4FV3A

Crystal structure of the erk2 complexed with ek6
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
347
structure length
346
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK6
rcsb
source organism Homo sapiens
total genus 105
structure length 346
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv3A01
4ANOA 4UZDA 2XNEA 5CQUA 2R3RA 2QOLA 5IA2A 3VHKA 1ATPE 3CXWA 3FLNC 2CMWA 2W9FB 2NRUA 4O0VA 2VWUA 3LFNA 1JKSA 3QGYA 3REPA 4FYOA 5IA4A 3UVRA 5L2TA 5J1WA 3RNYA 3OWLA 2ITXA 2CCHA 3RI1A 3U4WA 2OWBA 3TJCA 4DGGA 5IA3A 4J97A 3WZKA 4O7YA 1KOAA 4E4MA 2YDKA 3ETAA 4QPAA 4DH1A 3G0FA 4YHFA 3MVLA 3NCGA 4IZ5A 4XV9A 5GNKA 5M06A 2EU9A 4BTMA 5HO6A 5D12A 4EZ7A 4WOVA 3F69A 3W2PA 1VYWA 5C4KA 3U6IA 3FLWA 2JAVA 1VZOA 3DJ5A 4PV0A 4AN2A 3TTJA 2UZEA 2XEYA 2J4ZA 4E26A 4I93A 4BHZA 4EZ5A 5AP6A 3CLYA 3NX8A 3QRUA 4PNIA 1UNGA 4QMUA 5IUIA 3Q9ZA 2C1AA 3BBTB 2BAKA 2QOHA 4Y5QA 2CSNA 4I0TA 4IQ6A 3JXWA 4XG8A 1QPEA 3ZLWA 3ZOSA 5FDXA 3KC3A 4XEYA 3UYTA 5CSWA 5DGZA 5IKWA 2R3KA 3PIXA 3ORKA 4ZSGA 4M0YA 1XH8A 3PA4A 2J0JA 3UNZA 4BGQA 3QX4A 2ETKA 1LP4A 3VWAA 5L6PA 3DTCA 5AUUA 2QR8A 5A9UA 2ZOQA 2WTJA 3P4KA 2EXCX 4R1VA 4FKTA 4OUCA 3VUMA 2WQNA 3SLSA 4U97A 1K3AA 3DJ7A 4AFJA 2PVJA 3O23A 4FV1A 3FXWA 3B2WA 2YIQA 3Q9YA 4FKGA 3SQQA 1ZZLA 2X6DA 3QYWA 2WEIA 4F1OA 3EIDA 3OT8A 4ZTRA 3IW6A 3OZ6A 1NA7A 5AMNA 3QTQA 4AGWA 3ZYAA 4J52A 3R63A 1B6CB 1GAGA 5H8GA 1XKKA 3IOKA 3ZFMA 2DYLA 4Q2AA 3HAMA 1XH9A 5L2WA 4GKIA 1F3MC 3ORZA 5FGKA 3EJ1A 3LOKA 2C5XA 4FV6A 4X2KA 5L8JA 5HIBA 1YI3A 3N9XA 4FTRA 5FBOA 2R64A 4ZTQA 3HUBA 3POZA 3AC5A 1KE9A 2WMRA 4IMYA 4AAAA 3QA8A 5DIAA 4QYGA 2VO3A 4IZYA 4X2NA 4ZLZA 4GT3A 3MV5A 3QQLA 4G1WA 5LOHA 1MRVA 3BQRA 3GFEA 1FINA 3NUNA 4WD5A 5LVMA 4D4SA 2J90A 1Q99A 4IM3A 2JDSA 4GRBA 3N4TA 5E8WA 3V5QA 2YABA 1V0BA 1IR3A 3P7AA 2RGPA 1KE5A 2B9IA 3EKKA 3LMGA 5I9WA 5K5NA 5ACBC 1JQHA 5M44A 4M15A 3ITZA 2PMLX 3R1QA 2YERA 3KVXA 1MQBA 4QMSA 4MTAA 4RWKA 4J7BA 4C38A 3EFKA 4WHZA 1YHSA 4LYNA 1H24A 2VWZA 3SA0A 3CP9A 5I9ZA 1Y8YA 3W1FA 4PMTA 1Q41A 1REJA 4XP0A 2GS2A 5H2UA 5HG7A 3NUPA 3RINA 3FMDA 4FV9A 5IQAA 3DA6A 5ETFA 3EQIA 4JR3A 2B9FA 2UW7A 4F9WA 4FF8A 3R8ZA 4GL9A 4YU2A 3LQ8A 3MB7A 3SW7A 3VNTA 1GIIA 3E7VA 4QYFA 1HOWA 1R39A 5TT7A 3VUHA 4DH5A 2WQOA 3A61A 3OCSA 4FL3A 5D1JA 4GH2A 3MB6A 4V0GA 4X2JA 3DKOA 4E6CA 3P78A 1SNUA 1H8FA 1SVGA 4AGCA 4DH3A 3LW0A 2E9NA 5B2KA 3RWQA 4EK4A 4IAZA 4O7TA 2X7OA 4M8TA 4XYFA 4F99A 3RPYA 1YOLA 3KFAA 2YCFA 4IC8A 2QI8A 2H34A 4EJ7A 5KHXA 4ACGA 4D5HA 3OY3A 3Q4ZA 3UNJA 3VS6A 5HD7A 4DHFA 2G2HA 3WZDA 2IZSA 3FLQA 2I0VA 3UVPA 5J5TA 5IEVA 4DGOA 5C4LA 2X4FA 2C5OA 5DE2A 4ERWA 4ZTLA 4IJ9A 1RJBA 5KMKA 4LGGA 3PPJA 4M3QA 3R8MA 2HWOA 4ZP5A 5FD2A 4B99A 3FYJX 2H8HA 2WFYA 4K6ZA 4W4YA 3ZC6A 2VZ6A 3SDJA 4E8AA 1NY3A 1J7UA 2A27A 4FTNA 3FL5A 5E92A 3C51A 4U5JA 3MFUA 4QOXA 3QZFA 2CJMA 3QGWA 5EW3A 5HG5A 4YTIA 4XV1A 3LKMA 5IQCA 1M14A 2X81A 4FG7A 4FVQA 4O0TA 3DTWA 1ZYLA 3VRZA 2X1NA 1OKVA 3L8VA 3ZXTA 2I0HA 5TKDA 4BN1A 4DCEA 4C61A 4PMPA 2HY81 4HYUA 5DRBA 2XK9A 2YZAA 1CKPA 3MYGA 4IVAA 1PXPA 4DA5A 2ZVAA 5AJQA 2C5NA 3UMXA 3KXMA 2Y0AA 2R3JA 4LG4A 4XG2A 4FNZA 1OKZA 4KRDA 4EH3A 3WE8A 4FKIA 3NW7A 3OOMA 4FT0A 4MF0A 5KHWA 3F66A 2PHKA 4IWPA 5DLSA 5BVNA 1XQZA 3HX4A 3PXZA 3BV2A 3EN4A 3UTOA 4RG0A 2KULA 3HRCA 3QTSA 3LAUA 3D5WA 2P3GX 5D7AA 4U3ZA 4G2FA 2QOFA 2R3PA 1YI4A 4QMQA 5C1QB 2W0JA 3IK3A 3R02A 4JG6A 3RAHA 2GS6A 2FYSA 4CLJA 2BMCA 2G9XA 3LXNA 2XNBA 4FR4A 4L00A 5CYIA 3ZUUA 2XIZA 3NUAA 4ITJA 4R7BA 3SD0A 4CV8A 4CYJA 4DGLC 1NT2A 1U54A 2GNLA 3VUTA 4MK0A 1FBNA 1J7IA 4D9TA 2XCHA 3AT4A 2B4SB 1WVYA 2FSMX 4I0RA 4A4XA 4DN5A 1OL1A 5DEWA 3F82A 4RIXB 3GC9A 5EQPA 3EZRA 4MQ2A 2QURA 4EQUA 4QQTA 2JLDA 4FT3A 4M97A 3VJNA 3ZSGA 4FSZA 2X8DA 4D0WA 4CMOA 4XMOA 4FV2A 3QA0A 1Q3DA 5HEZA 4AOTA 4F4PA 2XK6A 4F09A 4RFZA 3PUPA 5C26A 3ROYA 1L3RE 3S00A 4AA5A 2VAGA 4EZ3A 3AOXA 5AUYA 3TNPC 3R8LA 3OBGA 2G2FA 4GU9A 3BYOA 3RZBA 3E5AA 5ANOA 1NVSA 2IWIA 3UQFA 3QD2B 3HA8A 4G3FA 3VS1A 3CR0A 3E87A 3GP0A 5IMXA 4NW6A 5FEQA 4PWNA 4QMVA 3KXZA 5G1XA 4DLIA 3VO3A 4YPDA 1PW2A 4ACCA 4RX9A 2QO7A 4CRLA 3CQUA 3EQFA 2WMXA 4LMNA 4G3GA 2NPQA 3R22A 4ASZA 1B39A 3FY2A 4I1ZA 3PWYA 1UU8A 4F7LA 3ZSIA 4XBRA 3TZ8A 2XKDA 2J0IA 3ZMMA 3BX5A 3OBJA 3THBA 1OBDA 3HMPA 5B2MA 5DNRA 5HTIA 1P4OA 4GS6A 2GQRA 2W1IA 5A4EA 4HJOA 3RK7A 2QO2A 2R0IA 1DM2A 4LUDA 4CTCA 3CPCA 4D2VA 3TZMA 3MTLA 3N51A 3NUUA 4QQCA 2HXLA 3HMMA 1SM2A 4P7EA 3NCZA 2QHMA 4YBKA 4BDGA 5LXMA 4FSNA 4O21A 4D2PA 3HA6A 3ORIA 3MFSA 4ZTNA 4IVBA 4WA9A 2F49A 2F2UA 3EN7A 3A4OX 4RWIA 4MXYA 3OCGA 4O6LA 4UY9A 5CTPA 3QQUA 5CLPA 5CAPA 1STCE 2O0UA 4HVHA 3VBVA 4DEEA 2ITWA 5J1VA 1BI8A 2ZV2A 4XJ0A 3PXQA 4YNOA 3B8RA 5L8KA 2NO3A 3DU8A 3D5VA 4X0MA 2CNQA 2R3HA 2WIHA 4RIWB 4BDAA 2PVRA 2C4GA 3DGKA 5CT0A 4KKEA 3I7CA 4FKUA 4HZSA 3FLSA 1SVEA 3C1XA 3ZO2A 5IQDA 3LJ2A 5ANEA 3RP9A 5EH0A 4CFVA 2OJFE 3MVJA 4ANSA 2QO9A 4EKKA 2IJMA 2QG5A 3DK6A 3LFFA 2VTJA 4MNEB 4F7NA 5HG9A 2C6OA 3OROA 2HW7A 3FLYA 3NNUA 1OECA 4QP7A 5D11A 2GDOA 4C4GA 3IS5A 4L8MA 2WQEA 3GCPA 3NYXA 3PG1A 4TN6A 3RMFA 4AZSA 3OWJA 4NM5A 3CKWA 2YITA 4J71A 3U51A 4D4RA 