4FV3A

Crystal structure of the erk2 complexed with ek6
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
346
Chain Sequence
b'PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK6
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 346
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv3A01
3CE3A 4O81A 2GHMA 2R3NA 3OZ6A 4QMSA 3EYHA 2X6DA 4JL9A 3PSBA 3V5QA 4BCFA 5L2SA 1URWA 2IZUA 3U8WA 2XKDA 5ITAA 2VO7A 2FVDA 2QHNA 3MBLA 1YWRA 3PVUA 4XP2A 3DKCA 1J7LA 3TUDA 1VZOA 4AW1A 2SRCA 5GNKA 5J1WA 4C33A 1WBSA 2OIDA 3MVMA 4AOTA 1H8FA 4B8MA 2EUFB 2OGVA 3F61A 4DG2E 4YLJA 3DKFA 5KMKA 5ETCA 4BI0A 2RF9A 5BYYA 1YOJA 4U9AA 3QQFA 5HQ0A 4YHTA 5AUYA 5M55A 2W5HA 3SLSA 4F6SA 2XMYA 3DTCA 3F3WA 4MBLA 3WZJA 5L2QA 4EC9A 4PL3A 4HGTA 1OIYA 2C0TA 4GJ2A 3O51A 3U4UA 1JNKA 4FZ6A 2I1MA 4Z7GA 4QMOA 2EB3A 3KCFA 4L7SA 4L52A 3MY1A 4FOBA 3ROCA 5A4EA 4HGLA 3GQIA 3MSSA 3F2AA 4PMSA 4V0GA 4CMTA 3D4QA 3D0EA 3DCVA 2Y6OA 3R63A 3F5PA 4ID7A 3QFVA 3ORIA 2BRGA 3LMIA 2GPHA 1MRUA 3A61A 3MV5A 4MD7E 2VRXA 3HA6A 5FEDA 3UG1A 3H9FA 2C3KA 3F5XA 4O0SA 2VWWA 4ACCA 2ZDUA 1H1WA 3SXRA 2XCKA 2GTMA 2OK1A 3ZUVA 1OPKA 3VUHA 1OPLA 3E8DA 3PIXA 4IACA 5HG5A 5JK3A 1IA8A 5ANKA 1JKSA 4AZWA 3GI3A 5EH0A 5E8WA 4DFLA 4OT5A 3O71A 4FG7A 2UZUE 4O0YA 3SKCA 4EK5A 3BBTB 3KULB 3AC1A 4NIFB 3POOA 5AV0A 2Q83A 5KX8A 1H26A 2QKRA 4FZ7A 4BCKA 1Q3WA 3UOHA 4F09A 4Y85A 3VULA 4P7EA 2WTWA 3GCQA 4FVQA 3BRBA 2WMVA 4JDJA 3NUUA 3EN6A 4C7TA 3ZO2A 3TUCA 3ZO3A 1W7HA 2B9JA 2ITTA 4CEGA 5F9EA 4UALA 5K5NA 3ZM9A 1TQMA 2GNJA 1HCKA 3BZ3A 2PYWA 4YHFA 2BIKB 5CSXA 3DNEA 3C1XA 5LMAA 4FV2A 1I44A 5C4KA 2I0EA 5ANOA 4BDAA 3QX4A 4WG3A 3P23A 3VS3A 2YDJA 3VW8A 5L6PA 4JAIA 5J8IA 3PSDA 4FSYA 3QTXA 4OTIA 4I6HA 2YEXA 3QZGA 4ZSLA 4YP8A 4EJNA 3PZEA 3R0TA 4CFNA 2JKQA 3MN3A 4M14A 4DTAA 2X4FA 4U6RA 2QHMA 4FKPA 2IVVA 2QOHA 4DFZE 4F4PA 3RAKA 2XB7A 2WU6A 2C5YA 4D2VA 2G2IA 3GP0A 3IW4A 5FQDC 4QOXA 3FAAA 4EEVA 2QOFA 2O64A 3F9NA 4KUJA 5EQYA 2BVAA 4IAIA 4IWDA 4P5QA 4PP9A 3DAKA 4QRCA 3MPAA 3EZVA 4QYHA 3EFKA 4YZMA 3GNIB 4BDFA 2YM3A 4N57A 3JY0A 2B9IA 2W7XA 4HPUE 1YXUA 3GVUA 2W1HA 3IW8A 3QTIA 2VTOA 1ZMVA 1W82A 2J6MA 3UVQA 1BI8A 4NM3A 3ZO1A 4D9UA 4O7LA 3BHTA 3FI2A 3C7QA 5DWRA 3E3PA 1WVXA 1BX6A 3KF7A 5H8BA 1O6LA 5AM6A 1Q8YA 2JKMA 3MJ2A 4FIFA 5DG5A 2ERZE 4F7JA 2NPQA 5CEIA 3BLHA 4LMNA 4QYYA 5LVNA 3SA0A 2OIBA 1OIUA 4EONA 3PVWA 2ETMA 2IN6A 5B2MA 2Y6MA 5HHWA 1H1PA 3COHA 4ALUA 4OTQA 3LFDA 4QQCA 5E8ZA 2CNVA 3KULA 4NIFA 4RC3A 3NUSA 3OVVA 3P0MA 3Q52A 3TXOA 3RWPA 3O50A 3MH2A 4XG8A 5AEPA 2PZ5A 1XH7A 1XJDA 1MQ4A 4I0SA 5HOAA 4LUEA 5FXQA 4DC2A 3HMIA 2UVYA 4K77A 2VUWA 4CRSA 3QXPA 4CYJA 3S0OA 4DGGA 4HZSA 3W2OA 2GNLA 5TT7A 5FUTA 3ZLWA 4DFXE 4YZDA 5ACBC 2VTHA 3QHWA 4DLIA 1DM2A 2PTKA 4ITIA 1YWVA 3R8PA 4LGDA 4WO5A 3U9NA 2YAKA 2F2UA 3VUTA 2ESMA 4FODA 3P5KA 4CT1A 4BCMA 5E8VA 2R7BA 2B52A 4RX7A 4TYHB 4UV0A 5AV1A 3RM7A 2EXMA 3OHTA 4CMOA 3QUPA 2W9ZB 2X8DA 3OY1A 2PZRA 2YJSA 1RQQA 3OROA 4QMPA 5A54A 2RIOA 3MPTA 3A4PA 3DB8A 4A9RA 1QPCA 3NNWA 4GYGA 4MQ1A 2JEDA 4H3BA 4X3FB 3TV4A 3V01A 4EHZA 5C26A 1Y6BA 3EQBA 3AD4A 5DPVA 3F5GA 3FLQA 3GEQA 1U5RA 3ANRA 3DBFA 5EKOA 3ET7A 1PYXA 3LW0A 4M8TA 4M7IA 4EZ5A 2ZV7A 5A14A 3FKOA 2QD9A 4L44A 4IQ6A 2YM5A 4FEQA 2VTTA 2W1GA 3QBNA 2QC6A 2WGJA 4EYMA 2W1CA 4QMNA 5EM5A 4I23A 4A4XA 2XS0A 3PFQA 2W5AA 1UNGA 4G31A 3TTIA 4UBAA 4BN1A 4ASXA 4A9SA 5DOSA 4PDPA 2F4JA 1SNXA 3PA5A 4YUQA 2GMXA 1PF8A 3A2CA 2G01A 4F64A 2WPAA 4G3DA 5DN3A 3NRMA 2VTJA 4GIIA 4I0TA 2C3JA 3Q60A 4FTNA 4UYNA 4IFCA 4UXLA 4KKHA 4W4WA 4X2JA 4NJ3A 4QMLA 5KMNA 2HY0A 4N6ZA 5HVYA 1RDQE 2P2HA 3FQSA 4BYIA 3FMEA 1Q24A 3WE8A 5KNJA 3MYGA 3R1QA 3AQVA 4YPSA 3M1SA 4O0UA 1FBNA 2C6IA 3C13A 4O86A 2R3PA 5HE1A 1ZARA 3QD3A 4YJOA 5IH6A 2CLXA 4O0XA 2WMTA 4FSTA 3VC4A 4NEUA 4X2NA 4R78A 1OIQA 3DNDA 5EI2A 4IVBA 4C2VA 4FYNA 3UIUA 4DINA 4B8LA 5L8JA 2V7OA 3NDMA 4FSUA 5AUZA 1LEZA 1T46A 5H9BA 4V05A 4KIQA 4QP8A 3H3CA 4TNBA 3A7IA 1PXLA 3LE6A 4MWIA 5K5XA 5I9VA 5L8LA 4A9YA 3FHIA 3ZCLA 4EOIA 4Y73A 1DS5A 1PKGA 5JKGA 5BQ0A 2UZNA 5C9CA 5FLFA 1ZY5A 3DZQA 2H34A 4L3LA 2G9XA 2YISA 2W1ZA 2W17A 4BZDA 3FUPA 4RJ8A 2JITA 4F9AA 4TYHA 2W0JA 3GXLA 5B2KA 5AP0A 3K3IA 2WQMA 4H05A 4JBVA 2QOQA 3UPXA 3M42A 3GBZA 2O8YA 2OJJA 3I6UA 4O6LA 2BKKA 3P79A 3QCYA 4MK0A 1BL7A 5AR5A 4R77A 3ZZEA 5CU0A 4DEDA 4G6NA 4M84A 4DYMA 2R3RA 3TZ7A 5HBJA 4EQUA 4X2KA 4X3FA 4BBFA 2QOLA 4J99A 2JKOA 4OTPA 3BEGA 3NW7A 2JKKA 5CYIA 4CZYB 4E5BA 2JD5A 3AXWA 3WOWA 4OTGA 2RGPA 4AXAA 4C36A 4BR3A 2XF0A 1J7IA 2ETKA 3KXMA 5CX9A 5HTCA 4G1WA 2RG6A 5JH6A 2FB8A 5CAUA 2O63A 5I9YA 4GSBA 2J0LA 3EZRA 1SM2A 1OUYA 3RKBA 4YJVA 3SW4A 2PUPA 3W32A 2UW4A 3BGQA 4BIEA 4O7NA 3SGCA 3R9OA 5AIKA 4GMYA 5DNRA 2PULA 3A8XA 2EXCX 4I93A 2OH4A 2F57A 4Y72A 3BHVA 3GU6A 4JIAA 4M97A 5LCKA 5DR6A 1FOTA 2Z7SA 4ANMA 4O7YA 2J7TA 4XG4A 2Y7JA 3RALA 2J2IB 2XCHA 5AV2A 5CF6A 4D5HA 3UZRA 2W1FA 4DEAA 4EOPA 2BRHA 5CTPA 4DLJA 5IZFA 3CD8A 3I7BA 2QNJA 4KINA 5KKRB 3TG1A 3D83A 2XK6A 4MH7A 3ZLYA 3IKAA 2OZOA 2QOCA 3GCUA 2OU7A 4GEOA 4DH1A 3ZHPC 2C47A 1V0BA 4XMOA 5CY3A 2NNWB 3CY3A 2XK8A 4MHAA 5IDNA 1UU7A 3FMMA 3R9DA 3QWKA 