4CMUA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor (10r)-7-amino-12-fluoro-1,3,10,16-tetramethyl-16,17-dihydro- 1h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11)benzoxadiazacyclotetradecin-15(10h)-one
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmuA01
1Y91A 3DXQA 5CENA 5AIRA 4WKQA 4UB7A 5IEXA 2W05A 4GT4A 5HU9A 2FYSA 4CT1A 2JKOA 5JGDA 5AP1A 3KY2A 3UVRA 3KEXA 4PMTA 4IVAA 3HEGA 4KKGA 4KBAA 4XV9A 2Y7JA 4W4YA 4BDIA 3NAXA 2CNQA 5M44A 4FL2A 3C4WA 5AUUA 2CLXA 3KL8A 4II5A 1OKYA 2XRWA 4OTFA 2GS2A 2ITOA 4JT3A 3RVGA 5IA2A 1Z5MA 4HCUA 4DFYA 2B4SB 4ZS4A 3REPA 5D11A 4Q2AA 4FIEA 5BX0A 4O7RA 3ZS5A 4FVRA 4YUQA 3T9IA 4FIGA 3FC2A 1Q61A 3OCGA 3AT3A 5GIPE 3TACA 4O0XA 4CMOA 5C4KA 1DS5A 4HNIA 1PXOA 5CVGA 1Z57A 3F3VA 3O7LB 3FQHA 1XH7A 5I4NA 2JITA 3E8NA 3EWHA 4UZHA 3EN4A 3QTSA 3A62A 2FSMX 5DIAA 1YI4A 3F2NA 2WXVA 2WFYA 3O96A 4M68A 4K11A 5DEWA 4ZZOA 1YXSA 5K4IA 3E8CA 2A2AA 3G0FA 4O0TA 3DAEA 2HAKA 2C6OA 3CBLA 4IAAA 3AMBA 5IEYA 4JL9A 4A9TA 1JWHA 2Y6OA 3W18A 4IDVA 3MGYA 4FKRA 3QXPA 3R2YA 3WZEA 4F7LA 4O7SA 3PPJA 4C62A 4F99A 1T45A 4C35A 5AIKA 4IAKA 5FRIA 3OY3A 4D58A 3R8UA 4F0IA 2QOBA 3O0GA 4BBMA 4FKVA 3EQGA 4FT5A 3GXLA 5EKOA 3QTQA 5AP3A 3V5PA 3FLSA 3ZLXA 1IA8A 3IQ7A 4KA3A 2YAKA 2ZDUA 3ENMA 4BL1A 3BCEA 2C6LA 3NYXA 2X8EA 1E9HA 2WOUA 1YRPA 3FWQA 2YCSA 3C4ZA 5HG7A 5FM2A 3LFDA 4HGTA 4O7LA 4AZFA 2BFXA 4I1ZA 3UQGA 1JKTA 3QTRA 4R3CA 4V04A 2VWYA 5ETFA 5AR2A 1FINA 3UP7A 4N4SA 4P5QA 4NKSA 4EJ7A 4ZSJA 4F0GA 4AE9A 2CGVA 3IKAA 4IZAA 5G6VA 1H8FA 3BKBA 4CMUA 2X7OA 4FL3A 4OTWA 2EXCX 1KE9A 3C9WA 3EZRA 3E8EA 4GMYA 1M17A 3DJ6A 3MH0A 5BVWA 2PVMA 2X81A 1SVHA 4FTNA 5ANIA 5I9YA 3L1SA 3ORMA 4DGMA 4FZ7A 3EFKA 5M4UA 4D4RA 2RFSA 2GNGA 2WEVA 3JVSA 1FOTA 3TUDA 3D5WA 3UC3A 5H3QA 1LEZA 3QCSA 4JDJA 2VTSA 2XJ2A 4E6CA 3FKNA 3CJGA 4W8DA 2A1AB 3A7FA 4A4OA 4DEBA 2YCRA 5AR5A 4FV5A 2V55A 2Z2WA 3VS4A 5DI1A 5AUWA 5HE2A 3WF8A 4ZEGA 2CN5A 2W0JA 4IJ9A 2QNJA 2XIRA 5B2LA 2UZUE 2W9ZB 4LGDA 4MD9E 5LVOA 2AC5A 2UVYA 1RJBA 5LARA 2G2HA 3WYYA 3HDNA 3NRMA 2O65A 4QPAA 4EH4A 3QUPA 3ORXA 5I0BA 4OLIA 4NL0A 3QRIA 1U59A 5DR6A 3RAIA 4O0WA 4ASDA 3HL7A 1BUHA 1XR1A 3R7VA 3ZFMA 4V05A 4D4SA 3Q9ZA 5KMMA 5E90A 2R2PA 4WT6A 3D4QA 1TQPA 4PMMA 3RJCA 2YISA 5AA8A 4N70A 4U43A 4Z7GA 4FTCA 3VS1A 3GP0A 1J1CA 4FMQA 4IQ6A 3UVPA 3QGYA 4C8BA 5M4CA 1SMHA 5DA3A 3UC4A 3VBQA 3II5A 4G1WA 3PLSA 4QP9A 5ANJA 3E63A 4XBRA 1PXJA 3P23A 4PP9A 2OSCA 4I0SA 2VV9A 5E8YA 3R8MA 5C03A 3DA6A 3MFUA 1OM1A 4TYGA 4YJPA 2W99B 4ZTRA 2ZM3A 2SRCA 5BVNA 2EWAA 5AUXA 2YDKA 3ET7A 2KTYA 4QYHA 4FGBA 4CV8A 3UE4A 4WIHA 5GZAA 4D0XA 5FD2A 1JAMA 1BL6A 4ENXA 4F9BA 3RPRA 4FNYA 2F49A 2KULA 2RFEA 2C5XA 2WTWA 4C4JA 4JJRA 4NU1A 2FH9A 2AYPA 5CF6A 1YXXA 5EM5A 4A9YA 5B2KA 3CKWA 2Y6MA 3HMOA 3PRIA 4KIQA 4EBVA 4ACMA 1BI8A 5C8NA 3VRYA 3OFMA 1LPUA 2VD5A 3EYGA 3NAYA 4L8MA 1IAJA 1CDKA 3MJ2A 4FT3A 1OIYA 4BDGA 1PJKA 1P4OA 2W5BA 2Y9QA 4I6HA 2XNNA 4K9YA 5CZIA 2C0OA 3BHUA 3I0OA 4WHZA 3IONA 2UZEA 4J7BA 4L9IA 4FTLA 1H1WA 4DC2A 2X6EA 5M53A 4YO4A 3FJQE 3DLSA 4QD6A 5HE1A 1I44A 4G3EA 4UWCA 5CU2A 5ANGA 2W1HA 3I0QA 4D5HA 3UO6A 4QMQA 3DB6A 4CT2A 4NT4A 4ANQA 3FI3A 3RM6A 3FL5A 3DV3A 2OXYA 5HE3A 2YLEA 1OKWA 5HVKA 3R8VA 1U4DA 1Q5KA 3ORZA 4C61A 3WE8A 3ZHPC 3HV7A 2ETKA 4PL3A 3LXNA 4HVHA 4AOIA 1KE8A 1ZZ2A 2UVZA 3GQLA 5IZFA 3UOJA 4X3FA 5HNGA 4EHVA 3ANQA 4O7NA 3BE9A 5JFXA 4S30A 3FPQA 4U3YA 4H36A 2ACXA 3F3ZA 2OJIA 4I6QA 3G0EA 3MPMA 2XYUA 3F2RA 4IX3A 2P2HA 4NM0A 2XK4A 3MH1A 5EW8A 4IWDA 4DTKA 2G2IA 3ENHA 4FSWA 2ITNA 5H8GA 5A4CA 3OD6X 1SVEA 5BVKA 3NIZA 5FBOA 3GI3A 3FZRA 3U87A 1LR4A 3KXXA 4XX9A 4DF3A 4W9WA 4G9RA 3CSVA 4JVGA 2P0CA 3QUEA 3S3IA 3QQFA 3ODZX 2BIKB 4FG7A 2ZB0A 4J53A 1GZNA 5DH3A 3WI6A 3NUNA 2QO9A 2F4JA 3D7ZA 3S1HA 2GSFA 4FEWA 3HMMA 5EOBA 4BR3A 3SLSA 3L9NA 2ZDTA 4GW8A 2YM3A 3F5UA 4FV7A 4PF4A 2C6KA 4BTFA 1H0WA 5IA5A 2X0GA 2XNEA 4EQMA 2H6DA 2REIA 4YC3A 2R64A 4GFMA 3QYWA 4X3FB 5B7VA 3MFTA 1J7IA 4FK6A 4MHAA 3VVHA 4YZCA 3D5UA 3A4OX 3P0MA 4XG9A 4Y83A 4EEVA 3TZMA 5AJQA 4OAUC 2GNIA 4GK2A 1WVYA 1REJA 5DT4A 3NYNA 3QQHA 4IAIA 1OL5A 4Y85A 4BF2A 4G34A 4L53A 5BVOA 4K18A 4QMVA 3D5XA 2G9XA 4DEEA 4XG4A 5DR2A 5EYCA 2E9OA 4NCTC 4ZLOA 3MH3A 4EWHA 2B9IA 5L6PA 2VO6A 4JX7A 3PXYA 4RIYA 4ZZMA 4KB8A 4AAAA 5HLNA 1PRYA 3DBEA 3LQ3A 3NUAA 1BKXA 4M8TA 5CZHA 2YFXA 4ARKA 3EQDA 3ROYA 5DN3A 2WMXA 4YJRA 2I7QA 4O38A 2I1MA 4KD1A 