3MH1A 3EQGA 4FA2A 4NL0A 3FC1X 1KOBA 4YZ9A 2OZAA 3BYVA 4KIKB 4FEVA 4YZNA 3ZXZA 1PXMA 4NYEA 1ZOEA 4IM0A 1LUFA 3DOGA 3C13A 3BWFA 1H1SA 5HU3A 4TL0A 2PTKA 4MXXA 1PXJA 3G9LX 3P23A 3WE4A 3BHHA 4KS8A 1Q5KA 5C03A 5A4QA 3BYMA 4D58A 4ZTMA 2WMBA 5IQIA 2EVAA 4FKRA 3KN6A 2XYNA 5E1SA 4BIBA 4L68A 1VYZA 3NAYA 4O0WA 1UWJA 4ZIMA 5I3OA 2NP8A 2ACXA 2BVAA 2JDOA 3ZU7A 5LMKA 4JG7A 4D55A 2UZTA 4ZSAA 5K0XA 2GS7A 4ID7A 3TNQB 2OJIA 3UZTA 5AP1A 3WF5A 4BCMA 4DTAA 3SOAA 4IFGA 2P4IA 1UWHA 3HEGA 4TTHB 5E8XA 3SW4A 5M4FA 4LRKA 2BZHB 4OTQA 4LM5A 3UIUA 3KF4A 4HYSA 1G8SA 4O1PA 4R3RA 2VTHA 2VGOA 5CEPA 2XNNA 3K2LA 4X6RA 4YJQA 5CF5A 2QOIA 3DS6A 4TKSA 4FK6A 3WZUA 5EM5A 4A4OA 1GZKA 4G5JA 2R3MA 5CT7A 4EWQA 5EOLA 4LI5A 2PK9A 5HGIA 2ZM4A 3C4FA 2W1EA 3KVWA 2WTDA 3OWPA 4O2ZA 4OTPA 4EYJA 4FIGA 4MQ1A 5GIPE 1JNKA 3NUSA 3FZTA 4FV7A 1O6KA 4OT5A 1XBCA 3F88A 1Q24A 2FB8A 3DNEA 5IEYA 5DVRA 3TEIA 3ANRA 3QF9A 3W2CA 2I1MA 2C6IA 3GT8A 5M4UA 5CEIA 5E4HA 4PTGA 3DB8A 3D5UA 2C6EA 2GTNA 2VTMA 4FTQA 5AIRA 3ACJA 2HXQA 5TE0A 3VIDA 4Y8DA 5CWZA 5DH3A 4DE4A 1NW1A 2C6TA 1A06A 4Q9SA 4D1ZA 5AEPA 5IQFA 5HU9A 3UMWA 4PDSA 4TW9A 2VO7A 4CG8A 5ANKA 4KS7A 2RKUA 3QTUA 4ACMA 2AC5A 3L8PA 4RX5A 5CALA 2JIVA 2UW8A 2OF4A 3P9JA 2JITA 4GIHA 3AC1A 5LMAA 4JAIA 4ZJJA 4RFMA 4FX3A 4IEBA 5CF4A 3PE2A 2VN9A 5LVLA 4KA3A 4UZHA 5AP2A 4OTFA 3BCEA 2ETMA 2UW4A 4U9AA 3D7TB 3DT1A 2Z2WA 3R2YA 3P86A 4B0GA 3VC4A 3TM0A 4M7IA 2BTSA 4CFFA 1FVTA 3ZZEA 4EL9A 2ZV7A 3O0GA 4TY1A 5JQ5A 1WAKA 3IW4A 4RA4A 5BVKA 1H0VA 3LVPA 3KK9A 3FKNA 3T3UA 2YEXA 4W8EA 4M69B 4XHKB 3FBVA 1YWNA 3GQIA 4N6YA 4NM3A 2CKEA 4A9TA 4I6HA 3CD3A 4A4LA 4HCVA 1KE8A 1OVEA 2OXYA 3R9OA 2XJ2A 1CTPE 3HLLA 1PHKA 2QC6A 2C1BA 5DRDA 3HMOA 3FMLA 1JSVA 2IZUA 3R1NA 5FTGA 2BDFA 3TNWA 5I9UA 1YXTA 1OM1A 4C2VA 3UOLA 2W9ZB 3HMIA 3RAKA 4RMZA 4LOQA 4QMPA 2VX3A 1Q62A 1Y57A 3KGAA 5BVWA 4YZBA 2B52A 4AU8A 4F63A 5A54A 1H26A 3PLSA 3PSCA 5EI2A 3ZFXA 4KNBA 4EH8A 1XH4A 1Q8YA 3QHRA 3QRKA 4IC7A 5HBJA 3FY0A 4QMXA 2ETRA 4U80A 5EHOA 4E5WA 3HP5A 4LGHA 4UALA 2YN8A 3G0EA 4XG6A 4E3CA 3RAWA 4O7ZA 3TG1A 4TRLA 2IW8A 2CNUA 4LL0A 3WILA 1PMEA 4IW0A 3UP2A 3FMEA 1Y8GA 5AP4A 1P4FA 4GG7A 3RHXA 2VWVA 4Z16A 3F5UA 4E4LA 5EK7A 4F64A 4IB3A 3FQSA 5E8YA 4GT5A 1GNGA 1P5EA 4PL3A 4RA5A 1WFCA 5CXHA 5M56A 4S2ZA 4TYIA 3V5PA 2C3JA 4J95A 2Q0BA 2FH9A 4KBKA 5CXZA 4QYYA 4HNIA 2UW9A 1W84A 2PZPA 2R5TA 2O3PA 3FWQA 3MY0A 2EXMA 3DBQA 4KABA 4ERKA 4FTAA 5I9YA 3ZEPA 4M66A 5J9YA 3F3WA 3KF7A 4JXFA 4QP2A 4LOOA 4IH8A 1YXVA 2GCDA 4QTEA 3RAIA 1UNHA 3HV7A 3EQCA 5CU6A 4TT7A 4BTFA 5I9VA 4C0TA 2BFXA 3QC4A 3RBWA 3QX2A 1UU3A 3SG9A 2PL0A 3Q52A 5J79A 3LCDA 4AZEA 2C30A 4J8NA 3DXNA 2WGJA 5D41A 4DH7A 3E3BX 4FV3A 5GJFA 4UWBA 4ZJVA 5EFQA 5M55A 4NM7A 3TWJA 4IX4A 4YC3A 4YJVA 4J53A 3NVMB 4YURA 4FT5A 1RDQE 5AV1A 4BDEA 3R71A 3P79A 4KB8A 4XOYA 4TWOA 3BRBA 3UQGA 1XO2B 3OEFX 4YJNA 5AAEA 5AIKA 4PTEA 3G5DA 3OFMA 4FVRA 2JFMA 4YPSA 4AA0A 3R7GA 3DAJA 1BL6A 3PE1A 1GZOA 2J0MB 3DPKA 4BCKA 4O0UA 4FTMA 3U9CA 3P0MA 4EK5A 4GV1A 3FKLA 3BKBA 1Y6BA 3QALE 4R1YA 5AV0A 3ZTXA 5KBQA 3W55A 3ZLYA 3VUGA 2PUUA 2IZTA 3W2RA 4AP7A 5FXQA 2YACA 1ZOHA 3JR1A 4ZZOA 5AUZA 3BHYA 4TYEA 2JBPA 4FKLA 4O0RA 4C58A 4WUNA 3TCPA 3QKMA 5AP5A 4QP8A 3ULZA 3NR9A 2WOTA 4LUEA 5HLWA 2IVTA 2YIXA 5HNBA 2QG7A 3NPCA 1M52A 3VF9A 2Y7JA 3UODA 2C6KA 4S33A 4GCJA 4CG9A 4FVPA 4UEUA 4JDJA 3ATSA 3Q6UA 3K54A 5KMLA 2C5VA 2BRGA 3G33A 4ZZMA 1ZXEA 5HIEA 5HX8A 2GTMA 4CNHA 3TNIA 2PUPA 3MFRA 4PL4A 4F1MA 2EUFB 4YTFA 4CMTA 3UOKA 4CLIA 3AMYA 2C3IB 4XG7A 1ERKA 5J7HA 2WMQA 3HV4A 4CFNA 4AOIA 4YJRA 4MBLA 2PVYA 5DEYA 5T68A 4BBMA 4QYEA 4EUTA 4I41A 4FKOA 5AAFA 5B2LA 5AM6A 5M57A 3C4CA 2BR1A 3IPHA 4NCTA 3ERKA 4ZY5A 3UDBA 4RJ6A 4L53A 3MSSA 3ZC5A 4EBWA 3IO7A 5J8IA 3D94A 5CF6A 2XJ0A 3QUEA 4FZ7A 5GJDA 2YA9A 2W99B 2A0CX 3ZH8A 4WBOA 3DKFA 4W4XA 3V5JA 2HELA 3F3TA 3IGGA 2OGVA 3MW1A 5LMKC 3CGFA 4NWMA 5F95A 4J1RA 5L2IA 3OEZA 3OG7A 4XBUA 2X9FA 5JQ8A 5IQGA 4FNWA 3E3PA 3NUXA 5AX9A 4ZMFA 3BGPA 2Z7SA 5E8ZA 1O9UA 2J5EA 5KZ0A 5AP0A 3LMIA 4KD1A 5EW8A 5HNGA 4BKZA 4RC4A 3DLSA 4WNKA 5BYYA 5J9LA 3AC3A 4WKQA 3LCKA 5LMBA 3QBNA 5HHWA 4L45A 4TNDA 2Q0NA 3RK5A 4IAYA 4AN3A 1R78A 3QCQA 4FTIA 4I6QA 4O91A 4K77A 1T45A 4OTDA 4MNEA 3L9MA 4TWCA 4TYHA 5CU3A 4BYIA 4YUQA 2R3IA 3UO5A 4HCUA 3OCBA 3MJ2A 3TV4A 4FKVA 4CCUA 4AZWA 3K5VA 1IA9A 2GSFA 2IW6A 4E1ZA 4G34A 3O7LB 1O6LA 4AZVA 3L8XA 3A60A 2G1TA 3FE3A 3PP1A 4JOAA 1YOJA 3OCTA 4CMUA 3RM7A 2UVXA 4QQJA 3WYYA 5IZFA 3UOJA 3QKKA 4U45A 5CNNA 3PVUA 5H8EA 2VTQA 4EOSA 1QL6A 1YOMA 4RWJA 1PXLA 4OR5A 3PY0A 1CMKE 5FM3A 5T6KA 3VW8A 4OT6A 3SG8A 4PP7A 1OGUA 2BPMA 4M0ZA 4EH7A 5KMMA 4A07A 2P2IA 4Y85A 1FVVA 3AGMA 1L8TA 5HE2A 3MI9A 4MCVA 2B54A 4BDDA 4TPTA 3G90X 5TOZA 4S30A 1IRKA 3I60A 3R1SA 5KBRA 3G2FA 4NTSA 4O1OA 3H0YA 3WARA 4YO4A 3R04A 2JC6A 3EQHA 3GU8A 3JVSA 4NZWB 2UZLA 1Q8ZA 2OIDA 4Z3VA 5AA8A 2BALA 2C3KA 4EYMA 3CTHA 4GKHA 4BZOA 1OL5A 1IAHA 3E62A 2BIYA 2Z7LA 3SV0A 4PNKA 3QTXA 4JAJA 1XBBA 2PZYA 4M84A 4G5PA 3POOA 4HYIA 3S4QA 1RE8A 3FUPA 3AT3A 4UMPA 4C3RA 1U4DA 4R7HA 4Z7HA 3W8QA 1JKKA 1Q8UA 5HVKA 1OIQA 5K9IA 3GUBA 4QP9A 3NIEA 1HCLA 4V01A 