4U81A 3T8OA 4GIHA 2JIUA 2GQSA 2B7AA 3WZKA 4E4NA 2CNQA 3LJ1A 2HZIA 2WEIA 1UKHA 2W5BA 4IJ9A 5I9WA 2PMNX 4RT7A 4DHFA 4ZY5A 3UVRA 4BGQA 3DXNA 3UYTA 5K9IA 1NVSA 3PRFA 4FIJA 4J71A 4XV3A 4DCAA 2QVSE 2R64A 2VNWA 5J7BA 2VTNA 3QQGA 5AR8A 1XH4A 3GU7A 3QKKA 4BIDA 4PNIA 3FC2A 2QQ7A 5I9UA 3TV7A 4F1OA 5HTIA 1YOMA 4GYIA 4W9XA 4NM0A 1VR2A 1BL6A 3T9TA 4I5HA 4D4YA 1H1SA 3OG7A 5CU6A 1S9IA 5E8UA 1UKIA 3OY3A 4GG7A 3JS2A 4S33A 5I0BA 3QXOA 4MF1A 2JC6A 3FPQA 3DQXA 4BTJA 2H8HA 2Z2WA 4IIRA 3ZYAA 4R7BA 1OITA 3C50A 3F6XA 4L46A 4DBNA 3TKHA 4Z9LA 2PSQA 5AJQA 3R7GA 4FEXA 4K6ZA 4AW5A 2V5QA 4R1YA 1PMVA 3C4FA 2ZVAA 3O8UA 4KSPA 3BU5A 2XRUA 3BQRA 3RHKA 1ZYJA 3QA8A 5AFVA 4S31A 3LAUA 4U3YA 5CU4A 3UP7A 4TPTA 4PWNA 4QP9A 4CLJA 4BZOA 5HTBA 3IPHA 2C30A 1PMEA 4USDA 4II5A 4X0MA 2ZMDA 4QQTA 2XK7A 3ORZA 3W16A 2QR7A 1ZMWA 4EH9A 5LMKC 3BGPA 3HGKA 4YNEA 5DFPA 4D1ZA 3Q32A 2WTJA 4R3PA 2IW8A 4ZY4A 5HLNA 2OFVA 3V5LA 4CV9A 2ITOA 2ONLC 4FL1A 1U59A 3QKMA 1Q8UA 3BHYA 4FV8A 4I4FA 3HA8A 3IECA 5HG9A 4G9CA 3QGYA 3AD6A 4UMRA 4DTKA 5F20A 3NNVA 5HO7A 5BVNA 2F49A 4DFYA 1H25A 4FG9A 4H58A 4C58A 2WOTA 2XJ1A 4W9WA 3HUCA 4FV9A 4O6EA 2WMUA 5JRQA 3NYOA 4P4CA 3OEZA 4M66A 1GZNA 2CPKE 3IK3A 3NUYA 3QLFA 4O0TA 2ITUA 3UGCA 1PJKA 4IAYA 2YCFA 5AADA 1ZLTA 3LCKA 4CKRA 1RE8A 4PV0A 4XEYA 2WTKB 4RBLA 4CT2A 4FKTA 2OBJA 3I5ZA 2CCHA 2BMCA 5L2IA 2CKQA 4GFOA 3ID6C 4IDVA 5LOHA 3FMJA 3ZRMA 4MF0A 1O6YA 2C6OA 1ZMUA 1IRKA 4IC8A 1W0XC 4EZ7A 2OIQA 2OSCA 4RJ3A 3V5TA 2XM9A 4O2PA 2PUNA 4DH5A 3NW5A 5AP1A 1P4OA 2WHBA 4C4EA 1PXIA 3P08A 5B0XA 3UZPA 2A2AA 5BUEA 3KKVA 3H0ZA 3DBCA 3FLYA 4GV1A 4LV8A 5D11A 3BYUA 1JKLA 4BHZA 2CGXA 4OAUC 2C1AA 3EQCA 4FT7A 3VUMA 2B53A 1P5EA 4F0GA 3QTZA 1M52A 3E63A 2OXDA 3QTWA 4HJOA 4RLKA 1QCFA 3DS6A 1Y57A 3VRZA 5C8NA 1KE9A 3L9NA 5CNNA 4CFVA 3G2FA 5HEZA 3NNXA 3JYAA 4ZTHA 3VBTA 3R8UA 4ACGA 3KXGA 4JNWA 4A4LA 4D2RA 2ITZA 5HCXA 2BAJA 5TO8A 4BDBA 4TKSA 2PVLA 3PIYA 4G16A 2C6MA 2C69A 3I81A 4FNYA 4RIYB 4XJ0A 2QOIA 2GQRA 5HCZA 2B54A 2ETRA 3PY0A 4F63A 4PPBA 3GU8A 4JDHA 5CI6A 3TN8A 4C34A 4R7HA 4EOSA 1OL2A 3OCTA 3FHRA 3PY1A 4GU6A 3ITZA 4RSSA 3A7JA 3I60A 3K3JA 2B4SB 2VAGA 4TYJA 4F6WA 3IQ7A 3KREA 5KZIA 5IG1A 5E9EA 4RVKA 2VX3A 4EH6A 4Z55A 1NVRA 4AZSA 2R7IA 2YA9A 4F1TA 2ACXA 3NUNA 3I5NA 3GGFA 2V62A 2AUHA 2IZRA 3EYGA 3FI3A 3UVPA 4LRMA 1OM1A 5CU2A 2JDOA 1WBWA 2Y4IB 3FMKA 3ZLSA 4BWKA 2JLDA 5JFXA 5GINE 2C5XA 2UZTA 1YDRE 4K33A 4KA3A 4KWPA 1STCE 4C8BA 3ZEWA 3E8EA 1YDSE 4M69B 4FG8A 3GB2A 4IADA 3IW5A 3OP5A 4EHEA 5TR6A 4HNFA 4WNMA 4MD8E 4BB4A 4IX6A 4F99A 1GZKA 1REKA 2YDKA 5HKMA 3W2PA 4P90A 4FNWA 3BPRA 1H0VA 4BDHA 3R8ZA 2WMSA 2JGZA 4BC6A 2W96B 4FGBA 4JJRA 4G34A 3DXQA 2X7GA 4ASEA 4KKEA 3NX8A 4BKJA 3DBEA 1F0QA 2C6LA 2WB8A 4JIKA 2YM6A 2H96A 3AMYA 1M2RA 2HOGA 4W4XA 2WTVA 5M08A 4QT1A 4WBBB 3O17A 4CVAA 4D4RA 5IQGA 3I79A 1ZYDA 4FT3A 2R0UA 4ALVA 2OF2A 5C01A 3MJ1A 5EG3A 2BROA 3GQLA 4BDCA 3PP0A 3FI8A 4L7FA 3QCQA 4JOAA 3FL5A 1OKYA 4CD0A 4BTFA 4RIWB 2E2BA 1QL6A 4JDIA 3ZOSA 3DK6A 4DGMA 5CALA 2HW7A 1L3RE 2YJRA 3PP1A 5L6WL 5AM7A 4NYEA 2OG8A 2UZOA 4NJDA 1R0PA 2JBOA 4NKAA 4I4EA 5I9ZA 4E6DA 3CGFA 4E5WA 4R1VA 4YNOA 4OW8A 4ACDA 2YLEA 3FZTA 4NCTA 3PLAE 4LUDA 5GZ8A 4FE2A 3OXZA 3Q04A 3KU2A 4RIYA 4Z7HA 5BVEA 1FPUA 2NRUA 3ACKA 5AAFA 4AN9A 5I4NA 5IQIA 3R22A 4I5PA 5CF8A 2GFSA 3C0GA 3EL8A 2ZM3A 3F5UA 5T68A 2HXLA 2V55A 4A07A 1WFCA 1MRYA 2YCQA 4I94A 3G90X 2YHVA 4W4VA 5DYJA 3HNGA 2QODA 3G0FA 1FMOE 3BELA 4WT6A 4PDSA 1YKRA 4B6LA 2WQNA 1GNGA 1YXSA 2VWUA 3SXSA 3DV3A 3PE2A 3L8XA 4AAAA 4HPTE 3E93A 2W05A 4X6QC 3EL7A 5M06A 4PP7A 5ANJA 5CEOA 5GZ9A 4X21A 4FV0A 3KVXA 3ZEPA 5AUUA 3E88A 3SOAA 3NLBA 2R3OA 4M69A 1PXOA 2WFYA 4UZDA 3R28A 4F9CA 5M4CA 2JIIA 5AR2A 3UG2A 3D7TB 3QUEA 4U41A 1OPJA 2PE1A 3BGZA 4AE6A 3QLGA 2XUUA 2FSMX 3FKNA 2VO0A 3N4VA 4FTAA 2O2UA 3UYSA 4AFJA 4O7WA 2W99B 3EH9A 4Q5EA 4DH8A 4X6RA 3LXPA 3DLZA 3U51A 3PLSA 1Q97A 5DMZA 3ZM4A 3PYYA 1V1KA 2OO8X 4FSMA 3OXIA 2A0CX 2WMAA 4FUXA 4MXZA 3GU4A 4I22A 4IX5A 4XP0A 4A4OA 1J1CA 3A60A 3OD6X 5E8SA 4MX9A 4Q2AA 3P7CA 5J9ZA 3AC5A 2YCSA 3DAEA 2XNBA 3F3ZA 3KMWA 3G9NA 1R1WA 4GRBA 1JVPP 2CGWA 2J50A 4JS8A 3ZLXA 4BWPA 2XH5A 2X7OA 1ZY4A 3CJGA 4FIHA 3V8TA 2BZIB 4L00A 2PZYA 1YVJA 5ICPA 3M11A 2BAQA 4RX5A 3DBQA 5FRIA 4FKRA 3R7UA 4BGHA 3ZSIA 5CZIA 1MQBA 2KTYA 2Q0BA 2IVTA 2B0QA 4RIWA 4E26A 3ZC5A 2IVSA 5JQ5A 3CEKA 2G15A 4DH3A 5BUIA 2YABA 5IA1A 2GS2A 3MFSA 2XIXA 4FZAB 3WZDA 4E7WA 5L2TA 2AC3A 4QTBA 3HMNA 4NTTA 2QURA 2BAKA 3TKIA 3R30A 4DFBA 1UV5A 3O7LD 3PXFA 3QQKA 5EDRA 2HCKA 3VS2A 5CSPA 1YI6A 2HXQA 2IO6A 1GIJA 2UW7A 4GFGA 4NUSA 2JFLA 4WNOA 2R3KA 4XUFA 3Q4TA 4YZBA 4O82A 4C4FA 4YC6A 2VN9A 1UWHA 4HVGA 4IB3A 4ZY6A 4ZXTA 3RPYA 3GCPA 2QLQA 3H9RA 4NTSA 4ENYA 1A9UA 4AU8A 1K2PA 2CGVA 4OTDA 5F1ZA 4DGOA 1XO2B 3IG7A 2QO2A 4NFNA 4NWMA 4XBRA 5FD2A 5L8KA 1XBAA 3CP9A 3ZS5A 4CQEA 2J51A 3GC0A 2VU3A 4G2FA 1OECA 4HYUA 3DAJA 3KF4A 2CN8A 4FKSA 4RQVA 3PRIA 5A4CA 3SDJA 3QTRA 2BRNA 2ITNA 1YRPA 2X4ZA 5JRSA 3RGFA 5AR4A 3LFCA 4W8EA 3S3IA 2XBAA 3VBVA 3W1FA 1PMNA 4R3RA 4TWNA 2JDSA 1MRVA 3E8CA 1CM8A 1KOBA 1Y8YA 2C3LA 3PVGA 4FV4A 4GW8A 2R4BA 5M09A 