A 3OCGA 3GCUA 3TACA 4CV9A 4CMTA 4XLVA 3W2CA 3DQXA 3UPZA 4MF0A 1Q99A 1YVJA 1V0PA 3ZLYA 4YZNA 3KRLA 3Q96A 2ERZE 5L6PA 3KVWA 3ORKA 3OROA 5CEIA 5AP1A 4QRCA 1KUTA 5I0BA 2HZ4A 2WEIA 1LPUA 4F08A 4FC0A 4O0TA 3KRWA 3R8MA 4TL0A 3I60A 3F2RA 4Z9LA 4N4SA 2NO3A 4IMYA 3TJCA 2BCJA 2RG5A 4OTFA 4BN1A 1LUFA 3GCVA 2X7OA 4FKIA 3ZEWA 5GNKA 3QGWA 2YM6A 1GIHA 4IBMA 3TKUA 3TZ8A 2J51A 5E9EA 3BU5A 3OY1A 4LV8A 4DTBA 4BBFA 4W8DA 4MWHA 3VULA 2W9FB 4X2GA 3OUNB 1R3CA 4UXQA 4FKLA 3SXRA 4PP7A 2NNWB 2QKRA 3EQCA 1H01A 1OIYA 4DN5A 3LAUA 3DKOA 2WU6A 4CMUA 4JDHA 3NCGA 3RZFA 3O71A 5FXRA 5D11A 5E8SA 3BE9A 1Z9XA 4IB5A 3FQSA 3QQGA 3IW4A 4RZVA 4ZS0A 5IQGA 2NP8A 4C59A 5IQFA 5L4QA 4K77A 1NY3A 4EUUA 3CKXA 1YHWA 3BHVA 2CGWA 3BU6A 3OEZA 4U3ZA 2VWBA 4N0SA 4EHEA 4O0VA 4GK4A 3R2BA 3JS2A 1J7LA 2YM4A 5KMOA 4AE6A 2EB2A 5K3YA 2VX1A 2XEYA 2BAQA 2J90A 2PSQA 1XBCA 5DHJA 3Q4TA 4BHZA 4Z55A 4CG8A 4D2RA 3U8WA 3BE2A 5CSXA 5KO1A 2O8YA 3R7VA 1WBWA 3KULA 5LXMA 2FB8A 3VNTA 5J79A 1JLUE 2XB7A 3MI9A 3LQ5A 4L3JA 4L9IA 3BHYA 5FWKK 5HG9A 4EZ3A 3MH0A 1VYWA 4G3FA 4QMZA 5ANGA 2B9JA 3QQHA 3UYTA 4F7SA 3RWQA 1SVEA 4PDYA 3L8XA 2JGZA 2OZOA 4H3QA 1J7IA 4XG2A 4YZBA 4D2WA 5DI1A 3VHEA 2ZMDA 4GU6A 5GIOE 3GC8A 4UZHA 1T46A 4ZTHA 3ANQA 4QP6A 1ND4A 2F2UA 3MFTA 3OZ6A 2A4LA 4FKJA 4G3CA 5HI2A 2RFNA 4XP2A 5I9XA 4ENXA 5L3AA 3PWYA 4BHNA 4AZTA 2UW9A 4R3PA 2E9VA 2OH0E 5HG7A 3QZHA 1J91A 2GFSA 4QMTA 3OW3A 4AT4A 2Y0AA 2UW3A 4BZNA 4D55A 4DEAA 2VX0A 4NSTA 3EYGA 4C2VA 5EM6A 2JEDA 3SA0A 5CAUA 5T3QA 3K5UA 4FF8A 4XS2A 3OCTA 4U97A 3UZRA 3D2IA 4NJDA 3OXTA 4EH4A 2R3JA 3PY0A 4L7SA 5A4EA 4CT2A 5LMKA 3NUAA 4ZMEA 1SNXA 1VR2A 2RIOA 3FMMA 3KXGA 4EL9A 3SXFA 3DXPA 3OXIA 2P33A 5JEBA 4IADA 3Q52A 5L2SA 3BLHA 2PTKA 1M14A 5CSVA 2CKQA 3G0EA 2PY3A 2NRUA 2R3IA 3KQ7A 3P9JA 4C35A 5ICPA 3NPCA 4IWQA 2ETRA 4JBPA 1ZARA 3KF7A 4D4VA 3ATTA 4D1SA 2F9GA 4GH2A 4CNHA 2YN8A 4DFLA 4EK5A 2QCSA 2Y6OA 3JUHA 4DTKA 1YW2A 4EH6A 4L6QA 2OKRA 4XCUA 3FL4A 3QA8A 4GL9A 2RFEA 2C6KA 4FKSA 4RJ6A 3W18A 1M52A 5BMSA 1H1PA 3WF8A 4RWIA 3TNQB 4DH3A 3C4CA 4YPSA 5H3QA 3V3VA 3E3PA 3CPCA 1CSNA 4QQ5A 2VO0A 1G5SA 2R3KA 4RT7A 3IECA 3R71A 3UQFA 4RVLA 3GXLA 5LJJA 3C0GA 2IVSA 4RA5A 2DS1A 2PUUA 1BX6A 3KXZA 4YHTA 3OWKA 3E8CA 1PXLA 1XR1A 3OG7A 4Y5HA 1XWSA 5J5TA 5HTIA 3MTFA 3Q9YA 3ZSGA 3C5IA 3UG2A 1W8CA 4PTCA 1QMZA 4O84A 1Y8GA 4UYNA 3D83A 2OJGA 3SOCA 3MVHA 1ZMUA 4IQ6A 2QOQA 4QO9A 3VS1A 4B8MA 5AM7A 4I1ZA 5F20A 2YERA 3U6JA 3VF9A 3VS3A 4I24A 4H36A 3OTVA 3F7WA 1KV2A 2WMRA 2R9SA 4J95A 5G1XA 2OF2A 4G17A 4XBUA 4C38A 5FDPA 2WQBA 1QPCA 3PUPA 3BKBA 3ORTA 1LP4A 4QP2A 2ZOQA 4ZEGA 4QMXA 4FGBA 4PMMA 3R9DA 2PVRA 3WZKA 3V01A 1NA7A 3WE4A 3PP0A 5I5ZA 3CSVA 5HBEA 4FUYA 2H6DA 3ALOA 4QNAA 5EK7A 3IW8A 4CKJA 4GJ3A 3NNVA 5L2QA 4EOQA 4GFGA 4AZSA 4BCGA 3EQPA 3G9NA 4D2PA 4IZAA 4CFFA 5D12A 4P2KA 3W1FA 4L3LA 4WA9A 3E3BX 4YZMA 5DFPA 5CANA 5CU6A 4F9YA 3DFCB 3MWUA 2QOIA 4X6QC 5JRSA 5D9HA 3QTIA 5JSMA 4PY1A 2C5OA 3PG1A 3TCPA 5GJFA 3ZUTA 1UU7A 2B55A 1DAWA 5KHXA 4X2JA 4Q9SA 5E4HA 3QFVA 1XH8A 4CD0A 4FZ6A 2X81A 3JVSA 4I6QA 5HESA 4DEGA 5C8NA 3FMLA 1ZYLA 2PE1A 3GC0A 4ID7A 2PZRA 3VQHA 2BALA 3NCZA 3REPA 2GNFA 4FT0A 4YJSA 3QWKA 3HUBA 3FKLA 4AOTA 5CQUA 4P4CA 2E2BA 3FWQA 5A3XA 2VWIA 2R0IA 3BYSA 4HGSA 3FYJX 4D5HA 3CJFA 4UMPA 3H9OA 4Z16A 5H8EA 3WBLA 4ANNA 3AXWA 3TZ9A 3HEGA 4CVAA 2BHEA 5JH6A 5M07A 4BRXA 3C0HA 1H26A 3BI6A 3TV4A 3QBNA 4PUZA 3D7TA 5HOAA 2HENA 4G6LA 3ATSA 4EH7A 1S9JA 1ERKA 5HGIA 2BAKA 5BVOA 4FT9A 4LRMA 4USFA 4EUTA 2VTIA 4NH1A 1O6YA 3OEFX 5AV2A 4ZIMA 2R2PA 3LCOA 3A99A 2ITVA 3M1SA 4RX9A 3AGLA 5CYIA 4YZDA 3T3VA 5ETIA 4DH8A 1JKSA 2GNGA 2V7OA 4A7CA 2ZVAA 2VO6A 4D5KA 3FI4A 4IX5A 3OY3A 2ACXA 3MS9A 3R01A 2PUNA 3V5TA 3LPBA 3QQJA 5IEYA 4MBLA 5KHWA 4E4MA 2IVVA 5IQDA 1JKKA 4H3BA 3U4UA 1K3AA 4W4VA 4XOZA 3VWAA 2YM7A 4FEVA 4IVDA 4LFIA 4FEQA 3F9NA 3MH3A 4FNYA 3R7YA 2I40A 4BDFA 2XBJA 4C3FA 4FIEA 4O96A 4BWXA 5KE0A 5DRBA 3SXSA 4O7SA 4ORKA 1Y6BA 4W4YA 4F6WA 4MVFA 5AR2A 4C4GA 2PL0A 5AADA 4PMSA 4KS8A 5FBOA 4R8QA 2O64A 3MJ2A 4ACGA 4ACCA 5IQEA 2VNWA 3Q04A 1J1BA 3ZDIA 1ZWSA 3FL5A 4TNBA 4YMJA 2V62A 3E8EA 3KMMA 3P7AA 5HEZA 5M4IA 1DM2A 4QOXA 4ZTRA 4BC6A 4FIIA 4FX3A 3UOJA 3R1SA 4KSPA 4XHKB 5BYZA 3RNYA 3MGYA 5CU0A 3QALE 4TYJA 4HOKA 4QMUA 4AZWA 1HCLA 4FL2A 4AUAA 4I6BA 5BQ0A 4BCOA 3ULZA 1BLXA 4IAZA 4PPAA 4L43A 4AU8A 3U9NA 2QC6A 4IVCA 4ARKA 1ZY5A 2BRNA 4YPDA 3UIUA 3W55A 1WVYA 2PMOX 4NFNA 4J1RA 3ZFXA 4JG8A 2YAKA 4RRVA 3AT3A 2R64A 5I9UA 2CMWA 4AW2A 4AZFA 5I9WA 4E4LA 2VTQA 4J99A 2JITA 3IQ7A 4EC8A 4JJRA 2YDKA 4XV9A 4O6EA 4WSYA 5TE0A 1U5QA 4O0RA 4FTAA 2GNIA 2V0DA 1WBNA 4FTQA 2WELA 4LUEA 3U9CA 4YO4A 3LE6A 4M69B 4U9AA 4I4EA 4O81A 3QCXA 5JK3A 5IKWA 5IA4A 4RWLA 3GT8A 2REIA 3KF4A 3PPKA 1B39A 3SC1A 2IZSA 1V0OA 3UZTA 3ZC6A 5DVRA 1GOLA 3AMBA 3BGZA 3F3TA 3OS3A 2UZOA 4IB1A 4XG6A 4TYHA 