4FV3A

Crystal structure of the erk2 complexed with ek6
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
346
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK6
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 346
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv3A01
1OKZA 1OL2A 3KEXA 3I6WA 3OTVA 4GUEA 2O63A 4JBQA 1J7UA 4BCOA 3CY3A 3KVWA 2XP2A 4ASZA 2ERZE 2PHKA 3IGGA 2OSCA 3LFFA 3JPVA 3VF8A 4BI1A 4QMLA 2EUFB 3VRZA 4FGRA 3F82A 4GFMA 1KV2A 1LEZA 2V5QA 2QONA 3KRLA 3TV7A 4PL4A 1OITA 2G2FA 4X3FC 5HEZA 3ID6C 3C9WA 2X9FA 4QOXA 4YJQA 4A4OA 5HBHA 4D0WA 5M4UA 4IM0A 2BIYA 2C6OA 5TOZA 3QUPA 3D4QA 2QNJA 1BMKA 4DH7A 3N4UA 3TJCA 4YJTA 5ICPA 3QCYA 2IW9A 5KKRC 4FSZA 1J1BA 1H1QA 4FTOA 5L2QA 3NGAA 4LV5A 2O8YA 4FSNA 5HTCA 4OW8A 3W8LA 5AIRA 2ZDTA 5CT7A 5ETAA 2W4JA 2C5OA 2O65A 3MFSA 4FKPA 2WEIA 5A4EA 5BVFA 2WEVA 3R7OA 3FXXA 4WNMA 3GXLA 3PP1A 4XBUA 4L9IA 2HZ4A 5IH6A 2C1AA 3LW0A 3VBTA 2PPQA 5E4HA 1JSTA 2C5XA 5C4KA 2R3PA 4XV1A 4CZTA 3ALOA 4EZ5A 3FXZA 3QUDA 3BV3A 4M7IA 2PE2A 3FHRA 3OEFX 1K3AA 5BPYA 2F7ZE 3V5LA 2FA2A 2XKEA 5LVOA 4M69B 4X0MA 3FAAA 5FRIA 2XK6A 3UOLA 2ITYA 4QTBA 1FQ1B 4G17A 2VNWA 4K1BA 4MXYA 1V0OA 2W1ZA 1H0WA 2JKKA 4EORA 3C13A 4NH1A 4HPUE 4U44A 3V6SA 4BDCA 3IGOA 1OL5A 3D14A 3UYSA 5IU2A 2GU8A 4AGUA 1ZYSA 3GC8A 2J0JA 3F3TA 3UIUA 4HGSA 4RPVA 3F7WA 4S32A 3QU0A 3MPAA 2YEXA 5DPVA 4A9UA 4OAUC 3NIZA 3H4JA 3RI1A 4YLLA 3R2BA 3M11A 2CPKE 4NM5A 5CQUA 1B38A 1R78A 5AV0A 4ZEGA 4F9AA 4JL9A 4AW1A 4FTAA 2R3FA 5D41A 1F5QA 1WBOA 4ALWA 2ITUA 3A60A 3RZFA 3CKXA 5HX8A 3P9JA 1Q62A 2ITOA 3QCXA 2W7XA 3HV4A 3AC8A 3W2PA 4E7WA 2YZLA 2PVJA 4GVJA 5DLSA 3OVVA 3R0TA 1UNHA 3P86A 3VUIA 4ARKA 3DB6A 3R9HA 4F7SA 2XNPA 4MX9A 4ZJIA 5FXRA 5IA2A 4CMUA 2I6LA 2G15A 4DAWA 3QGYA 3TWJA 5CASA 5I4NA 4O7ZA 4KRCA 4HJOA 4RLLA 3LQ5A 4TY1A 5TR6A 4QMWA 4AZVA 4B0GA 2ZM4A 4WG4A 3KXNA 4J71A 3OEZA 3RK7A 2C68A 5HD4A 2X7OA 4PUZA 5CENA 4YLJA 1YOLA 2WMTA 4FV0A 2QKRA 1ZYJA 4GKIA 1OPLA 4J97A 2AUHA 2W0JA 1RQQA 3ORMA 3NEWA 4RX8A 5EDQA 3W2OA 3DB8A 4OT6A 4RX9A 3RAWA 4AUAA 4PMSA 2VTJA 3FMLA 5M51A 4QNYA 3OOGA 3TZ7A 4EH9A 5TF9A 3LMIA 2PVHA 4FV2A 2I0EA 3BWFA 4UMUA 3QTUA 3ORTA 4IWOA 3DU8A 3RK9A 2CKEA 2XIRA 2Z7SA 4IBMA 3ZRKA 5HLPA 4DE4A 1JQHA 4M12A 2GNFA 3PRIA 3EZRA 4FUYA 3SLSA 3PXQA 4YR8A 3M42A 3O17A 2GNHA 4ZMFA 5M4IA 4S31A 4K11A 1I09A 1CSNA 5GJGA 4QQCA 5K0KA 4CV8A 3MV5A 5HG8A 4JDIA 2BZJA 2GDOA 4FUXA 3ZFYA 4BGHA 2PZIA 1Q61A 4AZFA 4C33A 3OFMA 3R7GA 3OCSA 4E5WA 2ITNA 3QCQA 3NYVA 4N4SA 3LM0A 4HYHA 1YDTE 5I3OA 5JFSA 5ANJA 3A61A 3HX4A 3DLZA 5ANIA 2J0LA 2WTWA 4RG0A 5KHXA 1SNXA 5EYDA 3K3IA 1KE7A 2ZMCA 1X8BA 3L8XA 4FIGA 4QT1A 3EN5A 4TKSA 4EH2A 4EQCA 5L2SA 4V04A 5ANKA 5CNNA 4QNAA 2Z7RA 1DI8A 4BKJA 5L2IA 4PWNA 2OF4A 4IZAA 3LFSA 5AA9A 2WOTA 3C4WA 4HVSA 3K5UA 4M15A 3C4XA 4FT3A 5JFXA 3HUCA 1YI6A 2O0UA 1YXUA 3MVHA 2IVTA 3NNXA 2VO7A 2WOUA 3OWPA 5HICA 2RSVA 5FGKA 2QI8A 3AG9A 3PYYA 3FYKX 2WKMA 2G01A 3EIDA 2J7TA 3LFBA 2QLUA 4GG5A 4NTTA 4USFA 3NDMA 5J1WA 5GZ8A 3R8MA 4YGAA 2XMYA 3NRMA 3WIGA 3W55A 5HBJA 5IEVA 4K77A 4BCPA 1UWJA 3FDNA 1YWVA 4BICA 2EB3A 3R2YA 4CZUA 4EH4A 4ANOA 1YW2A 3Q4CA 3QA8A 4CG8A 4DHFA 2CJMA 1FGIA 2B9IA 3COHA 4NKAA 4WNOA 2X7FA 4XHKB 5CT0A 5KUPA 2PVRA 1OIRA 4HNIA 3IW8A 3BV2A 1KSWA 2ZV7A 2RGPA 4ACHA 2I0VA 4YZNA 3ODZX 4FV3A 4FTQA 3T9TA 2PWLA 3R1SA 3FMDA 4H1MA 3FL4A 4I92A 2F9GA 5EHYA 5HIDA 2Y0AA 1M7NA 4FVRA 4QP4A 4DEBA 1I44A 3E93A 4JJRA 4AOJA 2GMXA 3F5PA 2Y4IB 3ZCLA 5L2WA 3BYSA 5AWMA 3LCKA 3LCSA 3WARA 5AM6A 3QKLA 2ZVAA 3BGQA 3RVGA 3GC7A 3TV6A 5JFVA 2JAMA 3LJ0A 3WBLA 5FEQA 2J4ZA 2YCFA 3QWJA 3QWKA 4HCTA 4IX6A 4AGCA 3DQWA 3GU4A 1R39A 3ZSGA 4CCUA 3BZ3A 4O0SA 4O6EA 4PV0A 4CMOA 4EK5A 2ITXA 3TUCA 4QP6A 3FZTA 3AC4A 3SG8A 2WPAA 2OJFE 4YO4A 3R71A 1KE6A 3QTSA 2X2KA 5E9EA 2YCRA 5DN3A 1JWHA 3KC3A 2JLDA 2VTAA 3TIZA 2UZLA 1LEWA 2JIVA 3HV6A 4L68A 5HE0A 3T9IA 3LJ1A 4GFGA 4EK3A 4BBEA 2BROA 3L9LA 5FLFA 4WBBB 1XH7A 4APCA 1OKWA 4C4IA 4CSVA 3GP0A 2BUJA 4C36A 3G6GA 1E9HA 3DY7A 4RJ3A 1GIJA 4S33A 3EQIA 2JFLA 1Y91A 2FGIA 2OH4A 4QQJA 1NY3A 3OW4A 3HL7A 5HD7A 4NT4A 2YJSA 4JAJA 4TZRA 5DYJA 2W5BA 4G9CA 1XR1A 3BLHA 1F0QA 5DR9A 3T3UA 5IPJA 4FTRA 5DT3A 3CS9A 2BAQA 2J50A 3GBZA 4IZ5A 4DGNA 3F3ZA 5KMOA 4DTAA 4IEBA 3ANRA 3K5VA 4F08A 3ZFMA 2W4OA 3FSKA 4TYEA 3IS5A 2CCIA 4RIWA 2EU9A 3TL8A 5JGAA 3CBLA 3QXPA 4G3CA 5HIBA 3W8QA 3ZLWA 1ZOHA 4GS6A 1J3HA 4UMTA 1GNGA 3KVXA 5EQYA 3QL8A 4FV6A 3CP9A 2YA9A 1DAYA 5LWMA 4M13A 2YACA 3ZTXA 3DKGA 3U8WA 5ANDA 4E6QA 4YTCA 4IFCA 2ZJWA 3VUTA 3TDVA 4RJ8A 1UNGA 5EKNA 4O83A 3G6HA 3OT3A 3B2WA 3PFQA 3LPBA 4LI5A 4ZZMA 3NUPA 4YZMA 4BDIA 4E93A 4F7NA 3VBWA 2GPHA 1QPCA 4KWPA 4DFYA 1OB3A 1M14A 3F69A 5IUIA 4FKJA 1J1CA 5HO8A 3D15A 5K3YA 1MQBA 2CNVA 4AOIA 5KMIA 4H05A 1H0VA 1Z57A 3KK8A 4UALA 5EW8A 4WSQA 2XK4A 4BDJA 1YOJA 2ZYBA 4JDKA 5EI8A 4YU2A 4BR3A 2GNJA 3O7LD 3O23A 5FM3A 2P0CA 2PVKA 4NJDA 5JT2A 4XNEA 1JBPE 3D94A 2YERA 2DQ7X 3C5UA 3PP0A 4WG5A 2IVUA 3NNVA 5GIOE 5HVYA 4RX7A 4D2RA 3KCKA 4EBVA 3H0ZA 4RX5A 1PMNA 3OXZA 4TWPA 3L9NA 5CEIA 3NNUA 1IEPA 4FV7A 4RA4A 1PYEA 2BTRA 4TYJA 1FMKA 1BI7A 2AYPA 5HQ0A 