2YAAA 5AUXA 4A06A 2P33A 3D7TA 4FSZA 2XYNA 4K0YA 3UO4A 3EQPA 2UUEA 3R9HA 3MB6A 4FK6A 3V8SA 2GNFA 2PWLA 1LR4A 2QCSA 5I9XA 3SHEA 4LRKA 3IOKA 2E9OA 4CFUA 2NP8A 3LCOA 4ZAUA 2DYLA 3OC1A 3ZTXA 3REPA 3NGAA 5EOBA 2XEYA 3ULZA 2V22A 1P4FA 1X8BA 1XH9A 5BVWA 2Y8OA 2JAVA 5M44A 2E9NA 4FZFB 4TYIA 2XK4A 4K8AA 4XOYA 3KK8A 4JXFA 4LG4A 4OGRA 3JPVA 5KMMA 3OTUA 3ODYX 3SX9A 4L9IA 3MFTA 4RLLA 4C2WA 3LJ0A 4UYAA 5CXZA 3E8NA 3R21A 3FE3A 4YC8A 3UQFA 5HX8A 4CYIA 3WYXA 2ITQA 4DEHA 4F65A 4HVDA 5T6KA 2QOKA 4WRGA 4JBQA 1SYKA 5HD4A 4WG4A 2VWBA 2RKUA 5J1VA 3UZTA 4PPCA 4RC4A 5DA3A 3JVSA 4E20A 2P2IA 4OBPA 3P78A 4Q5HA 2WEVA 3PJ8A 1NVQA 1R0EA 3R71A 4XRLA 4C57A 5KHWA 2WMXA 3Q53A 4L53A 3VS4A 5HNBA 1H0WA 3LZBA 4FKQA 2ZM1A 3DFCB 3VUKA 3UNJA 3W18A 4D2PA 1ZAOA 5DT4A 2IG7A 2I0YA 4JRVA 3QRIA 4BHNA 3TNHA 5HICA 5TE0A 4GVAA 2OW3A 2JIVA 5G6VA 4F9BA 3VW6A 3H9OA 3U6HA 5JFWA 3ATTA 5E90A 4P2KA 2Z02A 3BKBA 4O84A 1H07A 5K0KA 1RJBA 4ZS4A 3C4EA 4Y5QA 3W8QA 1CTPE 3KA0A 3LOKA 2CGUA 4H36A 3SV0A 2J0KA 4HVSA 2QU6A 4E6CA 1ZRZA 2QKWB 4FKUA 4G17A 1CSNA 2H6DA 3D94A 4FIIA 4IB1A 4F08A 2X1NA 4UXQA 4AW2A 5CAPA 4MBIA 5CZHA 3W2SA 4O7VA 2X6EA 2XK9A 4PMMA 3QC4A 4F9WA 4FBXA 4XYFA 4J53A 3D5WA 4LGHA 2BRMA 4U5JA 3ERKA 5E1EA 4FV5A 3EWHA 3GU5A 5FEEA 5TOZA 3TZ8A 3H30A 5JZJA 3NW6A 1IAJA 4CXAA 5IKWA 2FSLX 5AUVA 3TNQB 4IW0A 4IXPA 3LFQA 4J8NA 3V04A 2W4JA 1TVOA 3HMMA 4IM0A 3NIZA 1V0PA 4DA5A 3EN4A 4U43A 4XG6A 3QC9A 2R3GA 3POZA 5JMSA 3CQUA 1A06A 3ZFXA 3V3VA 2A19B 5HO6A 1NW1A 4J98A 4C59A 3MIAA 1H1QA 5E8XA 3MFRA 4EZ3A 4XOZA 3KEXA 3O96A 3HLLA 5JFVA 2IZTA 5LVPA 1ND4A 3HAVA 1AGWA 5K4IA 4BDIA 3HRCA 3AT4A 4MNFA 1ERKA 5FDXA 4PDYA 2XP2A 3I6WA 2GCDA 2FSOX 5D9HA 3RWQA 4RIOA 2XNNA 3UQCA 3F2NA 5A3XA 4ZJVA 3QGWA 4QD6A 2HWOA 3UIBA 3WI6A 3JR1A 3EQIA 5HLPA 4ZLOA 5CEMA 2VZ6A 3GC7A 3K5UA 4M3QA 4CTCA 5HIEA 3T3VA 3MDYA 1FGIA 4X3JA 1XR1A 2V7AA 4GUBA 4YZCA 3BE2A 1TKIA 2JDVA 1UU3A 4FUYA 2YCRA 5FP5A 4A9TA 5J5SA 3OBJA 3CQWA 5IQEA 3IS5A 4GJ3A 4WUAA 2ZV8A 1EH4A 2EWAA 4BGGA 5DBXA 2PL0A 5FBNC 2XKEA 5LARA 3BV3A 5CVHA 3ZSHA 4TNDA 5IMEA 3ORTA 3N4TA 3KFAA 4ACHA 4DEBA 2OXXA 1BMKA 1IEPA 1PXKA 3FZRA 4JX7A 4P5ZA 3UMXA 4L68A 3UQGA 3V5JA 3VF9A 4ANNA 4JQ8A 1G8AA 3PA4A 2UZDA 2ZYBA 4QMYA 4WSQA 3R7YA 2XNMA 5AV3A 3LFFA 2YDIA 3E64A 3DXPA 2XKCA 4RPVA 3AMAA 3KXXA 3MIYA 1SMHA 4FTMA 4G3FA 4PNKA 3UDBA 5BMSA 5CNOA 2J4ZA 2BR1A 4HCTA 1B39A 2NO3A 4FT5A 5CSVA 3BLRA 4I3ZA 5HZNA 3KRRA 1QPJA 4EHGA 1OMWA 1LUFA 2FSTX 4YJSA 1Q8ZA 3LLTA 5J9LA 1WVYA 3NCGA 5ETFA 4QTCA 5AP5A 3Q6WA 3QRKA 4J1RA 3C5UA 4EUTA 3ALNA 3QYWA 4YHJA 5LCJA 1XBCA 5EM6A 3VS0A 3HL7A 3U55A 4O0VA 4BICA 4KABA 4EK3A 1ZYCA 2OJ9A 5E4HA 3BE9A 5M07A 3DZOA 3KXNA 5IH4A 2YM8A 1YHSA 4CNHA 4FT9A 4E4MA 4UWYA 4E8AA 4FNZA 5EHYA 1TQPA 3IDBA 2XZSA 2OH0E 1WAKA 2Z7QA 4YJRA 3I7CA 3Q2MA 5CU3A 3E7VA 3N4UA 1GZ8A 2Z60A 3Q4ZA 2W4OA 4KIKB 4Y83A 3ALOA 3RPOA 3NAYA 4D9TA 2DS1A 5C8KA 2HYYA 3OBGA 4J8MA 4Z16A 5CI7A 5EW9A 1CMKE 3DDPA 2YITA 4D2WA 4DEEA 1GZOA 3QRTA 2WMBA 3NIEA 1J91A 2H9VA 4I5MA 3WBLA 3HYHA 4DFUA 4TL0A 4EBWA 2X0GA 3CTJA 4QO9A 3CD3A 4FL2A 2ZMCA 3NUAA 2PPQA 1YW2A 3U9CA 2HZ4A 2XIZA 1QMZA 2PVYA 4QYFA 2XNEA 5FP6A 4BTKA 2C6TA 1XH6A 3I0OA 3A8WA 3VAPA 3LQ5A 3BHUA 3VWAA 3TNWA 5FXRA 1UWJA 3EN7A 3P7BA 4O2ZA 3OS3A 3OUNB 4QPAA 4QYEA 2OICA 4MYGA 4XV9A 2QO9A 3MY0A 3N51A 1L8TA 2X8IA 4QP1A 4EOKA 5BX0A 4HCVA 1FVVA 4U7ZA 5AWMA 4WNKA 4ZTNA 4PPAA 4XRJA 2KULA 3QQUA 3FMNA 5M51A 4MTAA 3L8SA 4BDJA 5KMIA 5C4LA 4I6QA 4HYSA 5A6NA 2X7FA 4X3FC 4R7IA 5IMXA 4QNYA 4EH3A 3EQRA 4WA9A 4RX9A 2BDFA 4I92A 5D10A 1OI9A 3QYZA 2X9EA 4S34A 4CMUA 4GT5A 3GC8A 4U8ZA 4IB0A 5EDPA 1OKVA 3MH3A 5DEYA 4QMUA 1WBVA 4J52A 3PDTA 3DJ7A 3BX5A 3L9MA 3EFJA 3FPMA 3KGAA 4FVRA 3VS5A 4UMPA 2XYUA 3BHHA 4XG3A 1PXMA 3KRWA 1UNLA 4J7BA 4NKSA 5I5ZA 4DE4A 3VO3A 3FLNC 3GUBA 5EI6A 4GU9A 3DDQA 3G9LX 4WG5A 3TL8A 3TTJA 4F9YA 3BQCA 3SG8A 5KUPA 4LL5A 4R3CA 4XHKB 5FWKK 2P4IA 1ZOGA 5CT7A 5AIRA 4CKJA 3MTFA 5J5TA 1SNUA 3F88A 2R3FA 4IM2A 2VNYA 1PHKA 3QL8A 4MNEA 4IX3A 2A4LA 3AMBA 3CKXA 4O83A 4ANQA 4QTDA 4KD1A 3PJ2A 4M13A 5JZNA 4KIKA 5JT2A 4YLKA 4JR7A 1FVTA 4EH5A 3OW4A 4JQ7A 3IDPA 3F2RA 4FC0A 4AA0A 5AR3A 4CG8A 3ZFMA 3R7OA 3D2KA 3HV4A 4FKJA 3LLAA 4QYGA 5E91A 3E3BX 4QMXA 2C4GA 5LWNA 4H3PA 5EKNA 4UN0C 4EJ7A 2GQGA 4BRXA 2OJIA 4FVPA 4RX8A 3SOCA 2ZV9A 3GCVA 4FKLA 4PL4A 4E73A 3FWQA 3FYJX 3D5UA 3CLYA 1W8CA 2PUIA 1YI4A 3EFLA 3UODA 4RA4A 3RK5A 4MXOA 4M68A 4EH4A 4WIHA 4B4LA 3P9JA 3P7AA 3RM6A 2YZLA 4D1SA 4KRDA 1GOLA 2UW6A 3A7HA 4FTOA 4FKIA 5G1XA 4DEGA 4I41A 4ENXA 5IF1A 2FUMA 3RAHA 5IQFA 3S00A 4MKCA 4YBJA 2GNIA 3CGOA 4ONAA 3DOGA 5K3YA 3G0EA 1UNHA 2Y9QA 2P55A 3BI6A 3DU8A 2GHLA 4FTLA 4NH1A 3OWPA 4IBMA 4YZ9A 5AMNA 2YWVA 4WBOA 1OGUA 5HLWA 2YM7A 5J9YA 4JG7A 3ETAA 1K9AA 1YHWA 3F7WA 3H0YA 4I24A 3TACA 3KC3A 3PJ3A 4CQGA 2G2FA 2QG5A 4PMTA 3AT3A 2FO0A 3S2PA 5EYDA 3E87A 4TW9A 1XHAA 1SVEA 3EQFA 4H39A 4YJTA 2HZNA 4CCBA 4E93A 2YIWA 4AACA 5J87A 5HG7A 2UW8A 2CKEA 2YZAA 2ZB1A 5K0XA 4YMJA 1KE8A 4IM3A 3KL8A 3CTQA 4QP7A 3BYSA 3ORMA 4RIXB 3CTHA 3EKNA 4AFEA 4UMUA 1BUHA 4ANOA 3ZMMA 3F66A 2R3LA 4IH8A 3UBDA 4U45A 3UP2A 2VWVA 