3AC3A 3DQXA 3QRJA 4ALWA 4YZ9A 2PULA 2WIPA 3JS2A 2X4ZA 2QG7A 5EDPA 1GIHA 5KNJA 5FEEA 5L2WA 3D9VA 3AC2A 3IW6A 4ASZA 5J87A 4XP0A 3MVLA 4DEAA 3C4EA 3R00A 1PXIA 5JEBA 4WUAA 3K3IA 1UKIA 3I81A 3UQCA 1XH5A 2BRHA 2ITVA 3OWKA 4KRCA 4FEQA 2NRYA 1UU9A 3I6WA 4LFIA 2YIYA 4IH8A 4K1BA 2J6MA 2JD5A 4D55A 3UIBA 4FNZA 2PVFA 4UV0A 5DWRA 2Q83A 3BX5A 2B7AA 3PPZA 4O86A 3I4BA 4TW9A 5IMXA 4QYFA 3R9OA 4HZSA 2YZAA 3GU6A 5AV1A 5IDPA 3EQHA 3EQFA 3B2WA 4J8NA 2C6IA 2CGXA 4FV1A 2PL0A 4OTQA 1GY3A 5KBQA 5ACBC 5KX8A 3KXMA 4H3BA 5A3XA 3DXNA 2VWXA 3UYTA 3NR9A 4EI4A 3KF7A 4RIYB 4QPMA 2XIXA 4KIOA 3FMMA 3QZIA 4LM5A 2VTLA 4HOKA 4M12A 4MXZA 5AR3A 5CAVA 1JBPE 4YBKA 1V0BA 4QMWA 3H9OA 3NNUA 2C6TA 4N6YA 4R5YA 4WBBB 5IH6A 3COKA 3HMNA 4HW7A 3KF4A 4NM5A 3GC8A 4DG3E 4EC8A 4O27B 2RG5A 4ERWA 3TDWA 5KE0A 3NSZA 4YSMA 5EG3A 4FKQA 5JT2A 3GC0A 4Q9SA 2GNFA 5FXRA 4PX6A 3EH9A 3NWWA 3WZKA 3F7WA 1Q62A 2IZUA 3F3WA 4AE6A 2C3IB 3QLFA 3ZZEA 2ZB1A 4ID7A 3PJ2A 1O6KA 4B4LA 5K5NA 4V01A 1GJOA 4NUSA 1RW8A 4FV8A 3BYOA 3VW8A 4AT5A 5J5TA 2GCDA 5KO1A 1OIQA 3C1XA 4J8MA 2Y0AA 3DQWA 5CU3A 4QT1A 2HXQA 5E8WA 3PFQA 2O64A 4MNFA 3D15A 5EDRA 3TUBA 3AOXA 3LLAA 4FKJA 4L3LA 4O6LA 2G15A 4F9CA 2GU8A 4Y5HA 2LAVA 4KINA 5KCVA 4HVSA 5IUIA 5GZ8A 3FDNA 5HGIA 2YN8A 2QOLA 4FZ6A 5J9ZA 4O82A 3VHEA 3ZXZA 5M57A 1K3AA 4I20A 3TKUA 4FTRA 3NVKI 2OU7A 4C4HA 4F6UA 2CKQA 2WHBA 3ZDUA 4B0GA 3BELA 2R7BA 2YZLA 4DE4A 5FUTA 2EXMA 4RFMA 4AACA 2UZTA 3PIYA 5CEQA 1PXKA 4AFJA 3KRXA 4DFLA 3PWYA 2QONA 5CNNA 4GK3A 5CSHA 2PUPA 3R1QA 2BTRA 2PE2A 4AW5A 1YOJA 2VTRA 3GENA 5JKGA 4QQCA 2OZAA 2BTSA 2H9VA 2CCIA 2V5QA 4D1SA 4GRBA 1M7NA 5L4QA 1PKDA 4NJDA 1WAKA 4KS8A 4ALVA 4DEGA 4FG9A 3NZ0A 2A0CX 3GFEA 4JQ8A 4TNBA 4R7HA 3DGKA 3OXTA 2VO3A 2XM8A 4FZAB 2QODA 4MD7E 4LV5A 4NFMA 4Q5EA 4RJ7A 3UNZA 3OBGA 4DYMA 4EYMA 2OFVA 3PJ3A 3QL8A 2YWVA 4D28A 4FUXA 3VF8A 5CF4A 2ZV7A 5BUJA 3U6IA 4F0FA 3ZUTA 5DLSA 2ITZA 4FC0A 3W1FA 3LCDA 3QD2B 2W5HA 1ERKA 2F7EE 2ZM1A 3HV3A 3LE6A 4IB5A 3F3UA 3JVRA 5ETAA 5AUZA 4FIFA 4D2WA 4UMRA 3FMKA 4IVCA 4WSQA 5DHJA 4G6LA 2CJMA 4IHPA 4OBQA 4O7TA 2OICA 4FTUA 2W1ZA 5JH6A 5DOSA 1NY3A 4APPA 4FV4A 3Q3BA 4IIRA 1YHVA 5KZ0A 5JK3A 4ANMA 2O63A 2WQBA 4RFYA 3FXWA 1P5EA 1XH8A 3OROA 4BI2A 3LFNA 4L42A 4GUBA 3Q4ZA 4I5MA 2R3GA 3PY0A 2GFCA 2VWBA 3PIXA 4AA0A 3BU6A 5TE0A 3CEKA 3IGOA 1SZMA 4PRJA 4TYHA 4FNXA 4RJ4A 2OZAB 3IGGA 3THBA 3PP1A 3POOA 4YPDA 5M07A 3TNHA 3F3TA 3FY0A 3KRJA 4U40A 2XK3A 4O0VA 3R83A 1V0OA 2V0DA 5ETCA 3V04A 4AGWA 1PXLA 3ANRA 3EL7A 4UMPA 4FEVA 4J1RA 2UW4A 1Y8GA 4I6FA 1QCFA 5AWMA 3I5NA 4E4LA 5IQAA 5HD4A 4ZY6A 3R63A 3ORKA 4FIJA 3OW4A 3DXPA 3ZSHA 3TZ9A 4FV2A 3WIKA 4L3PA 1U46A 4E5WA 5CSPA 4AGCA 2JIVA 1PKGA 3OEZA 4N57A 4XV2A 3R30A 5DE2A 2BCJA 3C7QA 4B8LA 2QOIA 5LWNA 3GUBA 4RT7A 5EW3A 2ITUA 4G5PA 1URCA 1A9UA 4QP3A 4YJSA 5E7RA 3R8LA 4E4NA 3GQIA 1IRKA 3UTOA 3QWJA 2VO0A 5F1ZA 1ZMWA 4DA5A 4IAZA 3F6XA 4EOOA 4BZNA 3QCXA 1GZKA 2HOGA 3ZU7A 4YJUA 2QKWB 3QQLA 3BLQA 5KZIA 4ERKA 4C4GA 4TYHB 5LXMA 5HIEA 3A61A 2RFDA 4BYIA 2E9PA 3PWDA 5HNBA 3BYVA 1ZY5A 2RKUA 4AW1A 1KE5A 5HICA 3CQUA 3QBNA 4FZFB 2OO8X 4ZSEA 3LFQA 4Y72A 3AMYA 1AD5A 3VO3A 3JPVA 2BKKA 2C6EA 1PMVA 4FYOA 4XG8A 1CMKE 3NLBA 4C57A 5JMSA 2QOQA 3BWJA 3OXZA 3WOWA 2GFSA 3AD6A 4LL0A 2ZVAA 4PPCA 4FK3A 4R3PA 4YU2A 2CSNA 4XV3A 4CZTA 2Y8OA 4IE9A 4DCEA 4AN3A 5AV4A 2CCHA 3VJNA 1H01A 4YPSA 3HAMA 3WF9A 4I21A 4EH6A 4M0YA 4M13A 4KKHA 3H0ZA 3NX8A 4AN9A 2R4BA 5I3RA 3GEQA 3O7LD 4FSRA 4CVAA 2C5NA 2P4IA 2WZJA 4RPVA 1SVGA 4CQGA 4XG2A 1OL1A 3EOCA 1YDTE 4R8QA 3AT2A 4RZWA 4WA9A 4DH7A 4BCKA 3U55A 4L68A 3FL4A 3LXLA 3ZBXA 4BY9E 3LFBA 1AQ1A 2P55A 2Z8CA 2BDWA 4FGRA 3FMNA 4IWPA 4QQ5A 3DAJA 2OWBA 3Q5IA 4RBLA 4BIBA 5JFVA 2OLCA 4HJOA 4M7IA 4NCTA 4YGAA 3BBTB 3WIGA 2QU6A 2YM5A 2WQMA 1NT2A 2JDVA 2QD9A 3EL8A 4KAOA 5EM6A 4E4MA 3VW6A 4F4PA 2QOKA 5J79A 1OBGA 1XBAA 2WTIA 4QP8A 4BGQA 2W17A 3BYSA 3OW3A 4IWQA 1VYZA 2HZIA 3A7IA 1ZYDA 4PMSA 4YLJA 3U4WA 1WBSA 2Q0NA 2O5KA 5FEQA 2F7XE 3LJ0A 3ZYAA 5LCJA 3UYSA 1SNUA 3NGAA 4AP7A 5CAUA 3VUTA 4YHJA 3FMLA 3FZTA 4ZXTA 2RSVA 4O0YA 1HOWA 1AGWA 1H1RA 4OTRA 4ZJIA 3ZLYA 4YBJA 2R3LA 4CGAA 5DVRA 3Q2MA 5TR6A 2PZIA 2XA4A 1YOLA 2IZTA 4BCHA 3ZCLA 3HVCA 3OY1A 1QPCA 3UPZA 3AC4A 3HP2A 1S9JA 5A54A 5EYDA 1PMNA 1O6LA 3UGCA 4DH3A 3SD0A 1YHSA 4YLLA 1KSWA 3PA3A 4RX7A 4UXQA 4IVDA 3KN5A 2W5AA 3F5PA 2QO7A 1CSNA 3D83A 4BYJA 3W10A 5KUPA 2E9UA 2X9EA 3P1AA 