3BE9A 3II5A 3OCGA 3R8LA 5JEBA 3MDYA 5IMEA 1PMUA 3D9VA 3GUBA 3TACA 3N4TA 4ALVA 2BVAA 3COIA 2UVYA 4CKRA 2B0QA 1CKPA 2OH0E 4RMZA 4EWHA 5ANOA 3FLZA 3WF5A 1UU7A 3QX2A 4MKCA 3TEIA 3HP2A 2UW5A 4GG7A 4XLVA 3NUXA 2RFEA 3R9RA 4ID7A 4L53A 4UZHA 3LM5A 4LGDA 3W33A 1WBTA 3RK5A 4F0IA 3V8TA 4YJVA 3R63A 4FIIA 1YVJA 2XK8A 3BRBA 3FMMA 3R7UA 3VUDA 4E4MA 2PZ5A 3FXWA 4OTFA 3TNHA 3HGKA 2OXXA 3FWQA 3LCOA 4B99A 5AAGA 4JG7A 5JGDA 1QMZA 4PTGA 3HMIA 4IAZA 3LXPA 5BYZA 1OECA 5HLNA 4MD9E 1ZMWA 2HENA 4QP1A 4C3RA 5F9EA 4EC8A 1XH6A 3D83A 3R28A 4TWOA 2I40A 4AS0A 2F49A 5JFWA 1ZARA 4FIJA 3ZO2A 2OU7A 3WF9A 4O0YA 1Q8WA 4BCKA 4BIDA 3W2QA 3ZDUA 1J91A 4LMUA 2GHMA 2XNNA 4GYIA 2XIXA 3NCZA 4JBPA 5E8YA 1U5RA 1UU9A 1Y6AA 1JNKA 5E1SA 4I6QA 4NWMA 4DH3A 5LVMA 2X8IA 3PXFA 4E3CA 2XRUA 3SRVA 2GFCA 2I0HA 4MTAA 4U0IA 3RINA 3I60A 3PJCA 4N6YA 4BTKA 3HZTA 3HRCA 1MQ4A 2XRWA 3NW7A 4R1VA 5CVHA 4FG7A 5B2MA 4CYIA 1PXLA 3TDWA 2BFYA 3AD4A 2XA4A 3AMBA 4KUJA 3GCSA 1HCLA 5LMKC 4AXAA 3UNZA 2IVSA 2PVNA 3MVJA 4S2ZA 4EOOA 4YPSA 4IIRA 3FY2A 1FVRA 4A06A 2XKFA 4KBAA 2OBJA 2C6MA 4UZDA 3VW8A 3MN3A 2CN5A 4IMYA 4FKLA 5C03A 2PVYA 3PA5A 4U3YA 1H07A 2BDWA 1KE9A 3GVUA 3IECA 3PPZA 2W1EA 2XVDA 4RBLA 4BF2A 4WUAA 3SAYA 2CDZA 4CFNA 3I7CA 4DH1A 5IA4A 4BBFA 2QCSA 3Q4UA 1PXNA 3PE2A 4K9YA 4QMTA 2GS2A 3DBFA 4USDA 5ETIA 3LKMA 4EYJA 2OF2A 4FZDB 4BCJA 3F3UA 3TIYA 5CAUA 5J9YA 4P7EA 4FOBA 2W1DA 5C8KA 4B4LA 5KMKA 2ONLC 2EB2A 3VS2A 4F6SA 3D5XA 5AMNA 3BE2A 2A2AA 5CAQA 4IB1A 5JQ8A 3LQ3A 1IASA 5L6PA 1ZY4A 2YM5A 1URWA 3LIJA 4HVDA 3R73A 4ZXTA 4XOYA 3PVUA 4GSBA 1NT2A 2XIZA 3EMGA 4DINA 3FI8A 1Y57A 2BHEA 2OJGA 5AR5A 2VWZA 2XJ2A 2QQ7A 3F66A 3TKIA 2QOQA 2BFXA 2XEYA 4G5JA 3DS6A 2VTOA 1OZ1A 4GVAA 3FL5A 1ZY5A 4G6NA 1M2QA 4CZYB 4OTPA 4RIWB 4ZSJA 4QQTA 1XWSA 3O0GA 4IFGA 3E8NA 1UU3A 3M1SA 4R3CA 5CYIA 3R9NA 3R7EA 1JPAA 5AUZA 5EFQA 1YOMA 4MQ1A 4JIKA 4JNWA 4EOQA 3KRXA 1YHSA 3BBTB 3O2MA 2VWVA 4IX3A 3E63A 2YIQA 4MF0A 2C5YA 3VUKA 3AT4A 4HZRA 3GFWA 3UNKA 3ELJA 4U41A 3L9MA 3R1NA 4Y85A 5AP0A 1R0EA 4JRVA 3DPKA 3EN7A 4D55A 2YM4A 4TNDA 4FIHA 4QPMA 4TYIA 3TUDA 1GAGA 2WIPA 3EJ1A 4C3PA 3UO6A 3IPHA 5HO7A 5DVRA 4AWIA 2HW6A 3MGYA 4M68A 4EHZA 2WD1A 3FZRA 4R6VA 2YWPA 3WYXA 4E4XA 4TYGA 2YCQA 3KY2A 2BRNA 4I1ZA 4CTCA 4E1ZA 4NZWB 5BUIA 2H96A 2HW7A 3EYHA 4FL1A 4GT4A 2YLFA 4TYHA 4UWYA 2IW8A 4BWXA 2W9ZB 3Q4ZA 4MHAA 4FA2A 3A4OX 1A48A 1UV5A 3UO4A 4DG0E 2C3KA 2C4GA 3BHYA 4JAIA 2VX1A 3GNIB 4L46A 3BQCA 3P7BA 5FXSA 3NSZA 4O91A 1H28A 3ULZA 3QZGA 2J0IA 4KIQA 1KOBA 2XNBA 3TKHA 4G3EA 2R5TA 4F6UA 1PMVA 5AR2A 4GJ3A 2QOCA 3ZEPA 1WBPA 1W98A 5I5ZA 4FE2A 1PXMA 5EKOA 3VQUA 5F4NA 4RFMA 3RALA 3CEKA 4XRJA 4CNHA 3IW7A 3HECA 3WE4A 2EVAA 2X8EA 5J5SA 2YIXA 1KE5A 3Q9XA 2F2UA 4P5QA 3I0OA 3Q04A 3ET7A 5CSVA 4QP3A 4Z7GA 3QQUA 4YHJA 3KMUA 5LWNA 3DZQA 1S9IA 5E8UA 2Z02A 4QMZA 2W99B 4AQCA 3UIXA 3DNDA 3EQBA 4JQ8A 2Q0BA 3PXZA 2YFXA 3DQXA 5CEKA 3CGFA 3EN6A 3ZLXA 4FEUA 3QRJA 2QR7A 1MUOA 5IDPA 3ACJA 1EH4A 1REKA 4RVLA 3KULA 1XH5A 4BIBA 2R3QA 3GCQA 5B2LA 4FKQA 3KF7A 5IQAA 4I4FA 4QTAA 4AG8A 5T3QA 1H1RA 2VO6A 2GNGA 5C26A 3AD5A 4YTHA 2NRYA 5HGIA 4DFUA 5IQHA 4OTIA 4ITIA 3HRBA 1YI3A 4GFOA 3B8QA 4I6BA 4R3PA 4DC2A 3UZPA 4WRGA 3SRVB 3DKCA 2XYNA 1SM2A 4ZOGA 4ZLOA 5C01A 5KMJA 3VO3A 3SW7A 4O6LA 1WBVA 3OBJA 3TKUA 3RCDA 1PHKA 4XS2A 2VU3A 4YLKA 2IZUA 5LXMA 5GINE 3OF0A 4WNPA 5HCXA 1U54A 4IZYA 4PQNA 5CY3A 4ZZNA 1ZWSA 2W5HA 3QTZA 4G16A 4J99A 4IW0A 2X2MA 5D9HA 2YN8A 3H9OA 3K3JA 3LJ2A 3Q5IA 4XJ0A 4YC3A 3UTOA 1K2PA 2BRHA 3NZ0A 2WFYA 4FBXA 4DTBA 1GZNA 3U6JA 2CGUA 2UZNA 2BRGA 4Y5QA 4K18A 4N6ZA 3IW5A 1SVHA 4D0XA 4DFZE 1ERKA 1YDSE 4O7TA 2UZBA 4FT9A 2VO0A 5B2KA 4DTKA 3PTGA 1TVOA 4AN9A 4IJPA 5IQEA 4W4YA 4II5A 2QLQA 4FL3A 2V55A 4P4CA 5IQFA 5AUYA 1FVVA 3QCSA 4M84A 5F95A 2QD9A 5DEWA 4AT3A 2IN6A 1DM2A 1FOTA 5E8XA 4C0TA 4EKKA 2RG5A 3DA6A 4BCGA 3DOGA 4HGLA 4BGGA 3NAYA 3UP2A 3DXNA 5CU4A 4E73A 4F1OA 5JH6A 4EOLA 5J95A 4WUNA 3FLQA 4BDEA 4IQ6A 4YBJA 5EM7A 1ZYLA 4EQMA 3PE1A 4BB4A 5I9XA 3JXWA 5AP3A 4AA4A 4F0GA 1Q3WA 2XKDA 4EOIA 3FYJX 4I0TA 4RJ5A 4YBKA 3O8TA 1CDKA 3BYOA 3PWYA 1Q8YA 5AUWA 4BFMA 3W1FA 5AUUA 4M97A 4WKQA 4MD7E 3WZDA 2I1MA 4EOKA 2XNOA 2Y4IC 3V5PA 3Q6UA 4B6LA 5H8BA 5JQ5A 5HE2A 4L3PA 4BTFA 5M55A 4ZSLA 3DK6A 4KIPA 2A4LA 2PVMA 3CC6A 3FLYA 3HAVA 2X0GA 3FKNA 3QQGA 2W1FA 4KS7A 4X3JA 4QMNA 4XUFA 4F9YA 4OBQA 3VUMA 3RNIA 4D9TA 3NCGA 2XNMA 3HV3A 5AA8A 2BPMA 3QRTA 2OJJA 5A6NA 3IG7A 2WTVA 3UZTA 2CN8A 2ZMDA 3ZO4A 3PRFA 2WMBA 4L6QA 1U46A 2BRBA 2BMCA 2FVDA 5M09A 4RWLA 3RWQA 5AAFA 4L01A 1FMOE 4RC4A 5E8WA 5LVNA 3U51A 3JVRA 1PMEA 4C3FA 4K0YA 4M0YA 2Q83A 4XLIA 3SC1A 1M17A 2PK9A 4OBPA 4WOVA 1CMKE 2ESMA 1NVSA 1P14A 1YDRE 3I7BA 2WQOA 3WF6A 4BHZA 4CD0A 5BUEA 4TYHB 3PLSA 2YJRA 4U9AA 2WQMA 3MY0A 3RNYA 5FP6A 5HO6A 3SOAA 3QYWA 4R3RA 1FINA 4A4LA 2C0OA 5F20A 4CT1A 3HMPA 5HX6A 2OLCA 3G33A 2GSFA 2W1GA 3FLWA 5JRSA 2VAGA 1H00A 3BU3A 3MH1A 3L9PA 4O81A 3NUYA 4KAOA 4TXCA 4BWKA 2OFUA 3POOA 1JOWB 2Y4PA 5AP7A 3U9NA 3UVRA 4CYJA 4DCEA 1ZOEA 5L6WL 2IZSA 5IEYA 3LQ8A 4FNZA 2GQGA 1O9UA 3DKFA 4UMRA 3OXIA 1Z9XA 4BKYA 4KS8A 4FTMA 5A4LA 1FPUA 2GHGA 