2F7XE 4S2ZA 5AP6A 4AOIA 1PMUA 4GT4A 5AR7A 1F3MC 4PY1A 3W2QA 3ZSGA 3BEAA 3O0GA 3L1SA 4G3EA 4HNIA 4USEA 4TWCA 4YTCA 3UNZA 1NT2A 2BZHB 3LJ2A 1PKDA 4IEBA 1KUTA 3B8QA 3FEGA 5HG8A 1U46A 4CZTA 4F70A 3UO5A 1GAGA 3G6GA 2ITVA 4O0WA 2OFUA 5KE0A 4N4SA 2BTRA 2VTMA 2BZJA 2X9FA 3LHJA 4FV3A 4KIOA 5DLSA 3THBA 4WRSA 1PW2A 3TZ9A 2R5TA 4BVUA 1HCLA 5CAOA 3EKKA 3KB7A 3NZ0A 3QQLA 5M56A 2BHHA 2PVFA 2J0MB 5CAQA 4DTBA 5AX3A 2PMIA 2I6LA 3UTOA 4RWKA 4YLLA 3WIKA 5KKRC 4XCUA 3WF6A 4IX4A 4WSYA 3VHEA 4EK4A 1SZMA 5GJDA 3TNIA 1FINA 2I0HA 4QMWA 3R8LA 3JVRA 3QX2A 2VO3A 5EQEA 1KWPA 5FTGA 4PQNA 4YSJA 4PTEA 3MFUA 1QPEA 2ERKA 2C5NA 4BCHA 3EHAA 1AQ1A 3R01A 1IA9A 1UU8A 1E1XA 2C1BA 3K54A 4BCNA 3Q3BA 4FSQA 4AA4A 3ENHA 5BMMA 4JBOA 2PVNA 4MEDA 2VX1A 3UC3A 5AAEA 3CPCA 4UWBA 4CCUA 4GFMA 5L2WA 4QMZA 3UOJA 4U79A 5C03A 2R3MA 2VTPA 2XIYA 4RG0A 4BCOA 1JQHA 4IC7A 1ZZLA 4ANSA 4RVTA 5HIDA 4C02A 1Q61A 3Q2JA 5FXSA 4BFMA 3G51A 4YJPA 3E5AA 1KV2A 4OBQA 3OWKA 4RJ4A 3BIZA 3TT0A 5DVRA 4BCQA 3AC8A 5BYZA 3FDNA 4GT3A 4LL0A 4FT0A 3VUGA 3L8PA 4APCA 5LJJA 4UZHA 2VTIA 3V5WA 5D7AA 5A4LA 2CKOA 1JKKA 4RIXA 4CFXA 2J9MA 2F9GA 4AZVA 2BILB 2IW6A 1YQJA 2W1IA 3R1YA 2GNHA 2IWIA 2VWIA 3LCDA 4CKIA 5KBQA 5M4IA 4MVFA 2I0VA 3HDNA 4XS2A 4O0RA 1Q99A 3HAMA 1U4DA 4J96A 3S4QA 4FGRA 4FF8A 4G6OA 5GIPE 2JAMA 2J5FA 5HORA 3VS7A 4L67A 4TXCA 4B99A 4QQ5A 4DAWA 3IOPA 2WD1A 3CBLA 3E7OA 3CIKA 3ZO4A 2YIRA 4BDEA 3P1AA 5CEKA 3L8VA 2R3JA 3QQJA 3MPMA 5DI1A 3ZDUA 3RMFA 1URCA 2ZAZA 4USFA 4O7TA 4MD9E 4FTJA 1CKJA 4IAKA 3DPKA 2VTQA 4UY9A 3VS6A 1OVEA 1Y91A 2BHEA 3D15A 2A1AB 3Q5ZA 4M0YA 1H4LA 4BWXA 1W84A 4C37A 1H08A 4QNAA 4XV1A 3UC4A 3U6IA 4FMQA 1PY5A 3HDMA 4E4LA 3FXXA 5BPYA 5HVJA 2XJ0A 1CKIA 2OF4A 2CSNA 4O1PA 4EBVA 4ZSEA 3BV2A 3C4CA 4GK2A 3AG9A 3U4WA 1IASA 2WZJA 5HD7A 4ZMEA 4AOJA 1AD5A 4WUNA 3LXKA 3F3UA 4EOMA 5AAGA 5CASA 1KOAA 2PMLX 4D0WA 5AP2A 1Z9XA 4EWQA 5KHXA 4GKIA 1B6CB 3OWLA 2QG7A 5A4TA 3EB0A 3MW1A 3BYOA 4Q9SA 4XH6A 5EHOA 3OWJA 4ZLYA 2XNGA 4FEUA 3QWJA 4HGSA 4PMPA 3ORKA 4EYJA 5IQCA 3FZOA 2WNTA 4EKLA 1Q3DA 3HP2A 3W8LA 3RK9A 2IPXA 3DGKA 5HCYA 3Q9WA 2WMQA 3RNYA 1JSTA 4GVJA 5BYLA 3MGYA 2YERA 1JOWB 3OFMA 3QCSA 2CCIA 4FEVA 4BCPA 3LIJA 4CRLA 4Y95A 4R5YA 4ZTSA 3IONA 3TDVA 1CDKA 2BDJA 4CV8A 3LVPA 4D4SA 3KCKA 5BVFA 5ANEA 1KSWA 2X39A 3KRJA 3TDWA 4FTRA 2VD5A 4L8MA 4XG7A 3EQHA 4CFWA 4DITA 4EI4A 5CF5A 4KKGA 1OKWA 4XLIA 4ACMA 4AWIA 2WQBA 4L42A 5BVKA 2GFCA 3RPRA 4YTFA 3A4OX 5CEPA 3SC1A 5HNIX 2AYPA 4PL5A 4A9UA 4NCTC 2C0IA 4IVAA 4EH2A 5TKDA 3VBQA 5IPJA 2RFNA 2HK5A 3LMGA 4GL9A 3KK9A 3JUHA 4OLIA 4RJ5A 5DT3A 4DGLC 5IQAA 3MESA 5JFSA 3FZSA 3DKOA 4DCEA 4HGEA 3RVGA 5D41A 5AP7A 2VWXA 5ETAA 3E62A 3NSZA 5EHLA 1R39A 4EKKA 2BKZA 5LVLA 4G9RA 4GS6A 5FEQA 4D58A 5CVGA 3FYKX 2R3QA 4S30A 4C3RA 4J95A 2CHLA 4I6FA 2WIPA 5DR9A 3FY0A 5CVFA 1JKTA 2UZBA 3D14A 4QMVA 5CLPA 3CPBA 2WQOA 2Y4IC 3OW3A 4KRCA 1FMKA 5K4JA 5LWMA 4YO4A 2W1EA 2HY81 3S1HA 4BKYA 2C6EA 4AZTA 2OXYA 3T3UA 4ZTMA 5FDPA 3WIGA 1ZOHA 4BYJA 3RAIA 3QZIA 4FV7A 3UIXA 3LMHA 3HKOA 2FA2A 4TTHB 4R8QA 3LM0A 4FKGA 4AE9A 4ZZOA 4BCGA 3TIZA 2NRYA 1IAHA 4IDTA 4EUUA 5EW8A 2QR8A 4Y8DA 4RZWA 4AF3A 5J95A 4ERWA 1R78A 3SXFA 4CTBA 1YI3A 2BRBA 4NW5A 4JG6A 4RZVA 1BKXA 1XBBA 1BLXA 3QA0A 5IUIA 2YIXA 2C6KA 1OL5A 3BCEA 4K11A 5EDQA 3HRBA 1OB3A 4FSWA 3RJCA 3DY7A 3RP9A 1H1RA 2RFEA 4MQ2A 4YO6A 3WILA 3C0IA 4L43A 3MI9A 4X2FA 2VX0A 2REIA 4KBKA 3RHXA 4X7QA 3ODZX 2XBJA 3PPJA 4AA5A 4F7NA 3DJ6A 3PXQA 2ZM4A 3LM5A 1ATPE 1Z57A 3IW6A 4ZS0A 4D0XA 5J79A 2BPMA 4XP3A 3OMVA 2ITPA 2YN8A 2JDRA 3II5A 1WBPA 1J7UA 3WE4A 4JQEA 3R2YA 2QO7A 1DI9A 4BCJA 4AN3A 4KBAA 2PE2A 5DRBA 3ZH8A 2B55A 4YU2A 4RVLA 2VTLA 3H10A 2R0IA 3AGMA 4EK6A 2DUVA 2PVMA 4R6VA 5M53A 3IGOA 4WHZA 3RPVA 2GS6A 3DK3A 2B9FA 5D12A 3GFEA 3R8MA 3NUPA 5CWZA 4QPSA 3KMMA 2BDWA 3N9XA 3NYVA 1NXKA 2PVKA 3S95A 4XX9A 4FICA 4IZ7A 4DH7A 5CANA 1IR3A 3ZONA 4DF3A 2PHKA 3ORPA 4JR3A 3FMLA 1APME 5ETIA 2WOUA 2JDTA 4NM7A 1JWHA 3EQGA 4FKWA 4V04A 4BI2A 4OAVB 3QAME 3COMA 4OUCA 4ZSGA 4DGNA 3PXZA 3EN5A 3O8PA 1I09A 4IVCA 1WCCA 5AUWA 2OJFE 2GNGA 5FGKA 3ZZWA 4F7SA 4KAOA 5E92A 2GTNA 3ATSA 3A7FA 2X2MA 3NMUF 5LMBA 3V6RA 3ORLA 5DHJA 3QD2B 4I0RA 1GIIA 2FGIA 4ZLZA 3NWWA 4AZFA 2UW5A 2ITXA 3NPCA 4OTFA 3BYVA 4OTHA 5GHVA 2PE0A 1PXPA 2HWPA 3I0QA 4RFMA 3PJ1A 4BIBA 5KMLA 5GJFA 4FKVA 4G3CA 2UZWE 3KXHA 3HEGA 3UOLA 3V6SA 5EYCA 3V5PA 1JPAA 3NYNA 2UZVA 3ZBFA 4BZNA 4CFFA 2OZAB 4GKHA 4GUEA 5H2UA 3DK7A 3KN5A 4AT3A 4KS8A 2BCJA 3A99A 4FZDB 3R00A 4O96A 3Q9ZA 4U42A 4D2TA 3FLZA 4O1OA 4FSRA 1YXTA 3BYMA 4Y46A 2A27A 3O8TA 5T3QA 3BWJA 3QRUA 3NYXA 2CJMA 1J3HA 4I6BA 1YHVA 1Q41A 3FI4A 4QMQA 3QALE 4H1JA 3RK7A 3CY2A 4L45A 3ZFYA 4JT3A 5HX6A 4PUZA 3PA3A 3F69A 4ZK5A 4LOOA 4QMMA 4ZMFA 3ULIA 3DFAA 3WYYA 4H1MA 3MVHA 4I5CA 3EMGA 1Q4LA 5A4QA 2ITYA 4JLCA 5CSHA 2EU9A 5KCVA 2XRWA 5EW3A 3UE4A 3E92A 5E8YA 3MWUA 5IISA 4E4XA 1M7QA 3FXWA 3TUBA 3HP5A 3IW7A 3QRJA 4RQKA 1FQ1B 5GJGA 2UZEA 4FSNA 5M57A 2WMRA 4O7ZA 2J90A 3VQHA 5HVKA 4FTIA 3C4XA 1KV1A 3DT1A 5CXHA 2Y0AA 4EORA 3CXWA 4I1ZA 3QTUA 1YDTE 4RC2A 3SAYA 3JXWA 4L6QA 2E9VA 3WZEA 2YLFA 2RSVA 4RFYA 5BNJA 5IA2A 