3R6XA 3SX9A 3TDWA 5FP6A 3BBWA 2ZM3A 4U7ZA 2PZYA 3R7UA 3QXOA 3ZLXA 2CSNA 5E8ZA 4O7YA 4JRVA 5DA3A 5AAEA 2VV9A 2C6LA 4CXAA 5A4CA 4W9WA 4E3CA 5TF9A 2CN5A 3EZRA 4ANLA 4FZ7A 4H3PA 3SD0A 1MRYA 3MVLA 4YTIA 4OAUC 1UWJA 4P5ZA 5CT7A 5AP3A 3CBLA 1REKA 4JOAA 3LFBA 4K33A 3UNZA 2X6EA 3FQEA 1YXTA 3PG3A 2ZM1A 4IW0A 4NU1A 4QNYA 2OGVA 2YCSA 3I4BA 3L1SA 2XKFA 1KOAA 4HYIA 4O7ZA 3JVRA 5A4QA 5AV4A 1E1VA 3ZLSA 1SVGA 5C9CA 3MY5A 4QMNA 3SW4A 3VBXA 3L8VA 2ZV2A 4FI1A 2QOLA 4WT6A 3BYMA 3TUCA 3E62A 3PDTA 3WF5A 4J53A 4HVIA 4F1TA 2X9FA 4G1WA 5HCXA 3WF9A 5HG5A 2OH4A 5BVDA 4TYGA 5AX3A 2F4JA 3I6WA 3VN9A 2WMBA 4ALWA 2OJIA 5J1VA 2HK5A 4JXFA 3R8UA 3DFAA 3CTQA 4B8LA 5CASA 3ZSIA 5FTOA 5CVGA 4D1ZA 3WZUA 2C5VA 5AP0A 3ANRA 1OB3A 3O0GA 5EYCA 3HUCA 3OCSA 5BUIA 4C3PA 3DK6A 4JDIA 2VUWA 3KK9A 2OWBA 4FVRA 4E7WA 2J2IB 3I5ZA 4CLJA 1PF8A 4L52A 2J0KA 3I0OA 4Y73A 4DITA 2OO8X 4KRDA 4DGGA 4PP9A 1UNHA 3A8WA 2YCFA 3E87A 2C6EA 3UODA 1UKIA 4BDHA 3QTXA 3H9RA 5F95A 4USEA 4BTFA 2P3GX 5CF4A 2X39A 4I5HA 4ZJVA 2OZAB 4NT4A 3P0MA 3VS7A 2FGIA 5CU4A 4L53A 4FYOA 4BKJA 4BZDA 2UZEA 3PIYA 4WHZA 1QPJA 2VO7A 3TUBA 3TV6A 1Q24A 3WF7A 4R78A 2OSCA 4RFYA 2GDOA 3G6GA 3KU2A 3LMGA 3W10A 3ZRMA 4D2TA 4G9RA 2ONLA 5IQAA 1Q3WA 3ULIA 3FZOA 4FV4A 5IQIA 3PIZA 3BRBA 2BDJA 1UNLA 3PP1A 2J7TA 4ZXTA 1SYKA 4CFWA 4I6FA 3F5PA 3AMYA 5EFQA 3PVGA 3ZYAA 4TW9A 1KOBA 3NYVA 4CRSA 3MH2A 3NNWA 5FG8A 3AGMA 3U55A 2X1NA 2PMLX 5LVNA 3EB0A 4XG7A 4P90A 2F57A 4ANBA 3R1QA 3R21A 2C68A 2G9XA 5BVWA 1OVEA 2W05A 3ZMMA 2YAAA 1YOMA 1M7QA 5AP5A 2VTJA 4G2FA 2WMQA 4AA0A 3ZO1A 2WTKB 3OWJA 1HCKA 2W17A 3R83A 3THBA 4F1OA 1YI6A 5IQBA 5AIKA 3P1AA 2CGVA 4AE9A 5KMMA 2ITXA 3F6XA 2XNMA 4YZ9A 4FTTA 3MV5A 4QT1A 4IM3A 3UTOA 4HPTE 3ET7A 3HAMA 5LMBA 1OL1A 5CEQA 1I09A 1PXIA 2BRBA 4KKHA 2XNBA 4XH6A 5IF1A 3DT1A 4FKTA 3BHUA 3FDNA 3CY2A 3VUTA 5B7VA 5M44A 2BUJA 2GNHA 4K1BA 4B4LA 1NXKA 4JS8A 3MFUA 2WTJA 5J9YA 2PPQA 4BL1A 2JC6A 2C5YA 5K4JA 4S34A 2GS7A 3RCJA 5B2LA 2PMIA 5B0XA 3VQUA 4X2NA 4UY9A 3R22A 1F3MC 1KE7A 2H9VA 3QTZA 3R00A 4RIYB 5KMIA 4XP3A 3R8LA 1JKLA 3KN6A 5HCZA 2J4ZA 3D15A 4QMOA 5EM5A 1REJA 1WBTA 3BELA 3P23A 2BDWA 5ANEA 3VUDA 3F3WA 4ZSLA 4NM7A 5IU2A 1IA9A 3C7QA 4PQNA 2HZNA 4K18A 4WUNA 4FT7A 3ZFMA 3ZEPA 3JY0A 2GPHA 3E7OA 2UW7A 2X8DA 3OT3A 3Q2MA 3WE8A 4AOJA 4BIBA 4DAWA 2FSOX 3VRZA 4UBAA 5CI7A 3ZDUA 4JBVA 3LMIA 3QTWA 3GU5A 3E92A 4CYIA 5HICA 4YNEA 3FLZA 3QZIA 4D2VA 4I0TA 3HNGA 5CENA 3CE3A 3R02A 4D9UA 4DFNA 4PL3A 2RKUA 4LOOA 5AIRA 5KKRB 4FICA 1R1WA 5M08A 4DCEA 4AG8A 2C3LA 4AGUA 3G15A 3CPBA 3MFRA 4MNEB 4R5YA 5E1EA 2ITQA 3FLNC 3TIYA 3S4QA 5EI8A 3TKIA 3VBWA 2X8EA 4MQ2A 4B7TA 4ALVA 3R7OA 4DLJA 2WO6A 5BYLA 3R30A 3HMIA 2W1CA 4WG3A 5E8TA 1PYXA 3OWPA 5AFVA 4HGTA 4XG3A 4WUAA 1GZOA 1Y57A 3E93A 4FTRA 3WF6A 5E7RA 3RPVA 3ZH8A 5EW3A 3W2PA 3ZO2A 4BVUA 4PL5A 2HY0A 5CEPA 1G8SA 5CAOA 4DG0E 2BVAA 5FTQA 4OTGA 3L9NA 4FGRA 2WMAA 4C2WA 2P0CA 5E8YA 1R39A 2HIWA 5JZNA 3TV7A 5DBXA 2PYWA 2OJFE 4NIFA 1H1RA 5BNJA 2KTYA 4RIWA 3NSZA 2A27A 4O7TA 3EL7A 4O91A 5DN3A 2W9ZB 4N57A 3DU8A 4F6UA 4O38A 4QMMA 3RINA 4A4OA 4S31A 4CFXA 4GG5A 2EWAA 2PZ5A 2HW7A 2J0MB 3F2NA 4V0GB 4YSMA 2UZNA 4FNWA 4CV8A 4NL0A 4O83A 2QD9A 5HQ0A 2B1PA 4Q9ZA 1F0QA 1FGKA 4AWIA 4OBPA 5GJDA 3Q6UA 3QQFA 3UMXA 4EOMA 2VWUA 2YJSA 3ZM4A 4A9YA 3H9FA 4DA5A 1BI8A 2FO0A 2XKEA 4O82A 2NPQA 2YIYA 3ITZA 2BMCA 3NS9A 5HLPA 3RI1A 1L3RE 3AT2A 4FTMA 2A1AB 4LV5A 3BZ3A 3FMDA 2C0TA 3CKWA 5BUEA 3ZU7A 4F7JA 3L8SA 4H58A 5EOBA 1BUHA 4O0XA 3DAKA 3Q60A 4KSQA 4MKCA 2YA9A 1DS5A 3RAHA 2QVSE 2OK1A 3V6RA 4AXAA 2G2HA 3FY2A 3PXFA 3Q4CA 4C37A 3DA6A 1Q8YA 4DH1A 5L8LA 2ZYBA 2XEZA 1GAGA 5K4IA 2IJMA 4M84A 4J98A 4RIYA 2R3RA 5IQHA 4ITHA 5FXSA 4F65A 2WMWA 5ANOA 2CGXA 4IWPA 4MXZA 1R0EA 4G34A 5EW8A 4YTFA 1WBPA 5HIEA 5IA2A 4OT6A 3TZMA 2P2HA 4PV0A 4NIFB 3RPRA 3PXQA 2W1GA 3DOGA 3H4JA 4AZVA 4J52A 4CFVA 4YJNA 4EK3A 5HBJA 2J5FA 1M2PA 5EM8A 3F5UA 4BKYA 4GVJA 4E93A 4JBQA 4XLIA 4Y85A 2BZHB 2EXEA 5CNNA 5L2TA 2W4OA 4GIHA 4FMQA 3R9OA 1TQIA 1WFCA 3F3ZA 3NWWA 4I3ZA 3PXKA 4JNWA 4Q2AA 1PXJA 3L9PA 5HNIX 4IB0A 5I4NA 4MF1A 4O6LA 3UG1A 3ORLA 2WQEA 2Y4IB 3ACJA 2JDVA 2OIBA 3DDQA 4L7FA 3N51A 2RL5A 1XH6A 2OXXA 3QRIA 1ZXEA 4NKSA 4YP8A 4E8AA 3DJ5A 4RGJA 5AV1A 3MBLA 4F9AA 4DH7A 2JDOA 3QUEA 4YJPA 3KXHA 4ALUA 4TXCA 1OL7A 2XIZA 1ATPE 2I7QA 3VBQA 3Q4ZA 2WU7A 3CQUA 3U4WA 4EI4A 4FTJA 3CCNA 1OPKA 4GYGA 1UNGA 4A9SA 2QURA 3IDCA 5HE2A 4IHPA 4LGGA 5HE1A 1XBAA 3CGFA 3CQWA 4EWHA 3O7LB 2OIQA 4UWBA 5T6KA 4JX3A 4FTOA 4XV2A 1O6LA 5DG5A 2YIQA 3SKCA 4F64A 4A4LA 3FC1X 2GHMA 2ZMCA 4FTNA 4UMTA 4GUBA 3ZO4A 4LM5A 2VX3A 4GV1A 5HVKA 5JFWA 1CKPA 3VF8A 4DH5A 3ENMA 4PX6A 3GENA 4BCPA 3FHIA 4R5SA 3FC2A 4LYNA 2XIXA 4NWMA 3VHKA 1XH5A 4FTLA 3NX8A 5A4TA 3RBWA 4OTDA 3RP9A 4ZMFA 2OW3A 3EN6A 4I20A 4LMNA 2OFUA 5F1ZA 3RZBA 4F7NA 5CF8A 5F94A 4JG7A 