2VTTA 4D2VA 2GQRA 3NUAA 3ODYX 4O7LA 2WO6A 2IG7A 2O64A 4PL3A 4AP7A 3TNQB 1XH9A 5KHWA 2PMNX 1LUFA 2Z2WA 3CJFA 5E8ZA 4IB5A 2UZDA 5AR8A 3ZLYA 4YZBA 5AJQA 3IW4A 4B7TA 3IKAA 3GOKA 4YURA 4FIEA 2BZHB 3L8VA 5F1ZA 4IHPA 4DH8A 3IQ7A 4G6LA 1F3MC 5C27A 5HKMA 3RPOA 3ACKA 5EQPA 2G1TA 4FV1A 1A06A 3CY2A 4R7IA 2VWYA 4GJ2A 4RC2A 2PE0A 3FQSA 5AR7A 3HDMA 5IA3A 3KULB 2RFNA 3KGAA 4ZTLA 1MP8A 1PY5A 2IO6A 3BHTA 3C50A 3TCPA 5BQ0A 3RAHA 4O38A 3VBXA 2FB8A 4EOMA 3BEAA 2JC6A 3FY0A 3VC4A 1RDQE 3A7HA 4QYFA 5GJFA 2VGPA 4O22A 5CU2A 3VJNA 1JLUE 5EI2A 2I7QA 2P55A 2V7AA 4O0WA 5AX9A 5HI2A 3ZUUA 2BZIB 4DBNA 3COKA 5E7RA 3C4EA 4JDHA 4FTCA 4TW9A 5KNJA 1H1SA 1U54B 2BAJA 2HAKA 3Q6WA 4YJUA 2YDIA 4O0VA 5IZFA 2SRCA 3R7YA 4M66A 4UXLA 4CFXA 3D7TA 2XIYA 3OCBA 3BX5A 5HNIX 2R4BA 4D2PA 3BLQA 5CLPA 3MA6A 5CWZA 4ANMA 4KBKA 2PY3A 3Q96A 3WZUA 4GK2A 2XBJA 2QODA 3EH9A 3EKKA 4BTMA 4NKSA 3LCDA 3CTQA 1JSVA 3KN6A 4HNFA 1U5QA 2R3LA 2ITWA 2NRUA 3BHVA 3UOJA 5A54A 2JD5A 4HW7A 3MVLA 1XKKA 4HPTE 4YJRA 2GNLA 4RIXA 1GIIA 4EYMA 2UUEA 4P90A 4WIHA 4ZS0A 3RWPA 4D4RA 4RIYA 4USEA 5KCVA 5FEDA 4WD5A 3F2RA 5GHVA 1OBGA 1LPUA 2XBAA 4E6AA 4YJPA 3CSVA 2XK9A 5AP1A 2J90A 4BDDA 3BI6A 3Q4TA 4FKRA 1UKHA 2GTMA 2Z8CA 2B9FA 3LFEA 3OWKA 5ETCA 1ZRZA 1P4FA 4RZVA 3UE4A 2J9MA 1XBAA 3CGOA 4BDHA 4BHNA 3U54A 1JKLA 5FTQA 2VTQA 2NPQA 4I4EA 2B54A 4Z55A 5KMLA 5DBXA 3F9NA 3AMYA 4AW0A 3P78A 4IVBA 4NK9A 4Z16A 4MF1A 4NJ3A 5CSXA 3DNEA 4N0SA 1WCCA 4QMXA 1NW1A 4EI4A 4EH8A 3A7JA 5G1XA 4BZDA 4P5ZA 2B9HA 3N9XA 5ETFA 1PXPA 4OR5A 2R7IA 3QD2B 4F9CA 3TTJA 2W1CA 5D11A 5DWRA 4YTFA 3UG1A 5B7VA 4XG2A 3EQRA 3HA6A 4QP2A 3KK9A 4O1OA 5M4CA 4DLIA 4AAAA 4FEQA 2QU5A 1Y8GA 3HRFA 1H1WA 3O8PA 4YZ9A 2CMWA 3EWHA 4S34A 5LARA 2QO7A 2PVFA 3V8SA 5IQBA 5EQEA 2YAAA 4UMPA 4EK6A 3R22A 4IX5A 4AT4A 3PPJA 4A9RA 5HTIA 2JBOA 4ORKA 3QTWA 4FSTA 5EDRA 2G2HA 3LXKA 3NVKI 4AGWA 4TT7A 4IB3A 1ZYDA 3HV7A 1YKRA 4W9WA 4CRSA 1R0PA 3IO7A 4CXAA 1ZMVA 4X7QA 5AP2A 2BDJA 5CI6A 5H2UA 4GW8A 2WTIA 3SXSA 3O8UA 3CTJA 2OXDA 3Q2MA 4QPSA 4IC7A 3F6XA 3LMGA 5IQIA 4CTBA 4L42A 2C6EA 4JX3A 4Z3VA 2WU6A 4EK8A 3DLSA 3ZSIA 4KA3A 4FTLA 4QMPA 4CFMA 1PXJA 4BDKA 2JDSA 2ETMA 4D9UA 3QA0A 1W83A 3GCUA 3WOWA 1V0BA 1G8SA 1LR4A 4NSTA 3NNWA 1M2PA 3PZHA 4EL9A 4XEYA 2UVZA 4NFNA 4RT7A 1P2AA 3FUPA 2ZB1A 4XYFA 5D10A 5T68A 2OZAA 4LL0A 2X1NA 4ZSEA 1NXKA 4F0FA 5HVJA 3H9FA 4FV4A 4AA5A 4AZTA 2GS7A 1OKYA 4IVDA 4UV0A 2JKOA 3ZZWA 5JGBA 5JMSA 1WBSA 2BCJA 2P2IA 3MWUA 3AC5A 4OBOA 4YHTA 5CSWA 3VAPA 4F64A 3IDBA 3OP5A 5EM5A 1CTPE 5CSHA 4EH3A 3ROCA 5DR6A 4RFZA 1MRUA 4O7VA 4NM3A 1RW8A 3P79A 5K4IA 2RKUA 4LRMA 3QRUA 1RE8A 4YZCA 3F3WA 4KRDA 5ITAA 3SGCA 4ZY5A 4BZNA 3AC3A 3IK3A 3OC1A 2HWOA 3F5GA 1Q99A 4MVFA 4E5AX 5LMBA 3UQFA 5FUTA 1PKDA 5BVEA 4ZTNA 1H01A 3WZJA 4C62A 4RGJA 4WG3A 4XBRA 4XX9A 4DBXA 4O0TA 1OIYA 3ZXZA 4DEDA 3QTXA 2J0MB 4JI9A 4EH5A 3PXKA 4M8TA 2JKMA 3QGWA 3WE8A 5EM8A 2ZDUA 3F2NA 4BI0A 5HG5A 2W9FB 2Q0NA 2J2IB 4OTHA 2PYWA 1ZAOA 4OLIA 5HNBA 2PULA 3ORXA 4D5KA 4R8QA 3VS7A 5IA1A 3OXTA 3EHAA 4RVKA 5AR4A 5I0BA 3MI9A 1OL1A 4UYAA 3RM7A 4I6FA 4IAIA 4A9YA 2BILB 2W96B 3NR9A 3O7LB 3EFWA 3FPMA 2W5AA 3HMNA 3DZOA 4M14A 3UQGA 2B7AA 4A7CA 3EQGA 3FZSA 3MFUA 2PSQA 4FTNA 3BIZA 4KABA 4KKGA 4V05A 4C38A 1BLXA 3D7TB 4FSWA 3CQUA 4BCIA 4I5CA 3O51A 3PSCA 5JK3A 4MXCA 5JZNA 3TNPC 4NW5A 4GCJA 3S00A 4O84A 2WIHA 4BCMA 4DEGA 1IA9A 4UYNA 4ONAA 3QZHA 3VRYA 4N57A 3GC9A 4YJOA 5AV2A 2WMRA 2HCKA 3LOKA 1SZMA 3GOPA 4TWCA 4ZTMA 5FP5A 3V04A 4IVCA 1FBNA 3CPCA 4BY9E 1YXVA 3EQPA 4RIXB 3UIMA 4BGQA 3LFNA 4JDJA 4RIYB 5ACKA 3TTIA 3QQFA 2C3JA 1QPEA 2R3OA 5FEEA 3ORIA 3TUBA 2Y6OA 5BX0A 1YXSA 4QQ5A 1Q41A 3P4KA 4O27B 3QFVA 3MFRA 3QQLA 2O3PA 3PY1A 4PPCA 3HDNA 2PZPA 2WMSA 3GCVA 3GEQA 3F61A 3PJ8A 1TQMA 4DH5A 1TQIA 4KKHA 5HBEA 3UYTA 5HESA 4LM5A 2DS1A 3NW6A 4U80A 2BHHA 3U6HA 2VWIA 3D5VA 3F7ZA 1IRKA 2WXVA 3PSBA 2UZTA 4I5MA 3W16A 5FWKK 2IZRA 5EH0A 2UZUE 3ZFXA 4IDVA 2C0IA 2X81A 4RSSA 1T45A 5L8KA 5HTBA 5BVKA 4C2WA 2QURA 4KINA 2CSNA 2JGZA 3PJ3A 1GIHA 3C4ZA 3E8CA 3ZEWA 2R7BA 5IH4A 4FV8A 3ORKA 1OKVA 3JYAA 4O7WA 4FKTA 5FDPA 5M4FA 3C51A 3VUGA 2R3RA 3UPZA 1CM8A 2F7XE 1OIUA 2RFSA 3H9RA 4FZFB 5CAOA 5KE0A 4WHZA 3DXQA 1QL6A 3C0IA 2A19B 2C6IA 3CR0A 4IWDA 3FJQE 2VWXA 5H3QA 5M56A 3KCFA 4IAFA 3JS2A 2C6LA 2JFMA 4GYGA 5EHOA 5I9UA 4XG4A 4L00A 3TZ9A 5K0XA 4F09A 3CCNA 3MPTA 3P7CA 3BQRA 4XG8A 5L4QA 4OTGA 2C3IB 2NO3A 4PNIA 2WQNA 3R9DA 2YIYA 3U4WA 2PUNA 3MJ1A 3EQDA 2W1IA 2XJ0A 3OCTA 2CGXA 4RIOA 3VHEA 2FSMX 3CE3A 4V01A 5AAEA 2JBPA 3E88A 3TN8A 2V7OA 1Q97A 5IUHA 4D1XA 3E7OA 1OUKA 4OTWA 3ZH8A 1WVWA 4HVHA 2Z7QA 1H27A 3PA4A 4GK3A 3O71A 3UVQA 3R1YA 3PDTA 4QMSA 3IW6A 3KFAA 1WVYA 2XKCA 3PWDA 3R8UA 1OL6A 1REJA 3I81A 4FNXA 4O1PA 4PDYA 4EJ7A 4FSMA 2YISA 2BRMA 5IKWA 5CNOA 4DGOA 4QMOA 4DYMA 3MSSA 5DA3A 2O5KA 2OZAB 4FT0A 3ZC5A 3K54A 3TJDA 4F65A 4I24A 2C69A 2YABA 3BBWA 3BLRA 3G9LX 5BMMA 5AV3A 4E8AA 4EHEA 4AW2A 4D5HA 3VUHA 4ANBA 3OT8A 4DEEA 5CSPA 3UO5A 5CZIA 3JY9A 4Y46A 3PIYA 3HNGA 3UGCA 3V5WA 1Q24A 4BL1A 3U9CA 4CFFA 3NUUA 4BCHA 1OGUA 5DT0A 5KZ0A 4F70A 4ZTRA 2YCSA 4I0SA 1VJYA 4G31A 3FMEA 3PXYA 4RJ6A 1GZKA 