3QQGA 4WIHA 4I92A 2VWYA 1XR1A 2R7IA 4EOKA 4MXAA 3PSBA 4DEGA 5J5SA 5FTQA 3U6HA 4FL1A 2FSLX 2QOCA 4Y73A 5HX6A 5C8KA 1A48A 2I0YA 3CCNA 4UXLA 5FBNC 4CFXA 3MIYA 3NDMA 4JNWA 3UG1A 2PVMA 3ODZX 4GFOA 4AE9A 4BCHA 3S2PA 1Y6AA 5IH5A 4DF3A 2W4OA 1NVRA 4BL1A 4C8BA 4OLIA 3VBTA 3TI1A 3VQUA 5AA9A 4USEA 4EHZA 4FSMA 4QP1A 5FUTA 3U87A 1M2QA 4G3DA 1MQ4A 2E9UA 4O7LA 4YC6A 3H3CA 3I1AA 2GNGA 4J99A 4TZRA 2YIYA 1LEWA 2XA4A 2ZAZA 5EI8A 4FUXA 5FM2A 1Z5MA 4PDYA 1VR2A 3CTQA 5HI2A 4NH1A 1GIHA 1H28A 1OITA 3Q2MA 4BGGA 4IB0A 1JPAA 4U40A 5AR4A 2X6EA 4ZEGA 2UW5A 2CN8A 3A7IA 4RZWA 1PJKA 4L67A 3ZRKA 3BGQA 2HK5A 3HDMA 5HCYA 2REIA 2XB7A 3SX9A 5K4IA 1A9UA 1GJOA 2W5BA 4FTUA 3PA5A 4ZLYA 2VTNA 2XBAA 3OTVA 4KUJA 3HP2A 3C4ZA 3FZ1A 2F57A 3W33A 5LVOA 1QMZA 1R3CA 2EB2A 2UZDA 4DBNA 3T8OA 5D10A 3D7TA 3DY7A 3FSFA 5DOSA 4U43A 3QQHA 2YIWA 5DR9A 4N57A 4FSUA 3FMKA 4G16A 3TZ7A 3UQCA 3EB0A 2HAKA 3W18A 4G17A 2G15A 4MYGA 4C3FA 3JY0A 4L42A 2PE0A 1RW8A 5KMJA 2ITZA 4ENYA 1TKIA 1G3NA 4S34A 4YHTA 2OJGA 5CNOA 5HIDA 2PUNA 3E92A 4GK4A 4YR8A 4RJ7A 3FEGA 5EKOA 4C4JA 4CFWA 3AC8A 2O8YA 4FV0A 2XP2A 1DI9A 4GMYA 3FKOA 3F9NA 4OGRA 3PVBA 2X2MA 4F0FA 4D5KA 4A9RA 4QPMA 3DV3A 1E1VA 2H9VA 4L46A 4APPA 3FJQE 3BE2A 4JBPA 5DA3A 1YVJA 1FMOE 3A99A 3L1SA 4ASEA 4ZS4A 4FT7A 5EHLA 1BYGA 5AAGA 2RG5A 4YTCA 2XF0A 3TT0A 4BIDA 5KCVA 4E6DA 4EK3A 2GQSA 3JPVA 4H3QA 4C4FA 3MA3A 4FG8A 3BWJA 3WF7A 2C47A 5CVGA 4TWNA 5I0BA 5EM8A 1J7LA 4USFA 4U3YA 3VUDA 2QHNA 4BICA 1M7QA 2IZRA 3I6WA 2JDTA 2PU8A 4BTJA 4O82A 3VAPA 3T3VA 4BWKA 2YFXA 3ZEWA 4YGAA 4C7TA 2JGZA 3I81A 4V05A 4W4VA 4EOQA 2UV2A 5FXSA 4W8DA 4OAUC 3TJDA 4LFIA 3DXQA 2IN6A 4Y95A 3COMA 3O71A 1PKDA 3H9OA 3FZOA 2FSOX 4RVMA 3IKAA 1U5QA 1OL6A 3AMAA 4ZY6A 4IVCA 5HO7A 4UV0A 3FMHA 3NVKI 4KSQA 5T3QA 4RPVA 1TQMA 5EHYA 1ZAOA 3DK7A 4I3ZA 2ZMDA 4ENXA 4NT4A 1YQJA 1ZRZA 3VBXA 4C2WA 2BZKB 1OIRA 2BROA 4TWPA 1KE6A 2UZWE 2W1DA 3QUDA 1U59A 1OZ1A 1WVWA 2RL5A 3LCOA 2WMVA 5JFVA 2R3OA 4RJ5A 3KU2A 1LEZA 1AGWA 3FMJA 3NYVA 3PJ1A 4DC2A 4O83A 5LARA 3FI3A 4BDBA 3TKIA 5E9EA 5EYCA 3WBLA 1YKRA 3V5WA 1V0PA 2XVDA 2FA2A 2UUEA 4N70A 3KXHA 2X8EA 3DFCB 4DYMA 3NZ0A 4LQMA 1Z57A 4XG4A 1NXKA 3BE9A 2VTSA 3R7VA 1ZZ2A 4FZ6A 2Y9QA 3BHTA 2GNFA 2EWAA 4L52A 5H8BA 3R7IA 3MESA 3EQDA 1Q97A 5ETCA 3E8EA 5CQWA 3COHA 5IISA 4CD0A 1XH7A 4ZSJA 5M07A 3GU7A 2VX0A 2ITVA 3PZHA 3QRJA 4FIHA 4GEOA 4RQKA 4W9WA 3QWKA 2YDIA 4EH2A 5I5ZA 4NUSA 3W2SA 4UB7A 4DCAA 1YHWA 1PXIA 1IASA 4NCTC 1KV2A 4OBPA 2EB3A 4JS8A 2W06A 3TZ9A 4PX6A 4BWPA 4J8MA 4C34A 2B9JA 2PVLA 4QYHA 2Z7RA 1WBWA 4AZTA 3FXXA 3PTGA 4PQNA 4RJ8A 4APCA 5IA5A 4DFNA 4XLIA 4RIYB 4MD9E 4AF3A 3ORPA 3R7OA 2PVHA 4MVFA 3ZS5A 5BYZA 5KKRC 4FSTA 4L7SA 2UZVA 4AWIA 4EHVA 2WXVA 1OKYA 1YRPA 4BFMA 2LGCA 4F0IA 2XM9A 5LCKA 4E6QA 3OOGA 3R01A 2PZ5A 4NJ3A 1J1CA 4BDHA 2CKOA 3ENHA 3K3JA 2ITYA 3ATTA 1PXKA 1JKLA 1FOTA 3ODYX 2JKKA 3F2NA 2YM3A 3CS9A 4JDHA 5HE1A 3NNXA 4AT4A 5JGDA 5M08A 3QL8A 2J6MA 4RX7A 1ZY5A 5HTCA 2VO0A 3HV3A 3CTJA 4JT3A 3BV3A 5HVYA 4NFNA 4BGHA 2B9HA 2E9PA 2G01A 2VTTA 3LPBA 4YTHA 1ZYDA 4ARKA 2CGUA 4FIJA 4H3PA 1Z9XA 4KKGA 4UXQA 2CKQA 5FEDA 4S31A 4B6LA 2QLUA 3F3VA 4GSBA 3I5ZA 4NM0A 4CEGA 3OP5A 4FNXA 5CX9A 3BU5A 2BRBA 2WU7A 4FKQA 4K33A 1H08A 4CSVA 4MXZA 4O7SA 4JX3A 4I5CA 4CRSA 5CANA 3AD4A 4YNEA 2CHLA 2CLQA 3H4JA 2X9EA 2QODA 5JKGA 4IAIA 4WBBB 4GG5A 5F94A 2YWPA 5TR6A 3TUDA 4Q9ZA 3MH2A 5M53A 3COKA 3QWJA 5H9BA 4FTKA 4EC9A 2QQ7A 2JIIA 3PVWA 3HUCA 2ZDTA 1XBAA 3OMVA 2BRHA 4KBCA 5BVOA 5CEQA 3ACKA 4H39A 5J87A 4IIRA 1YXSA 3HVCA 3U9NA 4BCPA 3LLAA 5HD4A 4PDPA 2FGIA 5EKNA 3AXWA 5K4JA 3UIMA 3F3ZA 3E8CA 4DAWA 4EOJA 4H05A 3H9RA 1OL7A 3PYYA 2O2UA 2YM5A 5A4CA 2QVSE 4A06A 5B7VA 1H1WA 2HZIA 2J0KA 4FIIA 5BX0A 2J2IB 2ITNA 4FBXA 4WSQA 3VBQA 5DT3A 3UO6A 4RJ3A 4GYGA 4EI4A 4O6EA 2YCQA 3VS2A 3KRJA 3Q9XA 4CTBA 2DS1A 4IDVA 1OPJA 1WCCA 3OHTA 2I7QA 4M13A 2O5KA 2OO8X 2YIRA 4XRJA 2C68A 4BZNA 4AN9A 3LM5A 2O65A 3OUNB 3EFWA 4ANBA 4K0YA 4QTAA 3V8TA 5KMIA 4ZY4A 3P1AA 4YJOA 2WO6A 4YZCA 3Q32A 2PUIA 2ZJWA 4FIFA 4YHJA 1EH4A 1PKGA 1ZYCA 2JDVA 4ALUA 3PY1A 5KUPA 4LGDA 2J5FA 3OT3A 3AD6A 5ANDA 5JT2A 3BU3A 3QRIA 4I4FA 5AP3A 4ITIA 3MPAA 4I5PA 1JOWB 2WMUA 4PMSA 3LHJA 1KSWA 3BZ3A 4QQ5A 2CKPA 3R9RA 4XLVA 3PA3A 1CM8A 3ZLSA 4MX9A 3NIZA 2R3FA 3MWUA 5HNIX 3IGOA 5G6VA 4EK8A 5TF9A 3QQJA 4FEQA 2CNVA 3KRXA 2PVNA 4R77A 1I44A 2XK4A 4L43A 4IXPA 1SMHA 5L4QA 3TL8A 4BI2A 4MF1A 1Y91A 2HY0A 2ITOA 4GT4A 4U41A 4WT6A 4P90A 2I40A 4XUFA 4CKJA 4WG3A 2UW3A 3R1YA 5CZIA 2V62A 2VRXA 3Q4TA 2PZRA 5EDRA 3R7UA 3R00A 4UMRA 4ANLA 3LZBA 3FZPA 2QONA 3V04A 5JFXA 4MD7E 4AUAA 1ZMVA 3PJCA 3QUPA 2PSQA 3Q4CA 5EW9A 4AXAA 1YI6A 4DINA 2I6LA 5ICPA 1UU7A 1ZOGA 3DDPA 1YXUA 4II5A 3R7YA 3KY2A 3UC4A 3MS9A 3QU0A 4GK3A 1WBTA 2PZIA 3H10A 4NFMA 3UPXA 4E6AA 2YM6A 4FL2A 5AR5A 4RX8A 4RFYA 4D4YA 4EH6A 4QMNA 3TUCA 2CDZA 3KXGA 4U44A 2WKMA 4AFEA 1PXOA 4O27B 2GHMA 3H0ZA 5EQYA 2ZV8A 2E9OA 4C02A 3GOKA 4L6QA 2ITTA 2B55A 3Q5IA 1IEPA 4I20A 1WBVA 5DR2A 3AMBA 4LV8A 3FZRA 4F9YA 4JVGA 1KUTA 3CJGA 3FC2A 4UBAA 3WF6A 3T9IA 4IAFA 3BELA 2WQBA 4X6QC 3UIXA 5E7RA 4FV4A 3JYAA 3SXFA 2JFLA 4P5ZA 1KE7A 3LFEA 