1BI7A 3HA6A 3G9LX 4QYYA 3DZOA 4NW6A 2Y9QA 4HNIA 4AW0A 4BGGA 4KS7A 3HKOA 3DNDA 3PVWA 3KGAA 3WZDA 4NZWB 4M13A 4O0WA 5CTPA 4IX4A 3QCSA 2QHNA 3E88A 4AAAA 1XBBA 3MESA 3QUDA 2CJMA 4YGAA 3UOLA 1U5RA 2HZ0A 3FXWA 5HIBA 5A46A 2I0VA 5T68A 3IW5A 3F82A 3LJ2A 5BX0A 2JDSA 3NW7A 4HGLA 4KBCA 4RVTA 4EH9A 2OXYA 4G9CA 3BQRA 2ESMA 3UYSA 1QL6A 3FZTA 3PSDA 3UQCA 4M66A 3COHA 3ZTXA 4YO6A 4CZUA 3DLSA 2Y7JA 4FL1A 4WNOA 4E4XA 1XH9A 5K5NA 2OI4X 3AD4A 5CEOA 5I9VA 3IONA 3NUYA 4ZTNA 2VTAA 3PZHA 5GZ8A 4RVMA 2O5KA 4NM0A 3DQWA 2W4KA 1GIIA 3BV2A 5HE0A 2QG5A 4M0ZA 3DTWA 3NUPA 4QMWA 4RBLA 2VGPA 3O8TA 3FZSA 1TQMA 3NW5A 3QYWA 3TDVA 3F69A 3QTSA 4GSBA 4K2RA 2W1IA 3NGAA 3HV6A 4U8ZA 3NLBA 1OL5A 3LXKA 1DI9A 4GT4A 1V0BA 3DJ7A 1XH4A 3ORIA 3HRCA 2HXQA 3NR9A 2Z60A 2XK6A 1OKYA 4G5PA 5DNRA 3BYOA 4BDKA 3CJGA 3R2YA 4NCTC 4Y46A 2PVFA 4ZY5A 4ZLOA 5FRIA 3NIZA 5CVHA 1W0XC 3KMUA 3ETAA 2NRYA 4FVQA 3LFAA 4EHZA 4G16A 4TT7A 2CDZA 4IAYA 5C27A 2X7GA 2GCDA 3P08A 1NT2A 1QPEA 4R7BA 2B4SB 4FTCA 2R3OA 4FG9A 4DG2E 5BVEA 4XBRA 5K0XA 2R0UA 2O2UA 1FVVA 3ZRLA 3AOXA 3AG9A 4C8BA 4EQMA 4FA2A 2QO7A 1FINA 2Q83A 2BAJA 3RKBA 4I21A 1H07A 4XMOA 2XZSA 3D7ZA 4FKWA 5F4NA 2R3MA 2YM5A 4HGEA 2UW5A 3OMVA 1PXNA 4D4YA 4KABA 4C33A 5DT3A 2P4IA 4OBQA 4ANMA 3OOGA 3V8SA 4CZYB 3V5WA 3COKA 4IVAA 4UYAA 5FD2A 2QQ7A 3FMEA 3P5KA 2GS6A 1Y8YA 2WIPA 2X6DA 2YWPA 2VN9A 3H30A 4G3GA 3RVGA 2F49A 3FSKA 1E9HA 3FLSA 3ORMA 4BR3A 4DEDA 4X7QA 4UN0C 4USDA 4AN2A 4QTCA 2QHMA 2XMYA 3LW0A 3QF9A 2PU8A 4H05A 3COIA 5K0KA 5FQDC 3KEXA 3FKOA 2GSFA 3BLQA 3DBQA 5AP2A 2W96B 3O50A 3QX4A 4OGRA 2R3FA 2R5TA 2R3PA 3CIKA 3CP9A 1W98A 2BTRA 3QWJA 2PVLA 4FSYA 3O8UA 4FV8A 3POOA 3QD3A 4QQJA 4EH3A 3GGFA 4K0YA 1XHAA 4M7IA 3FHRA 5IPJA 4RMZA 2YEXA 3EFWA 2GTNA 3QRJA 2XP2A 4HZSA 2X2KA 4FZDB 4QMYA 2WHBA 3R1YA 3DY7A 4FKOA 3KA0A 4FV2A 4TNDA 4WRGA 1W82A 5A4LA 3SRVB 1YI4A 3FPMA 3WIGA 3QRTA 4E1ZA 3R9HA 4MH7A 2WZJA 5LARA 1SM2A 4L67A 3HP5A 3EQRA 4BDIA 4FK3A 4HCUA 4LL0A 2PMNX 3ROCA 4ASDA 2ITTA 2HWPA 1MRVA 1MRUA 3CD8A 1NVRA 4FKPA 3PSBA 2QR8A 4QYEA 2XNGA 4QMPA 2LGCA 1CKJA 2GHGA 4HYUA 4AX8A 4CQGA 5KCVA 4P5QA 4BY9E 2W4JA 2FH9A 4GMYA 4TWNA 4AT3A 1YHSA 1QPDA 3PJ8A 2HWOA 3G51A 5JT2A 4E5WA 5EQPA 2F7XE 1WCCA 5TOZA 4FKGA 3AC8A 4UB7A 3FJQE 5C01A 4BTMA 4YLLA 3S0OA 3MTLA 1CDKA 4CFUA 4JL9A 5CAQA 3QQUA 4FT5A 3V8WA 3QKKA 3UO4A 2JAVA 3B2TA 3QUPA 3LFFA 3DPKA 3LFDA 4KB8A 4KIKB 4RJ8A 5D10A 5A14A 5KMLA 4O7NA 1JSUA 4GS6A 4K6ZA 4EKLA 3FXZA 2UZTA 4YURA 4BTKA 5AP6A 2JKOA 3NMUF 1GNGA 2CLQA 4ANOA 3RJCA 4YTCA 5HX6A 1H08A 3IW6A 3CLYA 3R0TA 4QMVA 3E8DA 5EQEA 4I5MA 3FEGA 3OT8A 4O0UA 4FKRA 3RAKA 3SLSA 3A62A 3QD2B 2BHHA 2JLDA 2XJ1A 5D7AA 5EH0A 3DKGA 3EQDA 1ZOGA 4Z7GA 3SW7A 2VRXA 3DB6A 1PXKA 3B2WA 4EHGA 5JFSA 2J9MA 2YM8A 2BZJA 5AAFA 1PKDA 4BDAA 4QPMA 4WOVA 4XJ0A 2BR1A 4KINA 5D7VA 4JBOA 4RG0A 4RIOA 3NAYA 4DEBA 1FVTA 3UGCA 2CLXA 2QOCA 2BZKB 4GFMA 4KBAA 4LRJA 4X2FA 5DGZA 1YXVA 2C6OA 3NYXA 5AJQA 5LVLA 4BCIA 4C7TA 4AP7A 4LOQA 3UE4A 5EI6A 3VAPA 4FYNA 4NJ3A 3PRIA 4DYMA 4PF4A 2ZB1A 4XP0A 3O2MA 3SAYA 3BHTA 4AF3A 4DFUA 3VVHA 2PVYA 1UU8A 3S95A 1ZZLA 3DKFA 2E9PA 3K3IA 2WOTA 4AT5A 2ITPA 5AP4A 4B9DA 3QC4A 4BB4A 5C8MA 3CGOA 1ZOEA 5HG8A 3ZS5A 2XUUA 3TNHA 5IH6A 4AGCA 1XO2B 3OF0A 4C0TA 1FOTA 3VRYA 4BYIA 2P2IA 1OECA 3GU7A 3KK8A 3OW4A 4RPVA 3C50A 4HPUE 1ZYSA 4FG7A 1CKIA 5H8GA 4EBWA 2QG7A 3OOMA 4YJTA 1IA8A 5DIAA 3CQEA 4R1VA 3SRVA 5KBRA 2VTRA 3HV5A 3II5A 5L2WA 5M09A 3GBZA 1O9UA 2B54A 1PXMA 3RNIA 5L8JA 3O23A 3C0IA 3G33A 4FODA 5BPYA 1U4DA 4BGHA 4M14A 5H9BA 2WMUA 1YOLA 2VD5A 5E8VA 4C3RA 3QHWA 3IS5A 4RFMA 2PUPA 1KE9A 4FVPA 3NUSA 5HHWA 3RK5A 5DMZA 2B9IA 4U42A 1PMEA 2G15A 4F6SA 2ITNA 3FY0A 3MFSA 3P86A 3A7GA 4WNPA 5EYMA 4S33A 5CWZA 2EB3A 2JKKA 4E6CA 4CSVA 3HGKA 2B9HA 4JDKA 4JIKA 3HRBA 3BU3A 2VNYA 4YBKA 3DXQA 2X8IA 5FM2A 2R3LA 3UO6A 1WBVA 3A7HA 3HV4A 4QTDA 4KNBA 4FEWA 2WPAA 1YQJA 4DGLC 3LLAA 3Q4UA 4N6ZA 2ITUA 3HX4A 4WD5A 4NEUA 3KFAA 2C6TA 3IDPA 2WFYA 5IDNA 2JIIA 4R7HA 4M3QA 4IB3A 4YBJA 1L8TA 2G01A 2VTMA 1WZYA 4MK0A 4ZSGA 2Z2WA 2PVKA 3HYHA 4XG4A 3E7VA 4TWCA 5AWMA 2UW4A 1YXXA 4CQEA 4M68A 1Q8WA 1YXUA 4IZ5A 4K11A 3AQVA 1UA2A 1FGIA 2C0OA 3HA8A 3HRFA 1H0WA 4IVBA 5AUZA 4EOSA 4QMQA 2C30A 3LMHA 4O1OA 4EQCA 1URCA 2WB8A 4BI2A 2CCHA 4P7EA 3AC5A 5HCYA 2R3QA 3O17A 5GZ9A 4OUCA 4QP1A 2RGPA 4GYIA 4G3DA 3DXNA 3KC3A 4YTHA 4RWKA 4CTBA 5C1QB 3SG8A 3AC2A 4ZK5A 5LVOA 1XKKA 1Q5KA 2BILB 3IGOA 4DF3A 2OLCA 4QTAA 4F4PA 2ZB0A 3G6HA 2X0GA 4R7IA 2YZLA 3G5DA 5EHOA 4JQ8A 3JPVA 3KRJA 4LRKA 5H8BA 2BRGA 3GNIB 5DT4A 4BFMA 4AFJA 1PMVA 4GG7A 5KUPA 2V22A 4C61A 4EH2A 3F5GA 3AC3A 1VJYA 3DJ6A 4GJ2A 3PY1A 3VJOA 2XA4A 1FVRA 2IZTA 3FZRA 3GU6A 1H27A 2BROA 3PJ1A 5AR5A 4FZFB 4WBOA 3TKHA 3LJ1A 3BWFA 2PULA 5ANIA 4F0GA 2JIUA 3R7IA 4OBOA 3MPAA 4MWIA 1F5QA 1OKWA 3NDMA 3V6SA 4FTKA 3FMHA 4O21A 3EL8A 