4WSYA 5DFPA 3LFAA 3OP5A 4FKPA 2VN9A 4JQ7A 4KABA 2W06A 3W2SA 3MPTA 4GUEA 4QRCA 2UZOA 1ZOEA 5ACKA 2JKQA 3H4JA 2C30A 3ZSGA 4AA4A 4YTFA 5A6NA 1SYKA 1WMKA 2QC6A 4WRSA 4I5CA 5F9EA 5FQDC 4M0ZA 3TNPC 1PYXA 4E20A 4EK6A 1WBTA 4RRVA 2IO6A 4F6WA 3UNJA 4L44A 4TWNA 4C0TA 4C4EA 3PG3A 4C34A 4F9AA 5DMZA 4MEDA 5IQGA 4CFFA 1B38A 3Q6UA 4C3FA 2BDFA 4JX3A 1ATPE 3A60A 4C4IA 3CY3A 1JSVA 3DBQA 4BDBA 1K9AA 4E6QA 4G3FA 5DR9A 2OZOA 2V62A 3FHIA 4GG5A 2JGZA 3DNEA 3I60A 2Z7SA 3COHA 4TN6A 3FQSA 5BYLA 3G6GA 4PWNA 4QYEA 2NNWB 4DT8A 1F5QA 3BV2A 4FSNA 4G6NA 4QOXA 4L6QA 3OUNB 2YAAA 4LOOA 1JSTA 3VJOA 3UG1A 5BPYA 3Q9WA 3VF9A 2OW3A 3OHTA 3Q04A 2C1AA 3Q9XA 5EH0A 2BZHB 5IQDA 3K2LA 3RHKA 5DT0A 2J51A 1IR3A 2XBJA 3SX9A 2XZSA 3TV7A 5IH5A 1YQJA 4IZYA 4KNBA 3NS9A 3QAME 5CEKA 3BE2A 3S95A 1FMKA 4C2VA 4P4CA 2OBJA 3W33A 2PVLA 1XQZA 4NW6A 1XBBA 4YJVA 3ZC6A 2PYWA 3LM5A 3E7OA 4DGNA 2WTKC 3FMHA 5AAGA 2E9NA 4X0MA 3R7OA 4CYJA 3ZO4A 1NXKA 5L6WL 4LMNA 4IX6A 2WB8A 3DJ5A 3ULZA 5AX3A 4BGGA 4FYNA 1WVWA 1QPDA 2Y4PA 3VUKA 3L9LA 5CNOA 2ZYBA 2PK9A 5IQCA 4RFZA 4YTIA 4EWQA 3C0HA 1UU7A 4NTSA 3PXFA 4UWBA 5BYZA 5CASA 2VX0A 5HG8A 4QMPA 2BAQA 2EXEA 4L46A 2XKFA 1JQHA 3KFAA 4Z3VA 3K5UA 4D0WA 1I09A 3QX2A 4MH7A 3ZOSA 3TNIA 3P7AA 4FTTA 3FAAA 5E8TA 2XIYA 3MB6A 5CF5A 3DS6A 4OBOA 3IDBA 3UZPA 4EH5A 5LQFA 2GS6A 3CXWA 4HVIA 4A4XA 5HIDA 4F9YA 4ACHA 4TY1A 4JR7A 4DEDA 2ZAZA 3AXWA 4ZTSA 3MPAA 3ZM9A 4FKWA 1IAHA 3GU4A 4GKIA 3QZHA 4X6RA 3LAUA 3VWAA 3FLWA 3SKCA 2YJRA 3PVUA 4RVTA 1DI8A 3TXOA 4BDHA 3EN9A 3PRFA 1WZYA 4ZTQA 3SOAA 2CNUA 3BEGA 4U5JA 3BV3A 2C3KA 4U42A 5HBEA 5L2TA 4UY9A 3FMEA 5IUGA 3CLYA 1BI7A 3GB2A 2PTKA 2OJ9A 4JS8A 4TRLA 4TYIA 1H08A 4NH1A 4O7YA 3IG7A 3QX4A 4ITIA 1M7QA 3A2CA 3V5WA 3PSCA 3VS0A 4HGSA 4CMTA 5E8UA 2UZVA 3QUDA 1Q8TA 5A46A 1KOBA 5IQBA 4E4XA 2X8IA 1Q8UA 5TOZA 4GK4A 1OECA 5HX6A 4YNOA 2WMBA 3P5KA 3Q52A 3R8ZA 4CKIA 3LLTA 4O2ZA 2ZV2A 3MVMA 1JLUE 5HEZA 4FTMA 4J71A 1JVPP 3COIA 4G6OA 4WUNA 4EOJA 1CKIA 3G2FA 5E8XA 2WPAA 4BVUA 4WG3A 3LMGA 1JKKA 2JDRA 4CTBA 4OGRA 3CKXA 4DGGA 4X6QC 2W1FA 4ANNA 4D4VA 3F82A 5CU4A 2B55A 3KXGA 4FTAA 2XK7A 1M52A 5BVFA 2OF2A 4X2KA 4MD8E 4AW2A 3CCNA 3FBVA 3FQEA 4AZSA 1Y57A 4O84A 2C5VA 2VWVA 2B52A 5E1SA 5I9ZA 4LOQA 4IJPA 5F4NA 1MUOA 5G1XA 3VAPA 3DOGA 4FOCA 4BZOA 4DEIA 3GCSA 4F7NA 1CTPE 4HYSA 4XP3A 2QO2A 3ACJA 3LXKA 4AZWA 4BWKA 3QC9A 4IAYA 3OT3A 4R3RA 2XJ0A 2NPQA 2I0HA 3HA6A 3IW7A 4AZTA 5CALA 3JUHA 2A27A 1B6CB 4F70A 4FV6A 5HO7A 4E6AA 4QQJA 3BHTA 5IF1A 2PPQA 4TXCA 5AEPA 3NIEA 3BHVA 5EI8A 2HWOA 1KV1A 2JIIA 4A9SA 4FVPA 4PNIA 4DHFA 1P14A 5JFSA 3JR1A 4H3PA 4U44A 3UPXA 4BHNA 4BZDA 2J0KA 2UW0A 3C0GA 5HNIX 2XCKA 2IPXA 2FGIA 4HVDA 5IQEA 4ZK5A 5AUVA 4K33A 2G1TA 4BGHA 4P7EA 5KHWA 2R3QA 3CC6A 4BDJA 1H1SA 4D9TA 5HOAA 2W1IA 3QTZA 1H00A 2OJFE 5J8IA 4IANA 5CU6A 2JC6A 5EHOA 5GJGA 1U5RA 4YZBA 4E3CA 5FP5A 3R1SA 4WBOA 3C51A 2I6LA 2CHLA 4YNEA 3LFSA 5EFQA 4BDKA 4EBWA 3RMFA 2WOTA 3MYGA 4FKUA 3G15A 3DKOA 4EKLA 1MRYA 3EQPA 2FUMA 2W1GA 3GOKA 2XCHA 5FM3A 3SXSA 4NTTA 2YM4A 4FL1A 4CFWA 4XEYA 2WKMA 3ZRKA 1CM8A 2WMUA 4XG7A 2UUEA 5FLFA 3F69A 2XKEA 3FKOA 4RIOA 1FQ1B 3IK3A 1UA2A 2BHHA 4C36A 3IW8A 1H1QA 2YITA 2NRUA 4QP1A 5CVFA 3CP9A 2J50A 1ZRZA 2B54A 1MQBA 4NYEA 3R7YA 4BCFA 4DT9A 3R7EA 5CEIA 2R3KA 3NUYA 4F08A 5KMIA 1GIJA 4FICA 5F95A 5IG1A 5E91A 1H1PA 4W4WA 3CE3A 2H96A 5ANOA 2OIDA 4UMQA 2GHGA 1YXUA 4O1OA 1U5QA 3MN3A 4UYNA 1JPAA 3POZA 4KIKA 1W83A 3KRLA 3VIDA 2PMOX 1FPUA 2UVXA 4LG4A 5H8EA 1A48A 3TNQB 4NJ3A 1RQQA 4EH7A 3FYJX 4XUFA 5AAFA 1YI6A 4C7TA 4MBJA 4NKAA 4CV9A 2ITQA 2ONLC 3NW6A 3PP0A 4EUTA 3W2RA 1ZAOA 1OL7A 2XK8A 4IXPA 4JXFA 3QTWA 3ZO3A 2BKZA 1XH4A 3LFEA 4MQ2A 4NZWB 3LQ8A 2WQNA 3MDYA 4W9XA 4BBEA 4D5KA 2IW9A 4QTDA 1RE8A 4A06A 5AX9A 2C3JA 3HZTA 2B1PA 3OG7A 3QLGA 4IACA 4F63A 3KXHA 3SA0A 1PXPA 5JSMA 3AGMA 4C3RA 3R2BA 4MAOA 3DLZA 3NNXA 4M14A 3TIZA 3W55A 4CRSA 2F9GA 3WZDA 4Z55A 3FE3A 5EHLA 4GV1A 4FG8A 1PF8A 2ZM4A 3SOCA 3PJCA 4MXAA 2ITPA 3MV5A 4EOSA 2ETMA 4PQNA 5JQ8A 3BIZA 3UOKA 1NVSA 4MXYA 1BYGA 3LKMA 1OUYA 3ZSIA 1B39A 3EHAA 2PWLA 3OT8A 1H24A 4MX9A 3QYZA 2XIZA 3FUPA 4FI1A 4CTCA 3BYMA 3UVQA 4ZJVA 4KIKB 4MQ1A 2OIBA 3C50A 4ONAA 4C38A 1BX6A 3V3VA 1OIUA 5FGKA 3U6JA 3GU5A 4U41A 4AUAA 3HV4A 3GVUA 4GU6A 4ZTHA 4ZY5A 5FBNC 4ZSLA 3DFAA 4PMPA 4A7CA 4BHZA 4MBLA 1ND4A 3GCVA 3MWUA 3OZ6A 2BVAA 4DTBA 5CEPA 2YCQA 1GZOA 4X2JA 1W84A 4JDHA 1MRVA 