5ANJA 2ERZE 4CCBA 2YAKA 5IEXA 4IWDA 5BUIA 5JFSA 5K3YA 4BY9E 4R5YA 3PRFA 1UNLA 1X8BA 2RFDA 4X3FB 3LLTA 5J9ZA 3P5KA 3Q04A 4HNFA 5LVPA 1DAYA 2WTKB 4A9YA 3O50A 3QAME 4NW5A 4IE9A 2YLFA 5BUJA 5HORA 2A2AA 2R4BA 3OWKA 4JX7A 4OTRA 4ZJIA 4QT1A 2Y8OA 1UVRA 3VW6A 4MWIA 3LIJA 3ZUVA 1ZWSA 2YCRA 4IACA 3W32A 3ALOA 4GJ2A 1H1PA 2HW6A 4CZTA 5M09A 3SGCA 1DI8A 3HZTA 3F2AA 4WG4A 4V0GB 4O7VA 3DXPA 1PMNA 4BWXA 4PY1A 4AT5A 2W1HA 3DBEA 2C0IA 4JG8A 2UZBA 5AR7A 5IF1A 4X3JA 1KV1A 5IUGA 3PSDA 5IQBA 1OPKA 4LMUA 4FNYA 3VS3A 2ZYBA 4BI0A 4RJ4A 2X7FA 5CSHA 3UP7A 3IONA 3IDPA 3BLRA 4KIPA 5ETIA 3FYKX 3ZRLA 2PPQA 1OKWA 4R6VA 5DT4A 2UZNA 4EC8A 1FGKA 3FPQA 5EOBA 4D4VA 3LMHA 3R9DA 3FQEA 1NVQA 4K9YA 1DS5A 3AC2A 3CEKA 4YZMA 5FRIA 2VTLA 2XIXA 3LM0A 5JZJA 3G6GA 3DCVA 3KXNA 3ORNA 1BLXA 2BKZA 4ZS0A 5CASA 4FK3A 2E9VA 2W5AA 4GU6A 4PP9A 3B2TA 3I0OA 5ETAA 5FLFA 4PDOA 4DFBA 1SVHA 3D7ZA 2C6DA 3VF8A 3Q2JA 3L8SA 1URCA 2HZ4A 3D0EA 3KRRA 4O38A 3E63A 2JKOA 4AOJA 3EQRA 1H4LA 5IDPA 4RRVA 4WRGA 2VWBA 3QXPA 3EL7A 2W96B 2E2BA 4FEUA 1OUKA 3KL8A 4AACA 1YDRE 2WELA 5HICA 4B8MA 4FEXA 4E93A 4DEIA 3NEWA 1FMKA 1SNXA 2XNOA 4RZVA 5DWRA 5EG3A 4HPTE 4U79A 3BU6A 3Q6WA 3ULIA 2OBJA 3MTFA 2XNPA 3UBDA 1E1XA 3KK8A 3DQXA 3EN9A 4ZSLA 4Y5HA 3CQEA 5EYKA 5HLPA 4AW1A 4CFMA 4AQCA 4MH7A 5JH6A 1WMKA 2KTYA 4UN0C 2P55A 3OW3A 4S32A 3RPOA 3SHEA 5IH4A 3C0GA 4EOLA 5JFWA 4C4HA 5JN2A 2A1AB 2YWVA 5HCXA 3RVGA 2Y4IC 3FSKA 3MH0A 3EQPA 5A3XA 3CIKA 1VJYA 4RIXA 3D2IA 3EN5A 4YMJA 2GNJA 3UVQA 5KZIA 1U54B 3SAYA 3VN9A 3PXKA 4OAVB 3A7JA 3RCDA 4Z9LA 4PPAA 3G6HA 3BLQA 2WAJA 1LR4A 3C50A 3IW7A 4BVUA 3VS0A 3DBDA 3FHIA 3I5NA 3OY1A 5CI7A 3AD5A 4IB1A 4NKAA 4FC0A 2HCKA 3U8WA 4D9UA 4FG9A 5IQHA 1IA8A 4B7TA 3OW4A 2O63A 3IW5A 3CE3A 3V8SA 2IVSA 4FTTA 3KN5A 3NLBA 1MRUA 1RQQA 1OUYA 2BUJA 4DFYA 3GXLA 4AE6A 4AX8A 3C9WA 3R9NA 3A4PA 3EZVA 4F0GA 4XX9A 2IO6A 5M4CA 5KO1A 5KE0A 5JEBA 5BYLA 4TYJA 3V6SA 2ESMA 3D5XA 4GK2A 3PPKA 2R9SA 3VBYA 1ZYJA 4YJPA 4IX6A 1I09A 2PE2A 2YJRA 1FQ1B 4YLLA 1JSUA 3ANQA 4MXCA 1R1WA 4O2PA 3SKCA 5CU0A 2XIKA 3ZDUA 4N4SA 1Q8TA 2XUUA 1QPCA 4P2KA 4BDFA 4AS0A 4D1XA 3EYHA 3KCKA 4DEBA 5CSXA 2V0DA 4NSTA 1APME 3VUKA 5DR6A 4K8AA 4BCJA 3HKOA 3UPZA 3KMMA 2F7ZE 3HNGA 3P7CA 5FWKK 2XRUA 4AGDA 2NNWB 4DTBA 4FKWA 4FZFB 3ROCA 3L9LA 1XWSA 2R3GA 3E88A 4QMLA 3OF0A 5E90A 1ZMWA 3G51A 4MXOA 4I24A 3V8WA 3U54A 5FP6A 4LV5A 4DEAA 5CAQA 3ZHPC 3PLAE 4HYHA 4YC8A 3UG2A 1YWRA 1GIJA 5LJJA 3QTRA 3TACA 5BNJA 3DLZA 4TNBA 3W2OA 2WMSA 3KRWA 4LRMA 1OIYA 5FTOA 2GPHA 2DWBA 2F7EE 2H96A 3DKGA 4O0SA 4RWLA 4XP2A 3SC1A 4AW0A 3OUKA 4C3PA 5M51A 3D15A 4I4EA 2OICA 3CPBA 4X2FA 5DG5A 5C27A 1YDSE 3R8VA 4Z7GA 4NK9A 3HDNA 4BB4A 5DBXA 3GB2A 5EM6A 2NRYA 4WNPA 3V51A 1AD5A 3B8QA 4JBOA 4BDIA 3CY2A 2PY3A 2BTRA 1TVOA 4FKPA 4L44A 4RIWA 2EXEA 4PRJA 3WIGA 4ALWA 4F7SA 4EQMA 5JGBA 3ORTA 4IZAA 3QD0A 4XNEA 3N4UA 2R0UA 3C4XA 3GU4A 1S9JA 5DMZA 1Q61A 4EWHA 4M12A 4HVDA 1H1QA 3C4WA 3VRYA 3LJ0A 3AG9A 4MD8E 4DTKA 4KBAA 2OH0E 4N0SA 3RZFA 4KAOA 4PUZA 2QU6A 2OFUA 1ZMUA 3A7FA 1OPLA 5GZ9A 4BI1A 5CY3A 2VNWA 3GOPA 1W0XC 3MY5A 5LQFA 1BKXA 5AUVA 5IUHA 2J50A 4MWHA 5IG1A 4JDKA 1M2PA 5DFPA 3NYNA 4FUYA 2B53A 4FOCA 4H1MA 1AQ1A 2RG6A 2FSTX 4KIKA 2PYWA 4C57A 3R6XA 4IANA 2VUWA 2XM8A 2VTOA 4L9IA 4W9XA 2ITQA 2JKMA 3W2QA 5L2SA 2OZAB 2BRNA 3RALA 4JR7A 3UGCA 5A6NA 3DNDA 2JKQA 4AW2A 3AT2A 2UVZA 4H36A 5IA0A 4RT7A 5CAUA 4FZDB 3ZZWA 5AFVA 2GNHA 5AR2A 4BTKA 4X21A 3DKCA 1CSNA 3K3IA 4YBJA 4BIEA 3R0TA 3R73A 3WF8A 1YHVA 3MGYA 4Q5HA 4CQGA 1CDKA 2R2PA 2HIWA 4FSQA 5C8NA 5E8UA 4UX9A 3E8NA 3C5UA 5JRSA 5J7BA 3LE6A 4BZDA 3GFWA 3TKHA 3LFSA 4FSRA 4FGBA 3NSZA 3ZBFA 4I6BA 4GFGA 3S0OA 3BPRA 3PXFA 1FGIA 3QLGA 1XJDA 3BGZA 2CCIA 3OD6X 5EM7A 4ZLOA 2ITUA 4JBQA 5EQEA 3ZFYA 5I9XA 3JVRA 3CGOA 4YJTA 3EFLA 3LFDA 2OJJA 3QHWA 2CLXA 2C6LA 3Q4UA 4O0YA 3VS7A 4V04A 4XV2A 4A7CA 3OXIA 4I6FA 4RGJA 1WBOA 2F4JA 2C5YA 4QO9A 4JQEA 3IQ7A 3UYSA 4BF2A 4QTDA 1S9IA 3RNIA 1SYKA 3VVHA 4MHAA 4UWCA 2XBJA 1YWVA 1UV5A 2FUMA 1B38A 2OH4A 2ZDUA 4FOBA 4WNMA 3WYXA 4U42A 5L2QA 4ANMA 3ET7A 2VV9A 4BCFA 1TQPA 1PF8A 2W4KA 4CYIA 4HW7A 2V5QA 4U81A 1M17A 5KMNA 4MNFA 4FEWA 2XK3A 5HQ0A 4PPBA 3QLFA 3R83A 2LAVA 4HGEA 4BYJA 2GU8A 3KKVA 3EL8A 1K2PA 2GQGA 3RM6A 3LXPA 4HVIA 4DFUA 3V5TA 4PL5A 5EYDA 2PVKA 4DG2E 4QTCA 3PRIA 2QKRA 3A62A 5FG8A 3EQBA 4BDKA 4C4IA 1U5RA 5HVJA 3NS9A 3BQCA 1H1RA 2W7XA 3DFAA 4DEHA 5F4NA 1PRYA 4IWOA 1R0PA 4CQEA 2X39A 5JSMA 3UIBA 4ZMEA 2I0EA 4JQ8A 2QR7A 3A7GA 3SRVA 3ZBXA 2OFVA 3WZEA 3F7WA 2OU7A 3V01A 2HZ0A 5BPYA 4X3FA 4CKRA 4CGAA 3VHEA 4JJRA 4BDJA 2WHBA 4XH6A 3BLHA 3TKUA 1JKTA 4XG9A 1J91A 4QNYA 2WB8A 3PG3A 4M67A 4XCUA 5IMEA 2AC3A 3E64A 3TTIA 3PIYA 3HAVA 4M69A 4NU1A 3V6RA 3LJ1A 3BHUA 2F2CB 3OXZA 2Y6OA 2V7AA 1KWPA 2C6MA 3ZDIA 4EH9A 2BAJA 3BYSA 5K0KA 2PMNX 2QOQA 2BZJA 3VULA 3A8WA 3ENMA 2ERKA 3QCSA 1WBNA 3JY9A 2YLEA 3BIZA 3UC3A 4B4LA 3P08A 3PJ3A 2WQMA 4QMMA 5FP5A 5AUXA 5E1EA 5C01A 4HVSA 3MFTA 3UOHA 3OS3A 5A4TA 5IU2A 5ITAA 4F9CA 3UNKA 1WVXA 3IECA 1V1KA 1H0WA 2J0LA 1BMKA 2PMIA 2X0GA 3OVVA 4ZAUA 2IG7A 2V22A 4KWPA 4YSMA 3QZGA 1UKIA 4X2GA 3MA6A 3EHAA 3DDQA 1Q8WA 4MBIA 