3WILA 5ANJA 3W8QA 2XNEA 4FZAB 3VBVA 3HV3A 1VZOA 3KL8A 3A61A 3WIKA 4AW1A 5LQFA 3PYYA 2E9NA 3TUDA 3UVPA 2W5BA 3TG1A 5CALA 5AUWA 3H3CA 2DQ7X 5FEEA 2CN8A 3ACKA 4KWPA 4U0IA 3BBTB 1Q61A 1G3NA 5TKDA 3RMFA 1PRYA 1OL2A 3V5QA 1Q3DA 2XNNA 3G90X 4RVKA 4BWPA 3VJNA 2O0UA 2GS2A 3ALNA 5IA1A 4ACMA 4W4XA 3ZUUA 1RW8A 2VTLA 1CTPE 2OIDA 4PDPA 3PA4A 4Y83A 1Q97A 3LFCA 3IO7A 3V04A 4MBJA 4CLIA 4OTQA 4E73A 1CMKE 3AD6A 4FNXA 4MQ1A 2JAMA 3VS2A 1FPUA 4LGDA 5CF5A 4RIXB 3LHJA 4JAIA 1UWHA 5AR3A 3G0FA 5IZFA 5LVPA 2GNLA 3N9XA 2P55A 1H25A 5K5XA 2QOBA 2RFDA 3LXNA 1CM8A 2JD5A 2C3JA 4AA4A 5C8KA 3AD5A 2YIWA 2WIHA 4IJ9A 3EN7A 4X3FC 3O96A 4AFEA 4FUXA 4AOIA 4LL5A 2EXMA 4FSRA 5EHYA 4ZTQA 5EDRA 1HOWA 3QD0A 3F3VA 4ITJA 5FP5A 3ZHPC 4KBKA 4BDDA 3C4ZA 3Q53A 5CSHA 4LQMA 3A4OX 2WMSA 1YXSA 2J5EA 4O1PA 5CZIA 1LEZA 4EWQA 1W83A 1OI9A 4JX7A 4A9RA 1WVWA 1SMHA 2OU7A 4YHJA 5KMKA 5HLNA 3R9NA 2F7EE 2WEVA 4X3FA 3UC3A 1TVOA 3JY9A 5TO8A 4HVGA 2WKMA 5EQYA 1OIQA 4N70A 4D2SA 4QP8A 3TTIA 5A54A 2Z8CA 4LMUA 4KAOA 2PZIA 4EONA 5L6OA 3RPOA 4KIKA 2QNJA 2VWXA 4A07A 2C47A 1GIJA 2I0YA 2ONLC 3F5XA 5E1SA 3ZZEA 4RX7A 5I9ZA 4W8EA 2QOHA 5G6VA 1K9AA 4MTAA 2VTPA 4OTRA 2YZAA 3NRMA 3ZCLA 1ZYCA 3DNEA 3HZTA 2DUVA 2BRMA 2Y6MA 3NAXA 2YITA 2UZUE 2UW8A 3HDMA 3RM6A 2JFMA 3OWLA 4PNKA 2XCKA 1TQPA 3VS6A 4AN9A 4E5BA 4WG4A 4AQCA 3QKMA 1PMUA 2V5QA 3MW1A 4IXPA 3NUUA 4GRBA 2UZBA 2YABA 3MIYA 4RX8A 2HELA 2OF4A 3OBGA 3LCKA 3QD4A 3R73A 2J0JA 5CI6A 3D94A 4CFNA 4EK6A 3QHRA 4HVDA 4XV3A 3WYYA 1IAJA 4YJVA 4C62A 1YWNA 3U6HA 4TYHB 3HMNA 4YC6A 4IAIA 5KZ0A 5AUUA 2YDJA 3FZPA 3PTGA 4RQKA 5CT0A 3UP2A 3COMA 4BTJA 1S9IA 2XYUA 3I5NA 1H1WA 2BIYA 2C5XA 3C9WA 4Y8DA 1Y91A 1SVHA 4DFBA 3FMKA 3QXPA 4L01A 4MD8E 2IW6A 2Z7RA 4GKIA 4I23A 4BKZA 4TYEA 1R0PA 3BEAA 2R7IA 4WSQA 4QP4A 4ITIA 4BIDA 2Q0BA 2FSMX 2IZUA 3LZBA 4DGOA 1M2RA 2EXCX 3UQGA 4QPSA 4RJ3A 4CCUA 3JXWA 2FUMA 2W1ZA 3FSFA 2ZM4A 3GC7A 2ITYA 1MUOA 5JZJA 2PVHA 2BKKA 3NVMB 3S3IA 3ZZWA 4EORA 4J71A 4HCVA 4HJOA 3HP2A 1OUYA 4IZ7A 2Z02A 1BL7A 2W99B 3QZGA 4APCA 4CEGA 4BDEA 4RFZA 2WQNA 4EOJA 5DWRA 1Z57A 3A7IA 4PMTA 2ZV8A 3RCDA 3FMNA 4TWOA 4BF2A 3PLAE 1NVQA 3MYGA 4NM5A 1RDQE 3FZ1A 5KZIA 4APPA 5CEKA 3U87A 4ONAA 3U54A 2WQOA 3FMJA 3IPHA 4FIGA 4S30A 5AR4A 3MN3A 1PHKA 3Q32A 4QTEA 3NIEA 3CD3A 5M56A 1XH7A 3LXLA 2UVZA 3KXXA 3EIDA 4J8NA 2XVDA 3LJ0A 5D41A 3T9IA 5AUTA 4AZEA 5HLWA 4IC8A 3ID6C 4J97A 2H96A 4XV1A 1JQHA 3O51A 4BCMA 3PXRA 2CNQA 2YCQA 1Q8UA 2ZDUA 3EH9A 4HVSA 4ZZNA 1X8BA 3MJ1A 5DR2A 2C3KA 3DBDA 2WMTA 3ORNA 3QLFA 4EK8A 2QI8A 2QO2A 2Z7LA 4OW8A 1WBOA 3NUXA 4PDSA 3PVBA 3RALA 1EH4A 4PWNA 3QCYA 2VWYA 4F9CA 5EG3A 5HU3A 3EFKA 3R7EA 4V0GA 4UWCA 1GZNA 2Z7QA 3MSSA 1WBSA 4IACA 4O0YA 3GOPA 4U80A 5HVYA 4ZZMA 4DFYA 4R6VA 3C4WA 3ZOSA 4BCKA 5JFVA 4C4JA 2OJ9A 2JFLA 1R78A 4FV5A 3TZ7A 4BDJA 2W7XA 4O86A 1OKVA 3RGFA 4NW5A 5EKNA 5J7BA 2IWIA 3BYVA 3NZ0A 4PL4A 5C03A 2XK4A 3MDYA 1OM1A 2PE2A 3QRUA 5IH4A 4YC3A 5FUTA 3I0QA 5DT0A 3UJGA 5KMJA 4B0GA 3GFWA 3IOPA 3LFSA 5CXHA 2BPMA 4XEYA 3LLTA 2UZLA 2OG8A 3UC4A 4NFMA 5L8KA 4NKAA 5H2UA 1YWRA 3Q5ZA 2IW8A 1YDRE 2QLQA 4PMPA 1ZYJA 3QKLA 2XJ2A 4I6HA 2HW6A 5HORA 4IWOA 3QX2A 1GZ8A 1IEPA 3D14A 3I7CA 4GCJA 3C5UA 2WTIA 4QMLA 4ZAUA 3A60A 3ZO3A 4IZYA 1DI8A 1GJOA 1RJBA 3C4FA 2R3GA 5J1WA 2H8HA 3EJ1A 5IUIA 1G8AA 4DLIA 4WRSA 4CCBA 3HMOA 2R3HA 2XK7A 4Y95A 4U41A 3C51A 5DEYA 5GIPE 4OLIA 4U6RA 4GK3A 3IK3A 4L45A 3G2FA 3Q3BA 5CSWA 5E91A 3VUMA 4EQUA 4FBXA 4LG4A 2YACA 3QRKA 4CYJA 4XYFA 5CAVA 1IASA 5LMAA 4IAFA 2PZPA 4O7WA 4Y72A 3FE3A 5BUJA 3PY3A 3HMMA 4MEDA 5E92A 2C3IB 2W06A 5JFXA 3F7ZA 5JN2A 3DBCA 2BTSA 4O2ZA 3UNJA 2Y4PA 2VTOA 4BGQA 4I4FA 2XBAA 4C34A 3KREA 1JKTA 3D5XA 2JBOA 3FLWA 2F2CB 1JSVA 4H1JA 2B53A 1YDSE 2JBPA 5AUYA 1P5EA 4DFXE 2WTVA 5AM6A 5LOHA 3F61A 4EEVA 2WXVA 3OTUA 5A9UA 5B2MA 4IFCA 1M17A 2DWBA 3HLLA 5IEXA 4NM3A 1XJDA 2XJ0A 3CC6A 4R1YA 3BGQA 4W9XA 1P2AA 4XG8A 4M69A 3EN4A 3AC1A 3FUPA 3PJ3A 4JR3A 2G2FA 3Q5IA 1Q41A 5AA8A 5KX8A 5M51A 4V05A 2GQGA 3F66A 2ETKA 3PXYA 3KXNA 1H4LA 3H0YA 2WTDA 3JR1A 3C4XA 3FXXA 2BFYA 3KCFA 3OBJA 4QPAA 3KB7A 4ANSA 3R7GA 4FL3A 3V5JA 4BICA 5J87A 4Z3VA 5LVMA 3S00A 4FSZA 4C57A 2XCHA 1B38A 4ERWA 4S2ZA 4EYMA 1BL6A 4I22A 4TPTA 2QONA 3A7FA 3UOHA 2RFSA 2X4FA 3UOKA 2V7AA 3IDBA 1PKGA 3IKAA 4ZTLA 4LOPA 3KKVA 4IIRA 2UW0A 2IZRA 2BIKB 2AUHA 3ZXZA 5CEMA 2CKOA 3R8VA 2JIVA 2KULA 3OVVA 3PRFA 4MNFA 4FR4A 4WNMA 1P4OA 5EDQA 2C4GA 5CU3A 3QQLA 4HVHA 1YI3A 2PK9A 3NYOA 4FIHA 3GFEA 5E90A 4D4RA 2VWVA 2BRHA 4TYIA 4X3FB 1KSWA 4ZSAA 2OICA 3TJDA 4TY1A 2OJJA 4CMOA 4KIPA 3SOAA 2QOFA 4FG8A 2ITZA 3U51A 1UU9A 4NUSA 2YM3A 2ITOA 3FAAA 4IAKA 4X3JA 5EKOA 3WOWA 2IO6A 2QR7A 3BWJA 3LM5A 3FI3A 5HKMA 2IVTA 2HY81 5E8UA 2BFXA 2HZIA 3L9MA 4EZ7A 2JDTA 5BMMA 5GINE 3HL7A 4ZY6A 1U59A 3V8TA 4ACDA 3KMWA 5IUGA 5AUXA 1OGUA 4FIJA 4DG3E 3UNKA 3MPMA 