3GENA 4PRJA 3HECA 5DT0A 2FYSA 4FR4A 5EM8A 2XIRA 4EOOA 1Z5MA 3L9PA 3IGGA 3Q9YA 1H27A 5KZ0A 4H3QA 4AGUA 5EM7A 4IZAA 5IQHA 2GSFA 3QZFA 3LFEA 4YGAA 1ZZ2A 3O23A 4BBEA 4FL3A 4EQCA 1OL6A 4LQMA 4NM5A 3I4BA 5FM2A 4C0TA 2G1TA 4MXXA 1QPDA 2O5KA 4IB5A 5GIOE 3UO6A 3F7ZA 3R1SA 2EB2A 4RWJA 1V0OA 1XQZA 4O21A 1PXJA 3EQDA 4KNBA 3GOKA 4OTRA 4YJQA 5IA0A 3JY9A 4FKOA 3P4KA 3R6XA 4XG2A 2Y4PA 4HCUA 5I3RA 1PXNA 1F5QA 2W4KA 2W1DA 4AUAA 2FH9A 4BY9E 4M12A 1GJOA 2GS7A 3FQEA 2WTCA 2YIQA 3RINA 5H8GA 3PWYA 3IO7A 3PG1A 1ZYSA 3QQHA 5B7VA 1WVWA 5AP4A 4PTGA 3K2LA 4B7TA 4C62A 3SQQA 2PVRA 2C0OA 3MVJA 2OZAA 2F7EE 2X8EA 3QTSA 2VTRA 5IDPA 3FSFA 4KB8A 4LGGA 3FLWA 2VGPA 3MB7A 4TY1A 1XH5A 2G2HA 3D7ZA 4GCJA 5C1QB 5JSMA 2CNUA 4FNXA 2PU8A 2QOOA 2O65A 3VUDA 1WBOA 5CQUA 1H24A 3OEFX 4LRJA 3VIDA 4YPDA 3VBYA 3U87A 4MCVA 1SVHA 1NA7A 4C4JA 5A6OA 3MA6A 2ZJWA 2VWYA 1M7NA 1A48A 4K9YA 2JBPA 4IJPA 1Q8WA 4AN2A 4E6QA 3D9VA 1KE7A 3M2WA 1REJA 1FGKA 4HVHA 2WAJA 3LFBA 3OXTA 4L3PA 2HENA 3RBWA 3KRXA 4FK3A 1E9HA 1J1BA 4S32A 5CS6A 5CSWA 1ZWSA 3I1AA 4JRNA 4QMTA 5H8EA 5I3OA 4BI1A 2B1PA 5KO1A 5EI8A 5F95A 2ZB0A 2YM4A 4JX3A 1E1VA 2C6DA 3R7EA 4RRVA 4C35A 3PTGA 4FI1A 2XNPA 3HRFA 4U97A 4RWLA 5HIBA 2OLCA 3KY2A 5AA9A 2I40A 4FOCA 3EIDA 5HE3A 4IWPA 4OTWA 5FTOA 4MNEB 5L4QA 4QP6A 4XG9A 2PMOX 4M67A 4PTCA 4B9DA 3EN9A 4MAOA 3QD0A 3TI1A 4DBXA 2CDZA 2OI4X 2XNOA 3VNTA 5DR2A 2EVAA 1UVRA 4NFMA 4WNPA 4CSVA 1JSUA 1XH8A 3LXLA 3NAXA 4FYOA 4NT4A 4PX6A 3RI1A 3D2IA 3P86A 2IZSA 1YWNA 5EOLA 3LFAA 3B8RA 3ZDIA 4QPMA 2J5EA 5EYMA 2X2LA 4RGJA 5H3QA 2Z8CA 3TCPA 3U6JA 2WQEA 4IANA 2HELA 4U40A 3GCSA 3LKMA 2F7ZE 4G6LA 3PXKA 2Z7RA 2W06A 4JG8A 3AC4A 3EJ1A 4NW6A 4AGCA 4IAZA 4N70A 4D55A 4AZEA 1OIRA 3AOXA 2PK9A 5BUJA 2BALA 5L6OA 3R1NA 4MXYA 5FBOA 5HNGA 4GK4A 4QP3A 3FBVA 3OT3A 3HMPA 5IEVA 4NU1A 2ITWA 1ZYLA 4U44A 4YTHA 3VF8A 5IA3A 2XM8A 2OJGA 2GHGA 3PPKA 3EFWA 4TT7A 5B2LA 2O3PA 3TV6A 5CF4A 4I21A 5KMJA 4XLVA 5IA5A 2RFDA 3VJOA 1PYEA 2ZV2A 3DTWA 3W33A 3MH1A 4LMUA 5E7RA 3TZMA 4EK8A 3CKWA 1Q5KA 4DN5A 4OBOA 2WTIA 3T9IA 1Q62A 4BDGA 4ANLA 3ZXTA 4BL1A 4N6YA 1KE6A 1O9UA 4ZIMA 3FZ1A 3OOGA 4YURA 4DT8A 3SD0A 1MP8A 4U0IA 2CKPA 3VBWA 2UW0A 3DKGA 3VQUA 3OUKA 3B2WA 3AGLA 3WZUA 3C51A 5IU2A 4EH8A 2Q0NA 4ZJIA 5F94A 1OBGA 3LCTA 4DG3E 2YFXA 3TNPC 4EOJA 4GH2A 1YOLA 4XBUA 3Q96A 3PSCA 2R2PA 4ITJA 3AD5A 2RFSA 4EOLA 1BYGA 3KQ7A 3R73A 2LAVA 1VEBA 2DQ7X 4KBCA 4QP4A 2V0DA 4HOKA 1XKKA 3FLSA 4TYEA 4PDOA 4G3GA 4KS7A 1OKZA 1U54B 2GDOA 2ZOQA 2C68A 2VTSA 5EYKA 2WELA 4CFMA 3U54A 1OL7A 4ZTLA 1FVRA 4EQMA 3R7VA 3KVWA 2RL5A 3C0HA 2C3IB 3RNIA 4BDDA 3HZTA 4BF2A 4IVDA 5JN2A 3NUXA 1H00A 2YIYA 1OUKA 1OL1A 1LEWA 5LQFA 4UB7A 4AW0A 2P0CA 3KRLA 5C8MA 4JDKA 3DJ5A 4HYIA 1P2AA 4LI5A 4ZTRA 3MY5A 3RZFA 4ZSAA 3TIYA 5IA4A 2AC5A 4UX9A 3AC2A 4RVMA 2GU8A 4RA5A 3CQEA 4C4HA 5J7HA 3G15A 4IAAA 4DG0E 4D28A 4IE9A 5CT0A 5FG8A 3UPZA 3CS9A 3VUIA 3VRYA 3Q4UA 5CEQA 2B9HA 3ANQA 5DEWA 3G6HA 3LFSA 3Q9XA 3ZRLA 3D5XA 1W98A 3DQWA 3HV5A 3MTLA 4KSQA 1OBDA 3NCZA 3WF8A 4YJNA 4O27B 3CR0A 1DAYA 2F2CB 4HYHA 5IQDA 3ORXA 4AGDA 3VBXA 3QF9A 2PZPA 3ACJA 4ZTQA 3WF7A 4C3PA 5LMKA 4MXAA 5TF9A 3R04A 1TQIA 3NEWA 4QQJA 2OKRA 4QTAA 4HVIA 5ANIA 2ONLA 2P3GX 2E9UA 3GOPA 4L01A 5DIAA 3PVBA 3FC1X 3G5DA 4ANBA 2UV2A 5DGZA 1JBPE 3RCDA 4EC8A 1P14A 1M2PA 3DBDA 4FTUA 4LFIA 3OF0A 3FY2A 2XIKA 4RJ6A 3COIA 3NNUA 3OOMA 4NL0A 2IVUA 3B2TA 1Y6AA 4ZP5A 4JAJA 5CENA 1M14A 4FIEA 5HE0A 4JI9A 4K2RA 1G3NA 3HX4A 2XA4A 3PWDA 4YJUA 4FIGA 1XWSA 1IG1A 2BTSA 4QP2A 2CMWA 2HW6A 3H4JA 3R02A 1G5SA 3Q4CA 5KBRA 4G5PA 5IQBA 5IEYA 3PG3A 3OTVA 3GFWA 4AQCA 4FTKA 5JGBA 2CLQA 1JAMA 5AA8A 5HO8A 3PXRA 4UMTA 4XV2A 2IW9A 5IUHA 2YWPA 2PY3A 5C27A 4WOVA 2QU5A 1U54A 1G8SA 4RFZA 4G5JA 3R83A 4DEIA 2PVJA 3KXZA 1YXXA 2Z7LA 2UW3A 3W10A 4IWOA 3R9NA 1VJYA 5HBEA 3ZUTA 3Q6UA 4AT4A 2IJMA 3QHRA 4OR5A 5FM3A 3KMUA 3GT8A 1JLUE 4IMYA 3FMHA 4LOQA 5AP3A 4YBKA 3HV6A 4M15A 4NSTA 4WD5A 3FXZA 2R3IA 4YTIA 1O6KA 2BUJA 3R7IA 3A7GA 4C4GA 3IDCA 4FA2A 4Z3VA 2BIYA 4DT9A 3PJCA 4YC3A 4F0IA 3VVHA 4O7SA 2O0UA 5IH5A 4RJ7A 3C9WA 5ANGA 4ASDA 3HUBA 3ZXZA 1WBTA 2XKFA 3UOKA 3QTQA 3MA3A 4U80A 4W4YA 1K3AA 3QKLA 1H28A 3BBWA 5JEBA 1VYWA 5D1JA 4EHVA 3R9RA 1JSVA 4V01A 3W55A 2UW9A 4MWHA 4X2GA 3DB6A 5DRDA 3WARA 3TM0A 1T45A 2C5OA 4XNEA 3VHKA 4E5AX 4NZWB 4EOQA 5LVMA 3O2MA 3VN9A 4YSMA 3NR9A 5M4UA 4AX8A 1DAWA 2VO6A 3PZHA 4R5SA 4C4IA 5AUTA 4MBJA 2VV9A 4LM5A 4O22A 3HVCA 3LFNA 3O7LB 2I7QA 3ROYA 4FV6A 3CJFA 5EK7A 4JBPA 3OCSA 1Q8TA 3CCNA 4ARKA 5HI2A 3TWJA 4ERKA 3SVVA 4FEWA 4D5KA 4DFNA 4OT6A 5CAVA 5HESA 5DE2A 1W83A 2YACA 3PE1A 3RZBA 3PXYA 2WU7A 4LYNA 4RWIA 3V8WA 5A9UA 4CLIA 3TEIA 2WXVA 5DH3A 3R2BA 4E6AA 3BU6A 4ZZNA 4C61A 4EH7A 2XVDA 2XK3A 4O91A 3FMDA 2HZ0A 5E8TA 1PRYA 3NVMB 3UMWA 3ZC6A 4K18A 2PUUA 3TJDA 5HU3A 3AC3A 5IUGA 1ZXEA 3C4ZA 3LCSA 2UVXA 3UNKA 4ZSJA 5HGIA 4ZJJA 4APPA 4F1MA 4YR8A 3PIZA 3VJNA 4IZYA 5JQ8A 4KIPA 4UEUA 5JGDA 4EL9A 4TYGA 4QTEA 1RW8A 3PPZA 4F7LA 3WF5A 2PVHA 3L9LA 4LV5A 4ASZA 3LPBA 5FTQA 4O7RA 3RTPA 3SRVB 3MVLA 4BBMA 2QLUA 4TN6A 2J0JA 4TWOA 4ZZMA 2ZDTA 3ZRKA 2OWBA 3HV3A 3NS9A 3FZPA 4C3FA 3FL4A 5LVOA 