1GOLA 3LFBA 4WG5A 4TXCA 1UKHA 3AGLA 3V5LA 2ZV9A 2WNTA 3QRTA 1SZMA 2WPAA 4UMQA 4GVJA 5KMOA 3RCJA 4FZAB 3NYOA 3D9VA 4FICA 1XHAA 3PFQA 2P0CA 3R21A 2YDJA 3TNHA 5L3AA 1UA2A 2IVVA 2QLQA 2DQ7X 2ZM3A 5AV3A 2ZM1A 1BUHA 2QOKA 4B9DA 4D2RA 4EBVA 4F7JA 1OI9A 5GINE 3QQKA 5AV4A 2WTVA 3NW5A 4M68A 1PXNA 4BCOA 2X2LA 4YJSA 4XS2A 1JAMA 1URWA 4K2RA 4C33A 2WEVA 3BEGA 2GMXA 4G9RA 2JDRA 2W1ZA 5FEEA 3SVVA 2BDWA 3KB7A 1YDTE 2CN5A 1QPJA 4I22A 1FVRA 4NEUA 4OTWA 4C4EA 1ZYSA 5A6OA 3ZO4A 2QOBA 2FVDA 3WI6A 4FMQA 4DEDA 2RSVA 1J3HA 4AA4A 3IDBA 3EN6A 3PJ8A 5GJGA 5J95A 1JLUE 2GFSA 3HV6A 2BRMA 4XRLA 4DT8A 4J96A 3PJ2A 2PMOX 3KCFA 4QMOA 3UE4A 4F6UA 4I5MA 4FKSA 2XK7A 4U0IA 3RKBA 1DAWA 4H58A 4RLKA 5LWNA 3FLZA 2W1FA 4KIQA 3GEQA 2Z02A 3I4BA 1GZNA 2YM4A 3F61A 3FMNA 5EI6A 5JGAA 1WBPA 3EWHA 5CZHA 4DLJA 4E20A 4HVGA 3K5UA 5HKMA 1YW2A 5BVFA 2GHLA 3E93A 2P2HA 3PDTA 3ORLA 3OXTA 5BMMA 3BBWA 2OZOA 2XK8A 2W5HA 4NIFB 5HESA 4NKSA 3CY3A 3GBZA 3QD4A 5F1ZA 2WU6A 2YCSA 2Z7QA 2WD1A 2OIBA 2WTCA 3KXXA 3O96A 4CFUA 3EFJA 4EJNA 4JQ7A 4L01A 3FL4A 2B7AA 2XJ1A 3S1HA 3TV6A 3IG7A 3LCTA 3SXRA 2Z8CA 5ANIA 2C0TA 2W4JA 3MDYA 4D28A 4BCGA 5H3QA 2IVUA 2YM7A 3C7QA 2R7BA 4RSSA 3VJOA 5LWMA 1ZARA 4QMZA 2RFSA 3DAKA 3F5XA 3M2WA 1W8CA 5GHVA 3F2RA 2VWIA 4I0SA 4UMUA 3GI3A 3FZSA 3KULB 2XKEA 3QZIA 4R3PA 4RLLA 4O81A 3L9PA 4GIIA 5GIOE 4AW5A 2BDJA 4FKJA 4EKLA 2GNIA 2HZNA 3Q3BA 4L3PA 4NTTA 4ONAA 3I0QA 4IVDA 4X7QA 3WIKA 4LL5A 4Y46A 3U6JA 3MH3A 2WMAA 3F6XA 1JBPE 2XIRA 4P4CA 5L6WL 3ZSHA 1PMVA 4C59A 4RQVA 3OC1A 4F1TA 3H30A 1TQIA 1XH5A 2XH5A 3QTZA 4XP3A 2XNGA 4G3EA 5D7VA 4HPUE 5DN3A 5L8LA 2QD9A 2ONLA 2UVYA 3FAAA 4EOPA 5I4NA 4O86A 1H07A 3PPZA 1VEBA 4YLKA 2A19B 5AUWA 2GHGA 5HE0A 5DYJA 3M42A 4IB5A 3D2KA 2BIKB 4GFMA 4IWQA 4E4NA 3R7EA 4U7ZA 4RIOA 4R78A 4I5HA 3QXOA 4QTBA 4CZUA 1ZY4A 3GCSA 3O8TA 4E4XA 4O7NA 1V0OA 5LVNA 2O64A 1M7NA 4IAKA 3VUIA 4ZTSA 3L9NA 2WTIA 1Q4LA 2B1PA 4HZRA 4E5BA 3GC8A 1HCKA 3RTPA 2IW9A 4BCIA 3GC7A 3ORMA 4YSJA 2C3LA 2B0QA 4R8QA 4EQCA 3HECA 1UU9A 3EKNA 4YO6A 3T9TA 3LQ5A 4O7WA 3HGKA 3DK3A 4BR3A 2YM8A 5CEMA 1O6YA 3NWWA 4IDTA 3PXYA 1QPDA 4GVAA 4JRVA 2SRCA 2V55A 5DT0A 3ZRMA 2BHHA 2VX1A 4L7FA 2OLCA 4QP3A 2UZUE 1IG1A 3SOCA 3F5PA 4E5AX 2XYUA 4YZDA 5KKRB 4NJDA 1K9AA 5CAOA 5A46A 4EONA 3QD3A 4RVLA 3TXOA 2QU5A 4CT1A 2OF2A 3M1SA 4IFCA 4KKHA 5JMSA 5BVEA 2Q83A 1H25A 2A4LA 4MBJA 3BI6A 5F20A 3GVUA 2R3QA 2XMYA 3FDNA 3CJFA 2VTAA 2XNMA 3D14A 1OIUA 1W7HA 4XV3A 4TYHB 3SRVB 1E9HA 3OTUA 4WSYA 4AG8A 3RK9A 3V3VA 4QPSA 4B8LA 4F65A 3HMNA 4G3CA 4JI9A 1GZ8A 2P33A 2OKRA 3FHRA 4OTIA 3ZM4A 4F6SA 4F70A 3GC0A 2UW6A 2BAQA 4RVKA 3O7LD 4FV5A 4IHPA 3C0HA 4FT9A 4U6RA 3VBWA 3FPMA 1CKIA 4BKJA 2XS0A 4D0XA 3E8DA 3VS4A 5HG8A 1OBGA 3UJGA 1WBSA 4ZTHA 3MY1A 4U8ZA 4P5QA 3RPRA 4I23A 4BKYA 5CU4A 1REKA 2DUVA 2WTWA 5LCJA 1G8AA 5IDNA 3GCQA 4GUEA 3GCUA 4RC2A 3UO4A 3TIYA 1H00A 2OW3A 4DFLA 3TDVA 4C37A 3DB6A 5AUTA 4IM2A 3DBCA 3KREA 5HOAA 4FTCA 3D4QA 3ZO1A 5TO8A 5KNJA 4XG3A 4WNOA 4QP4A 5C9CA 3HRBA 3MJ1A 5CF8A 4R5SA 3VS5A 3C5IA 4FTOA 5IQEA 2GFCA 2W1GA 4O96A 4W4WA 4ALVA 4C36A 3R8PA 1JWHA 4H3BA 3QYZA 3KA0A 3DZQA 4CXAA 4FTLA 1PMUA 2RFNA 3QFVA 4X3FC 3NW6A 4O84A 2OIQA 2YISA 3KQ7A 4JRNA 4YP8A 2WOUA 2H6DA 2WTKC 4OBOA 5CI6A 3TV7A 3GNIB 4D2SA 5CAVA 3U55A 3WZJA 4L3JA 2CGVA 3AQVA 3GU6A 1OL2A 2X2KA 3BHVA 4FV8A 3QKLA 4F9BA 3UZPA 2RF9A 2BZIB 2W1CA 5HO8A 5DHJA 4I21A 3A2CA 3F5GA 4GUBA 3O2MA 1WZYA 1QCFA 3COIA 1OB3A 3E7OA 4BBFA 4IBMA 4EOMA 4JIKA 4FSWA 4EOOA 5CEOA 5IH6A 2VNYA 4IX3A 5HBEA 5IPJA 4WO5A 4WRSA 4F08A 2BCJA 2QOOA 3FI2A 1MUOA 4J98A 4BBEA 2VO6A 4LRJA 5BVDA 5EDPA 2Y6MA 4ANNA 4GW8A 4D2WA 3LQ3A 2VWWA 4DFZE 5CSPA 3RGFA 3VQHA 5HE3A 3C0IA 1W82A 3R28A 2HWPA 1IAJA 2Z60A 3IDCA 4O22A 5HLNA 3LFCA 4AZFA 5DI1A 3Q53A 4PF4A 1XH6A 4A9SA 1FPUA 5FDPA 2YJSA 3KEXA 2QKWB 4ITHA 2OI4X 3W8LA 3WOWA 1PY5A 2X7GA 5E8TA 2W05A 4CKIA 4RVTA 4G6NA 4XOZA 2J7TA 4EEVA 1U46A 4EK6A 3DQWA 4JBVA 4ZZNA 1M2RA 2XKFA 4ACHA 1W83A 4IX5A 4G6LA 3FI4A 5CENA 3SXSA 4UMTA 4BC6A 1BI7A 4ANQA 3DZOA 5CS6A 5AV2A 4KRCA 2RFEA 1PYEA 3N4VA 5A4LA 3ZUTA 5I3RA 2XIYA 4DT9A 1F0QA 4DG0E 2VGPA 4MEDA 3NNVA 3A8XA 3O8PA 4KINA 4R3CA 3JUHA 5HZNA 4HGSA 2BILB 2WIPA 2BFYA 2V7OA 3NGAA 4DH8A 5GZ8A 5HTBA 4K1BA 1JVPP 2WMTA 2C0OA 3CD8A 3RPVA 1CKJA 3Q96A 5AM7A 5AR8A 4D2TA 4ORKA 5BUEA 2OG8A 5C8MA 3LXKA 5E8SA 3EMGA 3FMMA 3PZEA 1H27A 1J1BA 2ZMCA 4QMYA 2CGXA 5CSVA 3TN8A 3TDWA 2ITPA 3KMUA 5CU2A 4FGRA 2UZOA 2VD5A 4MKCA 3PP0A 4YLJA 3LFQA 3U4UA 4Y83A 4CT2A 3ELJA 2JD5A 4FIEA 4AGUA 2XRWA 4HCTA 4G6OA 5AX3A 4AT3A 2F9GA 4ZK5A 4BCNA 2CPKE 3Q60A 2HYYA 5KX8A 3ZLXA 3QZHA 1F5QA 3MVHA 2JIUA 3F7ZA 3IW8A 2OJ9A 3MPMA 3R30A 3QC9A 5AWMA 2UW0A 4RC3A 3R8UA 5IA1A 1W98A 5D9HA 3TUBA 1PYXA 1Q3WA 4OBQA 4DFXE 3FI8A 2HENA 2WZJA 3CQWA 4CV9A 3G15A 3O17A 3TIZA 1T46A 2BKKA 4IJPA 5ACKA 3QTWA 2VWXA 3MN3A 1H01A 1MRYA 1R0EA 5FXRA 2JEDA 4YJUA 3PVGA 4FODA 4FYNA 5HBHA 4CVAA 3I6UA 5BQ0A 3R2BA 4BRXA 3GU5A 3C4EA 4DGNA 5F9EA 4FE2A 4C62A 3DBFA 1G5SA 3HRFA 3M11A 3NAXA 3CBLA 4Q5EA 3II5A 4IADA 4UWYA 4FI1A 5JZNA 5AADA 5JK3A 3MIAA 4QMTA 4F9AA 2BHEA 2X4ZA 4N6ZA 4GYIA 2G2IA 2OK1A 2PE1A 2F7XE 