3ZFYA 4IAAA 4IX6A 3GCSA 3NNXA 2UVXA 4KA3A 4GT5A 4TZRA 3HVCA 4E20A 2PUIA 4HYHA 2XIRA 2YISA 2ZV7A 2JKMA 5J5SA 3QA0A 4YC8A 4FV7A 3DBEA 1WAKA 2YCRA 4IDTA 4DINA 2PVNA 3RK7A 1PJKA 3A2CA 1WVXA 3GOKA 3Q9XA 4AS0A 1U54A 2WD1A 4J8MA 4MXCA 4PRJA 1J3HA 5DRDA 4EJNA 4U44A 3M2WA 4E26A 4EH5A 3LCTA 3N4TA 3L9LA 4F63A 3DZQA 1AGWA 4D28A 5CY3A 5I3RA 4FEXA 3W2QA 4M15A 4I92A 2W1EA 5J7HA 5E8XA 1AQ1A 2IN6A 5J9LA 3NYNA 4FSMA 3D7TB 3QTRA 2BDFA 4ASZA 5ETFA 4MX9A 1OKZA 2Z7SA 5EW9A 1URWA 3ODYX 2W1FA 1O6KA 4QMSA 2CGUA 4MCVA 4U45A 5M57A 3TEIA 5KBQA 4DCAA 2OZAA 3F88A 1ZOHA 3VBTA 2I0EA 3PA5A 1PYEA 5GZAA 3F2AA 4H1MA 4JQEA 4A4XA 3ORXA 3GU4A 3OFMA 5HTCA 3VS4A 4K9YA 3KULB 3QTUA 4L44A 1KV1A 4EOIA 1J1CA 3PJ2A 3MY0A 3UO5A 2GQRA 5KNJA 5E8WA 5EI2A 1JOWB 5HVJA 3FI2A 4RC2A 3T9TA 4UEUA 4L8MA 2PHKA 5L6WL 2BKZA 3W2OA 4BCHA 4Q5EA 1ZZ2A 2HYYA 2FYSA 2R7BA 4MXAA 5B2KA 2WNTA 3EOCA 2XKDA 5I3OA 3LVPA 3BCEA 3VC4A 4GIIA 2J6MA 3UZPA 2DYLA 4GW8A 4L42A 4Z7HA 3VUIA 2CKPA 5HZNA 3GCQA 1E1XA 4EYJA 3FBVA 3RPSA 4AGDA 3FQHA 3LM0A 4A9UA 4HYSA 3M42A 1OUKA 1PW2A 4DEIA 3DV3A 4RWJA 3FKNA 5IDPA 2I0HA 5LCKA 2XK3A 3WZJA 5M4CA 2I6LA 1U46A 4DE4A 2PVMA 2B7AA 4KKEA 4B99A 1Q62A 3PLSA 4CKIA 5HD4A 5HX8A 1P14A 2GFCA 2VU3A 4O0SA 3K54A 2ETMA 1Q8TA 3VUGA 1UU3A 4OTIA 3GEQA 2G1TA 4U3YA 1GY3A 3LQ8A 4F09A 3OD6X 4YSJA 3SG9A 5A6OA 4IWDA 3TNWA 5TR6A 2VO3A 3D5WA 4EK4A 4QYGA 4ERKA 2UV2A 5AUVA 2FA2A 4KKGA 4ZOGA 3ODZX 4RQVA 4X2KA 1OMWA 3ROYA 2CHLA 3RPYA 4F99A 5I9YA 5ITAA 4BCNA 5JRQA 1H8FA 2EU9A 3MPTA 4YJUA 3TNIA 3R63A 4G6NA 2C5NA 3PSCA 4MBIA 4CKRA 3K3JA 2YJRA 1APME 1YDTE 4IC7A 5AV0A 1LR4A 3DAJA 4M8TA 1ZYDA 4O2PA 4D1XA 4PNIA 4TWPA 3D4QA 4OR5A 3EMGA 1YOJA 3HDNA 3OUKA 4ZLZA 5FDXA 3MVMA 3UVRA 4RIXA 2C1BA 5HO8A 2C0IA 2RSVA 1IR3A 5FM3A 3SV0A 4CGAA 3NVKI 1SZMA 4MYGA 3ELJA 4G6OA 3BIZA 3Q2JA 1B6CB 3OC1A 3EFLA 3P4KA 5KKRC 3C13A 4OTWA 2OFVA 2PVJA 2AYPA 4ZTMA 1RQQA 4C02A 3CTHA 3JYAA 1JBPE 4MXYA 3WARA 4BCQA 4AACA 1PXOA 2WTCA 4UV0A 4MXXA 5AX9A 3A4PA 3OXZA 1PXPA 4FKQA 3QTQA 4LI5A 4RC3A 3Q9ZA 3TWJA 4EKKA 3U6IA 4QYFA 1STCE 2H34A 2W0JA 1Y6AA 2UUEA 3W33A 4DGMA 3S1HA 4ZP5A 4I5CA 4ZSJA 5J9ZA 5CU2A 4Q5HA 3F3UA 3KRRA 4AW5A 4E4NA 3R9RA 4D9TA 3A8XA 4FSUA 3DGKA 3WYXA 2E9UA 3DKCA 4ZJIA 4HCTA 4XRLA 2J0IA 2X9EA 4PPBA 4R3RA 1WMKA 2Q0NA 5ETCA 5FGKA 3VS0A 3W8LA 4U43A 1MP8A 2XIYA 3K2LA 4FV9A 1IG1A 1IAHA 3LIJA 4O7RA 3UVQA 4E6AA 4X21A 3QZFA 4F9WA 4MD7E 3PVUA 4UMQA 5AV3A 4BI1A 4BI0A 2XK8A 5CF6A 3ZXTA 1Q8ZA 1W84A 3GB2A 3IOKA 4J7BA 4GEOA 3KXMA 3CY3A 4RLLA 2CCIA 3I1AA 4UXLA 5IUHA 1J7UA 1JNKA 4YZCA 4EOLA 3PJCA 4NK9A 4JRNA 3BGPA 4B6LA 3HMPA 4F0FA 5GJGA 4JIAA 2A2AA 2CKEA 3EYHA 4YJOA 4FEUA 5M4FA 3EN9A 1KWPA 2W1HA 4OTHA 4PDOA 3ORPA 5M55A 3LCDA 2RF9A 5HO7A 4FV0A 3TL8A 5IA5A 2YLFA 4L3PA 4JR7A 3WZEA 4GU9A 2UZDA 4PTGA 2YFXA 3Q6WA 4XRJA 4UZDA 4F1MA 2VTTA 3PPJA 4FOCA 4NYEA 4XNEA 5CZHA 4I93A 1FBNA 5FXQA 2VWZA 3VS5A 5HO6A 1OIRA 2QOOA 3GVUA 3PPZA 4M67A 1YHVA 3W32A 4MD9E 4DBNA 4XOYA 3H0ZA 4CZTA 4L00A 3R8PA 4FSTA 5AP7A 4ENYA 3CEKA 2XF0A 2XIKA 2WMXA 1K2PA 3R28A 4X0MA 2SRCA 5DR9A 3TI1A 3NW6A 3B8QA 3MA6A 3ZBXA 3HECA 2W1DA 4EC9A 2J0LA 5JQ5A 1ZLTA 3VO3A 3D2KA 3ZRKA 5HNGA 4NTTA 2WTWA 2YIRA 2OXDA 3GP0A 3NUNA 3OCBA 4WO5A 4ZLYA 3L8PA 2ZV9A 2IW9A 4C4HA 4UWYA 4BBEA 1JSTA 4E6QA 4W4WA 2ERKA 4G3EA 4S32A 4YLKA 4EH8A 5BYYA 3HAVA 3DBFA 4EOPA 3DTCA 1H1SA 5LMKC 1H28A 5CAPA 5DYJA 5ACKA 5IA3A 3I79A 3POZA 3TIZA 3EN5A 2XM8A 4EZ5A 4C4IA 4FV6A 5EDPA 5BVNA 2UW6A 4D0XA 1H00A 4XG9A 1V1KA 4KIOA 4GT3A 3RK9A 3CTJA 1A9UA 2BZIB 3GCPA 2YDIA 4CT1A 3BPRA 3I6UA 1ZMWA 3AC4A 3LFNA 3SQQA 4ASXA 3ZSHA 5D1JA 3V51A 2JKQA 3D5VA 1XQZA 2X4ZA 4MNEA 5FEQA 5IISA 2E9OA 5ANKA 4BWKA 4O27B 3RAIA 4I5PA 3I7BA 5IEVA 4BDGA 4G5JA 2R3NA 1W7HA 5DLSA 5AAGA 5C4KA 2ZJWA 3R1NA 3GU8A 3RM7A 4BYJA 1JVPP 3LCSA 2CNUA 3UP7A 5IG1A 5DR6A 1OZ1A 4M12A 4KRCA 3CR0A 4N6YA 3BLRA 3ZC5A 3TTJA 3ZUVA 1GZKA 5EM7A 4RX5A 5JQ8A 1YKRA 2AC3A 4FIFA 3P7CA 1FQ1B 2C69A 1I44A 3LOKA 3MB7A 3PE2A 2IVUA 4QQCA 3BV3A 4M97A 4V01A 5HU9A 3QC9A 1QCFA 2EUFB 5AMNA 3GQIA 3VUHA 4XUFA 4CRLA 3TN8A 4LUDA 2X2LA 4FV3A 3S2PA 1UVRA 3LQ3A 4FK6A 2XH5A 5IMXA 1YWVA 3KN5A 3UBDA 4UX9A 2X2MA 3NNUA 4WIHA 4TRLA 4D58A 4AGWA 3UDBA 4EOKA 4II5A 2Y8OA 2GNJA 4YLJA 2CPKE 1JAMA 3PZEA 3EQFA 1H24A 4BDBA 2IG7A 2IPXA 3T3UA 4MHAA 2XM9A 4A06A 4YJQA 3FI8A 2XNOA 4TN6A 5CNOA 4TTHB 5GHVA 1VEBA 3P79A 1A48A 3H10A 3ERKA 1H1QA 1OPJA 3N4VA 5JGAA 3PE1A 2ITWA 1JPAA 4C4FA 2FSTX 4BCJA 4ZZOA 2PE0A 3I81A 4UALA 3ZM9A 2V55A 1OBGA 4QP3A 3UIXA 1P4FA 4X6RA 3DAEA 2G2IA 3QLGA 2O63A 3VW6A 3DS6A 1FMKA 1MQ4A 5ETAA 4QD6A 2ZAZA 3UIMA 4DT9A 3M11A 4RJ4A 4IM2A 5KMNA 3GQLA 4RIWB 5HIDA 2VTSA 2WMVA 4AN3A 5CXZA 4O7VA 3D0EA 4YU2A 4IM0A 1OITA 3BQCA 3CXWA 4DGNA 2W5HA 3K5VA 2A0CX 3PFQA 5ANDA 2EVAA 4JDJA 3MVJA 4FKVA 4ZJJA 5M4UA 4E6DA 4Y5QA 1T45A 5CVFA 4E5AX 3FPQA 4CTCA 4QP9A 4R77A 1M2QA 4WNKA 4FV1A 1FMOE 1PY5A 1DAYA 5IQCA 4RJ5A 2O65A 2FSLX 2QLUA 3C1XA 3NEWA 2XRWA 2GU8A 4JVGA 4GKHA 4U5JA 4DT8A 4YHFA 2VWWA 5EYKA 4IE9A 1H0VA 4JG6A 4RA4A 4MXOA 3RAWA 2C6DA 2UZVA 4BDCA 5JKGA 4OT5A 4KIQA 4IFGA 4PPCA 5C4LA 3EQIA 4FSNA 4D0WA 4DFZE 5CSPA 2GQSA 5HD7A 2AC5A 3AT4A 4RJ7A 3LKMA 5EYDA 3KY2A 2PWLA 2F7ZE 4U79A 4V04A 3P78A 3MB6A 3DCVA 2QOKA 5K9IA 3PWDA 3EQHA 3C4EA 2HAKA 1ZMVA 2UVYA 2VZ6A 3QAME 3ZBFA 3EZVA 3R8ZA 3PXZA 2UZWE 2B52A 4WBBB 4PTEA 3E64A 2XYNA 2YHVA 2QU6A