4ZSGA 4JOAA 3ZBXA 3ERKA 2AC3A 4YNEA 4JQEA 4QYYA 4ZJVA 4O7NA 5HOAA 2A0CX 4GU6A 3HVCA 3KKVA 3D2IA 4C02A 4ITHA 4F1TA 3MTLA 4NEUA 4FTUA 2H9VA 2RL5A 4MAOA 3Q5ZA 3BHUA 5TKDA 3V6RA 5FQDC 3E8DA 4BIEA 1RJBA 5BVWA 5BMSA 2PUUA 2QOOA 4RWKA 2W17A 2WHBA 1H8FA 3DDPA 2NP8A 3SQQA 2O2UA 1NVRA 4R7HA 3LFQA 5F94A 3TV4A 4L45A 4DITA 3E92A 2WNTA 2IPXA 4X2GA 2VTIA 4ZS4A 5HZNA 3HAMA 4NM7A 3ZC6A 4ACDA 3H0YA 3VBYA 1CKIA 4OAVB 4L67A 4U42A 3UODA 4J7BA 4CV9A 4FZ6A 4C34A 3VULA 4J52A 1WFCA 4WSYA 5M44A 4KBCA 1GY3A 3HP5A 3BYVA 4X6RA 1YWRA 4G2FA 2XYUA 2R9SA 3V5JA 4EZ3A 2DYLA 2UZWE 2JAVA 3TT0A 1PXIA 4FKIA 2ZM3A 3D0EA 3FZ1A 5FG8A 4I20A 5K4JA 1OPKA 3FEGA 2JITA 1AQ1A 4ZP5A 4FEWA 1BKXA 1YI4A 4IE9A 3W2SA 3PVGA 3QZFA 3OS3A 3B8RA 2VTRA 3RKBA 3VN9A 3RPRA 2LGCA 1IR3A 3D5UA 5FTOA 4I21A 4DG2E 5JKGA 5CEQA 3A2CA 4NUSA 4FK6A 4CGAA 5CF4A 2DUVA 2HY0A 4YJSA 4X2KA 3SV0A 1NVQA 3LCTA 2VGOA 5FD2A 2XF0A 3U6IA 3MY5A 3ATTA 4EJNA 4ANLA 5IG1A 2R3JA 3RTPA 4F1MA 3KRJA 3ZHPC 1E1XA 3GB2A 1ZLTA 1KV1A 2RIOA 1O6KA 5CVFA 2ZAZA 5B0XA 2WQEA 4ASXA 4FEVA 4I5HA 3RPYA 4MNEA 1ATPE 4LOQA 5L8JA 2WTKB 2ETKA 3DAEA 3D2KA 4I94A 1DI9A 2FSOX 3VW6A 5HE3A 3VHKA 2OGVA 3W10A 4AFJA 4PX6A 1WZYA 2OI4X 3C0HA 4D4VA 2XJ1A 5IEXA 4QRCA 3R02A 4BDBA 3F3VA 5IQGA 4EH7A 2CHLA 5L3AA 2X8DA 4MBJA 5H8GA 3DV3A 4QMUA 2WQBA 3JR1A 2YWVA 1OL7A 1G3NA 3CJGA 3WZKA 4C4HA 3I1AA 1MRYA 1H4LA 4GIIA 1XH4A 4R7BA 2WU7A 2OO8X 2OIBA 3DKOA 1W84A 3I5NA 3MPMA 1OPJA 4LQMA 4QYHA 5E90A 4DGGA 2WMAA 3R9OA 2B52A 3F5UA 2P3GX 3B2TA 1URCA 4C61A 2C5NA 5J7HA 3UDBA 5CALA 3E5AA 3FMKA 3P5KA 4BWPA 4D58A 4CVAA 5L8LA 3I79A 3IOKA 5GZ9A 4FZAB 4D2TA 1DS5A 4DF3A 3WZEA 3ORZA 3V3VA 4IB0A 5FXQA 3TG1A 5EW3A 2ITVA 3OUNB 3Q9WA 4H1JA 3QX4A 2UW6A 5J87A 4JQ7A 5CTPA 1BL6A 3V5QA 4RQVA 1AGWA 3FKOA 3C4FA 1NA7A 1VEBA 3FI2A 4FKWA 4FTJA 5HCZA 4XP3A 2GTNA 4Y72A 5KO1A 4FGBA 3TNWA 4Y5HA 4X6QC 5M08A 3E7VA 3NAXA 3RCJA 3VF9A 4E6CA 2YIRA 4GRBA 4C4FA 4GMYA 4WA9A 2OG8A 2XNGA 2XCHA 4H3BA 2C30A 4I5PA 3E3PA 3FQEA 4UWCA 3ROYA 4EUTA 4M67A 4ERKA 2V62A 4M3QA 4FYNA 1B6CB 1PW2A 2OZOA 4GV1A 5BYLA 3Q2JA 5FBNC 3EOCA 3QD0A 2WMWA 1HOWA 4S30A 2WMVA 4YP8A 4AACA 5A46A 4MXZA 3MW1A 2A27A 4LUDA 2R3MA 4X2FA 5DR2A 1ZXEA 3EL7A 2BALA 2UW8A 1M2RA 3MJ2A 3UOKA 2HYYA 3KA0A 3PIZA 3ZUVA 4CQGA 3KB7A 4DT8A 2GS6A 4G34A 4JLCA 2OKRA 2OW3A 3EB0A 3AQVA 4FV5A 3QRKA 4CT2A 5LJJA 1CKJA 3BWJA 3R04A 5T6KA 5J79A 1XHAA 2GHLA 2WTJA 4XG7A 3RBWA 3OY3A 3CKWA 1Q5KA 5HLWA 1OMWA 4RJ7A 1KE8A 4AOTA 5EYCA 5JRQA 4YNOA 3NW5A 2J5FA 4APPA 3RM6A 2VTLA 4NCTA 3ZMMA 1U59A 3G5DA 2WAJA 4A07A 3VQHA 4G3FA 3DCVA 3FMJA 4QO9A 3T3VA 2XM8A 4XOZA 3EKNA 4WRSA 2Y8OA 4OT5A 4TRLA 3PPKA 4NFMA 2QO9A 4G1WA 4AFEA 2UV2A 3KMWA 4ANQA 5A4QA 4I93A 1OUYA 3RHKA 5CAPA 5KX8A 1YWNA 2EXEA 2X6EA 4KIOA 2P2HA 4M0ZA 3FI4A 2PUIA 4A9SA 5ANGA 4B8MA 1Z5MA 2HZIA 2UZEA 5IA0A 4CG9A 4QMVA 3DFCB 4MH7A 2R3IA 5DOSA 4IWQA 1Q8UA 4LRKA 2OIQA 5DIAA 5LVLA 2OWBA 3Q60A 4FKOA 3S0OA 5BYYA 4XP0A 3DBEA 3HLLA 1FGKA 1J7LA 3DJ5A 3THBA 3BEGA 3G2FA 2VTPA 4R77A 4OGRA 3F2AA 3KXZA 3NMUF 4DFNA 3QD4A 3VBQA 3EN4A 4Y83A 3GFEA 5EG3A 4FTTA 4L3LA 3KMMA 1L3RE 5D7AA 3BU5A 4EZ7A 5DNRA 5EHLA 4YTIA 4GL9A 3CPBA 5C4LA 3D7ZA 4QP7A 4U6RA 1O6LA 3S4QA 3VS3A 4CQEA 2OXYA 2PE1A 2YM8A 3UOHA 3VS4A 5IQCA 2YITA 4KKEA 5M07A 5EK7A 3VS5A 4TL0A 4MBIA 3G90X 4MQ2A 5ANEA 4CCBA 2H34A 2ZV2A 4FKUA 4Y95A 4HGEA 4EOPA 1MRVA 4Q5HA 2BIKB 3RZBA 4O7RA 4E4NA 4IWPA 5IMXA 3A7IA 4MNEB 1YXXA 2C47A 2FYSA 4X3FA 4LL5A 3P23A 4BDGA 3CQEA 5I9VA 4LUEA 1PXKA 4FIFA 4EC9A 2NNWB 1QPJA 4FNWA 4DEAA 2OFVA 4V0GA 4DFXE 5J9LA 2E9NA 4C58A 2R0IA 3UNJA 4PF4A 2ZV8A 3HV5A 5AUTA 4Q5EA 5IH5A 4NYEA 3QQJA 4OTQA 3QQHA 4GT5A 2C1BA 4RRVA 4CMTA 3S95A 4U81A 3ZS5A 1G5SA 3LHJA 4MD8E 4IACA 4FSQA 4Q9SA 2CNUA 3R8PA 4J1RA 3N4VA 5AM7A 3QUEA 4IX4A 4HGTA 4UXQA 4DG3E 5I9YA 3SOCA 1Q8ZA 4JS8A 5FM2A 2IVVA 4ITJA 3EQHA 4FZ7A 4L7FA 2YM7A 3MB6A 2B9JA 4BZOA 3AC1A 1ZZ2A 3GU5A 5LCKA 4L52A 1HCKA 4K8AA 4G6OA 2UVXA 3LLTA 3UJGA 4NM0A 3RP9A 1SMHA 3AT2A 4JIAA 4GK4A 4XV2A 3SXRA 3OG7A 4HYUA 5A14A 3QHRA 3MH0A 4ZTQA 4U43A 4F7JA 4J53A 1KUTA 1W0XC 3SKCA 3V51A 4C57A 2GQSA 4RZWA 1XJDA 3RHXA 3W18A 5C8NA 5HE1A 4HVGA 3QD3A 2RFDA 3ZU7A 2BAKA 3MS9A 2YHVA 4FYOA 5EOBA 1OIQA 3R00A 3ULIA 4B9DA 5I9ZA 4C4GA 2Y7JA 4BN1A 4BDFA 4IC8A 3PY3A 4YJNA 5G6VA 3TZ8A 4U40A 3WILA 3ZRMA 2XEZA 5IISA 4KD1A 4AA0A 3FC2A 3KRWA 4XG9A 3PJ1A 2R64A 3H3CA 5AIKA 3F5XA 4MWIA 3A99A 5HIEA 1IG1A 4EHGA 2FUMA 4HCUA 4AE9A 3SXFA 4FOCA 4H39A 3U4UA 3H10A 4H58A 3UMWA 4AU8A 1JKSA 2C6TA 3QXOA 2C0TA 4DEIA 3UBDA 2QG5A 2BKKA 1W7HA 4C59A 4QMQA 3MFTA 3S2PA 4HOKA 3O96A 4ENYA 2VTMA 2FH9A 3NVMB 3PG1A 1JSUA 2ACXA 3E64A 4JBVA 4O0RA 3DBDA 3ZO1A 5IUGA 2VX0A 1IAJA 4F63A 3BKBA 3PXRA 4BI2A 4CFVA 3NWWA 4BTJA 4MBLA 3W32A 2WMQA 4RQKA 4IAYA 2W06A 3I4BA 4KIKA 1E1VA 2WB8A 3W2CA 4TPTA 2JIUA 2UW0A 2UZVA 3U87A 4LG4A 4ZTHA 4GIHA 5HHWA 3WF8A 1JKTA 3TM0A 3DT1A 4JBOA 4PY1A 4QD6A 4X21A 5AP4A 5C1QB 4O2PA 1UNLA 3EQFA 2WMXA 3KN5A 3RMFA 1M52A 4Y73A 2QOKA 5HU3A 5E8VA 4FR4A 3AGMA 3MIYA 4UY9A 4XV3A 3ZONA 3UMXA 2OIDA 3EYGA 4RJ4A 5DE2A 4EOJA 3UQCA 4LYNA 4RA5A 4FC0A 3QKKA 4E5BA 5ACBC 