1JSTA 3DAEA 3H9FA 2ZB0A 2VTPA 3HV5A 4GJ3A 1ZLTA 3D83A 2RIOA 2XEZA 3EH9A 3FV8A 4ASXA 2AUHA 3PIZA 5DPVA 4DITA 4FSYA 4QNAA 5FQDC 4FTJA 2HOGA 4HGTA 3KRLA 4O7RA 3MPTA 3GENA 3EOCA 1OMWA 2IPXA 4E7WA 5HCZA 2OXDA 4EH4A 3HL7A 3PXRA 2ONLC 3ZONA 2PVFA 3NUYA 4M14A 4HGLA 3JS2A 4E73A 2YAAA 2J51A 4IAAA 3LXLA 2C69A 2CGWA 4EHEA 3QCXA 4LOPA 3RJCA 4NIFA 5A14A 3BEAA 3NMUF 4BCQA 2W17A 2AYPA 4I94A 3ZCLA 4PMMA 4G9CA 2OXXA 2YZLA 2QCSA 5EDQA 2R3NA 3G9NA 4QMWA 3PY3A 5AR3A 4RBLA 4QRCA 5AP7A 5M4IA 4D1SA 5CEKA 5GZAA 3S3IA 4OTHA 4EHGA 4KSPA 4R7IA 5E8VA 4ZSEA 3S95A 2VTRA 4RIYA 4JIAA 3KMWA 4H1JA 3NNWA 4A9UA 3ID6C 3LCSA 4QP6A 3GGFA 4O0XA 4G31A 2X8IA 2VTIA 4K11A 3I7BA 4PTCA 3O8UA 3A7HA 3QCYA 3AC4A 4BDCA 5CVHA 2YHVA 3ZM9A 2XZSA 4OW8A 5EYMA 5E91A 3I79A 4PPCA 3GQLA 4EOIA 3UZRA 3LFAA 3PWDA 4KIOA 5ANGA 1P14A 3KULA 4IZ7A 1MP8A 3W10A 1BX6A 2R3LA 3IOPA 3FQHA 4F6WA 4K18A 4TYGA 4L3LA 4UYNA 2WMWA 3WF9A 3MVMA 3ALNA 4JLCA 4DGMA 2FO0A 3O51A 3RPSA 3BYUA 4CZYB 3Q9WA 4HOKA 3R9HA 3NRMA 2PWLA 4ACDA 4QD6A 3HYHA 4UYAA 4EORA 3CKXA 3P7BA 3QTIA 3ZO3A 2Y4IB 2JBOA 1LPUA 2Y4PA 3EYGA 1BL7A 4BHNA 4MAOA 4Y72A 4Z55A 4OTGA 4USDA 3QQFA 3RWPA 3Q5ZA 3CSVA 3RHKA 5L6OA 3F3UA 2XKCA 4JDIA 4WUAA 5CVFA 4ASDA 4EH5A 2J9MA 4DG3E 4ZOGA 1P2AA 4JL9A 4C35A 3GCVA 2JAMA 5BMSA 4EUUA 1GY3A 4DBXA 2ZB1A 1ND4A 3CC6A 2XCKA 5K5XA 5B0XA 3W16A 2QNJA 2VU3A 3DJ6A 3MBLA 5JRQA 1YXXA 2OSCA 3FXZA 4ZXTA 3ORXA 2PULA
chains in the Genus database with same CATH superfamily
4ANOA 4UZDA 2XNEA 5CQUA 2R3RA 2QOLA 5IA2A 3VHKA 3AKJA 1ATPE 3CXWA 3FLNC 2CMWA 2W9FB 2NRUA 4O0VA 2VWUA 3LFNA 1JKSA 3QGYA 3REPA 4FYOA 5IA4A 3UVRA 5L2TA 5J1WA 3RNYA 3OWLA 2ITXA 2CCHA 3RI1A 3U4WA 2OWBA 3TJCA 4DGGA 5IA3A 4J97A 3WZKA 4O7YA 1KOAA 4E4MA 2YDKA 3ETAA 4QPAA 4DH1A 3G0FA 4YHFA 3MVLA 3NCGA 4IZ5A 4XV9A 5GNKA 5M06A 2EU9A 4BTMA 5HO6A 5D12A 4EZ7A 4WOVA 3F69A 3W2PA 1VYWA 5C4KA 3U6IA 3FLWA 2JAVA 1VZOA 3DJ5A 4PV0A 4AN2A 3TTJA 2UZEA 2XEYA 2J4ZA 4E26A 4I93A 4BHZA 4EZ5A 5AP6A 3CLYA 3NX8A 3QRUA 4PNIA 1UNGA 4QMUA 5IUIA 3Q9ZA 2C1AA 3BBTB 2BAKA 2QOHA 4Y5QA 2CSNA 4I0TA 4IQ6A 3JXWA 4XG8A 1QPEA 3ZLWA 3ZOSA 5FDXA 3KC3A 4XEYA 3UYTA 5CSWA 5DGZA 5IKWA 2R3KA 3PIXA 3ORKA 4ZSGA 4M0YA 1XH8A 3PA4A 2J0JA 3UNZA 4BGQA 3QX4A 2ETKA 1LP4A 3VWAA 5L6PA 3DTCA 5AUUA 2QR8A 5A9UA 2ZOQA 2WTJA 3P4KA 2EXCX 4R1VA 4FKTA 4OUCA 3VUMA 2WQNA 3SLSA 4U97A 1K3AA 3DJ7A 4AFJA 2PVJA 3O23A 4FV1A 3FXWA 3B2WA 2YIQA 3Q9YA 4AXFA 4FKGA 3SQQA 1ZZLA 2X6DA 3QYWA 2WEIA 4F1OA 3EIDA 3OT8A 4ZTRA 3IW6A 3OZ6A 1NA7A 5AMNA 3QTQA 4AGWA 3ZYAA 4J52A 3R63A 1B6CB 1GAGA 5H8GA 1XKKA 3IOKA 3ZFMA 2DYLA 4Q2AA 3HAMA 1XH9A 5L2WA 4GKIA 1F3MC 3ORZA 5FGKA 3EJ1A 3LOKA 2C5XA 4FV6A 4X2KA 5L8JA 5HIBA 1YI3A 3N9XA 4FTRA 5FBOA 2R64A 4ZTQA 3HUBA 3POZA 3AC5A 1KE9A 2WMRA 4IMYA 4AAAA 3QA8A 5DIAA 4QYGA 2VO3A 4IZYA 4X2NA 4ZLZA 4GT3A 3MV5A 3QQLA 4G1WA 5LOHA 1MRVA 3BQRA 3GFEA 1FINA 3NUNA 4WD5A 5LVMA 4D4SA 2J90A 1Q99A 4IM3A 2JDSA 4GRBA 3N4TA 1ST4A 5E8WA 3V5QA 2YABA 1V0BA 1IR3A 3P7AA 2RGPA 4AXDA 1KE5A 2B9IA 3EKKA 3LMGA 5I9WA 5K5NA 5ACBC 1JQHA 5M44A 4M15A 3ITZA 2PMLX 3R1QA 2YERA 3KVXA 1MQBA 4QMSA 4MTAA 4RWKA 4J7BA 4C38A 3EFKA 4WHZA 1YHSA 4LYNA 1H24A 2VWZA 3SA0A 3CP9A 5I9ZA 1Y8YA 3W1FA 4PMTA 1Q41A 1REJA 4XP0A 2GS2A 5H2UA 5HG7A 3NUPA 3RINA 4AAYA 3FMDA 4FV9A 5IQAA 3DA6A 5ETFA 3EQIA 4JR3A 2B9FA 2UW7A 4F9WA 4FF8A 3R8ZA 4GL9A 4YU2A 3LQ8A 3MB7A 3SW7A 3VNTA 1GIIA 3E7VA 4QYFA 1HOWA 1R39A 5TT7A 3VUHA 4DH5A 2WQOA 3A61A 3OCSA 4FL3A 5D1JA 4GH2A 3MB6A 4V0GA 4X2JA 3DKOA 4E6CA 3P78A 1SNUA 1H8FA 1SVGA 4AGCA 4DH3A 3LW0A 2E9NA 5B2KA 3RWQA 4EK4A 4IAZA 4O7TA 2X7OA 4M8TA 4XYFA 4F99A 3RPYA 1YOLA 3KFAA 2YCFA 4IC8A 2QI8A 2H34A 4EJ7A 5KHXA 4ACGA 4D5HA 3W0RA 3OY3A 3Q4ZA 3UNJA 3VS6A 5HD7A 4DHFA 2G2HA 3WZDA 2IZSA 3FLQA 2I0VA 3UVPA 5J5TA 5IEVA 4DGOA 5C4LA 2X4FA 2C5OA 5DE2A 4ERWA 4ZTLA 4IJ9A 4DHZA 3AKKA 1RJBA 5KMKA 4LGGA 3PPJA 4M3QA 3R8MA 2HWOA 4ZP5A 5FD2A 4B99A 3FYJX 2H8HA 2WFYA 4K6ZA 4W4YA 3ZC6A 2VZ6A 3SDJA 4E8AA 1NY3A 1J7UA 2A27A 4FTNA 3FL5A 5E92A 3C51A 4U5JA 3MFUA 4QOXA 3QZFA 2CJMA 3QGWA 5EW3A 5HG5A 4YTIA 2X0OA 4XV1A 3LKMA 5IQCA 1M14A 2X81A 4FG7A 4FVQA 4O0TA 3DTWA 1ZYLA 3VRZA 2X1NA 1OKVA 3L8VA 3ZXTA 2I0HA 5TKDA 4BN1A 4DCEA 4C61A 4PMPA 2HY81 4HYUA 5DRBA 2XK9A 2YZAA 1CKPA 3MYGA 4IVAA 1PXPA 4DA5A 2ZVAA 5AJQA 2C5NA 3UMXA 3KXMA 2Y0AA 2R3JA 4LG4A 4XG2A 4FNZA 1OKZA 4KRDA 4EH3A 3WE8A 4FKIA 3NW7A 3O5AA 3OOMA 4FT0A 4MF0A 5KHWA 3F66A 2PHKA 4IWPA 5DLSA 5BVNA 1XQZA 3PFYA 3HX4A 3PXZA 3BV2A 3EN4A 3UTOA 4RG0A 2KULA 3HRCA 3QTSA 3LAUA 3D5WA 2P3GX 5D7AA 4U3ZA 4G2FA 2QOFA 2R3PA 1YI4A 4QMQA 5C1QB 2W0JA 3IK3A 3R02A 4JG6A 3RAHA 2GS6A 2FYSA 4CLJA 2BMCA 2G9XA 3LXNA 2XNBA 4FR4A 4L00A 5CYIA 3ZUUA 2XIZA 3NUAA 4ITJA 4R7BA 3SD0A 4CV8A 4CYJA 4DGLC 1NT2A 1U54A 2GNLA 3VUTA 1G8KA 4MK0A 1FBNA 1J7IA 2NYAA 4D9TA 2XCHA 3AT4A 2B4SB 1WVYA 2FSMX 4I0RA 4A4XA 4DN5A 1OL1A 5DEWA 3F82A 4RIXB 3GC9A 5EQPA 3EZRA 4MQ2A 2QURA 4EQUA 4QQTA 2JLDA 4FT3A 4M97A 3VJNA 3ZSGA 4FSZA 2X8DA 4D0WA 4CMOA 4XMOA 4FV2A 3QA0A 1Q3DA 5HEZA 4AOTA 4F4PA 2XK6A 4F09A 4RFZA 3PUPA 5C26A 3ROYA 1L3RE 3S00A 4AA5A 2VAGA 4EZ3A 3AOXA 