1ZYCA 3IDCA 4YC8A 4GS6A 4FSQA 3FPMA 3HLLA 3AD5A 2FVDA 3D2KA 4FSTA 3VS2A 4RWLA 4BC6A 3EN7A 4B99A 3UMWA 4AZEA 2X2MA 1XKKA 5AV0A 4MXXA 4QMZA 5FTGA 3RK5A 3O71A 1YHWA 5L2IA 2Z02A 4UMTA 4N6ZA 2OFUA 4QMNA 1K2PA 3ZXTA 3AC1A 4GIIA 1KOAA 4QMMA 3VNTA 3MTFA 3U4UA 2BDJA 2VNYA 5C4LA 1O9UA 5C01A 4B7TA 2CPKE 3F88A 3MBLA 5EQYA 4IZ7A 3UP2A 3S00A 4LQMA 3GCQA 4W4VA 2IVSA 1H0VA 4GT5A 5JN2A 5E8VA 4JLCA 1PXNA 3QKMA 3R71A 2UZWE 1Z9XA 3I7CA 4YHFA 5JGAA 2AUHA 3QHWA 4KBKA 1GOLA 3CD3A 2QU5A 3I5ZA 3QCYA 4RC3A 2QHNA 4BCOA 4C2WA 4QQTA 2C68A 2CKEA 5C8MA 4L7SA 4YZDA 3SW7A 5AM7A 1WBWA 5K0KA 3DCVA 4QMTA 5AR8A 1NVRA 2O0UA 3OMVA 5D1JA 2WTJA 1UU3A 4CG8A 4TYJA 4ZAUA 4NEUA 3PIZA 4GL9A 3DK3A 3DKGA 3MVJA 1XH6A 1JNKA 4IDTA 3RM7A 2A19B 2WTKB 4HYHA 2F2UA 1G8AA 5ANEA 2W1EA 3JXWA 4RJ3A 1REKA 3EIDA 3Q5ZA 2XB7A 5M4IA 1L8TA 4OUCA 2CGWA 3QQJA 3E7VA 2PVYA 4JRNA 2VNWA 2YHVA 3R04A 4IB0A 4ITHA 3IOKA 4IX5A 5JFWA 2FSLX 4F7SA 3O8TA 2VWUA 4F09A 5HD7A 1TKIA 3RWPA 4EOKA 5E92A 4HZRA 4E6DA 3P86A 5AADA 5HQ0A 2BAJA 4KRDA 2XUUA 3DFCB 3KB7A 2X2KA 2EU9A 3UZRA 5CTPA 3UBDA 3MVHA 4XS2A 2YCFA 5CAPA 3O50A 3BEAA 4FT7A 3TUCA 3MY5A 4PDYA 3N4VA 1F3MC 2HK5A 3NUXA 3ZRLA 4YJOA 3AG9A 3G9LX 1GIIA 4R77A 2ZMCA 3L8SA 1VYWA 3A7GA 3MJ1A 4EOIA 3OCSA 3EQCA 4XH6A 4BKYA 3O2MA 2WELA 2BPMA 3CJFA 4D1ZA 5C26A 2Z7RA 2JIUA 5CANA 5CAOA 4RJ8A 4XRLA 4QP7A 4Q9ZA 2P2IA 2JDTA 3MIYA 4LRKA 3R21A 5CYIA 5EOLA 4BWPA 4D2SA 3ZM4A 4DH1A 3WARA 5EW9A 4GEOA 1ZYSA 1WVXA 2XM9A 3KCKA 1DAYA 3RGFA 4GSBA 3T8OA 3UIUA 1ZWSA 3O17A 3ZLSA 3RCDA 2PUUA 4RA4A 3TT0A 2O2UA 4LGHA 4PP7A 4M66A 4O0RA 1UNGA 1V1KA 3LMIA 2UW6A 4GCJA 3Q4CA 3FLNC 3Q96A 4J99A 3KMWA 5DNRA 3E3PA 2DUVA 3UIMA 4LUDA 3U8WA 3VBVA 4AU8A 4DG0E 5DRDA 2OJGA 3MFSA 3RPYA 5IKWA 5M09A 2XIKA 2I0VA 1BMKA 2UZLA 3HECA 4AOTA 3BLRA 3VUDA 4BFMA 4EH8A 1YKRA 3FLZA 4BBFA 1KE7A 4C4FA 4RVLA 2PE0A 4IX4A 2HWPA 1CKPA 2RG6A 4ACDA 1KV2A 4CZUA 2HZNA 2NP8A 4FVQA 4MXCA 5GZ9A 4U8ZA 3SDJA 3SAYA 3VUHA 4WNPA 4E26A 2WMAA 5T68A 5AMNA 4L45A 4O21A 2J2IB 2AC3A 2XJ1A 3FZSA 3PUPA 4J52A 3G51A 2B9HA 4I4FA 2VU3A 4LV8A 2UW5A 3ERKA 4HPTE 4B8MA 3SRVA 2W4JA 1STCE 4P5ZA 4DLJA 4J96A 3ID6C 3ROCA 3TJDA 2GNHA 2WIHA 2YERA 3ELJA 4KKEA 5AP2A 4BCJA 4USEA 3GNIB 2XMYA 5CEOA 4YR8A 1XH9A 3QRTA 4IM3A 2C1BA 4RGJA 2BHEA 2HELA 4H05A 2X8DA 3SV0A 3VBTA 4ASXA 2B0QA 2ETRA 2JBPA 2OF4A 3GU8A 2J90A 2QCSA 3RWQA 4YJTA 5BVDA 1UKHA 1Q8WA 5EM8A 3DDPA 4ZIMA 3SXRA 5K5XA 5KMKA 3AGLA 4XCUA 4QNAA 5CAQA 4RWIA 2RL5A 2XKCA 4FODA 2R3NA 4RA5A 4DITA 2QLQA 5F94A 4CCUA 4PDSA 1UU8A 3F9NA 4I0TA 3EQBA 3UZTA 4FSYA 5L6OA 4CFVA 4XBUA 5HVYA 4AT3A 4XRJA 3VUIA 5CS6A 2I0EA 4CKJA 3QF9A 4M3QA 3BLHA 2W4OA 5EQEA 5BMSA 2CLQA 4CD0A 4GJ2A 3OEFX 3OXIA 3S4QA 4AZVA 5GINE 4MVFA 2EB3A 3W2CA 4M97A 1SM2A 3DJ7A 4JRVA 3ZZWA 4CYIA 3L9PA 3SRVB 4QYGA 4GFOA 3V5JA 3TEIA 3W2QA 1FVRA 5LVMA 2YDJA 3K54A 4D2VA 4XYFA 1M2PA 4DTAA 4FT0A 4KSPA 3CGOA 2C0IA 5DBXA 2ONLA 3PXRA 4QNYA 4G3CA 2VTHA 1J1BA 3LCOA 3LFFA 4FZDB 3MESA 4I5PA 2WO6A 4H58A 1IG1A 5IA1A 4A4LA 1TQIA 4AG8A 3P7CA 3V6RA 4F64A 3MFRA 4ZTLA 3QZFA 3LJ1A 2R5TA 3SC1A 2WMTA 4ZJJA 1ZLTA 1XWSA 1VJYA 4BB4A 4QMXA 4O81A 3OWJA 3EKNA 1PMUA 1ZMVA 3Q32A 4NW5A 4ZTMA 4F1OA 2C4GA 3CTHA 4ZTNA 2ITTA 5D7VA 3EJ1A 3V51A 3PVGA 3HMPA 2J0IA 3FY2A 2UW3A 3HA8A 3VS6A 1H07A 2GS7A 3HDMA 5F20A 4Y95A 3BPRA 4C37A 3GFWA 3I7BA 2QOFA 5J5SA 3BU3A 3PA5A 2QLUA 4NFNA 3LOKA 2VUWA 3D14A 3RPSA 5E8SA 2E9VA 1ZXEA 3E93A 3LCKA 4DINA 3W32A 3LCTA 3OUKA 4D1XA 5A4QA 2UZNA 3TJCA 4F6SA 1P4FA 3CY2A 3DKFA 5A14A 5J7HA 4K77A 3HYHA 3VRZA 2LGCA 5C27A 2YM8A 2ZV9A 4O7ZA 4ORKA 3ULIA 4MWIA 1E1VA 3FLYA 5AP7A 2QURA 2WMWA 4JBVA 4YURA 4FKTA 4P2KA 3R9HA 5HTBA 3C0IA 3TNWA 1DI9A 1YOMA 3RNYA 2DS1A 1FMOE 5LWMA 3OC1A 1WFCA 1O6YA 3IO7A 3C13A 4GVAA 4UMUA 3FXXA 2F57A 4FKOA 4EHZA 2C5OA 4EK3A 3LM0A 4IEBA 4DGOA 4GG7A 3RNIA 2OKRA 4MWHA 1KUTA 1NW1A 2UV2A 2PVHA 3R7IA 4BIDA 3ALNA 4H1JA 1QMZA 4BCIA 2P3GX 1PMEA 1F0QA 3R1NA 4RJ5A 4AGDA 5EI6A 4FNWA 1G5SA 3LW0A 1OITA 3A7JA 1J7LA 5CU0A 3TM0A 1FVTA 3IECA 3ACKA 2PZPA 3R28A 5CSWA 5IISA 4QMUA 3RAWA 4U45A 2R9SA 5GHVA 5ICPA 4IB1A 4S31A 4O6EA 4UX9A 1ZYJA 2E2BA 2HY0A 2FB8A 2XNMA 4GIHA 4JDIA 2I40A 4BI1A 4CFMA 5GJDA 3RK9A 2WGJA 1M2RA 3UQFA 4EORA 4UYAA 3ZTXA 1DM2A 3QC4A 2JKMA 4DFBA 1Q3DA 4UXLA 3G9NA 2WAJA 5H8BA 4JAJA 2RGPA 3RP9A 4GJ3A 5A4TA 5IH4A 3ZO2A 2RFNA 2JFMA 3GOPA 4APCA 3DAKA 3SHEA 2VGPA 3ZEPA 4XOZA 2YWPA 