chains in the Genus database with same CATH superfamily
4CG9A 3LXPA 3V5PA 5BVFA 4O7LA 3BHHA 3TM0A 5DEWA 3IGGA 4JAJA 4AA5A 4YNOA 4EJ7A 3AMAA 3UIBA 3EWHA 4FSWA 4I0RA 4EOOA 4DBXA 4NTSA 1OL6A 2GHLA 4JT3A 5JGDA 4O4EA 2B9FA 3BX5A 4FKUA 4WKQA 3CS9A 1UV5A 2HOGA 3ENHA 5CS6A 5DOSA 3IG7A 4IANA 4YJRA 3EFJA 1KE8A 5FTGA 5CQWA 5DPVA 3W2SA 5FBNC 4IH8A 2XS0A 3VIDA 2HCKA 4R3CA 5HE3A 4ASEA 4U81A 5IA0A 2OBJA 3FLQA 2CNVA 4HZRA 2Y4IC 2YIXA 3D5UA 3D9VA 3RWPA 4O22A 3VBYA 4HW7A 1Z5MA 4BIEA 3GC9A 1JWHA 2XRUA 5C26A 4QP7A 3B8RA 4XX9A 4QYHA 5L2IA 1U54B 2XNPA 4RZWA 5BVKA 4EHVA 1KE5A 2X7FA 4C4EA 4ZS4A 4ACHA 3EQBA 3FV8A 4GFOA 4CFMA 1BYGA 4JQ7A 2XKCA 4LGHA 2WGJA 5EOLA 3VUKA 3OP5A 3A7JA 3KRXA 5J8IA 2A19B 3EKKA 4C36A 2C1AA 2J50A 3SGCA 4F70A 2GMXA 3W2RA 5M06A 1OBDA 5LCJA 2HXLA 2VTNA 2I1MA 4F0IA 3O7LD 1RE8A 4TKSA 4KUJA 3QL8A 4ZY4A 3BEGA 4BZOA 5FEDA 4F9BA 3QU0A 1A06A 3QYZA 4M0YA 3HV7A 2QO9A 5M53A 4MAOA 2VAGA 2O3PA 3SDJA 4OAVB 2WAJA 2B0QA 5F9EA 1NW1A 3RHKA 2FVDA 4BBMA 2ZDTA 3SHEA 4FT3A 1LEWA 3P7BA 4C58A 3DK3A 4FOBA 4I41A 4QQTA 3QGYA 3Q9WA 3NFGB 4ZTSA 2C6MA 2WOUA 5AEPA 2VTHA 5JGBA 3DDPA 5FLFA 4BCFA 3MH1A 3DK7A 4DEEA 3KVXA 2QU5A 3MY1A 5HNBA 3RTPA 4FTUA 4DTAA 3W16A 1ZY4A 4DEHA 3O8PA 3EQGA 1M7NA 4IEBA 4RLKA 5A6NA 1YRPA 1BMKA 5CLPA 1OIUA 2WQMA 1VYZA 3EKNA 3MA3A 3LFEA 3PA3A 3ZLWA 2XARA 2YLEA 4KD1A 3R04A 4QTBA 4RSSA 3UMWA 2YWVA 3ZONA 3TXOA 5LWNA 2QODA 4JI9A 2LAVA 3TNPC 3SVVA 1TKIA 3PIXA 4GVAA 2VGOA 4GUEA 4IJPA 1KE6A 5AR8A 4I94A 4D4SA 1NVSA 3QQKA 4FSQA 4UMRA 5JMSA 3WI6A 4ZSEA 3GI3A 5EHLA 3EHAA 4YR8A 5CX9A 4K8AA 4F7LA 5HTBA 1IRKA 4I0SA 4JLCA 4A9TA 2R4BA 5IH5A 4L46A 3E8NA 3AKLA 3DB8A 1Q4LA 4H39A 1UKHA 3UPXA 4WG5A 4FE2A 3GUBA 1AD5A 3T8OA 3BYUA 1MQBA 2W5AA 3MIAA 4RC4A 4YUQA 1PMNA 5J95A 1ZRZA 3DLZA 4U40A 4FNZA 3RHXA 3TT0A 4ANQA 3LFQA 3E63A 5DE2A 1ZAOA 4DC2A 2WTKC 4UMUA 3FYKX 2RG6A 3V5LA 5LWMA 5DH3A 4DDIA 2QKWB 2C6IA 4HNFA 1SNUA 3KCKA 5TT7A 3OHTA 4J96A 4IX3A 4EBVA 5ACBC 5AR7A 5IMEA 1BKXA 4GK2A 4IDVA 4FTIA 3VW8A 5HBHA 1G8KA 1OPLA 3IW7A 2GTMA 2XK9A 3E5AA 4DHFA 3QCQA 4NCTA 5AA9A 3N4UA 3FLYA 4OTPA 2JDRA 3ORZA 4L68A 4G31A 3OCGA 3GCUA 3TACA 4CV9A 4CMTA 4XLVA 3W2CA 3DQXA 3UDTA 3UPZA 4MF0A 1Q99A 1YVJA 1V0PA 3ZLYA 4YZNA 3KRLA 3Q96A 2ERZE 5L6PA 3W0SA 3KVWA 3ORKA 3OROA 5CEIA 5AP1A 4QRCA 1KUTA 5I0BA 2HZ4A 2WEIA 1LPUA 4F08A 4FC0A 4O0TA 3KRWA 3R8MA 4TL0A 3I60A 3F2RA 4Z9LA 4N4SA 2NO3A 4IMYA 3TJCA 2BCJA 2RG5A 4OTFA 4BN1A 1LUFA 3GCVA 2X7OA 4FKIA 3ZEWA 5GNKA 3QGWA 2YM6A 1GIHA 4IBMA 3TKUA 3TZ8A 2J51A 5E9EA 3BU5A 3OY1A 4LV8A 4DTBA 4BBFA 4W8DA 4MWHA 3VULA 2W9FB 4X2GA 3OUNB 1R3CA 4UXQA 4FKLA 3SXRA 4PP7A 2NNWB 2QKRA 3EQCA 1H01A 1OIYA 4DN5A 3LAUA 3DKOA 2WU6A 4CMUA 4QDVA 4JDHA 3NCGA 3RZFA 3O71A 5FXRA 5D11A 5E8SA 3BE9A 1Z9XA 4IB5A 3FQSA 3QQGA 3IW4A 4RZVA 4ZS0A 5IQGA 2NP8A 4C59A 5IQFA 5L4QA 4K77A 1NY3A 4EUUA 3CKXA 1YHWA 3BHVA 2CGWA 3BU6A 3OEZA 4U3ZA 3AKJA 2VWBA 4N0SA 4EHEA 4O0VA 4GK4A 3R2BA 3JS2A 1J7LA 2YM4A 5KMOA 4AE6A 2EB2A 5K3YA 2VX1A 2XEYA 2BAQA 2J90A 2PSQA 1XBCA 5DHJA 3Q4TA 4BHZA 4Z55A 4CG8A 4D2RA 3U8WA 3BE2A 5CSXA 5KO1A 2O8YA 3R7VA 1WBWA 3KULA 1W2CA 5LXMA 2FB8A 3VNTA 5J79A 1JLUE 2XB7A 3MI9A 3LQ5A 4L3JA 4L9IA 3BHYA 5FWKK 5HG9A 4EZ3A 3MH0A 1VYWA 4G3FA 4QMZA 5ANGA 2B9JA 3QQHA 3UYTA 4F7SA 3RWQA 4AAYA 1SVEA 4PDYA 3L8XA 2JGZA 2OZOA 4H3QA 1J7IA 4XG2A 4YZBA 4D2WA 5DI1A 3VHEA 2ZMDA 4GU6A 5GIOE 3GC8A 4UZHA 1T46A 4ZTHA 3ANQA 4QP6A 1ND4A 2F2UA 3MFTA 3OZ6A 2A4LA 4FKJA 4G3CA 5HI2A 2RFNA 4XP2A 5I9XA 4ENXA 5L3AA 3PWYA 4BHNA 4AZTA 2UW9A 4R3PA 2E9VA 2OH0E 4BJJA 5HG7A 3QZHA 1J91A 2GFSA 4QMTA 3OW3A 4AT4A 2Y0AA 2UW3A 4BZNA 4D55A 4DEAA 2VX0A 4NSTA 3EYGA 4C2VA 5EM6A 2JEDA 3SA0A 5CAUA 5T3QA 3K5UA 4FF8A 4XS2A 3OCTA 4U97A 3UZRA 3D2IA 4NJDA 3OXTA 4EH4A 2R3JA 3PY0A 4L7SA 5A4EA 4CT2A 5LMKA 3NUAA 4ZMEA 1SNXA 1VR2A 2RIOA 3FMMA 3KXGA 4EL9A 3SXFA 3DXPA 3OXIA 2P33A 5JEBA 4IADA 3Q52A 5L2SA 3BLHA 2PTKA 1M14A 5CSVA 2CKQA 3G0EA 2PY3A 2NRUA 2R3IA 3KQ7A 3P9JA 4C35A 5ICPA 3NPCA 4IWQA 2ETRA 4JBPA 1ZARA 3KF7A 4D4VA 3ATTA 4D1SA 2F9GA 4GH2A 4CNHA 2YN8A 4DFLA 4EK5A 2QCSA 2Y6OA 3JUHA 4DTKA 1YW2A 4EH6A 4L6QA 2OKRA 4XCUA 3FL4A 3QA8A 4GL9A 2RFEA 2C6KA 4FKSA 4RJ6A 3W18A 1M52A 5BMSA 1H1PA 3WF8A 4RWIA 3TNQB 4DH3A 3C4CA 4O4DA 4YPSA 5H3QA 3V3VA 3E3PA 3CPCA 1CSNA 