5AUYA 3TNPC 3R8LA 3OBGA 2G2FA 4GU9A 3BYOA 3RZBA 2IEWA 3E5AA 5ANOA 1NVSA 2IWIA 3UQFA 3QD2B 3HA8A 4G3FA 4O4FA 3VS1A 3CR0A 3E87A 3GP0A 5IMXA 4NW6A 5FEQA 4PWNA 4QMVA 3KXZA 5G1XA 4DLIA 3VO3A 4YPDA 1PW2A 4ACCA 4RX9A 2QO7A 4CRLA 4QDEA 3CQUA 3EQFA 2WMXA 4LMNA 4G3GA 2NPQA 3R22A 4ASZA 1B39A 3FY2A 4I1ZA 3PWYA 1UU8A 4F7LA 3ZSIA 4XBRA 3TZ8A 2XKDA 2J0IA 3ZMMA 3BX5A 3OBJA 3NFFB 3THBA 1OBDA 3HMPA 5B2MA 5DNRA 5HTIA 1P4OA 4GS6A 2GQRA 2W1IA 5A4EA 4HJOA 3RK7A 2QO2A 2R0IA 1DM2A 4LUDA 4CTCA 3CPCA 4D2VA 3TZMA 3MTLA 3N51A 3NUUA 4QQCA 2HXLA 3HMMA 1SM2A 4P7EA 3NCZA 2QHMA 4YBKA 4BDGA 5LXMA 4FSNA 4O21A 4D2PA 3HA6A 3ORIA 3MFSA 4ZTNA 4IVBA 4WA9A 2F49A 2F2UA 3EN7A 3A4OX 4RWIA 4MXYA 3OCGA 4O6LA 4UY9A 5CTPA 3QQUA 5CLPA 5CAPA 1STCE 2O0UA 4HVHA 3VBVA 4DEEA 2ITWA 5J1VA 1BI8A 2ZV2A 4XJ0A 3PXQA 4YNOA 3B8RA 5L8KA 2NO3A 3DU8A 3D5VA 4X0MA 2CNQA 2R3HA 2WIHA 4RIWB 4BDAA 2PVRA 2C4GA 3DGKA 5CT0A 4KKEA 3I7CA 4FKUA 4HZSA 3FLSA 1SVEA 3C1XA 3ZO2A 5IQDA 3LJ2A 5ANEA 3RP9A 5EH0A 4CFVA 2OJFE 3MVJA 4ANSA 2QO9A 4EKKA 2IJMA 2QG5A 3DK6A 3LFFA 2VTJA 4MNEB 4F7NA 5HG9A 2C6OA 3OROA 2HW7A 3FLYA 3NNUA 1OECA 4QP7A 5D11A 2GDOA 4C4GA 3IS5A 4L8MA 2WQEA 3GCPA 3NYXA 3PG1A 4TN6A 3RMFA 4AZSA 3OWJA 4NM5A 3CKWA 2YITA 4J71A 3U51A 4D4RA 3MH1A 3EQGA 4FA2A 4NL0A 3FC1X 1KOBA 4YZ9A 2OZAA 3BYVA 4KIKB 4FEVA 4YZNA 3ZXZA 1PXMA 4NYEA 1ZOEA 4IM0A 1LUFA 3DOGA 3C13A 3BWFA 1H1SA 5HU3A 4O4BB 4TL0A 2PTKA 4MXXA 1PXJA 3G9LX 3P23A 3WE4A 3BHHA 4KS8A 1Q5KA 5C03A 5A4QA 3BYMA 4D58A 4ZTMA 2WMBA 5IQIA 2EVAA 4FKRA 3KN6A 2XYNA 5E1SA 4BIBA 4L68A 1VYZA 3NAYA 4O0WA 1UWJA 4ZIMA 5I3OA 2NP8A 2ACXA 2BVAA 2JDOA 3ZU7A 5LMKA 4JG7A 4D55A 2UZTA 4ZSAA 5K0XA 2GS7A 4ID7A 3TNQB 2OJIA 3UZTA 5AP1A 3WF5A 4BCMA 4DTAA 3SOAA 4IFGA 2P4IA 1UWHA 3HEGA 4TTHB 5E8XA 3SW4A 5M4FA 4LRKA 2BZHB 4OTQA 4LM5A 3UIUA 3KF4A 4HYSA 1G8SA 4O1PA 4R3RA 2VTHA 2VGOA 5CEPA 2XNNA 3K2LA 4X6RA 4YJQA 5CF5A 2QOIA 3DS6A 4TKSA 4FK6A 3WZUA 5EM5A 4A4OA 1GZKA 4G5JA 2R3MA 5CT7A 4EWQA 5EOLA 4LI5A 2PK9A 5HGIA 2ZM4A 3C4FA 2W1EA 3KVWA 2WTDA 3OWPA 4O2ZA 4OTPA 4EYJA 4FIGA 4MQ1A 5GIPE 1JNKA 3NUSA 3FZTA 4FV7A 1O6KA 4OT5A 1XBCA 3F88A 1Q24A 2FB8A 3DNEA 5IEYA 5DVRA 3TEIA 3ANRA 3QF9A 3W2CA 2I1MA 2C6IA 3GT8A 5M4UA 5CEIA 5E4HA 4PTGA 3DB8A 3D5UA 2C6EA 2GTNA 2VTMA 4FTQA 5AIRA 3ACJA 2HXQA 5TE0A 3VIDA 4Y8DA 5CWZA 5DH3A 4DE4A 1NW1A 2C6TA 1A06A 4Q9SA 4D1ZA 5AEPA 5IQFA 5HU9A 3UMWA 4PDSA 4TW9A 2VO7A 4CG8A 2X0PA 5ANKA 4KS7A 2RKUA 3QTUA 4ACMA 2AC5A 3L8PA 4RX5A 5CALA 2JIVA 2UW8A 2OF4A 3P9JA 2JITA 4GIHA 3AC1A 5LMAA 4JAIA 4ZJJA 4RFMA 4FX3A 4IEBA 5CF4A 3PE2A 2VN9A 5LVLA 4KA3A 4UZHA 5AP2A 4OTFA 3BCEA 2ETMA 2UW4A 4U9AA 3D7TB 3DT1A 2Z2WA 3R2YA 3P86A 4B0GA 3VC4A 3TM0A 4M7IA 2BTSA 4CFFA 1FVTA 3ZZEA 4EL9A 2ZV7A 3O0GA 1W2CA 4TY1A 5JQ5A 1WAKA 3IW4A 3UDSA 4RA4A 5BVKA 1H0VA 3LVPA 3KK9A 3FKNA 3T3UA 2YEXA 4W8EA 4M69B 4XHKB 3FBVA 1YWNA 3GQIA 4N6YA 4NM3A 2CKEA 4A9TA 4I6HA 2AEGA 3CD3A 4A4LA 4HCVA 1KE8A 1OVEA 2OXYA 3R9OA 2XJ2A 1CTPE 3HLLA 1PHKA 2QC6A 2C1BA 5DRDA 3HMOA 3FMLA 1JSVA 2IZUA 3R1NA 5FTGA 2BDFA 3TNWA 5I9UA 1YXTA 1OM1A 4C2VA 3UOLA 2W9ZB 3HMIA 3RAKA 4RMZA 4LOQA 4QMPA 2VX3A 1Q62A 1Y57A 3KGAA 5BVWA 4YZBA 2B52A 4AU8A 4F63A 5A54A 1H26A 3PLSA 3PSCA 5EI2A 3ZFXA 4KNBA 4EH8A 1XH4A 1Q8YA 3QHRA 3QRKA 4IC7A 5HBJA 3FY0A 4QMXA 2ETRA 4U80A 5EHOA 4E5WA 3HP5A 4LGHA 4UALA 2YN8A 3G0EA 4XG6A 4E3CA 3RAWA 4AXEA 4O7ZA 3TG1A 4TRLA 2IW8A 2CNUA 4LL0A 3WILA 1PMEA 4IW0A 3UP2A 3FMEA 1Y8GA 5AP4A 1P4FA 4GG7A 3RHXA 2VWVA 4Z16A 3F5UA 4E4LA 5EK7A 4F64A 4IB3A 3FQSA 5E8YA 4GT5A 1GNGA 1P5EA 4PL3A 4RA5A 1WFCA 5CXHA 5M56A 4S2ZA 4TYIA 3V5PA 2C3JA 4J95A 2Q0BA 2FH9A 4KBKA 5CXZA 4QYYA 4HNIA 2UW9A 1W84A 2PZPA 2R5TA 2O3PA 3FWQA 3MY0A 2EXMA 3DBQA 4KABA 4ERKA 4FTAA 5I9YA 3ZEPA 4M66A 5J9YA 3F3WA 3KF7A 4JXFA 4QP2A 4LOOA 4IH8A 1YXVA 2GCDA 4QTEA 3RAIA 1UNHA 3W0SA 3HV7A 3EQCA 5CU6A 4TT7A 4BTFA 5I9VA 4C0TA 2BFXA 3QC4A 3RBWA 3QX2A 1UU3A 3SG9A 2PL0A 3Q52A 5J79A 3LCDA 4AZEA 2C30A 4J8NA 3DXNA 2WGJA 5D41A 4DH7A 3E3BX 4FV3A 5GJFA 4UWBA 4ZJVA 5EFQA 5M55A 3TMOA 4NM7A 3TWJA 4IX4A 4YC3A 4YJVA 4J53A 3NVMB 4YURA 4FT5A 1RDQE 5AV1A 4BDEA 3R71A 3P79A 4KB8A 4XOYA 4TWOA 3BRBA 3UQGA 1XO2B 3OEFX 4YJNA 5AAEA 5AIKA 4PTEA 3G5DA 3OFMA 4FVRA 2JFMA 4YPSA 4AA0A 3R7GA 3DAJA 1BL6A 3PE1A 1GZOA 2J0MB 3DPKA 4BCKA 4O0UA 4FTMA 3U9CA 3P0MA 4EK5A 4GV1A 3FKLA 3BKBA 1Y6BA 3QALE 4R1YA 5AV0A 3ZTXA 5KBQA 3W55A 3ZLYA 3VUGA 2PUUA 2IZTA 3W2RA 4AP7A 5FXQA 2YACA 1ZOHA 3JR1A 4QEBA 4ZZOA 5AUZA 3BHYA 4TYEA 2JBPA 4FKLA 4O0RA 4C58A 4WUNA 3TCPA 3QKMA 5AP5A 4QP8A 3ULZA 3NR9A 2WOTA 4LUEA 5HLWA 2IVTA 2YIXA 5HNBA 2QG7A 3NPCA 1M52A 3VF9A 2Y7JA 3UODA 2C6KA 4S33A 4GCJA 4CG9A 4FVPA 4UEUA 4JDJA 3ATSA 3Q6UA 3K54A 5KMLA 2C5VA 2BRGA 3G33A 4ZZMA 1ZXEA 5HIEA 5HX8A 2GTMA 4CNHA 3TNIA 2PUPA 3MFRA 4PL4A 4F1MA 2EUFB 4YTFA 4CMTA 3UOKA 4CLIA 3AMYA 2C3IB 4XG7A 1ERKA 5J7HA 2WMQA 3HV4A 4CFNA 4AOIA 4YJRA 4MBLA 2PVYA 5DEYA 5T68A 4BBMA 4QYEA 4EUTA 4I41A 4FKOA 5AAFA 5B2LA 5AM6A 5M57A 3C4CA 2BR1A 3IPHA 4NCTA 3ERKA 4ZY5A 3UDBA 4RJ6A 4L53A 3MSSA 3ZC5A 4EBWA 3IO7A 5J8IA 3D94A 5CF6A 2XJ0A 3QUEA 4FZ7A 5GJDA 2YA9A 2W99B 2A0CX 3ZH8A 