2ZM1A 4D28A 5CU6A 1VYZA 3VWAA 2Y6MA 3GQIA 3NYOA 3PIXA 5KMMA 1GZOA 4I22A 2CLQA 3UC4A 3DFAA 1QPDA 4D4SA 2ITTA 2PMLX 3Q53A 4PDOA 4J8MA 3ETAA 5CU0A 2X39A 3DTWA 4IADA 1DAWA 2H6DA 3I6UA 2Z60A 1V1KA 1GOLA 4JXFA 3QC4A 3DBQA 2P33A 4PPBA 2YM3A 4D1ZA 4L8MA 2F7EE 2QHMA 4FVQA 1ZZLA 3P1AA 5JN2A 2VRXA 1AD5A 4FKVA 4GEOA 1VR2A 3KRRA 4LRJA 3HMOA 3QHWA 1L8TA 2X6DA 3GT8A 1IAHA 1QCFA 1WVXA 3HEGA 4BCQA 3S3IA 4R1YA 4LOPA 3H30A 4PRJA 4UBAA 4O7YA 5M57A 5A6OA 3BYMA 3CD8A 5AADA 1WMKA 2E9PA 4H3PA 2UW4A 4EQUA 3UVPA 2IJMA 5AR3A 4F7LA 3WYYA 4DLJA 3LVPA 2VN9A 3FHIA 3MA3A 3I0QA 3MH3A 4MK0A 4PMPA 2DWBA 3QAME 1YQJA 5C9CA 3VS1A 4AZWA 5JSMA 4NU1A 4YSMA 2WGJA 5HVKA 1IA8A 5LCJA 4FX3A 3KL8A 2JDRA 1B39A 3LXNA 1WBNA 4PP9A 5AX3A 5J9ZA 4ACMA 3ZOSA 4O82A 1A9UA 2PTKA 3C0GA 4IJ9A 1PKGA 1JAMA 2IW6A 4YHFA 4KSQA 4R78A 3AC2A 1GJOA 2A1AB 4MCVA 4NIFA 4X3FB 1SYKA 2CNQA 5A4CA 3EFJA 4A4XA 3KXGA 4IXPA 1WAKA 4P2KA 4V0GB 3ZSHA 2Y9QA 5KBRA 3ALNA 4FT5A 4UWBA 3SD0A 3SDJA 3OTUA 1ZYCA 3FZPA 3QKMA 4OTDA 4MNFA 3KQ7A 5KKRB 3QTIA 3OW3A 5K5XA 5HNGA 5D7VA 1YHWA 2QKWB 3CIKA 4MEDA 1G8AA 2I0YA 4AW5A 4I23A 4OUCA 4L43A 2LAVA 4U7ZA 5EYMA 5L6OA 3VNTA 2VX3A 3L8PA 3FI3A 4NTSA 4ZY4A 2HK5A 1Q3DA 4LOOA 1YRPA 3OWJA 2J0KA 4YSJA 3KXHA 1T46A 4FKGA 4MXXA 2VWWA 3OD6X 2RG6A 3AOXA 4I6HA 3QZIA 4QPAA 1WBWA 3E87A 5CAVA 2V22A 3QYZA 3UC3A 5AUVA 4CKJA 4YZDA 2W1HA 3KU2A 3ZM4A 4R5YA 3MESA 1XO2B 4GUBA 4ZIMA 4H3QA 4D2WA 4E6DA 2PU8A 2IWIA 3UPXA 4CKIA 4FTIA 4FVPA 2FO0A 4JG8A 4JR7A 4WT6A 3DJ7A 4UB7A 3MH2A 3PUPA 4I41A 3MB7A 4F9BA 4BBMA 2JDTA 2KULA 3A7GA 4IM2A 4AN2A 5LVPA 2BZKB 2XK7A 5I3RA 4FODA 4AZEA 1H25A 3R1QA 4ZMEA 4I3ZA 3R7IA 4CLIA 3DBCA 3AGLA 5M53A 2X4ZA 5CX9A 4LV8A 4LMNA 5BVOA 4W9XA 2VTSA 3BCEA 1SVEA 1TKIA 1V0PA 2QC6A 3Q9YA 3LFCA 4UEUA 3S1HA 1OM1A 4C37A 2WTKC 4FSRA 1KOAA 4X2NA 3ZDIA 4BC6A 4UX9A 4G5PA 1ND4A 2JIIA 4JT3A 4K6ZA 3TNIA 2QOIA 4W4XA 5C8MA 4QYEA 3MBLA 4I0RA 5DI1A 4MXOA 1Q4LA 2JEDA 3QRIA 4PMTA 4ZJJA 1R3CA 2J5EA 1ZOGA 1OVEA 4HCVA 4U45A 3A8XA 3A8WA 4H36A 5J5TA 3QQKA 4J95A 2CKOA 4O21A 4DCAA 3F88A 3DGKA 4IAKA 3G0FA 5CVGA 1S9JA 3BGPA 2XCKA 5HG9A 3PA3A 5DMZA 4DA5A 3FMNA 1UVRA 3IOPA 1XH8A 1PYXA 3NLBA 4U8ZA 4D2SA 2XK3A 3MY1A 2REIA 4W8EA 3SW4A 4BDAA 3R8ZA 3V8WA 2ZV9A 5E8SA 2XUUA 4QTCA 2PZYA 4RVMA 4FG9A 1VZOA 3SG9A 4AE6A 3LXLA 2XB7A 4FKSA 4K33A 3NYXA 2C6DA 3EQCA 2HELA 2PL0A 3GI3A 4ZK5A 2PZRA 4CFUA 3DAKA 4EUUA 5FTGA 2B1PA 2HXQA 3RPSA 3FV8A 3GU8A 3NX8A 4KIKB 2XNEA 3CXWA 4UMQA 2AC5A 5CXHA 4CLJA 3VS0A 4ALUA 4DN5A 1TQPA 5GNKA 3WF7A 3ZUTA 5CF6A 3SVVA 3UZRA 2VV9A 1H1PA 4W4VA 2YM6A 3FLNC 3G9NA 5FBOA 3QLFA 3IDPA 3HMMA 1VYWA 1PRYA 3A7FA 2QOFA 4ZY6A 4WO5A 2J51A 2CCHA 3QTQA 4OTRA 5D1JA 3SA0A 3R01A 3C1XA 3HYHA 2E9UA 3LMHA 1KWPA 2C3LA 4TNBA 3T8OA 3FLSA 4KB8A 4MXAA 3UIBA 4D4YA 3HUBA 5K9IA 1BUHA 3GC0A 3ENHA 4FI1A 3ZLSA 4O2ZA 5L2TA 4RWIA 3PG3A 4Z9LA 2OK1A 2PMOX 1YHVA 4JR3A 2X7GA 3R8VA 5HU9A 4EKLA 3VVHA 2C5VA 3DTCA 3Q32A 3UG2A 4IANA 3TI1A 3LFDA 4N70A 3G0EA 4YC6A 3GGFA 5TT7A 4O86A 5TE0A 3EFKA 4BCFA 3A62A 3ORPA 1W8CA 2XS0A 3G15A 2E2BA 3GCPA 4G9RA 2JDVA 4WBOA 1XBBA 3JVSA 3OOMA 2X9EA 4FSYA 4YC8A 5CU3A 5E1EA 2BTSA 3LZBA 3OUKA 3PSDA 3Q3BA 3REPA 4ANSA 2HOGA 1Q8TA 2ITZA 3AMAA 3FSFA 3IDCA 5IF1A 4WNKA 5LMAA 2PVLA 3UP7A 5CXZA 2BDFA 2ITQA 4U3ZA 2G2IA 2EXMA 4RWJA 4FTKA 4J8NA 2VO3A 5E91A 5EM6A 3ANQA 3LLAA 4C7TA 2VZ6A 2QR8A 3L1SA 4GH2A 5J8IA 5IQDA 3FKLA 1APME 3I5ZA 3HKOA 5EYKA 3PVWA 4BVUA 5CF5A 4EBWA 2XM9A 4RVTA 3PLAE 2QOLA 5IDNA 2B55A 3A4PA 1J7IA 4FF8A 5GJDA 3FBVA 2QU6A 2CKQA 4D1SA 3ORNA 4GU9A 3EZVA 1H24A 1GZ8A 3R30A 4F4PA 2B4SB 4RC3A 4ENXA 1OI9A 2VD5A 4E26A 5DT4A 4NIFB 4XG6A 4GKHA 4MWHA 3RAKA 3D5WA 3RAIA 4FK3A 5EI6A 2W05A 2EXCX 2F4JA 3BU6A 3DJ6A 3FMHA 3L8SA 3NIEA 2WELA 4IH8A 3V5TA 2YDJA 1H08A 4XRLA 5CEPA 1O6YA 3E62A 5CANA 2HZ0A 2P4IA 2YDKA 5BNJA 2BKZA 2QG7A 4FEXA 3Q9ZA 4NL0A 3C4CA 5CS6A 2CGVA 2XZSA 3Q52A 4IZ7A 3WI6A 5DGZA 3WIKA 2F2CB 2BR1A 3FPQA 5LOHA 3NUSA 5DH3A 2VTHA 3KXXA 3OBGA 4AGDA 4CFWA 4DFBA 2HZNA 4JVGA 4PP7A 3C7QA 2X4FA 4C4EA 4EK4A 2OJ9A 1STCE 5LMKA 3OY1A 3PZEA 4X2JA 4ASDA 5IA5A 3RJCA 1UWHA 5HG7A 3POZA 1Y6BA 2HXLA 3CTHA 3MIAA 4QTEA 4BYIA 4Q9ZA 3OROA 3NYNA 3R21A 4O7SA 4JRNA 2ETRA 5EW9A 5KZIA 4IDTA 4IVAA 4U97A 1R1WA 4AX8A 3CD3A 4RLKA 5DRBA 3VIDA 4PL5A 3PY0A 5A3XA 3BPRA 4XG3A 1SVGA 5HORA 3VJOA 3NUNA 1U4DA 3P08A 4ZLZA 4L44A 5I9WA 3DDQA 4QYGA 2GFSA 3E8EA 2XIKA 3COMA 2IZTA 2XH5A 3M2WA 3ENMA 4RFYA 3V01A 4O0UA 4ZTSA 4CRLA 5CQWA 4ANNA 2V0DA 4HVIA 4YPDA 4Z7HA 4F9WA 4QP9A 2CKPA 2ONLA 4U5JA 5BVNA 3GQLA 4E20A 2VWBA 3OMVA 1BX6A 4Y8DA 4MYGA 5M06A 1BYGA 4E4LA 1UU8A 3PJ2A 2HIWA 3GU6A 4FT7A 3QF9A 3ZBFA 4LGGA 5A9UA 5TO8A 1XQZA 3E3BX 3G51A 3LE6A 3QLGA 4LGHA 3ZRLA 2OJIA 4QMYA 4BCNA 4QTDA 2J6MA 1Y8YA 4DT9A 2E9VA 1H26A 4GT3A 2FSLX 4PTEA 3SHEA 4FG8A 3IONA 4O0XA 2C6KA 2GCDA 2UW9A 3R6XA 5AUXA 3AT3A 3EFLA 4DGMA 4C4JA 3OZ6A 5DRDA 4BKZA 4C8BA 5CEOA 3CQWA 4PDPA 2VUWA 3EL8A 1JVPP 3TZMA 3MYGA 4DGLC 1P4OA 2R3KA 2UW3A 3TXOA 5GIPE 2WTCA 5BUJA 3KF4A 4IAAA 5BVDA 4DEHA 3EN9A 4FL2A 2R3HA 3KXMA 3OWLA 4FNYA 5DEYA 4YO6A 4TTHB 5EOLA 1XBCA 4FV9A 3DK7A 4JX7A 2YLEA 