4EK8A 2ITXA 3BHHA 4DGLC 3R7UA 2OXXA 3T3VA 1JOWB 3LCSA 1ZY4A 3ZEWA 4LI5A 2VTJA 4JIKA 2WEIA 5L2QA 4EZ3A 1YWVA 3IW5A 3RZFA 1R39A 3MA3A 1H4LA 4LGGA 1XHAA 3UMXA 1LP4A 4DBNA 1BLXA 3ZFXA 1GZ8A 3DBFA 4XHKB 4R78A 3NEWA 1OKZA 3GC7A 2BILB 2IZSA 4RG0A 2BALA 5ETIA 2QVSE 5AA9A 2OIQA 5KMJA 5IPJA 3F5GA 3RZBA 4UALA 4FEUA 2PVRA 4RWJA 2ESMA 4MNEA 5J1VA 3U54A 2O3PA 3PVWA 3G33A 4FOBA 5J9YA 5KMNA 1Q3WA 4O91A 1LUFA 4H1MA 1PXMA 4DH5A 3F5XA 3SG8A 3HP5A 4X21A 3MTLA 5AP0A 1URWA 4F1MA 4LL5A 4GVJA 3P79A 3VUGA 4EZ7A 4IW0A 3SXFA 2BRBA 3P7BA 4TT7A 3AMAA 1HCLA 4PTGA 2B53A 3FC1X 5AM6A 5LJJA 3BGPA 4HYIA 4USDA 1FGKA 2XEYA 3QXOA 5TO8A 3CTQA 1PYEA 3UODA 1YWRA 2XK9A 3D5VA 3QTUA 3VBYA 2VTIA 3VBWA 4K8AA 4J98A 2Z7QA 3F61A 4RC2A 2VX3A 4HGLA 4QP6A 2BRNA 2P33A 4UBAA 3TV4A 4Q5HA 3ALOA 1QL6A 3CR0A 4FV0A 3WF6A 3PY1A 1S9IA 4YTCA 5LMKC 5HCXA 4S2ZA 3WF7A 4KBCA 4LUEA 4BKJA 3OVVA 4U3ZA 5KKRC 3WBLA 2PHKA 3TZ8A 2WNTA 3UO4A 2QI8A 5HTIA 2ITWA 2JFLA 2YM7A 4IMYA 3QA0A 3ZBFA 3Q6WA 4D4YA 1H26A 2VX1A 3W8QA 4MNEB 4MTAA 3RBWA 4IFGA 2FSOX 3V6SA 3W2PA 3E8DA 3PA4A 2WTVA 2FSTX 3L9MA 4QPSA 4Y46A 3UOLA 1UNLA 2GPHA 2I0YA 4L67A 1YVJA 4AS0A 3EFLA 5CX9A 2XEZA 5FDXA 4QP2A 5LMAA 3PLAE 2RIOA 4R5SA 2CNVA 4OT5A 4I0RA 4I94A 3A8XA 3ZLWA 2VRXA 3FZOA 5HI2A 4FSUA 3NYOA 5HESA 4O2PA 4BN1A 2O8YA 3C5UA 5D12A 4CLJA 5M55A 4ZSGA 4EOPA 5IA0A 4CCBA 4JIAA 4OT6A 1NVQA 4FF8A 4GT3A 5CI7A 3FYKX 4GFGA 2BAKA 4IM0A 4TYEA 4V0GA 1OZ1A 2HZ0A 3HUBA 4G31A 4A9RA 5J9LA 1KWPA 3ODYX 4RSSA 4PV0A 4RIWA 2J0LA 2PVJA 2OJJA 3PPKA 1WBVA 2BZKB 2QR7A 4WRGA 1XBCA 2DWBA 1XJDA 4YJQA 3QQUA 3SQQA 5JQ5A 4OTPA 4X7QA 4LRJA 5BYYA 4EH3A 2JLDA 5AP6A 4QTCA 1Q8ZA 4ACGA 1OVEA 5AAEA 4AFEA 2BMCA 2OXDA 4C3PA 1Q41A 2W7XA 3IW4A 1OL2A 3BQCA 3KA0A 4FTQA 3FKLA 4IVBA 4DFNA 3MSSA 2VTMA 4LOPA 3M42A 4LYNA 3KCFA 3HRFA 3W16A 5M08A 3B8QA 3SVVA 1U54A 3OS3A 3FHRA 4JQEA 2XYNA 2GMXA 5CEMA 3B2TA 3IS5A 4TWOA 4L3JA 3N4UA 2IW6A 3QQKA 2UW8A 3ITZA 3NNWA 4I22A 4AT4A 1MQ4A 4GYGA 5FP6A 4V0GB 3VQUA 4BTMA 4FSZA 4IFCA 4ZZNA 3NUPA 4NM3A 2PZ5A 5J1WA 5TT7A 5DRBA 3A8WA 2IZRA 3FZ1A 3Q4TA 3NW5A 2GHLA 3EFJA 4RIWB 3ZFYA 3R02A 5EQPA 1Q97A 5CY3A 4QTAA 4AF3A 1PHKA 3QHRA 2WTCA 1ZYLA 2G01A 4NM7A 4PPBA 5IU2A 4OTGA 3WILA 2VGOA 2EB2A 4ZMFA 5BMMA 5L8KA 4YZMA 2CMWA 4HPUE 4U9AA 2QHMA 3KU2A 4BRXA 2GQRA 4YMJA 3R1YA 3E87A 2VAGA 2WQEA 3FV8A 2HIWA 4BCMA 3BI6A 4H3QA 1U54B 3G6HA 4U79A 4CNHA 3T3UA 4FEXA 3ORIA 4X2FA 4K6ZA 1DAWA 4EYJA 3WF5A 2BRGA 3PXZA 3OBJA 2CGUA 4HCTA 5IQFA 4YTHA 4MF1A 4U7ZA 4WNKA 5EYKA 4YZNA 5HHWA 5L8JA 3FXZA 1PY5A 5CVHA 4C33A 4QTEA 4I24A 3QKLA 4PL4A 2CN8A 4TKSA 2PVNA 3COMA 3C5IA 3DNDA 4RVMA 3DT1A 2BROA 1WBOA 4QO9A 4UWYA 2VZ6A 3FZPA 3KXNA 3V5QA 4ALUA 4CZYB 5E8ZA 4ASEA 3N51A 2W96B 3OTUA 5FWKK 1FBNA 3H0YA 2BZJA 3MH2A 5FTQA 3CS9A 4FIHA 3R22A 4YO6A 3MA6A 5EI2A 2QOCA 4AGUA 3CQEA 4WNOA 5AR4A 2BFYA 4MKCA 3MS9A 5I3OA 3K5VA 5A9UA 4PNKA 2C3LA 3WZUA 3ORLA 5A4LA 4IB3A 4L43A 4CFUA 3KVXA 4BTJA 3GGFA 4YHTA 3VS7A 4XOYA 2OH4A 5DG5A 1OIRA 3PZEA 3V8TA 1WCCA 5IQHA 4M67A 3CQWA 1Q8YA 5J7BA 3DK6A 3H9FA 3LZBA 5CT0A 4JG8A 2IVVA 3R6XA 5TF9A 4XMOA 3KREA 4AW0A 1CKJA 1UVRA 3TIYA 4EL9A 2VO7A 4CG9A 2NO3A 3NPCA 4XG6A 3UIXA 3HX4A 5ITAA 2CKPA 4U81A 4E93A 4S34A 2VTNA 3IPHA 2IVTA 4FIIA 2OG8A 2QG5A 5HCYA 4C59A 1OBDA 4HGEA 2IG7A 3H10A 2VTTA 2YLFA 3D0EA 3LPBA 5GIOE 4WD5A 4G2FA 1T46A 3LIJA 4EQUA 2RF9A 3QQGA 2PUNA 4E8AA 1VZOA 4IC7A 3TI1A 5AUTA 3CPCA 5K0XA 3KK8A 4FV3A 4RC4A 4MYGA 3BWFA 1MP8A 5CLPA 3U6HA 2BR1A 3KRRA 4AXAA 4CFXA 4FE2A 3E64A 4UEUA 3KVWA 5EK7A 4ANSA 1Y6AA 2WQOA 2X4FA 4FX3A 3FI4A 5I5ZA 1V0PA 4B9DA 5M4FA 3DU8A 5CQWA 4IZ5A 5D9HA 3ZUVA 4ENYA 3NMUF 4Y5QA 3GCUA 4E5AX 4HVGA 3MI9A 4S33A 3HNGA 4PY1A 1BL7A 4J95A 1OPLA 3DBDA 3KULA 2IJMA 2XH5A 2XNGA 3OWLA 4PUZA 4QTBA 1UV5A 3RINA 3RALA 4XP2A 3TKIA 2UW7A 4LMUA 2VTPA 4U6RA 5BUEA 4FA2A 4P90A 4K0YA 4BDAA 4JNWA 5HTCA 3KQ7A 2C6MA 4AOJA 2C47A 2DQ7X 3I79A 4IADA 2V7AA 3SG9A 4FTKA 2EUFB 2Z60A 4ITJA 5GJFA 4DFUA 4I23A 4TWCA 4DLIA 4U97A 2GNLA 4RLLA 1IA9A 4X2NA 4FTOA 4R1VA 4WO5A 3PTGA 1YXTA 4C02A 3ZMMA 3TZ7A 4BI0A 1H27A 3AQVA 2J0JA 4G3GA 5LVLA 5FXQA 3BU5A 1Y8YA 3QD3A 3T9TA 4KS7A 4D9UA 4OR5A 5DT3A 1MRUA 5KBRA 3QRKA 4HYUA 4FUYA 3U9CA 4DAWA 3QGWA 2X6DA 3PXQA 3TCPA 5BNJA 5BQ0A 1YW2A 5AFVA 4DN5A 1UWHA 3U51A 4GKHA 4RLKA 5HIBA 4MF0A 3EB0A 2Y4IC 5M51A 4L01A 2HZ4A 4I6BA 4MBIA 4EQCA 2IVUA 5HLPA 3VULA 5FTOA 3W8LA 5HE0A 