4WBOA 3DKFA 4W4XA 3V5JA 2HELA 3F3TA 3IGGA 2OGVA 3MW1A 5LMKC 3CGFA 4NWMA 5F95A 4J1RA 5L2IA 3OEZA 3OG7A 4XBUA 2X9FA 5JQ8A 4AXCA 4FNWA 3E3PA 3NUXA 5AX9A 4ZMFA 3BGPA 1VLRA 2Z7SA 5E8ZA 1O9UA 2J5EA 5KZ0A 5AP0A 3LMIA 4KD1A 5EW8A 5HNGA 4BKZA 4RC4A 3DLSA 4WNKA 5BYYA 5J9LA 3AC3A 4WKQA 3LCKA 5LMBA 3QBNA 5HHWA 4L45A 4TNDA 2Q0NA 3RK5A 4IAYA 4AN3A 1R78A 3QCQA 4FTIA 4I6QA 4O91A 4K77A 1T45A 4OTDA 4MNEA 3L9MA 4TWCA 4TYHA 5CU3A 4BYIA 4YUQA 2R3IA 3UO5A 1OGYA 4HCUA 3OCBA 3MJ2A 3TV4A 4FKVA 4CCUA 4AZWA 3K5VA 1IA9A 2GSFA 2IW6A 4E1ZA 4G34A 3O7LB 1O6LA 4AZVA 3L8XA 3A60A 2G1TA 3FE3A 3PP1A 4JOAA 1YOJA 3OCTA 4CMUA 3RM7A 2UVXA 4QQJA 3WYYA 5IZFA 3UOJA 3QKKA 4U45A 5CNNA 3PVUA 5H8EA 2VTQA 4EOSA 1QL6A 1YOMA 4RWJA 1PXLA 4OR5A 3PY0A 1CMKE 5FM3A 5T6KA 3VW8A 4OT6A 3SG8A 4PP7A 1OGUA 2BPMA 4M0ZA 4EH7A 5KMMA 4A07A 2P2IA 4Y85A 1FVVA 3AGMA 1L8TA 5HE2A 3MI9A 4MCVA 2B54A 4BDDA 4TPTA 3G90X 5TOZA 4S30A 1IRKA 3I60A 3R1SA 5KBRA 3G2FA 4NTSA 4O1OA 3H0YA 3WARA 4YO4A 3R04A 2JC6A 3EQHA 3GU8A 3JVSA 4NZWB 2UZLA 1Q8ZA 2OIDA 4Z3VA 5AA8A 2BALA 2C3KA 4EYMA 3CTHA 4GKHA 4BZOA 1OL5A 1IAHA 3E62A 2BIYA 2Z7LA 3SV0A 4PNKA 3QTXA 4JAJA 1XBBA 2PZYA 4M84A 4G5PA 3POOA 4HYIA 3S4QA 1RE8A 3FUPA 3AT3A 4UMPA 4C3RA 1U4DA 4R7HA 4Z7HA 3W8QA 1JKKA 1Q8UA 5HVKA 1OIQA 5K9IA 3GUBA 4QP9A 3NIEA 1HCLA 4V01A 3QQGA 4WIHA 4I92A 2VWYA 1XR1A 2R7IA 4EOKA 4MXAA 3PSBA 4DEGA 5J5SA 4DHJA 5FTQA 3U6HA 4FL1A 2FSLX 2QOCA 4Y73A 5HX6A 5C8KA 1A48A 4BJJB 2I0YA 3CCNA 4UXLA 5FBNC 4CFXA 3MIYA 3NDMA 4JNWA 3UG1A 2PVMA 3ODZX 4GFOA 4AE9A 4BCHA 3S2PA 1Y6AA 5IH5A 4DF3A 2W4OA 1NVRA 4BL1A 4C8BA 4OLIA 3VBTA 3TI1A 3VQUA 5AA9A 4USEA 4EHZA 4FSMA 4QP1A 5FUTA 3U87A 1M2QA 4G3DA 1MQ4A 2E9UA 4O7LA 4YC6A 3H3CA 3I1AA 2GNGA 4J99A 4TZRA 2YIYA 1LEWA 2XA4A 2ZAZA 5EI8A 4FUXA 5FM2A 1Z5MA 4PDYA 1VR2A 3CTQA 5HI2A 4NH1A 1GIHA 1H28A 1OITA 3Q2MA 4BGGA 4IB0A 1JPAA 4U40A 5AR4A 2X6EA 4ZEGA 2UW5A 2CN8A 3A7IA 4RZWA 1PJKA 4L67A 3ZRKA 3BGQA 2HK5A 3HDMA 5HCYA 2REIA 2XB7A 3SX9A 5K4IA 1A9UA 1GJOA 2W5BA 4FTUA 3PA5A 4ZLYA 2VTNA 2XBAA 3OTVA 4KUJA 3HP2A 3C4ZA 3FZ1A 2F57A 3W33A 5LVOA 1QMZA 1R3CA 2EB2A 2UZDA 4DBNA 3T8OA 5D10A 3D7TA 3DY7A 3FSFA 5DOSA 4U43A 3QQHA 2YIWA 5DR9A 4N57A 4FSUA 3FMKA 4G16A 3TZ7A 3UQCA 3EB0A 2HAKA 3W18A 4G17A 2G15A 4MYGA 4C3FA 3JY0A 4L42A 2PE0A 1RW8A 5KMJA 2ITZA 4ENYA 1TKIA 1G3NA 4S34A 4YHTA 2OJGA 5CNOA 5HIDA 2PUNA 3E92A 4GK4A 4YR8A 4RJ7A 3FEGA 5EKOA 4C4JA 4CFWA 3AC8A 2O8YA 4FV0A 2XP2A 1DI9A 4GMYA 3FKOA 3F9NA 4OGRA 3PVBA 2X2MA 4F0FA 4D5KA 4A9RA 4QPMA 3DV3A 1E1VA 2H9VA 4L46A 4APPA 3FJQE 3BE2A 4JBPA 5DA3A 1YVJA 1FMOE 3A99A 3L1SA 4ASEA 4ZS4A 4FT7A 5EHLA 1BYGA 5AAGA 2RG5A 4YTCA 2XF0A 3TT0A 4BIDA 5KCVA 4E6DA 4EK3A 2GQSA 3JPVA 4H3QA 4C4FA 3MA3A 4FG8A 3BWJA 3WF7A 2C47A 5CVGA 4TWNA 5I0BA 5EM8A 1J7LA 4USFA 4U3YA 3VUDA 2QHNA 4BICA 1M7QA 2IZRA 3I6WA 2JDTA 2PU8A 4BTJA 4O82A 3VAPA 3T3VA 4BWKA 2YFXA 3ZEWA 4YGAA 4C7TA 2JGZA 3I81A 4V05A 4W4VA 4EOQA 2UV2A 5FXSA 4W8DA 4OAUC 3TJDA 4LFIA 3DXQA 2IN6A 4Y95A 3COMA 3O71A 1PKDA 3H9OA 3FZOA 2XAOA 2FSOX 4RVMA 3IKAA 1U5QA 1OL6A 3AMAA 4ZY6A 4IVCA 5HO7A 4UV0A 3FMHA 3NVKI 4KSQA 5T3QA 4RPVA 1TQMA 5EHYA 5IQGA 1ZAOA 3DK7A 4I3ZA 2ZMDA 4ENXA 4NT4A 1YQJA 1ZRZA 3VBXA 4C2WA 2BZKB 1OIRA 2BROA 4TWPA 1KE6A 2UZWE 2W1DA 3QUDA 1U59A 1OZ1A 1WVWA 2RL5A 3LCOA 2WMVA 5JFVA 2R3OA 4RJ5A 3KU2A 1LEZA 1AGWA 3FMJA 3NYVA 3PJ1A 4DC2A 4O83A 5LARA 3FI3A 4BDBA 3TKIA 5E9EA 5EYCA 3WBLA 1YKRA 3V5WA 1V0PA 4DDGA 2XVDA 2FA2A 2UUEA 4N70A 3KXHA 2X8EA 3DFCB 4DYMA 3NZ0A 4LQMA 1Z57A 4XG4A 1NXKA 3BE9A 2VTSA 3R7VA 1ZZ2A 1ST0A 3W0QA 4FZ6A 2Y9QA 3BHTA 2GNFA 2EWAA 4L52A 5H8BA 3R7IA 3MESA 3EQDA 1Q97A 5ETCA 3E8EA 5CQWA 3COHA 5IISA 4CD0A 1XH7A 4ZSJA 5M07A 3GU7A 2VX0A 2ITVA 3PZHA 3QRJA 4FIHA 4GEOA 4RQKA 4W9WA 3QWKA 2YDIA 4EH2A 5I5ZA 4NUSA 3W2SA 4UB7A 4O4EA 4DCAA 1YHWA 1PXIA 1IASA 4NCTC 1KV2A 4OBPA 2EB3A 4JS8A 2W06A 3TZ9A 4PX6A 4BWPA 4J8MA 4C34A 2B9JA 2PVLA 4QYHA 2Z7RA 1WBWA 4AZTA 3FXXA 3PTGA 4PQNA 4RJ8A 4APCA 5IA5A 4DFNA 4XLIA 4RIYB 4MD9E 4AF3A 3ORPA 3R7OA 2PVHA 4MVFA 3ZS5A 3UDZA 5BYZA 5KKRC 4FSTA 4L7SA 2UZVA 4AWIA 4EHVA 2WXVA 1OKYA 1YRPA 4BFMA 2A98A 2LGCA 4F0IA 2XM9A 5LCKA 4E6QA 3OOGA 3R01A 2PZ5A 4NJ3A 1J1CA 4BDHA 2CKOA 3ENHA 3K3JA 2ITYA 3ATTA 1PXKA 1JKLA 1FOTA 3ODYX 2JKKA 3F2NA 2YM3A 3CS9A 4JDHA 5HE1A 3NNXA 4AT4A 5JGDA 5M08A 3QL8A 2J6MA 4RX7A 1ZY5A 5HTCA 2VO0A 3HV3A 3CTJA 4JT3A 3BV3A 5HVYA 4NFNA 4BGHA 2B9HA 2E9PA 2G01A 2VTTA 3LPBA 4YTHA 1ZYDA 4ARKA 2CGUA 4FIJA 4H3PA 1Z9XA 4KKGA 4UXQA 2CKQA 5FEDA 4S31A 4B6LA 2QLUA 3F3VA 4GSBA 3I5ZA 4NM0A 4CEGA 3OP5A 4FNXA 5CX9A 3BU5A 2BRBA 2WU7A 4FKQA 4K33A 1H08A 4CSVA 4MXZA 4O7SA 4JX3A 4I5CA 4CRSA 5CANA 3AD4A 4YNEA 2CHLA 2CLQA 3H4JA 2X9EA 2QODA 5JKGA 4IAIA 4WBBB 4GG5A 5F94A 2YWPA 5TR6A 3TUDA 4Q9ZA 3MH2A 5M53A 3COKA 3QWJA 5H9BA 4FTKA 4EC9A 2QQ7A 2JIIA 3PVWA 3HUCA 2ZDTA 1XBAA 3OMVA 2BRHA 4KBCA 5BVOA 5CEQA 3ACKA 4H39A 4F78A 5J87A 4IIRA 1YXSA 3HVCA 3U9NA 4BCPA 3LLAA 5HD4A 4PDPA 2FGIA 5EKNA 3AXWA 5K4JA 3UIMA 3F3ZA 3E8CA 4DAWA 4EOJA 4H05A 3H9RA 1OL7A 3PYYA 2O2UA 2YM5A 5A4CA 2QVSE 4A06A 5B7VA 1H1WA 2HZIA 2J0KA 4FIIA 5BX0A 2J2IB