4QQ5A 2VO0A 1G5SA 2R3KA 4RT7A 3IECA 3R71A 3UQFA 4RVLA 3GXLA 5LJJA 3C0GA 2IVSA 4AXDA 4RA5A 2DS1A 2PUUA 1BX6A 3KXZA 4YHTA 3OWKA 3E8CA 1PXLA 1XR1A 3OG7A 4Y5HA 1XWSA 5J5TA 5HTIA 3MTFA 3Q9YA 3ZSGA 3C5IA 3UG2A 1W8CA 4PTCA 1QMZA 4O84A 1Y8GA 4UYNA 3D83A 2OJGA 3SOCA 3MVHA 1ZMUA 4IQ6A 2QOQA 4QO9A 3VS1A 4B8MA 5AM7A 4I1ZA 5F20A 2YERA 3U6JA 3VF9A 3VS3A 4I24A 4H36A 3OTVA 3F7WA 1KV2A 2WMRA 2R9SA 4J95A 5G1XA 2OF2A 4G17A 4XBUA 4C38A 5FDPA 2WQBA 4MUQA 1QPCA 3PUPA 3BKBA 3ORTA 1LP4A 4QP2A 2ZOQA 4ZEGA 4QMXA 4FGBA 4PMMA 3R9DA 2PVRA 3WZKA 3V01A 1NA7A 3WE4A 3PP0A 5I5ZA 3CSVA 5HBEA 4FUYA 2H6DA 3ALOA 4QNAA 5EK7A 3IW8A 4CKJA 4GJ3A 3NNVA 5L2QA 4EOQA 4GFGA 4AZSA 4BCGA 3EQPA 3G9NA 4D2PA 4IZAA 4CFFA 5D12A 4P2KA 3W1FA 4L3LA 4WA9A 3E3BX 4YZMA 5DFPA 5CANA 5CU6A 4F9YA 3DFCB 3MWUA 2QOIA 4X6QC 5JRSA 5D9HA 3QTIA 5JSMA 4PY1A 2C5OA 3PG1A 3TCPA 5GJFA 3ZUTA 1UU7A 2B55A 1DAWA 5KHXA 4X2JA 4Q9SA 5E4HA 3QFVA 1XH8A 4CD0A 4FZ6A 2X81A 3JVSA 4I6QA 5HESA 4DEGA 5C8NA 3FMLA 1ZYLA 2PE1A 3GC0A 4ID7A 2PZRA 3VQHA 2BALA 3NCZA 3REPA 2GNFA 4FT0A 4YJSA 3QWKA 3HUBA 3FKLA 4AOTA 5CQUA 4P4CA 2E2BA 3FWQA 5A3XA 2VWIA 2R0IA 3BYSA 4HGSA 3FYJX 4D5HA 3CJFA 4UMPA 3H9OA 4Z16A 5H8EA 3WBLA 4ANNA 3AXWA 3TZ9A 3HEGA 4CVAA 2BHEA 5JH6A 5M07A 4BRXA 3C0HA 1H26A 3BI6A 3TV4A 3QBNA 4PUZA 3D7TA 5HOAA 2HENA 4G6LA 3ATSA 4EH7A 4LDTA 1S9JA 1ERKA 5HGIA 2BAKA 5BVOA 4FT9A 4LRMA 4USFA 4EUTA 2VTIA 4NH1A 1O6YA 3OEFX 5AV2A 4ZIMA 2R2PA 3LCOA 3A99A 2ITVA 3M1SA 4RX9A 3AGLA 5CYIA 4YZDA 3T3VA 5ETIA 4DH8A 1JKSA 2GNGA 2V7OA 4A7CA 2ZVAA 2VO6A 4D5KA 3FI4A 4IX5A 3OY3A 2ACXA 3MS9A 3R01A 2PUNA 3V5TA 3LPBA 3QQJA 5IEYA 4MBLA 3W0QA 5KHWA 4E4MA 2IVVA 5IQDA 1JKKA 4H3BA 3U4UA 1K3AA 4W4VA 4XOZA 3VWAA 2YM7A 4FEVA 4IVDA 4LFIA 4FEQA 3F9NA 3MH3A 4FNYA 3R7YA 2I40A 4BDFA 2XBJA 4O4CA 4FIEA 4O96A 4C3FA 4AXEA 4BWXA 5KE0A 5DRBA 3SXSA 4O7SA 4ORKA 1Y6BA 4W4YA 4F6WA 4MVFA 5AR2A 4C4GA 2PL0A 5AADA 4PMSA 4KS8A 5FBOA 4R8QA 2O64A 3MJ2A 4ACGA 4ACCA 5IQEA 2VNWA 3Q04A 1J1BA 3ZDIA 1ZWSA 3FL5A 4TNBA 4YMJA 2V62A 3E8EA 3KMMA 3P7AA 5HEZA 5M4IA 1DM2A 4QOXA 4ZTRA 4BC6A 4FIIA 4FX3A 3UOJA 3R1SA 4KSPA 4XHKB 5BYZA 3RNYA 3MGYA 5CU0A 3QALE 4TYJA 4HOKA 4QMUA 4AZWA 1HCLA 4FL2A 4AUAA 4I6BA 5BQ0A 4BCOA 3ULZA 1BLXA 4IAZA 4PPAA 4L43A 4AU8A 3U9NA 2QC6A 4IVCA 4ARKA 1ZY5A 2BRNA 4YPDA 3UIUA 3W55A 1WVYA 2PMOX 4NFNA 4J1RA 3ZFXA 4JG8A 2YAKA 4RRVA 3AT3A 2R64A 5I9UA 2CMWA 4AW2A 4AZFA 5I9WA 4E4LA 2VTQA 4J99A 2JITA 3IQ7A 4EC8A 4JJRA 2YDKA 4XV9A 4O6EA 4WSYA 5TE0A 1U5QA 4O0RA 4FTAA 2GNIA 2V0DA 1WBNA 2X0QA 2WELA 4FTQA 4LUEA 3U9CA 3LE6A 4M69B 4U9AA 4I4EA 4YO4A 3QCXA 5JK3A 5IKWA 5IA4A 4RWLA 3GT8A 2REIA 3W0OA 3KF4A 3PPKA 1B39A 3SC1A 2IZSA 1V0OA 3UZTA 3ZC6A 5DVRA 1GOLA 3AMBA 3BGZA 3F3TA 3OS3A 2UZOA 4IB1A 4XG6A 4TYHA 3R6XA 3SX9A 3TDWA 5FP6A 3BBWA 2ZM3A 4U7ZA 2PZYA 3R7UA 3QXOA 3ZLXA 2CSNA 5E8ZA 4O7YA 4JRVA 5DA3A 5AAEA 2VV9A 2C6LA 4CXAA 5A4CA 4W9WA 4E3CA 5TF9A 2CN5A 3EZRA 4ANLA 4FZ7A 4H3PA 3SD0A 1MRYA 3MVLA 4YTIA 4OAUC 2XAMA 1UWJA 4P5ZA 5CT7A 5AP3A 3CBLA 1REKA 4JOAA 3LFBA 4K33A 3UNZA 2X6EA 3FQEA 1YXTA 3PG3A 2ZM1A 4IW0A 4NU1A 4QNYA 2OGVA 2YCSA 3I4BA 3L1SA 2XKFA 5BV3A 1KOAA 4HYIA 4O7ZA 3JVRA 5A4QA 5AV4A 1E1VA 3ZLSA 1SVGA 5C9CA 3MY5A 4QMNA 3SW4A 3VBXA 3L8VA 2ZV2A 4FI1A 2QOLA 4WT6A 3BYMA 3TUCA 3E62A 3PDTA 3WF5A 4J53A 4HVIA 4F1TA 2X9FA 4G1WA 5HCXA 3WF9A 5HG5A 2OH4A 5BVDA 4TYGA 5AX3A 2F4JA 3I6WA 3VN9A 2WMBA 4ALWA 2OJIA 5J1VA 3PUFC 2HK5A 4JXFA 3R8UA 3DFAA 3CTQA 4B8LA 5CASA 3ZSIA 5FTOA 5CVGA 4D1ZA 3WZUA 2C5VA 5AP0A 3ANRA 1OB3A 3O0GA 5EYCA 3HUCA 3OCSA 5BUIA 4C3PA 3DK6A 4JDIA 2VUWA 3KK9A 2OWBA 4FVRA 4E7WA 2J2IB 3I5ZA 4CLJA 1PF8A 4L52A 2J0KA 3I0OA 4Y73A 4DITA 2OO8X 4KRDA 4DGGA 4PP9A 1UNHA 3A8WA 2YCFA 3E87A 2C6EA 3UODA 1UKIA 4BDHA 3QTXA 3H9RA 5F95A 4USEA 4BTFA 2P3GX 5CF4A 2X39A 4I5HA 4ZJVA 2OZAB 4NT4A 3P0MA 3VS7A 2FGIA 5CU4A 4L53A 4FYOA 4BKJA 4BZDA 2UZEA 3PIYA 4WHZA 1QPJA 2VO7A 3TUBA 3TV6A 1Q24A 3WF7A 4R78A 2OSCA 4RFYA 2GDOA 3G6GA 3KU2A 3LMGA 3W10A 3ZRMA 4D2TA 4G9RA 2ONLA 5IQAA 1Q3WA 3ULIA 2XAOA 3FZOA 4FV4A 5IQIA 3PIZA 3BRBA 2BDJA 1UNLA 3PP1A 2J7TA 4ZXTA 1SYKA 4CFWA 4I6FA 3F5PA 3AMYA 5EFQA 3VONA 3PVGA 3ZYAA 4TW9A 1KOBA 3NYVA 4CRSA 3MH2A 3NNWA 5FG8A 3AGMA 3U55A 2X1NA 2PMLX 5LVNA 3EB0A 4XG7A 4P90A 2F57A 4ANBA 3R1QA 3R21A 2C68A 2G9XA 5BVWA 1OVEA 2W05A 3ZMMA 2YAAA 1YOMA 1M7QA 5AP5A 2VTJA 4G2FA 2WMQA 4AA0A 3ZO1A 2WTKB 3OWJA 1HCKA 2W17A 3R83A 3THBA 4F1OA 1YI6A 5IQBA 5AIKA 3P1AA 2CGVA 4AE9A 5KMMA 2ITXA 3F6XA 2XNMA 4YZ9A 4FTTA 3MV5A 4QT1A 4IM3A 3UTOA 4HPTE 3ET7A 3HAMA 5LMBA 1OL1A 4O4FA 5CEQA 1I09A 1PXIA 2BRBA 4KKHA 2XNBA 4XH6A 5IF1A 3DT1A 4FKTA 3BHUA 3FDNA 3CY2A 3VUTA 5B7VA 5M44A 2BUJA 2GNHA 4K1BA 4B4LA 1NXKA 4JS8A 3MFUA 2WTJA 5J9YA 2PPQA 4BL1A 2JC6A 2C5YA 5K4JA 4S34A 2GS7A 3RCJA 5B2LA 2PMIA 5B0XA 3VQUA 4X2NA 4UY9A 3R22A 