4O38A 1UA2A 1B38A 2W9FB 1M2QA 2X81A 5AV4A 3MH0A 5BVDA 3KN6A 3BU3A 1CKPA 3SW7A 1LP4A 5F4NA 2PZIA 2R3HA 3W2CA 4L3JA 2WO6A 3MS9A 2X2KA 3FKLA 1BI7A 3RCJA 3ZUUA 4B0GA 3F3TA 3EOCA 4J97A 1M17A 3RAWA 3RPSA 1WMKA 3BLQA 3OCBA 1VYZA 4GK3A 1SVGA 2E9PA 4AS0A 4M0ZA 4MXCA 2XEZA 3G33A 4HZRA 4CGAA 3ELJA 3QD4A 4FX3A 4BTMA 4NK9A 4U3ZA 4IAFA 2WIHA 4LOPA 2VTAA 1Y8GA 3SG9A 3BWFA 3TKUA 1MUOA 5HBHA 4WKQA 5GZAA 5L3AA 3HMOA 3TJCA 3C5IA 3UJGA 4C38A 2HIWA 5CQWA 2WTKC 4ORKA 4AGWA 2J0IA 1ZOEA 4F0FA 5HU9A 2C5VA 4FTCA 3NVKI 2WKMA 5M4FA 2CN5A 3Q5IA 1UU9A 1OZ1A 4Y5HA 4N0SA 4YZNA 4HW7A 3HV7A 3DA6A 4RMZA 3AT2A 5D7VA 3WF9A 2VWZA 4JVGA 3COKA 4F6UA 3QU0A 3QZHA 4FTTA 3QUDA 1WZYA 1U5QA 4IZ5A 2QI8A 4TZRA 3K5VA 5KMOA 5E1SA 4I20A 1GIHA 3LQ3A 3A62A 3UIMA 4ITHA 5IEXA 2EXEA 3PUPA 4PF4A 4IWQA 2UZLA 1H01A 5ACKA 4V0GB 3LXNA 3ZU7A 3FJQE 4GG5A 4IFGA 2RG5A 5JGAA 3ORNA 4D1XA 2HAKA 3OCGA 4ALWA 4TRLA 5AX9A 4EWHA 4UMQA 4E1ZA 2BZKB 1LPUA 1KE5A 1S9JA 4D4VA 4TWPA 3PY3A 4UWCA 4A7CA 4K1BA 1DI8A 2DWBA 2JFMA 4FTQA 1WBNA 1YXVA 3C4WA 3F3VA 3LQ8A 4W8DA 1R3CA 4D2SA 4Q9ZA 3QCXA 4BKZA 3V51A 4FV1A 2LGCA 5HE2A 4AG8A 3F82A 3SRVA 2R9SA 3FQHA 2VGOA 4IHPA 2QONA 3FV8A 3VS1A 1NY3A 4CG9A 2UVZA 3DLSA 5EFQA 2WMWA 2WTDA 3W2RA 5BVOA 5ANDA 5LXMA 2BFXA 3CC6A 2XJ2A 4ZOGA 4BCIA 4BDKA 3FSKA 3OT8A 4E3CA 3ZBXA 5EQPA 4AT5A 4ZEGA 1HOWA 5A46A 3D5VA 1GY3A 4AP7A 3ENMA 2QOBA 3GC9A 4CZUA 2BFYA 3CSVA 3R8VA
chains in the Genus database with same CATH superfamily
3CE3A 4O81A 2GHMA 2R3NA 3OZ6A 4QMSA 3EYHA 2X6DA 4JL9A 3PSBA 3V5QA 4BCFA 5L2SA 1URWA 2IZUA 3U8WA 2XKDA 5ITAA 1TFFA 2VO7A 2FVDA 2QHNA 3MBLA 1YWRA 3PVUA 4XP2A 3DKCA 1J7LA 3TUDA 1VZOA 4AW1A 2SRCA 5GNKA 5J1WA 4C33A 1WBSA 2OIDA 3MVMA 4AOTA 1H8FA 4B8MA 2EUFB 2OGVA 3F61A 4DG2E 4YLJA 3DKFA 5KMKA 5ETCA 4BI0A 2RF9A 5BYYA 1YOJA 4U9AA 3QQFA 5HQ0A 4YHTA 5AUYA 5M55A 2W5HA 3SLSA 4F6SA 3W0PA 2XMYA 3DTCA 3F3WA 4MBLA 3WZJA 5L2QA 4EC9A 4PL3A 4HGTA 1OIYA 2C0TA 4GJ2A 3O51A 3U4UA 1JNKA 4FZ6A 2I1MA 4Z7GA 4QMOA 2EB3A 3KCFA 4L7SA 4L52A 3MY1A 4FOBA 3ROCA 5A4EA 4HGLA 3GQIA 3MSSA 3F2AA 4PMSA 4V0GA 4CMTA 3D4QA 3D0EA 3DCVA 2Y6OA 3R63A 3F5PA 4ID7A 3QFVA 3ORIA 2BRGA 3LMIA 2GPHA 1MRUA 3A61A 3MV5A 4MD7E 2VRXA 3HA6A 5FEDA 3UG1A 3H9FA 2C3KA 3F5XA 4O0SA 2VWWA 4ACCA 2ZDUA 1H1WA 3SXRA 2XCKA 2GTMA 2OK1A 3ZUVA 1OPKA 3VUHA 1OPLA 3E8DA 3PIXA 4IACA 5HG5A 5JK3A 1IA8A 5ANKA 1JKSA 4AZWA 3GI3A 5EH0A 5E8WA 4DFLA 4OT5A 3O71A 4FG7A 2UZUE 4O0YA 3SKCA 4EK5A 3BBTB 3KULB 3AC1A 4NIFB 3POOA 5AV0A 2Q83A 5KX8A 1H26A 2QKRA 4FZ7A 4BCKA 1Q3WA 3UOHA 4F09A 4Y85A 3VULA 4P7EA 2WTWA 3GCQA 3NFGB 4FVQA 3BRBA 2WMVA 4JDJA 3NUUA 3EN6A 4C7TA 3ZO2A 3TUCA 3ZO3A 1W2FA 1W7HA 2B9JA 2ITTA 4CEGA 4UALA 5F9EA 5K5NA 1TQMA 3ZM9A 2GNJA 1HCKA 3BZ3A 2PYWA 4YHFA 2BIKB 5CSXA 3DNEA 3C1XA 5LMAA 4FV2A 1I44A 5C4KA 2I0EA 5ANOA 4BDAA 3QX4A 4WG3A 3P23A 3VS3A 2YDJA 3VW8A 5L6PA 4JAIA 5J8IA 3PSDA 4FSYA 3QTXA 4OTIA 4I6HA 2YEXA 3QZGA 4ZSLA 4YP8A 1OGYA 4EJNA 3PZEA 3R0TA 4CFNA 2JKQA 3MN3A 4M14A 4O4BB 4DTAA 2X4FA 4U6RA 2QHMA 4FKPA 2IVVA 2QOHA 4DFZE 4F4PA 3RAKA 2XB7A 2WU6A 2C5YA 4D2VA 2G2IA 3GP0A 3IW4A 5FQDC 4QOXA 3FAAA 4EEVA 2QOFA 2O64A 3F9NA 4KUJA 5EQYA 2BVAA 4IAIA 4IWDA 4P5QA 4PP9A 3DAKA 4QRCA 3MPAA 3EZVA 4QYHA 3EFKA 4YZMA 3GNIB 4BDFA 2YM3A 4N57A 3JY0A 2B9IA 2W7XA 4HPUE 1YXUA 3GVUA 2W1HA 3IW8A 3QTIA 2VTOA 1ZMVA 1W82A 2J6MA 3UVQA 1BI8A 4NM3A 3ZO1A 4D9UA 4O7LA 3BHTA 3FI2A 3C7QA 5DWRA 3E3PA 1WVXA 1BX6A 3KF7A 5H8BA 1O6LA 5AM6A 1Q8YA 2JKMA 3MJ2A 4FIFA 5DG5A 2ERZE 4F7JA 2NPQA 5CEIA 3BLHA 4LMNA 4QYYA 5LVNA 3SA0A 2OIBA 1OIUA 4EONA 3PVWA 2ETMA 2IN6A 5B2MA 2Y6MA 5HHWA 1H1PA 3COHA 4ALUA 4OTQA 3LFDA 4QQCA 5E8ZA 2CNVA 2XANA 3KULA 4NIFA 4RC3A 3NUSA 3OVVA 3P0MA 3Q52A 3TXOA 3RWPA 3O50A 3MH2A 4XG8A 5AEPA 2PZ5A 1XH7A 1XJDA 1MQ4A 4I0SA 5HOAA 4LUEA 5FXQA 4DC2A 3HMIA 2UVYA 4K77A 2VUWA 4CRSA 3QXPA 4CYJA 3S0OA 4DGGA 4HZSA 3W2OA 2GNLA 5TT7A 5FUTA 3ZLWA 4DFXE 4YZDA 5ACBC 2VTHA 3QHWA 4DLIA 1DM2A 2PTKA 2AQXA 4ITIA 1YWVA 3R8PA 4LGDA 4WO5A 3U9NA 2YAKA 2F2UA 3VUTA 2ESMA 4FODA 1VLRA 3P5KA 4CT1A 4BCMA 5E8VA 2R7BA 2B52A 4RX7A 4TYHB 4UV0A 5AV1A 3RM7A 2EXMA 3OHTA 4CMOA 3QUPA 2W9ZB 2X8DA 3OY1A 2PZRA 2YJSA 1RQQA 3OROA 4QMPA 5A54A 2RIOA 3MPTA 2X0OA 3A4PA 3DB8A 4A9RA 1QPCA 3NNWA 4GYGA 4MQ1A 2JEDA 4H3BA 4X3FB 3TV4A 3V01A 4EHZA 5C26A 1Y6BA 3EQBA 3AD4A 5DPVA 3F5GA 3FLQA 3GEQA 1U5RA 3ANRA 3DBFA 5EKOA 3ET7A 1PYXA 3LW0A 4M8TA 4M7IA 4EZ5A 2ZV7A 5A14A 3FKOA 2QD9A 4L44A 4IQ6A 2YM5A 4FEQA 2VTTA 2W1GA 3QBNA 2QC6A 2WGJA 4EYMA 4DDGA 2W1CA 4QMNA 5EM5A 4I23A 4A4XA 2XS0A 3PFQA 2W5AA 1UNGA 4G31A 3TTIA 4UBAA 4BN1A 4ASXA 4A9SA 5DOSA 4PDPA 2F4JA 1SNXA 3PA5A 4YUQA 2GMXA 1PF8A 3A2CA 2G01A 4F64A 2WPAA 4G3DA 5DN3A 3NRMA 2VTJA 4GIIA 4I0TA 2C3JA 3Q60A 4FTNA 4UYNA 2XALA 4IFCA 4UXLA 4KKHA 4W4WA 4X2JA 4NJ3A 4QMLA 5KMNA 2HY0A 4N6ZA 5HVYA 1RDQE 2P2HA 3FQSA 4BYIA 3FMEA 1Q24A 3WE8A 5KNJA 3MYGA 3R1QA 3AQVA 4YPSA 3M1SA 4O0UA 1FBNA 2C6IA 3C13A 4O86A 2R3PA 5HE1A 1ZARA 3QD3A 4YJOA 5IH6A 2CLXA 4O0XA 2WMTA 4FSTA 4AQKA 3VC4A 4NEUA 4X2NA 4R78A 1OIQA 3DNDA 5EI2A 4IVBA 4C2VA 4FYNA 3UIUA 4DINA 4B8LA 5L8JA 2V7OA 3NDMA 