1KE6A 2UZBA 3KULB 5LMKA 1H28A 4Z16A 3S2PA 1XO2B 4ZLZA 3HV6A 3NYVA 5HZNA 2C5YA 4G5JA 3MIAA 3ORTA 3LVPA 5HKMA 5DGZA 3AC8A 3TV6A 4KIPA 5H9BA 5CQUA 3DDQA 4Y8DA 3V8WA 3S0OA 3QKKA 3HGKA 4YP8A 2R3HA 2J5EA 2C69A 3HUCA 3R9RA 2ZOQA 4ZLYA 3C4XA 4YSJA 4IM2A 4EOLA 4NIFA 5HO8A 4EKKA 2HENA 3M11A 4FT9A 4EOQA 4RX8A 1OPKA 3GU7A 4CFNA 3VC4A 5CF8A 2HW7A 2W1CA 1TVOA 4HCVA 4L00A 4XNEA 2FO0A 1YWNA 3CTJA 3HV5A 4G17A 2X1NA 5CXHA 1G8SA 3P78A 1UWJA 3ORPA 4F7JA 2YIXA 3LJ2A 1R0EA 2HXLA 1YI3A 4I5HA 4AQCA 5HG9A 5HG5A 4WG4A 4CXAA 4WOVA 4JG7A 3IDPA 3KMUA 2XBAA 3Q9YA 3C4CA 2EVAA 3LHJA 3HMIA 4NSTA 1R1WA 3ZRMA 4DH8A 3HAVA 3NW7A 2JDOA 4ANBA 3HKOA 4FTIA 4BKZA 5D41A 1OGUA 2HYYA 4ACCA 5KKRB 5L2SA 3EQRA 3AT4A 5M06A 2Z7LA 3SW4A 1YDRE 3ZONA 3LMHA 3H9RA 4O22A 2R3PA 3EMGA 4FKSA 4X2GA 5ANKA 2XRUA 1ZZLA 3GT8A 3HRBA 3ORNA 2GTNA 4NIFB 5DPVA 4BCNA 5IA3A 4BDFA 4EHEA 4FV9A 3DBCA 4L7FA 3ZUUA 1ZMUA 2ERZE 4QMOA 1L3RE 5HLWA 2YIWA 3ETAA 1J91A 4XJ0A 4OTDA 1APME 3E92A 3O51A 3TG1A 3CGFA 3RTPA 4W8EA 3PSBA 3QD4A 1YDSE 3A7HA 4JAIA 4D2PA 1QPEA 2W1DA 4OAVB 2YABA 4HNFA 4BDDA 1Q99A 4IC8A 3NDMA 3RAKA 3M1SA 3QRUA 2R3JA 3C4FA 4M84A 3JY9A 3Q4UA 3FMDA 3G5DA 4BTKA 1TQMA 4YC6A 4AWIA 3UG2A 3RI1A 4ZY4A 4RX5A 4L52A 2GTMA 2HCKA 2WMSA 4I41A 5JZNA 2YM6A 5I9UA 2HW6A 2OH0E 2YIQA 2WMVA 3DK7A 4DCAA 2XVDA 5LCKA 2QOHA 2WTDA 4JI9A 1OL6A 4FBXA 4Z7HA 5E9EA 4FSMA 3WZJA 5DYJA 4UZDA 4TL0A 3BGZA 2IWIA 2ITYA 4A07A 2X7GA 3RPVA 4DFZE 4EK4A 3NUUA 3E3BX 4R7IA 4Z9LA 5A4EA 5K9IA 3DY7A 3NVMB 1FVVA 4O96A 3BBWA 3LXPA 2JAVA 3N9XA 5HBHA 2ZV8A 1LEWA 4I3ZA 3DKCA 3OF0A 3VS3A 1W8CA 4D2TA 2X9FA 2PU8A 1IASA 3TKHA 3QFVA 5BVEA 4AX8A 1OPJA 1Y6BA 3D7TA 4F1TA 3V8SA 5IEVA 3ZC5A 4XV1A 3GBZA 3OCBA 3G90X 4H39A 3FSFA 2PZRA 3O8UA 5FXSA 3RK7A 1J3HA 3DB8A 3Q53A 4EH2A 4N0SA 5ANDA 4I93A 4CSVA 5AP5A 3EKKA 1JSUA 4M69A 3DTCA 5D10A 2W4KA 3EN6A 4OTIA 5KMLA 4EUUA 3FEGA 2PMLX 4BWXA 3E88A 3BHYA 5I9XA 1Q4LA 5I9VA 4EK5A 5EKNA 3QTIA 4IWOA 4O1PA 4I4EA 5CXZA 3MW1A 3QA8A 2BIYA 4JR3A 3VQHA 2GDOA 3RKBA 2X2LA 3KMMA 3P9JA 4PPAA 2CKOA 2F7ZE 2OK1A 5H2UA 5CT7A 1R0PA 3H3CA 4CRLA 5HX8A 2J5FA 2XF0A 2PUIA 2R7IA 4RQKA 3PE1A 1W7HA 4RJ6A 5HBJA 4BICA 4RMZA 3V01A 1A06A 3PDTA 5CSXA 4PTCA 3PVBA 5K3YA 4MCVA 5CWZA 4A9UA 2HY81 3BRBA 4FKLA 4BCPA 3V5LA 3FI8A 5GNKA 2PSQA 3I1AA 1ZOGA 2B9JA 3UNKA 5LOHA 5BUIA 5TKDA 2F2CB 2R3IA 3DZQA 2WMQA 3KKVA 3ZO1A 3P08A 3CD8A 2VWIA 3PY3A 1M14A 4CEGA 2A4LA 1UNHA 1RDQE 3D7TB 3BYUA 3IOPA 3CPBA 3VS5A 5HORA 4XLVA 4ZP5A 4NK9A 2G2FA 2VWZA 2XS0A 3TL8A 3UDBA 1VR2A 3CIKA 2QR8A 2PVKA 2YJSA 4M69B 4PL5A 4EZ5A 3QU0A 3BGQA 3TWJA 5FDPA 3VUMA 3WE4A 5M56A 1IEPA 5JZJA 3R9DA 2WD1A 2ERKA 2JAMA 3K3JA 3LQ5A 4FKGA 5L3AA 4KSQA 4E5BA 1VEBA 5AV3A 3P4KA 5CSVA 2B9FA 1PW2A 3AD4A 2WMRA 3NNVA 3DPKA 4GH2A 4KWPA 2R3RA 2GQGA 4G3DA 4RVKA 5CI6A 4DEHA 4UN0C 4RIXA 4E1ZA 3MY1A 5EDQA 4EOMA 4EJNA 3FLQA 1M2QA 1P2AA 2BRMA 3KC3A 4R6VA 4K2RA 1FGIA 4EONA 4WG5A 4DG2E 5KMOA 3TN8A 3QTXA 4JDKA 3DTWA 5B0XA 3PE2A 1R3CA 4G9CA 3R0TA 2JEDA 3GC9A 3OCTA 2QQ7A 4ZS0A 2BZIB 2QOOA 1SNXA 2V22A 1W82A 4O0SA 2H8HA 2R3FA 3BQRA 3DZOA 4PDOA 5T3QA 3L8XA 4QYYA 1R78A 3RHXA 2W9FB 4R7BA 1WBPA 1QPJA 4YJNA 3A99A 4QMYA 1ZARA 2IN6A 3O23A 4W4XA 3Q2JA 3EN5A 4RX9A 4Y73A 3EQIA 4F65A 3NUSA 2JKKA 4FKIA 4I92A 3PJ1A 5AUYA 2OGVA 2WU6A 3R9NA 4MK0A 2QKRA 5DEYA 3OOMA 4F9WA 3M2WA 3E5AA 2PY3A 3KK9A 4XLIA 4BIEA 4JG6A 3ATTA 2JBOA 3JYAA 3PZHA 3F7ZA 3F66A 5LVPA 2X7FA 2XK6A 3N4TA 4BCGA 4RZVA 3R8PA 3OOGA 3E62A 4RIXB 1H25A 5HU3A 4OTHA 3L8PA 4KUJA 3R73A 3ATSA 4NWMA 4S32A 2DYLA 3VN9A 3PJ8A 4CKRA 2XNOA 4ANLA 2ZMDA 5T6KA 3LFCA 4JBPA 4C58A 4BDCA 4E7WA 4O7VA 2YDIA 4O83A 1YXVA 3RCJA 4TPTA 4B6LA 2IW8A 5L8LA 4MXOA 3QCQA 2VWWA 3KN6A 4TTHB 1JKLA 3VBXA 3KGAA 3KXZA 5E1EA 3QALE 5LVNA 5IQIA 2R0IA 1EH4A 2PMNX 2PZYA 4M15A 5J95A 3RAHA 3AC5A 2WU7A 3W2OA 3HRCA 5E4HA 2VTOA 1W98A 5IUHA 2FA2A 4DFXE 3OTVA 4EHGA 4X3JA 4GYIA 3EFWA 5FG8A 1GNGA 2XP2A 5LMBA 5C9CA 3QZGA 1OB3A 4LRMA 2X39A 3QWKA 1Q24A 3R7GA 2BUJA 3KRWA 5EM7A 2OI4X 2GQSA 3NCGA 3I6UA 2H34A 2UZDA 4R1YA 5C8KA 3FMJA 1WBNA 5AP4A 3Q60A 4GU9A 2XNPA 3BZ3A 4ZMEA 3PXKA 4FR4A 4QMLA 4ZOGA 3OWPA 1GAGA 4AN2A 2J7TA 3EYHA 3F2AA 3QD0A 4YLKA 3O8PA 3ZH8A 4JBQA 5HCZA 2R3MA 3RPOA 3TTJA 4U0IA 4J97A 3UJGA 3WYXA 4BDEA 2C0TA 2J0MB 5HO6A 2Y4IB 4OW8A 3SGCA 5JRQA 2GNJA 4WNMA 4IAFA 5AV2A 2YACA 3H30A 5IDNA 3MB7A 3EZVA 1OI9A 2YIRA 2JDSA 4G16A 2UW9A 2YA9A 3PG1A 2XNBA 3JY0A 4BCQA 1W0XC 4ANOA 2V7OA 3FI2A 3PSDA 2C6DA 3D2IA 3V5TA 4CQEA 4D2RA 2CDZA 4RQVA 1ZOHA 4RWKA 1NA7A 3U9NA 2VTAA 3A4PA 4IBMA 5JRSA 3TTIA 1J7UA 5AR7A 2XKDA 5HVJA 3D94A 4JOAA 5KHXA 4X3FC 3MY0A 2YEXA 3UOHA 5EHYA 4PDPA 5C1QB 4XG3A 5I9WA 3L8VA 4AA5A 1X8BA 2VTQA 5B2MA 5JGBA 4CLIA 2R0UA 3R01A 4EH9A 4DBXA 4E73A 1JKSA 3GCPA 4QMSA 4PTEA 5A6OA 1G3NA 2ZJWA 1OUKA 5EYMA 1OKVA 4FTJA 2Q0BA 4TWPA 3ZDIA 2J9MA 3NCZA 4QP4A 4ZSAA 5D7AA 3TDVA 1E1XA 5IA4A 4TNDA 3FSKA 2PMIA 3UO5A 5IMEA 4EC9A 1HCKA 3PYYA 2PE1A 4JBOA 2GHMA 1OMWA 4O0UA 5K4JA 2R3OA 4U80A 4OBPA 2J4ZA 5FEDA 4USFA 3VHKA 4O7WA 4TZRA 3B8RA