3R7VA 3C5IA 3KREA 4M69A 4F99A 2YAKA 1OBDA 2ZB0A 4HYSA 1UA2A 4LFIA 3SX9A 3DXPA 4XV9A 4YMJA 5H8EA 1SNUA 4F6WA 3U55A 4EH6A 4TWNA 5D12A 5CZHA 4J98A 5FDXA 4UN0C 4IM3A 5EDPA 3BYUA 4BYJA 4CEGA 3AD6A 3ITZA 4ASEA 4ZAUA 5CI7A 3ZXTA 2QHNA 3QTRA 4U79A 3QALE 3AXWA 5J1VA 4PPAA 2KTYA 1JKKA 2ZOQA 5LQFA 2UZOA 3ZYAA 5GZAA 2JKQA 4FMQA 1M7QA 4K2RA 1ZMUA 3ATSA 4PDSA 4PTCA 2QVSE 3OHTA 3ORLA 4YUQA 1PJKA 2WZJA 5JZJA 2HY81 5HCYA 4AF3A 3LFAA 1FVTA 3QC9A 4ZZOA 2B53A 5AFVA 4XH6A 2HWPA 2OICA 2R0UA 3CLYA 3HA8A 3PVBA 4Q2AA 3MVMA 5DFPA 3FC1X 1UKIA 4J96A 4EEVA 1BI8A 2X2LA 4L3JA 2PUPA 5CF8A 3NPCA 2VWUA 2YZAA 4DFLA 4A9TA 1P5EA 4NW6A 2WTDA 4QMMA 2GNIA 2ITPA 5DG5A 3BGZA 2ERKA 3NS9A 4PMMA 5E92A 2Z7LA 3FZOA 3MTFA 4PNKA 4QP8A 2CLXA 2JDOA 4NCTC 5KMNA 5AP6A 2R2PA 2R3GA 4AT5A 4XMOA 4W4WA 4XCUA 2W4KA 3LAUA 4FSUA 2RF9A 3RGFA 2VNYA 3VS6A 3ZM9A 2G9XA 4ZSAA 3O50A 1W82A 3DK3A 5E8TA 2EWAA 5H9BA 5K5NA 2CGWA 3ZZEA 4EOSA 3FE3A 4HYIA 3RPVA 5AV1A 5DHJA 4ERWA 4XP2A 4EONA 5AV4A 3N51A 4JG6A 4W8DA 3R83A 3P7AA 4ZLYA 5A4TA 4L7SA 4B8LA 1BL7A 4KNBA 4TN6A 2WMUA 4G3DA 4BRXA 5AP5A 2FSTX 3BHHA 4KSPA 5KBQA 4HZSA 4R5SA 4ACCA 3K2LA 3GU7A 1PF8A 4ACGA 2R3NA 3P0MA 1LP4A 3FQHA 4O96A 5AEPA 3BELA 4AN3A 2VTNA 4C2VA 5CEMA 4AZSA 3DAJA 3ZO3A 2H8HA 2UW7A 3VBVA 2F57A 2PMIA 5J7BA 1K9AA 3GENA 4G3GA 4EWQA 3W2RA 4EHVA 1YXTA 2QOHA 1PXOA 2YIWA 3JY0A 4C35A 4FICA 3QBNA 3JUHA 2QOBA 2E9OA 2QO2A
chains in the Genus database with same CATH superfamily
1OKZA 1OL2A 3KEXA 3I6WA 3OTVA 4GUEA 2O63A 4JBQA 1J7UA 4BCOA 3CY3A 3KVWA 2XP2A 4ASZA 2ERZE 2PHKA 3IGGA 2OSCA 3LFFA 3JPVA 3VF8A 4BI1A 4QMLA 2EUFB 3VRZA 4FGRA 3F82A 4GFMA 1KV2A 1LEZA 4QDEA 2V5QA 2QONA 3KRLA 3TV7A 4PL4A 1OITA 2G2FA 4X3FC 5HEZA 3ID6C 3C9WA 2X9FA 4QOXA 4YJQA 4A4OA 4DHJA 5HBHA 4D0WA 5M4UA 4IM0A 2BIYA 2C6OA 5TOZA 3QUPA 3D4QA 2QNJA 1BMKA 4DH7A 3N4UA 3TJCA 4YJTA 5ICPA 3QCYA 2IW9A 5KKRC 4FSZA 1J1BA 1H1QA 4FTOA 5L2QA 3NGAA 4LV5A 2O8YA 4FSNA 5HTCA 4OW8A 3W8LA 5AIRA 2ZDTA 5CT7A 5ETAA 2W4JA 2C5OA 2O65A 3MFSA 4FKPA 2WEIA 5A4EA 5BVFA 2WEVA 3R7OA 3FXXA 4WNMA 3GXLA 3PP1A 4XBUA 4L9IA 2HZ4A 5IH6A 2C1AA 3LW0A 3VBTA 2PPQA 5E4HA 1JSTA 2C5XA 5C4KA 2R3PA 4XV1A 4CZTA 3ALOA 4EZ5A 3FXZA 3QUDA 3BV3A 4M7IA 2PE2A 3FHRA 3OEFX 1K3AA 5BPYA 2F7ZE 3V5LA 4QEBA 2FA2A 2XKEA 5LVOA 4M69B 4X0MA 3FAAA 5FRIA 2XK6A 3UOLA 2ITYA 4QTBA 1FQ1B 4G17A 2VNWA 4K1BA 4MXYA 1V0OA 2W1ZA 1W2FA 1H0WA 2JKKA 4EORA 3C13A 4NH1A 4HPUE 4U44A 3V6SA 4BDCA 3IGOA 1OL5A 3D14A 3UYSA 5IU2A 2GU8A 4AGUA 1ZYSA 3GC8A 2J0JA 3F3TA 3UIUA 4HGSA 4RPVA 3F7WA 4S32A 3QU0A 3MPAA 2YEXA 5DPVA 4A9UA 4OAUC 3NIZA 3H4JA 3RI1A 4YLLA 3R2BA 3M11A 2CPKE 4NM5A 5CQUA 1B38A 1R78A 5AV0A 4ZEGA 4F9AA 4JL9A 4AW1A 4FTAA 2R3FA 5D41A 1F5QA 1WBOA 4ALWA 2ITUA 3A60A 3RZFA 3CKXA 5HX8A 3P9JA 1Q62A 2ITOA 3QCXA 2W7XA 3HV4A 3AC8A 3W2PA 4E7WA 2YZLA 2PVJA 4GVJA 5DLSA 3OVVA 3R0TA 1UNHA 3P86A 3VUIA 4ARKA 3DB6A 3R9HA 4F7SA 2XNPA 4MX9A 4ZJIA 5FXRA 5IA2A 4CMUA 2I6LA 2G15A 4DAWA 3QGYA 3TWJA 5CASA 5I4NA 4O7ZA 4KRCA 4HJOA 4RLLA 3LQ5A 4TY1A 5TR6A 4QMWA 4AZVA 4B0GA 2ZM4A 4WG4A 3KXNA 4J71A 3OEZA 3RK7A 2C68A 5HD4A 2X7OA 4PUZA 5CENA 4YLJA 1YOLA 2WMTA 4FV0A 2QKRA 1ZYJA 4GKIA 1OPLA 4J97A 2AUHA 2W0JA 1RQQA 3ORMA 3NEWA 4RX8A 5EDQA 3W2OA 3DB8A 4OT6A 4RX9A 3RAWA 4AUAA 4PMSA 2VTJA 3FMLA 5M51A 4QNYA 3OOGA 3TZ7A 4EH9A 5TF9A 4I6LA 3LMIA 2PVHA 4FV2A 2I0EA 3BWFA 4UMUA 3QTUA 3ORTA 4IWOA 3DU8A 4BJJB 3RK9A 2CKEA 2XIRA 2Z7SA 4IBMA 3ZRKA 5HLPA 4DE4A 1JQHA 4M12A 2GNFA 3PRIA 3EZRA 4FUYA 3SLSA 3PXQA 4YR8A 3M42A 3O17A 2GNHA 4ZMFA 5M4IA 4S31A 4K11A 1I09A 1CSNA 5GJGA 4QQCA 5K0KA 4CV8A 3MV5A 5HG8A 4JDIA 2BZJA 2GDOA 4FUXA 3ZFYA 4BGHA 2PZIA 1Q61A 4AZFA 4C33A 3OFMA 3R7GA 3OCSA 4E5WA 2ITNA 3QCQA 3NYVA 4N4SA 3LM0A 4HYHA 1YDTE 5I3OA 5JFSA 5ANJA 3A61A 3HX4A 3DLZA 5ANIA 2J0LA 2WTWA 4RG0A 5KHXA 1SNXA 5EYDA 3K3IA 1KE7A 2ZMCA 1X8BA 3L8XA 4FIGA 4QT1A 3EN5A 4TKSA 4EH2A 4EQCA 5L2SA 4V04A 5ANKA 5CNNA 4QNAA 2Z7RA 1DI8A 4BKJA 5L2IA 4PWNA 2OF4A 4IZAA 3LFSA 1ST4A 5AA9A 2WOTA 3C4WA 4HVSA 3K5UA 4M15A 3C4XA 4FT3A 5JFXA 3HUCA 1YI6A 2O0UA 1YXUA 3MVHA 2IVTA 3NNXA 2VO7A 2WOUA 3OWPA 5HICA 2RSVA 5FGKA 2QI8A 3AG9A 3PYYA 3FYKX 2WKMA 2G01A 3EIDA 2J7TA 3LFBA 2QLUA 4GG5A 4NTTA 4USFA 3NDMA 5J1WA 5GZ8A 3R8MA 4YGAA 2XMYA 3NRMA 3WIGA 3W55A 5HBJA 5IEVA 4K77A 4BCPA 1UWJA 3FDNA 1YWVA 4BICA 1TFFA 2EB3A 3R2YA 4CZUA 4EH4A 4ANOA 1YW2A 3Q4CA 3QA8A 4CG8A 4DHFA 2CJMA 1FGIA 2B9IA 3COHA 4NKAA 4WNOA 2X7FA 4XHKB 5CT0A 5KUPA 2PVRA 1OIRA 4HNIA 3IW8A 3BV2A 1KSWA 2ZV7A 2RGPA 4ACHA 2I0VA 4YZNA 3ODZX 4FV3A 4FTQA 3T9TA 2PWLA 3R1SA 3FMDA 4H1MA 3FL4A 4I92A 2F9GA 5EHYA 5HIDA 2Y0AA 1M7NA 4FVRA 4QP4A 4DEBA 1I44A 3E93A 4JJRA 4AOJA 2GMXA 3F5PA 2Y4IB 3ZCLA 5L2WA 3BYSA 5AWMA 3LCKA 3LCSA 3WARA 5AM6A 3QKLA 2ZVAA 3BGQA 3RVGA 3GC7A 3TV6A 5JFVA 2JAMA 3LJ0A 3WBLA 5FEQA 2J4ZA 2YCFA 3QWJA 3QWKA 4HCTA 4IX6A 4AGCA 3DQWA 3GU4A 1R39A 3ZSGA 4CCUA 3BZ3A 4O0SA 4O6EA 4PV0A 4CMOA 4EK5A 2ITXA 3TUCA 4QP6A 3FZTA 3AC4A 3SG8A 2WPAA 2OJFE 4YO4A 3R71A 1KE6A 3QTSA 2X2KA 5E9EA 2YCRA 5DN3A 1JWHA 3KC3A 2JLDA 2VTAA 3TIZA 2UZLA 1LEWA 2JIVA 3HV6A 4L68A 5HE0A 3T9IA 3LJ1A 