4FSUA 5AUZA 1LEZA 1T46A 5H9BA 4V05A 4KIQA 4QP8A 3H3CA 4TNBA 3A7IA 1PXLA 3LE6A 4MWIA 5K5XA 5I9VA 5L8LA 4A9YA 3FHIA 3ZCLA 4EOIA 4Y73A 1DS5A 1PKGA 5JKGA 5BQ0A 2UZNA 5C9CA 5FLFA 1ZY5A 3DZQA 2H34A 4L3LA 2G9XA 2YISA 2W1ZA 2W17A 4BZDA 3FUPA 4RJ8A 2JITA 4F9AA 4TYHA 2W0JA 3GXLA 5B2KA 5AP0A 3K3IA 2WQMA 4H05A 4JBVA 2QOQA 3UPXA 3M42A 3GBZA 2O8YA 2OJJA 3I6UA 4O6LA 2BKKA 3P79A 4FJVA 4DHJA 3QCYA 4MK0A 1BL7A 5AR5A 4R77A 3ZZEA 5CU0A 4DEDA 4G6NA 4M84A 4DYMA 2R3RA 3TZ7A 5HBJA 4EQUA 4X2KA 4X3FA 4BBFA 2QOLA 4J99A 2JKOA 4OTPA 3BEGA 3NW7A 2JKKA 5CYIA 4CZYB 4E5BA 2JD5A 3AXWA 3WOWA 4OTGA 2RGPA 4AXAA 4C36A 4BR3A 2XF0A 1J7IA 2ETKA 3KXMA 5CX9A 5HTCA 4G1WA 2RG6A 5JH6A 2FB8A 5CAUA 2O63A 5I9YA 4GSBA 2J0LA 3EZRA 1SM2A 1OUYA 3RKBA 4YJVA 3SW4A 2PUPA 3W32A 2UW4A 3BGQA 4BIEA 4O7NA 3SGCA 3R9OA 5AIKA 4GMYA 5DNRA 2PULA 3A8XA 2EXCX 4I93A 2OH4A 2F57A 4Y72A 3BHVA 3GU6A 4JIAA 4M97A 5LCKA 5DR6A 1FOTA 2Z7SA 4ANMA 4O7YA 2J7TA 4XG4A 2Y7JA 3RALA 2J2IB 2XCHA 5AV2A 5CF6A 4D5HA 3UZRA 2W1FA 4DEAA 4EOPA 2BRHA 5CTPA 4DLJA 5IZFA 3CD8A 3I7BA 2QNJA 4KINA 5KKRB 3TG1A 3D83A 2XK6A 4MH7A 3ZLYA 3IKAA 2OZOA 2QOCA 3GCUA 2OU7A 4GEOA 4DH1A 3ZHPC 2C47A 1V0BA 4XMOA 3W0RA 5CY3A 2NNWB 3CY3A 2XK8A 4MHAA 5IDNA 1UU7A 3FMMA 3R9DA 3QWKA 4U81A 3T8OA 4GIHA 2JIUA 2GQSA 4LDTA 2B7AA 3WZKA 4E4NA 2CNQA 3LJ1A 2HZIA 2WEIA 1UKHA 2W5BA 4IJ9A 5I9WA 2PMNX 4RT7A 4DHFA 4ZY5A 3UVRA 4BGQA 3DXNA 3UYTA 5K9IA 1NVSA 3PRFA 4FIJA 4J71A 4XV3A 4DCAA 2QVSE 2R64A 2VNWA 5J7BA 2VTNA 3QQGA 5AR8A 1XH4A 3GU7A 3QKKA 4BIDA 4PNIA 3FC2A 2QQ7A 5I9UA 3TV7A 4F1OA 5HTIA 1YOMA 4GYIA 4W9XA 4NM0A 1VR2A 1BL6A 3T9TA 4I5HA 4D4YA 1H1SA 3OG7A 5CU6A 1S9IA 5E8UA 1UKIA 3OY3A 4GG7A 3JS2A 4S33A 5I0BA 3QXOA 4MF1A 2JC6A 3FPQA 3DQXA 4BTJA 2H8HA 2Z2WA 4IIRA 3ZYAA 4R7BA 1OITA 3C50A 3F6XA 4L46A 4DBNA 3TKHA 4Z9LA 2PSQA 5AJQA 3R7GA 4FEXA 4K6ZA 4AW5A 2V5QA 4R1YA 1PMVA 3C4FA 2ZVAA 3O8UA 4KSPA 3BU5A 2XRUA 3BQRA 3RHKA 1ZYJA 3QA8A 5AFVA 4S31A 3LAUA 4U3YA 5CU4A 3UP7A 4TPTA 4PWNA 4QP9A 4CLJA 4BZOA 5HTBA 3IPHA 2C30A 1PMEA 4USDA 4II5A 4X0MA 2ZMDA 4QQTA 2XK7A 3ORZA 3W16A 2QR7A 1ZMWA 4EH9A 5LMKC 3BGPA 3HGKA 4YNEA 5DFPA 4D1ZA 3Q32A 2WTJA 4R3PA 2IW8A 4ZY4A 5HLNA 2OFVA 3V5LA 4CV9A 2ITOA 2ONLC 4FL1A 1U59A 3QKMA 1Q8UA 3BHYA 4FV8A 4I4FA 3HA8A 3IECA 5HG9A 4G9CA 3QGYA 3AD6A 4UMRA 4DTKA 5F20A 3NNVA 5HO7A 5BVNA 2F49A 4DFYA 1H25A 4FG9A 4H58A 4C58A 2WOTA 2XJ1A 4W9WA 3HUCA 4FV9A 4O6EA 2WMUA 5JRQA 3NYOA 4P4CA 3OEZA 4M66A 1GZNA 2CPKE 3IK3A 4DDIA 3NUYA 3QLFA 4O0TA 2ITUA 3UGCA 1PJKA 4IAYA 2YCFA 5AADA 1ZLTA 3LCKA 4CKRA 1RE8A 4PV0A 4XEYA 2WTKB 4RBLA 4CT2A 4FKTA 2OBJA 3I5ZA 2CCHA 2BMCA 5L2IA 2CKQA 4GFOA 3ID6C 4IDVA 5LOHA 3FMJA 3ZRMA 4MF0A 1O6YA 2C6OA 1ZMUA 1IRKA 4IC8A 1W0XC 4EZ7A 2OIQA 2OSCA 4RJ3A 3V5TA 2XM9A 4O2PA 2PUNA 4DH5A 3NW5A 4JMQA 5AP1A 1P4OA 2WHBA 4C4EA 1PXIA 3P08A 5B0XA 3UZPA 2A2AA 5BUEA 3KKVA 3H0ZA 3DBCA 3FLYA 4GV1A 4LV8A 5D11A 3BYUA 1JKLA 4BHZA 2CGXA 4OAUC 2C1AA 3EQCA 4FT7A 3VUMA 2B53A 1P5EA 4F0GA 3QTZA 1M52A 3E63A 2OXDA 3QTWA 4HJOA 4RLKA 1QCFA 3DS6A 1Y57A 3VRZA 5C8NA 1KE9A 3L9NA 5CNNA 4CFVA 3G2FA 5HEZA 3NNXA 3JYAA 4ZTHA 3VBTA 3R8UA 4ACGA 3KXGA 4JNWA 4A4LA 4D2RA 2ITZA 5HCXA 2BAJA 5TO8A 4BDBA 4TKSA 2PVLA 3PIYA 4G16A 2C6MA 2C69A 3I81A 4FNYA 4RIYB 4XJ0A 2QOIA 2GQRA 5HCZA 2B54A 2ETRA 3PY0A 4F63A 4PPBA 3GU8A 4JDHA 5CI6A 3TN8A 4C34A 4R7HA 4EOSA 1OL2A 3OCTA 3FHRA 3PY1A 4GU6A 3ITZA 4RSSA 3A7JA 3I60A 3K3JA 2B4SB 2VAGA 4TYJA 4F6WA 3IQ7A 3KREA 5KZIA 5IG1A 5E9EA 4RVKA 2VX3A 4EH6A 4Z55A 1NVRA 4AZSA 2R7IA 2YA9A 4F1TA 2ACXA 3NUNA 3I5NA 3GGFA 2V62A 2AUHA 2IZRA 3EYGA 3FI3A 3UVPA 4LRMA 1OM1A 5CU2A 2JDOA 1WBWA 2Y4IB 3FMKA 3ZLSA 4BWKA 2JLDA 5JFXA 5GINE 2C5XA 2UZTA 1YDRE 4K33A 4KA3A 4KWPA 1STCE 4C8BA 3ZEWA 3E8EA 1YDSE 4M69B 4FG8A 3GB2A 4IADA 3IW5A 3OP5A 4EHEA 5TR6A 4HNFA 4WNMA 4MD8E 3UDTA 4BB4A 4IX6A 4F99A 1GZKA 1REKA 2YDKA 5HKMA 3W2PA 4P90A 4FNWA 3BPRA 1H0VA 4BDHA 3R8ZA 2WMSA 2JGZA 4BC6A 2W96B 4FGBA 4JJRA 4G34A 3DXQA 2X7GA 4ASEA 4KKEA 3NX8A 4BKJA 3DBEA 1F0QA 2C6LA 2WB8A 4JIKA 2YM6A 2H96A 3AMYA 1M2RA 2HOGA 4W4XA 2WTVA 3PFYA 5M08A 4QT1A 4WBBB 3O17A 4CVAA 4D4RA 5IQGA 3I79A 1ZYDA 4FT3A 2R0UA 4ALVA 2OF2A 5C01A 3MJ1A 5EG3A 2BROA 3GQLA 4BDCA 3PP0A 3FI8A 4L7FA 3QCQA 4JOAA 3FL5A 1OKYA 4CD0A 4BTFA 4RIWB 2E2BA 1QL6A 4JDIA 3ZOSA 3DK6A 4DGMA 5CALA 2HW7A 1L3RE 2YJRA 3PP1A 5L6WL 5AM7A 4NYEA 2OG8A 2UZOA 4NJDA 1R0PA 2JBOA 4NKAA 4I4EA 5I9ZA 4E6DA 5BV3A 3CGFA 4E5WA 4R1VA 4YNOA 4OW8A 4ACDA 2YLEA 3FZTA 4NCTA 3PLAE 4LUDA 5GZ8A 4FE2A 3OXZA 3Q04A 3KU2A 4RIYA 4Z7HA 5BVEA 1FPUA 2NRUA 3ACKA 5AAFA 4AN9A 5I4NA 5IQIA 3R22A 4I5PA 5CF8A 2GFSA 3C0GA 3EL8A 2ZM3A 3F5UA 5T68A 2HXLA 2V55A 4A07A 1WFCA 1MRYA 2YCQA 4I94A 3G90X 2YHVA 4W4VA 5DYJA 3HNGA 2QODA 3G0FA 1FMOE 3BELA 4WT6A 4PDSA 1YKRA 4B6LA 2WQNA 1GNGA 1YXSA 2VWUA 3SXSA 3DV3A 3PE2A 3L8XA 4AAAA 4HPTE 3E93A 2W05A 4X6QC 3EL7A 5M06A 4PP7A 5ANJA 5CEOA 5GZ9A 4X21A 4FV0A 3KVXA 3ZEPA 5AUUA 3E88A 3SOAA 3NLBA 2R3OA 4M69A 1PXOA 2WFYA 4UZDA 3R28A 4F9CA 5M4CA 2JIIA 5AR2A 3UG2A 3D7TB 3QUEA 4U41A 1OPJA 2PE1A 3BGZA 4AE6A 3QLGA 2XUUA 2FSMX 3FKNA 2VO0A 3N4VA 4FTAA 2O2UA 