chains in the Genus database with same CATH superfamily
1Y91A 3DXQA 5CENA 5AIRA 4WKQA 4UB7A 5IEXA 2W05A 4GT4A 5HU9A 2FYSA 4CT1A 2JKOA 5JGDA 5AP1A 3KY2A 3UVRA 3KEXA 4PMTA 4IVAA 3HEGA 4KKGA 4KBAA 4XV9A 2Y7JA 4W4YA 4BDIA 3NAXA 2CNQA 5M44A 4FL2A 3C4WA 5AUUA 2CLXA 3KL8A 4II5A 1OKYA 2XRWA 4OTFA 2GS2A 2ITOA 4JT3A 3RVGA 5IA2A 1Z5MA 4HCUA 4DFYA 2B4SB 4ZS4A 3REPA 5D11A 4Q2AA 4FIEA 5BX0A 4O7RA 3ZS5A 4FVRA 4YUQA 3T9IA 4FIGA 3FC2A 1Q61A 3OCGA 3AT3A 5GIPE 3TACA 4O0XA 4CMOA 5C4KA 1DS5A 4HNIA 1PXOA 5CVGA 1Z57A 3F3VA 3O7LB 3FQHA 1XH7A 5I4NA 2JITA 3E8NA 3EWHA 4UZHA 3EN4A 3QTSA 3A62A 2FSMX 5DIAA 1YI4A 3F2NA 2WXVA 2WFYA 3O96A 4M68A 4K11A 5DEWA 4ZZOA 1YXSA 5K4IA 3E8CA 2A2AA 3G0FA 4O0TA 3DAEA 2HAKA 2C6OA 3CBLA 4IAAA 3AMBA 5IEYA 4JL9A 4A9TA 1JWHA 2Y6OA 3W18A 4IDVA 3MGYA 4FKRA 3QXPA 3R2YA 3WZEA 4F7LA 4O7SA 3PPJA 4C62A 4F99A 1T45A 4C35A 5AIKA 4IAKA 5FRIA 3OY3A 4D58A 3PUFC 3R8UA 4F0IA 2QOBA 3O0GA 4BBMA 4FKVA 3EQGA 4FT5A 3GXLA 5EKOA 3QTQA 5AP3A 3V5PA 3FLSA 3ZLXA 1IA8A 3IQ7A 4KA3A 2YAKA 2ZDUA 3ENMA 4BL1A 3BCEA 2C6LA 3NYXA 2X8EA 1E9HA 2WOUA 1YRPA 3FWQA 2YCSA 3C4ZA 5HG7A 5FM2A 3LFDA 4HGTA 4O7LA 4AZFA 2BFXA 4I1ZA 3UQGA 1ST0A 1JKTA 3QTRA 4R3CA 4V04A 2VWYA 5ETFA 5AR2A 1FINA 3UP7A 4N4SA 4P5QA 4NKSA 4EJ7A 4ZSJA 4F0GA 4AE9A 2CGVA 3IKAA 4IZAA 5G6VA 1H8FA 3BKBA 4CMUA 2X7OA 4FL3A 4OTWA 2EXCX 1KE9A 3C9WA 3EZRA 3E8EA 4JMQA 4GMYA 1M17A 3DJ6A 3MH0A 5BVWA 2PVMA 2X81A 1SVHA 4FTNA 5ANIA 5I9YA 3L1SA 3ORMA 4DGMA 4FZ7A 3EFKA 5M4UA 4D4RA 2RFSA 2GNGA 2WEVA 3JVSA 1FOTA 3TUDA 3D5WA 3UC3A 5H3QA 1LEZA 3QCSA 4JDJA 2VTSA 2XJ2A 4E6CA 3FKNA 3CJGA 4W8DA 2A1AB 3A7FA 4A4OA 4DEBA 2YCRA 5AR5A 4FV5A 2V55A 2Z2WA 3VS4A 5DI1A 5AUWA 5HE2A 3WF8A 4ZEGA 2CN5A 2W0JA 4IJ9A 2QNJA 2XIRA 5B2LA 2UZUE 2W9ZB 4LGDA 4MD9E 5LVOA 2AC5A 2UVYA 1RJBA 5LARA 2G2HA 3WYYA 3HDNA 3NRMA 2O65A 4QPAA 4EH4A 3QUPA 3ORXA 5I0BA 4OLIA 4NL0A 3QRIA 1U59A 5DR6A 3RAIA 4O0WA 4ASDA 3HL7A 1BUHA 1XR1A 3R7VA 3ZFMA 4V05A 4D4SA 3Q9ZA 5KMMA 5E90A 2R2PA 4WT6A 3D4QA 1TQPA 4PMMA 3RJCA 2YISA 5AA8A 4N70A 4U43A 4Z7GA 4FTCA 3VS1A 3GP0A 1J1CA 4FMQA 4IQ6A 3UVPA 3QGYA 4C8BA 5M4CA 1SMHA 5DA3A 3UC4A 3VBQA 3II5A 4G1WA 3PLSA 4QP9A 5ANJA 3E63A 3O5AA 4XBRA 1PXJA 3P23A 4PP9A 2OSCA 4I0SA 2VV9A 5E8YA 3R8MA 5C03A 3DA6A 3MFUA 1OM1A 4TYGA 4YJPA 2W99B 4ZTRA 2ZM3A 2SRCA 5BVNA 2EWAA 5AUXA 2YDKA 3ET7A 2KTYA 4QYHA 4FGBA 4CV8A 3UE4A 4WIHA 5GZAA 4D0XA 5FD2A 1JAMA 1BL6A 4ENXA 4F9BA 3RPRA 4FNYA 2F49A 2KULA 2RFEA 2C5XA 2WTWA 4C4JA 4JJRA 4NU1A 2FH9A 2AYPA 5CF6A 1YXXA 5EM5A 4A9YA 5B2KA 3CKWA 2Y6MA 3HMOA 3PRIA 4KIQA 4EBVA 4ACMA 1BI8A 5C8NA 3VRYA 3OFMA 1LPUA 2VD5A 3EYGA 3NAYA 4L8MA 1IAJA 1CDKA 3MJ2A 4FT3A 1OIYA 4BDGA 1PJKA 1P4OA 2W5BA 2Y9QA 4I6HA 2XNNA 4K9YA 5CZIA 2C0OA 3BHUA 3I0OA 4WHZA 3IONA 2UZEA 4J7BA 4L9IA 4FTLA 1H1WA 4DC2A 2X6EA 5M53A 4YO4A 3FJQE 3DLSA 4QD6A 5HE1A 1I44A 4G3EA 4UWCA 5CU2A 5ANGA 2W1HA 3I0QA 4D5HA 3UO6A 4QMQA 3DB6A 4CT2A 1TFFA 2IF8A 4NT4A 3FI3A 3RM6A 4ANQA 3FL5A 3DV3A 2OXYA 5HE3A 2YLEA 1OKWA 5HVKA 3R8VA 1U4DA 1Q5KA 3ORZA 4C61A 3WE8A 3ZHPC 3HV7A 2ETKA 4PL3A 3LXNA 4HVHA 4AOIA 1KE8A 1ZZ2A 2UVZA 3GQLA 5IZFA 3UOJA 4X3FA 3BLAA 5HNGA 3W0PA 4EHVA 3ANQA 4O7NA 3BE9A 5JFXA 4S30A 3FPQA 4U3YA 4H36A 2ACXA 3F3ZA 2OJIA 4I6QA 3G0EA 3MPMA 2XYUA 3F2RA 4IX3A 2P2HA 4NM0A 2XK4A 3MH1A 5EW8A 4IWDA 4DTKA 2G2IA 3ENHA 4FSWA 2ITNA 5H8GA 5A4CA 3OD6X 1SVEA 5BVKA 3NIZA 5FBOA 3GI3A 3FZRA 3U87A 1LR4A 3KXXA 4XX9A 4DF3A 4W9WA 4G9RA 3CSVA 4JVGA 2P0CA 4I6LA 3QUEA 3S3IA 3QQFA 3ODZX 2BIKB 4FG7A 2ZB0A 4J53A 1GZNA 5DH3A 3WI6A 3NUNA 2QO9A 2F4JA 3D7ZA 3S1HA 2GSFA 4FEWA 3HMMA 5EOBA 4BR3A 3SLSA 3L9NA 2ZDTA 4GW8A 2YM3A 3F5UA 4FV7A 4PF4A 2C6KA 4BTFA 1H0WA 5IA5A 2X0GA 2XNEA 4EQMA 2H6DA 2REIA 4YC3A 2R64A 4GFMA 3QYWA 4X3FB 