1F3MC 1KE7A 2H9VA 3QTZA 3R00A 4RIYB 5KMIA 4XP3A 3R8LA 1JKLA 3KN6A 5HCZA 2J4ZA 3D15A 4QMOA 5EM5A 1REJA 1WBTA 3BELA 3P23A 2BDWA 5ANEA 3VUDA 3F3WA 4ZSLA 4NM7A 5IU2A 1IA9A 3C7QA 4PQNA 2HZNA 4K18A 4WUNA 4FT7A 3ZFMA 3ZEPA 3JY0A 2GPHA 3E7OA 2UW7A 2X8DA 3OT3A 3Q2MA 3WE8A 4AOJA 4BIBA 4DAWA 2FSOX 3VRZA 4UBAA 5CI7A 3ZDUA 4JBVA 3LMIA 3QTWA 3GU5A 3E92A 4CYIA 5HICA 4YNEA 3FLZA 3QZIA 4D2VA 4I0TA 3HNGA 5CENA 3CE3A 3R02A 4D9UA 4DFNA 4PL3A 2RKUA 4LOOA 5AIRA 5KKRB 4FICA 1R1WA 5M08A 4DCEA 4AG8A 2C3LA 4AGUA 3G15A 3CPBA 3MFRA 4MNEB 4R5YA 5E1EA 2ITQA 3FLNC 3TIYA 3S4QA 5EI8A 3TKIA 3VBWA 2X8EA 4MQ2A 4B7TA 4ALVA 3R7OA 4DLJA 2WO6A 5BYLA 3R30A 3HMIA 2W1CA 4WG3A 5E8TA 1ST0A 1PYXA 3OWPA 5AFVA 4HGTA 4XG3A 4WUAA 1GZOA 1Y57A 3E93A 4FTRA 4O4BB 3WF6A 5E7RA 3RPVA 3ZH8A 5EW3A 3W2PA 3ZO2A 4BVUA 4PL5A 2HY0A 5CEPA 1G8SA 5CAOA 4DG0E 2BVAA 5FTQA 4OTGA 3L9NA 4FGRA 2WMAA 4C2WA 2P0CA 5E8YA 1R39A 2HIWA 5JZNA 3TV7A 5DBXA 2PYWA 2OJFE 4NIFA 1H1RA 5BNJA 2KTYA 4RIWA 3NSZA 2A27A 4O7TA 3EL7A 4O91A 5DN3A 2W9ZB 4N57A 3DU8A 4F6UA 4O38A 4QMMA 3RINA 4A4OA 4S31A 4CFXA 4GG5A 2EWAA 2PZ5A 2HW7A 2J0MB 3F2NA 4V0GB 4YSMA 2UZNA 4FNWA 4CV8A 4NL0A 4O83A 2QD9A 5HQ0A 2B1PA 4Q9ZA 1F0QA 1FGKA 4AWIA 4OBPA 5GJDA 3Q6UA 3QQFA 2X0PA 3UMXA 2VWUA 2YJSA 3ZM4A 4A9YA 3H9FA 4DA5A 1BI8A 2FO0A 2XKEA 4O82A 2NPQA 2YIYA 3ITZA 2BMCA 3NS9A 5HLPA 3RI1A 1L3RE 3AT2A 4FTMA 2A1AB 4LV5A 3BZ3A 3FMDA 2C0TA 3CKWA 5BUEA 3ZU7A 4F7JA 3L8SA 4H58A 5EOBA 1BUHA 4O0XA 3DAKA 3Q60A 4KSQA 4MKCA 2YA9A 1DS5A 3RAHA 2QVSE 2OK1A 3V6RA 4AXAA 2G2HA 3FY2A 3PXFA 3Q4CA 4C37A 4EOMA 3DA6A 4AXCA 1Q8YA 4DH1A 5L8LA 2ZYBA 2XEZA 1GAGA 5K4IA 2IJMA 4M84A 4J98A 4RIYA 2R3RA 5IQHA 4ITHA 5FXSA 4F65A 2WMWA 5ANOA 2CGXA 4IWPA 4MXZA 1R0EA 4G34A 5EW8A 4YTFA 1WBPA 5HIEA 5IA2A 4OT6A 3TZMA 2P2HA 4PV0A 4NIFB 3RPRA 3PXQA 2W1GA 3DOGA 3H4JA 4AZVA 4J52A 4CFVA 4YJNA 4EK3A 5HBJA 2J5FA 1M2PA 5EM8A 3F5UA 4BKYA 4GVJA 4E93A 4JBQA 4XLIA 4Y85A 2BZHB 2EXEA 5CNNA 5L2TA 2W4OA 4GIHA 4FMQA 3R9OA 1TQIA 1WFCA 3F3ZA 3NWWA 4I3ZA 3PXKA 4JNWA 4Q2AA 1PXJA 3L9PA 5HNIX 4IB0A 5I4NA 4MF1A 4O6LA 3UG1A 3ORLA 2WQEA 2Y4IB 3ACJA 2JDVA 2OIBA 1VLRA 3DDQA 4L7FA 3N51A 2RL5A 1XH6A 2OXXA 3QRIA 1ZXEA 4NKSA 4YP8A 4E8AA 3DJ5A 4RGJA 5AV1A 3MBLA 4F9AA 4DH7A 2JDOA 3QUEA 4YJPA 3KXHA 4ALUA 4TXCA 1OL7A 2XIZA 1ATPE 2I7QA 3VBQA 3Q4ZA 2WU7A 3CQUA 3U4WA 4EI4A 4FTJA 3CCNA 1OPKA 4GYGA 1UNGA 4A9SA 2QURA 3IDCA 5HE2A 4IHPA 4LGGA 5HE1A 1XBAA 3CGFA 3CQWA 4EWHA 3O7LB 2OIQA 4UWBA 5T6KA 4JX3A 4FTOA 4XV2A 1O6LA 5DG5A 2YIQA 3SKCA 4F64A 4A4LA 3FC1X 2GHMA 2ZMCA 4FTNA 4UMTA 4GUBA 3W0RA 3ZO4A 4LM5A 2VX3A 4GV1A 5HVKA 5JFWA 1CKPA 3VF8A 4DH5A 3ENMA 4PX6A 3GENA 4BCPA 3FHIA 4R5SA 3FC2A 4LYNA 2XIXA 4NWMA 3VHKA 1XH5A 4FTLA 3NX8A 5A4TA 3RBWA 4OTDA 3RP9A 4ZMFA 2OW3A 3EN6A 4I20A 4LMNA 2OFUA 5F1ZA 3RZBA 4F7NA 5CF8A 5F94A 4JG7A 1BI7A 3HA6A 3G9LX 4DHZA 4QYYA 3DZOA 4NW6A 2Y9QA 4HNIA 4AW0A 4BGGA 4KS7A 3HKOA 3DNDA 3PVWA 3KGAA 3WZDA 4NZWB 4M13A 4O0WA 5CTPA 4IX4A 3QCSA 2QHNA 3E88A 4AAAA 1XBBA 3MESA 3QUDA 2CJMA 4YGAA 3UOLA 1U5RA 2HZ0A 3FXWA 5HIBA 5A46A 2I0VA 5T68A 3IW5A 3F82A 3LJ2A 5BX0A 2JDSA 3NW7A 4HGLA 4KBCA 4RVTA 4EH9A 4QDEA 2OXYA 4G9CA 3BQRA 2ESMA 3UYSA 1QL6A 3FZTA 3PSDA 3UQCA 4M66A 3COHA 3ZTXA 4YO6A 4CZUA 3DLSA 2Y7JA 4FL1A 4WNOA 4E4XA 1XH9A 5K5NA 2OI4X 3AD4A 5CEOA 5I9VA 3IONA 3NUYA 4ZTNA 2VTAA 3PZHA 5GZ8A 4RVMA 2O5KA 4NM0A 3DQWA 2W4KA 1GIIA 3BV2A 5HE0A 2QG5A 4M0ZA 3DTWA 3NUPA 4QMWA 4RBLA 2VGPA 3O8TA 3FZSA 1TQMA 3NW5A 3QYWA 3TDVA 3F69A 3QTSA 4GSBA 4K2RA 2W1IA 3NGAA 3HV6A 4U8ZA 3NLBA 1OL5A 3LXKA 1DI9A 4GT4A 1V0BA 3DJ7A 2X0OA 1XH4A 3ORIA 3HRCA 2HXQA 3NR9A 2Z60A 2XK6A 1OKYA 4G5PA 5DNRA 3BYOA 4BDKA 3CJGA 3R2YA 4NCTC 4Y46A 2PVFA 4ZY5A 4ZLOA 5FRIA 3NIZA 5CVHA 1W0XC 3KMUA 3ETAA 2NRYA 4FVQA 3LFAA 4EHZA 4G16A 4TT7A 2CDZA 4IAYA 5C27A 2X7GA 2GCDA 3P08A 1NT2A 1QPEA 4R7BA 2B4SB 4FTCA 2R3OA 4FG9A 4DG2E 5BVEA 4XBRA 5K0XA 2R0UA 2O2UA 1FVVA 3ZRLA 3AOXA 3AG9A 4C8BA 4EQMA 4FA2A 2QO7A 1FINA 2Q83A 2BAJA 3RKBA 4I21A 2XANA 1H07A 4XMOA 2XZSA 3D7ZA 4FKWA 5F4NA 2R3MA 2YM5A 4HGEA 2UW5A 3OMVA 1PXNA 4D4YA 4KABA 4C33A 5DT3A 2P4IA 4OBQA 4ANMA 3OOGA 3V8SA 4CZYB 3V5WA 3COKA 4IVAA 4UYAA 5FD2A 2QQ7A 3FMEA 3P5KA 2GS6A 1Y8YA 2WIPA 2X6DA 2YWPA 2VN9A 3H30A 4G3GA 3RVGA 2F49A 3FSKA 1E9HA 3FLSA 3ORMA 4BR3A 4DEDA 4X7QA 4UN0C 4USDA 4AN2A 4QTCA 2QHMA 2XMYA 3LW0A 3QF9A 2PU8A 4H05A 3COIA 5K0KA 5FQDC 3KEXA 3FKOA 2GSFA 3BLQA 3DBQA 5AP2A 2W96B 3O50A 3QX4A 4OGRA 2R3FA 2R5TA 1XMLA 2R3PA 3CIKA 3CP9A 1W98A 2BTRA 3QWJA 2PVLA 4FSYA 3O8UA 4FV8A 3POOA 3QD3A 4QQJA 4EH3A 3GGFA 4K0YA 1XHAA 4M7IA 3FHRA 5IPJA 4RMZA 2YEXA 3EFWA 2GTNA 3QRJA 2XP2A 4HZSA 2X2KA 4FZDB 4QMYA 2WHBA 3R1YA 3DY7A 4FKOA 3KA0A 4FV2A 4TNDA 4WRGA 1W82A 5A4LA 3SRVB 1YI4A 3FPMA 3WIGA 3QRTA 4E1ZA 3R9HA 4MH7A 2WZJA 5LARA 1SM2A 4L67A 3HP5A 3EQR