3UYSA 4AFJA 4O7WA 2W99B 3EH9A 4Q5EA 4DH8A 4X6RA 3LXPA 3DLZA 3U51A 3PLSA 1Q97A 5DMZA 3ZM4A 3PYYA 1V1KA 2OO8X 4FSMA 3OXIA 2A0CX 2WMAA 4FUXA 4MXZA 3GU4A 4I22A 4IX5A 4XP0A 4A4OA 1J1CA 3A60A 3OD6X 5E8SA 4MX9A 4Q2AA 3P7CA 5J9ZA 3AC5A 2YCSA 3DAEA 2XNBA 3F3ZA 3KMWA 3G9NA 1R1WA 4GRBA 1JVPP 2CGWA 2J50A 4JS8A 3ZLXA 4BWPA 2XH5A 2X7OA 1ZY4A 3CJGA 4FIHA 3V8TA 2BZIB 4L00A 2PZYA 1YVJA 5ICPA 3M11A 2BAQA 4RX5A 3DBQA 5FRIA 4FKRA 3R7UA 4BGHA 3ZSIA 5CZIA 1MQBA 2KTYA 2Q0BA 2IVTA 2B0QA 4RIWA 4E26A 3ZC5A 2IVSA 5JQ5A 3CEKA 2G15A 4DH3A 5BUIA 2YABA 5IA1A 2GS2A 3MFSA 2XIXA 4FZAB 3WZDA 4E7WA 5L2TA 2AC3A 4QTBA 3HMNA 4NTTA 2QURA 2BAKA 3TKIA 3R30A 4DFBA 1UV5A 3O7LD 3PXFA 3QQKA 5EDRA 2HCKA 3VS2A 5CSPA 1YI6A 2HXQA 2IO6A 1GIJA 2UW7A 4GFGA 4NUSA 2JFLA 4WNOA 2R3KA 4XUFA 3Q4TA 4YZBA 4O82A 4C4FA 4YC6A 2VN9A 1UWHA 4HVGA 4IB3A 4ZY6A 4ZXTA 3RPYA 3GCPA 2QLQA 3H9RA 4NTSA 4ENYA 1A9UA 4AU8A 1K2PA 2CGVA 4OTDA 5F1ZA 4DGOA 1XO2B 3IG7A 2QO2A 4NFNA 4NWMA 4XBRA 5FD2A 5L8KA 1XBAA 3CP9A 3ZS5A 4CQEA 2J51A 3GC0A 2VU3A 3KIOC 4G2FA 1OECA 4HYUA 3DAJA 3KF4A 2CN8A 4FKSA 4RQVA 3PRIA 5A4CA 3SDJA 3QTRA 2BRNA 2ITNA 1YRPA 2X4ZA 5JRSA 3RGFA 5AR4A 3LFCA 4W8EA 3S3IA 2XBAA 3VBVA 3W1FA 1PMNA 4R3RA 4TWNA 2JDSA 1MRVA 3E8CA 1CM8A 1KOBA 1Y8YA 2C3LA 3PVGA 4FV4A 4GW8A 2R4BA 5M09A 2YAAA 5AUXA 4A06A 2P33A 3D7TA 4FSZA 2XYNA 4K0YA 3UO4A 3EQPA 2UUEA 3R9HA 3MB6A 4FK6A 3V8SA 2GNFA 2PWLA 1LR4A 2QCSA 5I9XA 3SHEA 4LRKA 3IOKA 2E9OA 4CFUA 2NP8A 3LCOA 4ZAUA 2DYLA 3OC1A 3ZTXA 3REPA 3NGAA 5EOBA 2XEYA 3ULZA 2V22A 4F78A 1P4FA 1X8BA 1XH9A 5BVWA 2Y8OA 2JAVA 5M44A 2E9NA 4FZFB 4TYIA 2XK4A 4O4FA 4K8AA 4XOYA 3KK8A 4JXFA 4LG4A 4OGRA 3JPVA 5KMMA 3OTUA 3ODYX 3SX9A 4L9IA 3MFTA 4RLLA 4C2WA 3LJ0A 4UYAA 3UDSA 5CXZA 3E8NA 3R21A 3FE3A 4YC8A 3UQFA 5HX8A 4CYIA 3WYXA 2ITQA 4DEHA 4F65A 4HVDA 5T6KA 2QOKA 4WRGA 4JBQA 1SYKA 5HD4A 4WG4A 2VWBA 2RKUA 5J1VA 3UZTA 4PPCA 4RC4A 5DA3A 3JVSA 4E20A 2P2IA 4OBPA 1ST0A 3P78A 4Q5HA 2WEVA 3PJ8A 1NVQA 1R0EA 3R71A 4XRLA 4C57A 5KHWA 2WMXA 3Q53A 4L53A 3VS4A 5HNBA 1H0WA 3LZBA 4FKQA 2ZM1A 3DFCB 3VUKA 3UNJA 3W18A 4D2PA 1ZAOA 5DT4A 2IG7A 2I0YA 4JRVA 3QRIA 4BHNA 3TNHA 5HICA 5TE0A 4GVAA 2OW3A 2JIVA 3BL7A 5G6VA 4F9BA 3VW6A 3H9OA 3U6HA 5JFWA 3ATTA 5E90A 4P2KA 2Z02A 3BKBA 4O84A 1H07A 5K0KA 1RJBA 4ZS4A 3C4EA 4Y5QA 3W8QA 1CTPE 4BJJB 3KA0A 3LOKA 2CGUA 4H36A 3SV0A 2J0KA 4HVSA 2QU6A 4E6CA 1ZRZA 2QKWB 4FKUA 4G17A 1CSNA 2H6DA 3D94A 4FIIA 4IB1A 4F08A 2X1NA 4UXQA 4AW2A 5CAPA 4MBIA 3W0SA 5CZHA 3W2SA 4O7VA 2X6EA 2XK9A 4PMMA 3QC4A 4F9WA 4FBXA 4XYFA 4J53A 3D5WA 4LGHA 2BRMA 4U5JA 3ERKA 2XAMA 5E1EA 4FV5A 3EWHA 3GU5A 5FEEA 5TOZA 3TZ8A 3H30A 5JZJA 3NW6A 1IAJA 4CXAA 5IKWA 2FSLX 5AUVA 3TNQB 4IW0A 4IXPA 3LFQA 4J8NA 3V04A 2W4JA 1TVOA 3HMMA 4IM0A 3NIZA 1V0PA 4DA5A 3EN4A 4U43A 4XG6A 3QC9A 2R3GA 3POZA 5JMSA 3CQUA 1A06A 3ZFXA 3V3VA 2A19B 5HO6A 1NW1A 4J98A 4C59A 3MIAA 1H1QA 5E8XA 3MFRA 4EZ3A 4XOZA 3KEXA 3O96A 3HLLA 5JFVA 2IZTA 5LVPA 1ND4A 3HAVA 1AGWA 5K4IA 4BDIA 3HRCA 3AT4A 4MNFA 1ERKA 5FDXA 4PDYA 2XP2A 3I6WA 2ZFYA 2GCDA 2FSOX 5D9HA 3RWQA 4RIOA 2XNNA 3UQCA 3F2NA 5A3XA 4ZJVA 3QGWA 4QD6A 2HWOA 3UIBA 3WI6A 3JR1A 3ML1A 3EQIA 5HLPA 4ZLOA 5CEMA 2VZ6A 3TYKA 3GC7A 3K5UA 4M3QA 4CTCA 5HIEA 3VONA 3T3VA 3MDYA 1FGIA 4X3JA 1XR1A 2V7AA 4GUBA 4YZCA 3BE2A 2NYAA 1TKIA 2JDVA 1UU3A 4FUYA 2YCRA 5FP5A 4A9TA 5J5SA 3OBJA 3CQWA 5IQEA 3IS5A 4GJ3A 4WUAA 2ZV8A 1EH4A 2EWAA 4BGGA 5DBXA 2PL0A 5FBNC 2XKEA 5LARA 3BV3A 5CVHA 3ZSHA 4TNDA 5IMEA 3ORTA 3N4TA 3KFAA 4ACHA 4DEBA 2OXXA 1BMKA 1IEPA 1PXKA 3FZRA 4JX7A 4P5ZA 3UMXA 4L68A 3UQGA 3V5JA 3VF9A 4ANNA 4JQ8A 1G8AA 3PA4A 2UZDA 2ZYBA 4QMYA 4WSQA 3R7YA 2XNMA 5AV3A 3LFFA 2YDIA 3E64A 3DXPA 2XKCA 4RPVA 3AMAA 3KXXA 3MIYA 1SMHA 4FTMA 2AEGA 4G3FA 4PNKA 4BJJA 3UDBA 5BMSA 5CNOA 2J4ZA 2BR1A 4HCTA 1B39A 2NO3A 4FT5A 5CSVA 3BLRA 4I3ZA 5HZNA 2XAOA 3KRRA 1QPJA 4EHGA 1OMWA 1LUFA 2FSTX 4YJSA 1Q8ZA 3LLTA 5J9LA 1WVYA 3NCGA 5ETFA 4QTCA 5AP5A 3Q6WA 3QRKA 4J1RA 3C5UA 4EUTA 3ALNA 3QYWA 4YHJA 5LCJA 1XBCA 5EM6A 3VS0A 3HL7A 3U55A 4O0VA 4BICA 4KABA 4EK3A 1ZYCA 2OJ9A 5E4HA 3BE9A 5M07A 3DZOA 3KXNA 5IH4A 2YM8A 1YHSA 4CNHA 4FT9A 4E4MA 4UWYA 4E8AA 4FNZA 5EHYA 1TQPA 3IDBA 2XZSA 2OH0E 1WAKA 2Z7QA 4YJRA 3I7CA 3Q2MA 5CU3A 3E7VA 3N4UA 1GZ8A 2Z60A 3Q4ZA 2W4OA 4KIKB 4Y83A 3ALOA 3RPOA 3NAYA 4D9TA 2DS1A 5C8KA 2HYYA 3OBGA 4J8MA 4Z16A 5CI7A 5EW9A 1CMKE 3DDPA 2YITA 4D2WA 4DEEA 1GZOA 3QRTA 2WMBA 3NIEA 1J91A 2H9VA 3P5JC 4I5MA 3WBLA 3HYHA 4DFUA 4TL0A 4EBWA 2X0GA 3CTJA 4QO9A 3CD3A 4FL2A 2ZMCA 3NUAA 2PPQA 1YW2A 3U9CA 2HZ4A 2XIZA 1QMZA 2PVYA 4QYFA 2XNEA 5FP6A 4BTKA 2C6TA 1XH6A 3I0OA 3A8WA 3VAPA 3LQ5A 3BHUA 3VWAA 3TNWA 5FXRA 1UWJA 3EN7A 3P7BA 4O2ZA 3OS3A 3OUNB 4QPAA 4QYEA 2OICA 4MYGA 4XV9A 2QO9A 3MY0A 3N51A 1L8TA 2X8IA 4QP1A 4EOKA 5BX0A 4HCVA 1FVVA 4U7ZA 5AWMA 4WNKA 4ZTNA 4PPAA 4XRJA 2KULA 3QQUA 3FMNA 5M51A 4MTAA 3L8SA 4BDJA 5KMIA 5C4LA 4I6QA 4HYSA 5A6NA 2X7FA 4X3FC 4R7IA 5IMXA 4QNYA 4EH3A 3EQRA 4WA9A 4RX9A 2BDFA 4I92A 5D10A 1OI9A 3QYZA 2X9EA 4S34A 4CMUA 4GT5A 3GC8A 4U8ZA 4IB0A 5EDPA 1OKVA 3MH3A 5DEYA 4QMUA 1WBVA 4J52A 3PDTA 3DJ7A 3BX5A 3L9MA 3EFJA 3FPMA