4GFGA 4EK3A 4BBEA 2BROA 3L9LA 5FLFA 4WBBB 2X0OA 1XH7A 4APCA 1OKWA 4C4IA 4CSVA 3GP0A 2BUJA 4C36A 3G6GA 1E9HA 3DY7A 4RJ3A 1GIJA 4S33A 3EQIA 2JFLA 1Y91A 2FGIA 2OH4A 4QQJA 1NY3A 3OW4A 3HL7A 5HD7A 4NT4A 2YJSA 4JAJA 4TZRA 5DYJA 2W5BA 4G9CA 1XR1A 3BLHA 1F0QA 5DR9A 3T3UA 5IPJA 4FTRA 5DT3A 3CS9A 2BAQA 2J50A 3GBZA 4IZ5A 4DGNA 3F3ZA 5KMOA 4DTAA 4IEBA 4O4FA 3ANRA 3K5VA 4F08A 3ZFMA 2W4OA 3FSKA 4TYEA 3IS5A 2CCIA 4RIWA 2EU9A 3TL8A 5JGAA 3CBLA 3QXPA 4G3CA 5HIBA 3W8QA 3ZLWA 1ZOHA 4GS6A 1J3HA 4UMTA 1GNGA 3KVXA 5EQYA 3QL8A 4FV6A 2XAMA 3CP9A 2YA9A 1DAYA 2NYAA 5LWMA 4M13A 2YACA 3ZTXA 3DKGA 3U8WA 5ANDA 4E6QA 4YTCA 4IFCA 2ZJWA 3VUTA 3TDVA 4RJ8A 1UNGA 5EKNA 4O83A 3G6HA 3OT3A 3B2WA 3PFQA 3LPBA 4LI5A 4ZZMA 3NUPA 4YZMA 4BDIA 4E93A 4F7NA 3VBWA 1G8JA 2GPHA 1QPCA 4KWPA 4DFYA 1OB3A 1M14A 3F69A 5IUIA 4FKJA 1J1CA 5HO8A 3D15A 5K3YA 1MQBA 2CNVA 4AOIA 5KMIA 4H05A 1H0VA 1Z57A 3KK8A 4UALA 5EW8A 4WSQA 2XK4A 4BDJA 1YOJA 2ZYBA 4JDKA 5EI8A 4YU2A 4BR3A 2GNJA 3O7LD 3O23A 5FM3A 2P0CA 2PVKA 4NJDA 5JT2A 4XNEA 1JBPE 3D94A 2YERA 2DQ7X 3C5UA 3PP0A 4WG5A 2IVUA 3NNVA 5GIOE 5HVYA 4RX7A 4D2RA 3KCKA 4EBVA 3H0ZA 4RX5A 1PMNA 3OXZA 4TWPA 3L9NA 5CEIA 3NNUA 1IEPA 4FV7A 4RA4A 1PYEA 2BTRA 4TYJA 1FMKA 1BI7A 2AYPA 5HQ0A 3BE9A 3II5A 3OCGA 3R8LA 5JEBA 3MDYA 5IMEA 1PMUA 3D9VA 3GUBA 3TACA 3N4TA 4ALVA 2BVAA 3COIA 2UVYA 4CKRA 2B0QA 1CKPA 2OH0E 4RMZA 4EWHA 5ANOA 3FLZA 3WF5A 1UU7A 3QX2A 4MKCA 3TEIA 3NFFB 3HP2A 2UW5A 4GG7A 3W0SA 4XLVA 3NUXA 2RFEA 3R9RA 4ID7A 4L53A 4UZHA 3LM5A 4LGDA 3W33A 1WBTA 3RK5A 4F0IA 3V8TA 4YJVA 3R63A 4FIIA 1YVJA 2XK8A 3BRBA 3FMMA 3R7UA 3VUDA 4E4MA 2PZ5A 3FXWA 4OTFA 3TNHA 3HGKA 2OXXA 3FWQA 3LCOA 4B99A 5AAGA 4JG7A 5JGDA 1QMZA 4PTGA 3HMIA 4IAZA 3LXPA 5BYZA 1OECA 5HLNA 4MD9E 1ZMWA 2HENA 4QP1A 4C3RA 5F9EA 4EC8A 1XH6A 3D83A 3R28A 4TWOA 2I40A 4AS0A 2F49A 5JFWA 1ZARA 4FIJA 3ZO2A 2OU7A 3WF9A 4O0YA 1Q8WA 4BCKA 4BIDA 3W2QA 3ZDUA 1J91A 4LMUA 2GHMA 2XNNA 4GYIA 2XIXA 3NCZA 4JBPA 5E8YA 1U5RA 1UU9A 1Y6AA 1JNKA 5E1SA 4I6QA 4NWMA 4DH3A 5LVMA 2X8IA 3PXFA 4E3CA 2XRUA 3SRVA 2GFCA 2I0HA 4MTAA 4U0IA 3RINA 3I60A 3PJCA 4N6YA 4BTKA 3HZTA 3HRCA 1MQ4A 2XRWA 3NW7A 4R1VA 5CVHA 4FG7A 5B2MA 4CYIA 1PXLA 3TDWA 2BFYA 3AD4A 2XA4A 3AMBA 4KUJA 3GCSA 1HCLA 5LMKC 4AXAA 3UNZA 2IVSA 2PVNA 3MVJA 4S2ZA 4EOOA 4YPSA 4IIRA 3FY2A 1FVRA 4A06A 2XKFA 4KBAA 2OBJA 2C6MA 4UZDA 3VW8A 3MN3A 2CN5A 4IMYA 4FKLA 5C03A 2PVYA 3PA5A 4U3YA 1H07A 2BDWA 1KE9A 3GVUA 3IECA 3PPZA 2W1EA 2XVDA 2AQXA 4RBLA 4BF2A 4WUAA 3SAYA 2CDZA 4CFNA 3I7CA 4DH1A 5IA4A 4BBFA 2QCSA 3Q4UA 1PXNA 3PE2A 4K9YA 4QMTA 2GS2A 2XALA 3DBFA 4USDA 5ETIA 3LKMA 4EYJA 2OF2A 4FZDB 4BCJA 3F3UA 3TIYA 5CAUA 5J9YA 4P7EA 4FOBA 2W1DA 5C8KA 4B4LA 5KMKA 2ONLC 2EB2A 3VS2A 4F6SA 3D5XA 3AKLA 5AMNA 3BE2A 2A2AA 5CAQA 4IB1A 5JQ8A 3LQ3A 1IASA 5L6PA 1ZY4A 2YM5A 1URWA 3LIJA 4HVDA 3R73A 4ZXTA 4XOYA 3PVUA 4GSBA 1NT2A 2XIZA 3EMGA 4DINA 3FI8A 1Y57A 2BHEA 2OJGA 5AR5A 2VWZA 2XJ2A 2QQ7A 3F66A 3TKIA 2QOQA 2BFXA 2XEYA 4G5JA 3DS6A 2VTOA 1OZ1A 4GVAA 3FL5A 1ZY5A 4G6NA 1M2QA 4CZYB 4OTPA 4RIWB 4ZSJA 4QQTA 1XWSA 2A98A 3O0GA 3E8NA 4IFGA 1UU3A 3M1SA 4R3CA 5CYIA 3R9NA 3R7EA 1JPAA 5AUZA 5EFQA 1YOMA 4MQ1A 4JIKA 4JNWA 4EOQA 3KRXA 1YHSA 3BBTB 3O2MA 2VWVA 4IX3A 3E63A 2YIQA 4MF0A 2C5YA 3VUKA 3AT4A 4HZRA 3GFWA 3UNKA 3ELJA 4U41A 3L9MA 3R1NA 4Y85A 5AP0A 1R0EA 4JRVA 3DPKA 3EN7A 4D55A 2YM4A 4TNDA 4FIHA 4QPMA 4TYIA 4O4BB 3TUDA 1GAGA 2WIPA 3EJ1A 4C3PA 3UO6A 3IPHA 5HO7A 5DVRA 4AWIA 2HW6A 3MGYA 4M68A 4EHZA 2WD1A 3FZRA 4R6VA 2YWPA 3WYXA 4E4XA 4TYGA 2YCQA 3KY2A 2BRNA 4I1ZA 4CTCA 4E1ZA 4NZWB 5BUIA 2H96A 2HW7A 3EYHA 4FL1A 4GT4A 2YLFA 4TYHA 4UWYA 2IW8A 4BWXA 2W9ZB 3Q4ZA 4MHAA 4FA2A 3A4OX 1A48A 1UV5A 3UO4A 4DG0E 2C3KA 2C4GA 3BHYA 4JAIA 2XAOA 2VX1A 3GNIB 4L46A 3BQCA 3P7BA 5FXSA 3NSZA 4O91A 1H28A 3ULZA 3QZGA 2J0IA 4KIQA 1KOBA 2XNBA 3TKHA 4G3EA 2R5TA 4F6UA 1PMVA 5AR2A 4GJ3A 2QOCA 3ZEPA 1WBPA 1W98A 5I5ZA 4FE2A 1PXMA 5EKOA 3VQUA 5F4NA 4RFMA 3RALA 3CEKA 4XRJA 4CNHA 3IW7A 3HECA 3WE4A 2EVAA 2X8EA 5J5SA 2YIXA 1KE5A 3Q9XA 2F2UA 4P5QA 3I0OA 3Q04A 3ET7A 5CSVA 4QP3A 4Z7GA 4AQKA 3QQUA 4YHJA 3KMUA 5LWNA 3DZQA 1S9IA 5E8UA 2Z02A 2ZFYA 4QMZA 3TYKA 2W99B 4AQCA 3UIXA 3DNDA 3EQBA 4JQ8A 2Q0BA 3PXZA 2YFXA 3PUFC 3DQXA 5CEKA 3CGFA 3EN6A 3ZLXA 4FEUA 3QRJA 2QR7A 1MUOA 5IDPA 3ACJA 1EH4A 1REKA 4RVLA 3KULA 1XH5A 4BIBA 2R3QA 3GCQA 5B2LA 4FKQA 3KF7A 5IQAA 4I4FA 4QTAA 4AG8A 5T3QA 1H1RA 2VO6A 2GNGA 5C26A 3AD5A 4YTHA 2NRYA 5HGIA 4DFUA 5IQHA 4OTIA 4ITIA 3HRBA 1YI3A 4GFOA 3B8QA 4I6BA 4R3PA 4DC2A 3UZPA 4WRGA 3SRVB 3DKCA 2XYNA 1SM2A 4ZOGA 4ZLOA 5C01A 5KMJA 3VO3A 3SW7A 4O6LA 1WBVA 3OBJA 3TKUA 3RCDA 1PHKA 4XS2A 2VU3A 4YLKA 2IZUA 5LXMA 5GINE 3OF0A 4WNPA 5HCXA 1U54A 4IZYA 4PQNA 5CY3A 4ZZNA 1ZWSA 2W5HA 3QTZA 4G16A 4J99A 4IW0A 2X2MA 5D9HA 2YN8A 3H9OA 3K3JA 3LJ2A 3Q5IA 4XJ0A 4YC3A 3UTOA 1K2PA 2BRHA 3NZ0A 2WFYA 4FBXA 4DTBA 1GZNA 3U6JA 2CGUA 2UZNA 2BRGA 2IEWA 4Y5QA 4K18A 4N6ZA 3IW5A 1SVHA 4D0XA 3NFGB 4DFZE 1ERKA 1YDSE 4O7TA 2UZBA 4FT9A 2VO0A 5B2KA 4DTKA 3PTGA 1TVOA 4AN9A 4IJPA 5IQEA 4W4YA 4II5A 2QLQA 4FL3A 2V55A 4P4CA 5IQFA 5AUYA 1FVVA 3QCSA 4M84A 5F95A 2QD9A 5DEWA 4AT3A 2IN6A 1DM2A 1FOTA 5E8XA 4C0TA 4EKKA 2RG5A 3DA6A 4BCGA 3DOGA 4HGLA 4BGGA 3NAYA 3UP2A 3DXNA 5CU4A 4E73A 4F1OA 5JH6A 4EOLA 5J95A 4WUNA 3FLQA 4BDEA 4IQ6A 4DDGA 4YBJA 5EM7A 1ZYLA 4EQMA 3PE1A 4BB4A 5I9XA 3JXWA 5AP3A 4AA4A 4F0GA 1Q3WA 2XKDA 4EOIA 3FYJX 4I0TA 4RJ5A 4YBKA 3O8TA 1CDKA 3BYOA 3PWYA 1Q8YA 5AUWA 4BFMA 3W1FA 5AUUA 4M97A 4WKQA 4MD7E 3WZDA 2I1MA 4EOKA 2XNOA 2Y4IC 3V5PA 3Q6UA 4B6LA 5H8BA 5JQ5A 5HE2A 4L3PA 4BTFA 5M55A 4ZSLA 3DK6A 4KIPA 2A4LA 2PVMA 3CC6A 3FLYA 3HAVA 2X0GA 3FKNA 3QQGA 2W1FA 4KS7A 4X3JA 4QMNA 4XUFA 4F9YA 4OBQA 3VUMA 3RNIA 4D9TA 3NCGA 2XNMA 3HV3A 5AA8A 2BPMA 3QRTA 2OJJA 5A6NA 3IG7A 2WTVA 3UZTA 2CN8A 2ZMDA 3ZO4A 3PRFA 2WMBA 4L6QA 1U46A 2BRBA 2BMCA 2FVDA 5M09A 4RWLA 3RWQA 5AAFA 4L01A 1FMOE 4RC4A 5E8WA 5LVNA 3U51A 3JVRA 1PMEA 4C3FA 4K0YA 4M0YA 2Q83A 4XLIA 3SC1A 1M17A 2PK9A 4OBPA 3UDTA 4WOVA 1CMKE 2ESMA 1NVSA 1P14A 1YDRE 3I7BA 2WQOA 3WF6A 4BHZA 4CD0A 5BUEA 4TYHB 3PLSA 2YJRA 4U9AA 2WQMA 3MY0A 3RNYA 5FP6A 5HO6A 3SOAA 3QYWA 4R3RA 1FINA 4A4LA 2C0OA 5F20A 4CT1A 3HMPA 5HX6A 2OLCA 3G33A 2GSFA 2W1GA 3FLWA 5JRSA 2VAGA 1H00A 3BU3A 3MH1A 3L9PA 4O81A 3NUYA 4KAOA 4TXCA 4BWKA 2OFUA 3POOA 1JOWB 2Y4PA 5AP7A 3U9NA 3UVRA 4CYJA 4DCEA 1ZOEA 5L6WL 2IZSA 5IEYA 3LQ8A 4FNZA 2GQGA 1O9UA 3DKFA 4DHIB 4UMRA 3OXIA 1Z9XA 4BKYA 3P5JC 4KS8A 4FTMA 5A4LA 1FPUA 2GHGA 2VTTA 4D2VA 2GQRA 3NUAA 3ODYX 4O7LA 2WO6A 2IG7A 2O64A 4PL3A 4AP7A 3TNQB 1XH9A 5KHWA 2PMNX 1LUFA 2Z2WA 3CJFA 5E8ZA 4IB5A 2UZDA 5AR8A 3ZLYA 4YZBA 5AJQA 3IW4A 4AXDA 4B7TA 3IKAA 3GOKA 4YURA 4FIEA 5BV3A 2BZHB 3L8VA 5F1ZA 4IHPA 4DH8A 3IQ7A 4G6LA 1F3MC 5C27A 5HKMA 3RPOA 3ACKA 5EQPA 2G1TA 4FV1A 1A06A 3CY2A 4R7IA 2VWYA 4GJ2A 4RC2A 2PE0A 3FQSA 5AR7A 3HDMA 5IA3A 3KULB 3VONA 2RFNA 3KGAA 4ZTLA 1MP8A 1PY5A 2IO6A 3BHTA 3C50A 3TCPA 5BQ0A 3RAHA 4O38A 3VBXA 2FB8A 4EOMA 3BEAA 2JC6A 3FY0A 3VC4A 1RDQE 3A7HA 4QYFA 5GJFA 2VGPA 4O22A 5CU2A 3VJNA 1JLUE 5EI2A 2I7QA 3BLAA 2P55A 2V7AA 4O0WA 5AX9A 5HI2A 3ZUUA 2BZIB 4DBNA 3COKA 5E7RA 1W2DA 3C4EA 4JDHA 4FTCA 4TW9A 5KNJA 1H1SA 1U54B 2BAJA 2HAKA 3Q6WA 4YJUA 2YDIA 4O0VA 5IZFA 2SRCA 3R7YA 4M66A 4UXLA 4CFXA 3D7TA 2XIYA 3OCBA 3BX5A 5HNIX 2R4BA 4D2PA 3BLQA 5CLPA 3MA6A 5CWZA 4ANMA 4KBKA 2PY3A 3Q96A 3WZUA 4GK2A 2XBJA 2QODA 3EH9A 3EKKA 4BTMA 4NKSA 3LCDA 3CTQA 1JSVA 3KN6A 4HNFA 1U5QA 2R3LA 2ITWA 2NRUA 3BHVA 3UOJA 5A54A 2JD5A 4HW7A 3MVLA 1XKKA 4HPTE 4YJRA 2GNLA 4RIXA 1GIIA 4EYMA 2UUEA 4P90A 4WIHA 4ZS0A 3RWPA 4D4RA 4RIYA 4USEA 5KCVA 5FEDA 4WD5A 3F2RA 5GHVA 1OBGA 1LPUA 2XBAA 4E6AA 4YJPA 3CSVA 2XK9A 5AP1A 2J90A 4BDDA 3BI6A 3Q4TA 4FKRA 1UKHA 2GTMA 2Z8CA 2B9FA 3LFEA 3OWKA 5ETCA 1ZRZA 1P4FA 4RZVA 3UE4A 2J9MA 1XBAA 3CGOA 4BDHA 4BHNA 3U54A 1JKLA 5FTQA 2VTQA 2NPQA 4I4EA 2B54A 4Z55A 5KMLA 5DBXA 3F9NA 3AMYA 4AW0A 3P78A 4IVBA 4NK9A 4Z16A 4MF1A 4NJ3A 5CSXA 3DNEA 4N0SA 1WCCA 4QMXA 1NW1A 4EI4A 4EH8A 3A7JA 5G1XA 4BZDA 4P5ZA 2B9HA 3N9XA 5ETFA 1PXPA 4OR5A 2R7IA 3QD2B 4F9CA 3TTJA 2W1CA 5D11A 5DWRA 4YTFA 3UG1A 5B7VA 4XG2A 3EQRA 3HA6A 4QP2A 3KK9A 4O1OA 5M4CA 4DLIA 3W0NA 4AAAA 4FEQA 2QU5A 1Y8GA 3HRFA 1H1WA 3O8PA 4YZ9A 2CMWA 3EWHA 4S34A 5LARA 2QO7A 2PVFA 3V8SA 5IQBA 5EQEA 2YAAA 4UMPA 4EK6A 3R22A 4IX5A 4AT4A 3PPJA 4A9RA 5HTIA 2JBOA 4ORKA 3QTWA 4FSTA 5EDRA 2G2HA 3LXKA 3NVKI 4AGWA 4TT7A 4IB3A 1ZYDA 3HV7A 1YKRA 4W9WA 4CRSA 1R0PA 3IO7A 4CXAA 1ZMVA 4X7QA 5AP2A 2BDJA 5CI6A 5H2UA 4GW8A 2WTIA 3SXSA 3O8UA 3CTJA 2OXDA 3Q2MA 4QPSA 4IC7A 3F6XA 3LMGA 5IQIA 4CTBA 4L42A 2C6EA 4JX3A 4Z3VA 2WU6A 4EK8A 3DLSA 3ZSIA 4KA3A 4FTLA 4QMPA 4CFMA 1PXJA 4BDKA 2JDSA 2ETMA 4D9UA 3QA0A 1W83A 3GCUA 3WOWA 1V0BA 1G8SA 1LR4A 4NSTA 3NNWA 1M2PA 3PZHA 4EL9A 4XEYA 2UVZA 4NFNA 4RT7A 1P2AA 3FUPA 2ZB1A 4XYFA 5D10A 5T68A 2OZAA 4LL0A 2X1NA 4ZSEA 1NXKA 4F0FA 5HVJA 3H9FA 4FV4A 4AA5A 4AZTA 2GS7A 1OKYA 4IVDA 3W0RA 4UV0A 2JKOA 3ZZWA 5JGBA 2X0QA 5JMSA 1WBSA 2BCJA 2P2IA 3MWUA 3AC5A 4OBOA 4YHTA 5CSWA 3VAPA 4F64A 3IDBA 3OP5A 5EM5A 1CTPE 5CSHA 4EH3A 3ROCA 5DR6A 4RFZA 1MRUA 4O7VA 4NM3A 1RW8A 3P79A 5K4IA 2RKUA 4LRMA 3QRUA 1RE8A 4YZCA 3F3WA 4KRDA 5ITAA 3SGCA 4ZY5A 4BZNA 3AC3A 3IK3A 3OC1A 2HWOA 3F5GA 1Q99A 4MVFA 4E5AX 5LMBA 3UQFA 5FUTA 1PKDA 5BVEA 4ZTNA 1H01A 3WZJA 4C62A 4RGJA 4WG3A 4XBRA 4XX9A 4DBXA 4O0TA 1OIYA 3ZXZA 4DEDA 3QTXA 2J0MB 4JI9A 4EH5A 3PXKA 4M8TA 2JKMA 3QGWA 3WE8A 5EM8A 2ZDUA 3F2NA 4BI0A 5HG5A 2W9FB 2Q0NA 2J2IB 4OTHA 2PYWA 1ZAOA 4OLIA 5HNBA 2PULA 3ORXA 4D5KA 4R8QA 3VS7A 5IA1A 3OXTA 3EHAA 4RVKA 5AR4A 5I0BA 3MI9A 1OL1A 4UYAA 3RM7A 4I6FA 4IAIA 4A9YA 2BILB 2W96B 3NR9A 3O7LB 3EFWA 3FPMA 2W5AA 3HMNA 3DZOA 4M14A 3UQGA 2B7AA 4A7CA 3EQGA 3FZSA 3MFUA 2PSQA 4FTNA 3BIZA 4KABA 4KKGA 4V05A 4C38A 1BLXA 3D7TB 4FSWA 3CQUA 4BCIA 4I5CA 3O51A 3PSCA 5JK3A 4MXCA 5JZNA 3TNPC 4NW5A 4GCJA 3S00A 1ST0A 2WIHA 4O84A 4BCMA 4DEGA 1IA9A 4UYNA 4ONAA 3QZHA 3VRYA 4N57A 3GC9A 4YJOA 5AV2A 2WMRA 2HCKA 3LOKA 1SZMA 3GOPA 4TWCA 4ZTMA 5FP5A 3V04A 4IVCA 1FBNA 3CPCA 4BY9E 1YXVA 3EQPA 4RIXB 3UIMA 4BGQA 3LFNA 4JDJA 4RIYB 5ACKA 3TTIA 3QQFA 2C3JA 1QPEA 2R3OA 5FEEA 3ORIA 3TUBA 2Y6OA 5BX0A 1YXSA 4QQ5A 1Q41A 3P4KA 4O27B 3QFVA 2AEGA 3MFRA 3QQLA 2O3PA