5B7VA 3MFTA 1J7IA 4FK6A 4MHAA 3VVHA 4YZCA 3D5UA 3A4OX 3P0MA 4XG9A 4Y83A 4EEVA 3TZMA 5AJQA 4OAUC 2GNIA 4GK2A 1WVYA 1REJA 5DT4A 3NYNA 3QQHA 4IAIA 1OL5A 4Y85A 4BF2A 4G34A 4L53A 5BVOA 4K18A 4QMVA 3UDZA 3D5XA 2G9XA 4DEEA 4XG4A 5DR2A 5EYCA 2E9OA 4NCTC 4ZLOA 3MH3A 4EWHA 2B9IA 5L6PA 2VO6A 4JX7A 3PXYA 4RIYA 4O4DA 4ZZMA 4KB8A 4AAAA 5HLNA 1PRYA 3DBEA 3LQ3A 3NUAA 1XMMA 1BKXA 4M8TA 5CZHA 2YFXA 4ARKA 3EQDA 3ROYA 5DN3A 2WMXA 4YJRA 2I7QA 3VONA 4O38A 2I1MA 4KD1A 3AC3A 3DQXA 3QRJA 4ALWA 4YZ9A 2PULA 2WIPA 2XARA 3JS2A 2X4ZA 2QG7A 5EDPA 1GIHA 5KNJA 5FEEA 5L2WA 3D9VA 3AC2A 3IW6A 4ASZA 5J87A 4XP0A 3MVLA 4DEAA 3C4EA 3R00A 1PXIA 5JEBA 4WUAA 3K3IA 1UKIA 3I81A 3UQCA 1XH5A 2BRHA 2ITVA 3OWKA 4KRCA 4FEQA 2NRYA 1UU9A 3I6WA 4LFIA 2YIYA 4IH8A 4K1BA 2J6MA 2JD5A 4D55A 3UIBA 4FNZA 2PVFA 4UV0A 5DWRA 2Q83A 3BX5A 2B7AA 3PPZA 4O86A 3I4BA 4TW9A 5IMXA 4QYFA 3R9OA 4HZSA 2YZAA 3GU6A 5AV1A 5IDPA 3EQHA 3EQFA 3B2WA 4J8NA 2C6IA 2CGXA 4FV1A 3AKLA 2PL0A 4OTQA 1GY3A 5KBQA 5ACBC 5KX8A 3KXMA 4H3BA 5A3XA 3DXNA 2VWXA 3UYTA 3NR9A 4EI4A 3KF7A 4RIYB 4QPMA 2AQXA 2XIXA 4KIOA 3FMMA 3QZIA 4LM5A 2VTLA 4HOKA 4M12A 4MXZA 5AR3A 5CAVA 1JBPE 4YBKA 1V0BA 4QMWA 3H9OA 3NNUA 2C6TA 4N6YA 4R5YA 4WBBB 5IH6A 3COKA 3HMNA 4HW7A 3KF4A 4NM5A 3GC8A 4DG3E 4EC8A 4O27B 2RG5A 4ERWA 3TDWA 5KE0A 3NSZA 4YSMA 5EG3A 4FKQA 5JT2A 3GC0A 4Q9SA 2GNFA 5FXRA 4PX6A 3EH9A 3NWWA 3WZKA 3F7WA 1Q62A 2IZUA 3F3WA 4AE6A 2C3IB 3QLFA 3ZZEA 2ZB1A 4ID7A 3PJ2A 1O6KA 4B4LA 5K5NA 4V01A 1GJOA 4NUSA 1RW8A 4FV8A 3BYOA 3VW8A 4AT5A 5J5TA 2GCDA 5KO1A 1OIQA 3C1XA 4J8MA 2Y0AA 3DQWA 5CU3A 4QT1A 2HXQA 5E8WA 3PFQA 2O64A 4MNFA 3D15A 5EDRA 3TUBA 3AOXA 3LLAA 4FKJA 4L3LA 4O6LA 2G15A 4F9CA 2GU8A 4Y5HA 2LAVA 4KINA 5KCVA 4HVSA 5IUIA 5GZ8A 3FDNA 5HGIA 2YN8A 2QOLA 4FZ6A 5J9ZA 4O82A 3VHEA 3ZXZA 5M57A 1K3AA 4I20A 3TKUA 4FTRA 3NVKI 2OU7A 4C4HA 4F6UA 2CKQA 2WHBA 3ZDUA 4B0GA 3BELA 2R7BA 2YZLA 4DE4A 5FUTA 2EXMA 4RFMA 4AACA 2UZTA 3PIYA 5CEQA 1PXKA 4AFJA 3KRXA 4DFLA 3PWYA 2QONA 5CNNA 4GK3A 5CSHA 2PUPA 3R1QA 2BTRA 2PE2A 4AW5A 1YOJA 2VTRA 3GENA 5JKGA 4QQCA 2OZAA 2BTSA 2H9VA 2CCIA 2V5QA 4D1SA 4GRBA 1M7NA 5L4QA 1PKDA 4NJDA 1WAKA 4KS8A 4ALVA 4DEGA 4FG9A 3NZ0A 2A0CX 3GFEA 4JQ8A 4TNBA 4R7HA 3DGKA 3OXTA 2VO3A 2XM8A 4FZAB 2QODA 4MD7E 4LV5A 4NFMA 4Q5EA 4RJ7A 3UNZA 3OBGA 4DYMA 4EYMA 2OFVA 3PJ3A 3QL8A 2YWVA 4D28A 4FUXA 3VF8A 5CF4A 2ZV7A 5BUJA 3U6IA 4F0FA 3ZUTA 5DLSA 2ITZA 4FC0A 3W1FA 3LCDA 3QD2B 2W5HA 1ERKA 2F7EE 2ZM1A 3HV3A 3LE6A 4IB5A 3F3UA 3JVRA 5ETAA 5AUZA 4FIFA 4D2WA 4UMRA 3FMKA 4IVCA 4WSQA 5DHJA 4G6LA 2CJMA 4IHPA 4OBQA 4O7TA 2OICA 4FTUA 2W1ZA 5JH6A 5DOSA 1NY3A 4APPA 4FV4A 3Q3BA 4IIRA 1YHVA 5KZ0A 5JK3A 4ANMA 2O63A 2WQBA 4RFYA 3FXWA 1P5EA 1XH8A 3OROA 4AXCA 4BI2A 3LFNA 4L42A 4GUBA 3Q4ZA 4I5MA 2R3GA 3PY0A 2GFCA 2VWBA 3PIXA 4AA0A 3BU6A 5TE0A 3CEKA 3IGOA 1SZMA 4PRJA 4TYHA 4FNXA 3PFYA 4RJ4A 2OZAB 3IGGA 3THBA 3PP1A 3POOA 4YPDA 5M07A 3TNHA 3F3TA 3FY0A 3KRJA 4U40A 2XK3A 4O0VA 3R83A 1V0OA 2V0DA 5ETCA 3V04A 4AGWA 1PXLA 3ANRA 3EL7A 4UMPA 4FEVA 4J1RA 2UW4A 1Y8GA 4I6FA 1QCFA 5AWMA 3I5NA 4E4LA 5IQAA 5HD4A 4ZY6A 3R63A 3ORKA 4FIJA 3OW4A 3DXPA 3ZSHA 3TZ9A 4FV2A 3WIKA 4L3PA 1U46A 4E5WA 5CSPA 4AGCA 2JIVA 4DDIA 1PKGA 3OEZA 4N57A 4XV2A 3R30A 5DE2A 2BCJA 3C7QA 4B8LA 2QOIA 5LWNA 3GUBA 4RT7A 5EW3A 2ITUA 4G5PA 1URCA 1A9UA 4QP3A 4YJSA 5E7RA 3R8LA 4E4NA 3GQIA 1IRKA 3UTOA 3QWJA 2VO0A 5F1ZA 1ZMWA 4DA5A 4IAZA 3F6XA 4EOOA 4BZNA 3QCXA 1GZKA 2HOGA 3ZU7A 4YJUA 2QKWB 3QQLA 3BLQA 5KZIA 4ERKA 4C4GA 4TYHB 5LXMA 5HIEA 3A61A 2RFDA 4BYIA 2E9PA 3PWDA 5HNBA 3BYVA 1ZY5A 2RKUA 4AW1A 1KE5A 5HICA 3CQUA 3QBNA 4FZFB 2OO8X 4ZSEA 3LFQA 4Y72A 3AMYA 1AD5A 3VO3A 3JPVA 2BKKA 2C6EA 1PMVA 4FYOA 4XG8A 1CMKE 3NLBA 4C57A 5JMSA 2QOQA 3BWJA 3OXZA 3WOWA 2GFSA 3AD6A 4LL0A 2ZVAA 4PPCA 4FK3A 4R3PA 4YU2A 2CSNA 4XV3A 4CZTA 2Y8OA 4IE9A 4DCEA 4AN3A 5AV4A 4AXFA 2CCHA 3VJNA 1H01A 4YPSA 3HAMA 3WF9A 4I21A 4EH6A 4M0YA 4M13A 4KKHA 3H0ZA 3NX8A 4AXDA 4AN9A 2R4BA 5I3RA 3GEQA 3O7LD 4FSRA 4CVAA 2C5NA 2P4IA 2WZJA 4RPVA 1SVGA 4CQGA 4XG2A 1OL1A 3EOCA 1YDTE 4R8QA 3AT2A 4RZWA 4WA9A 4DH7A 4BCKA 3U55A 4L68A 3FL4A 3LXLA 3ZBXA 4BY9E 3LFBA 1AQ1A 2P55A 2Z8CA 2BDWA 4FGRA 3FMNA 4IWPA 4QQ5A 3DAJA 2OWBA 3Q5IA 4RBLA 4BIBA 5JFVA 2OLCA 4HJOA 4M7IA 4NCTA 4YGAA 3BBTB 3WIGA 4AAYA 2QU6A 2YM5A 2WQMA 1NT2A 2JDVA 2QD9A 3EL8A 4KAOA 5EM6A 4E4MA 3VW6A 4F4PA 2QOKA 5J79A 1OBGA 1XBAA 2WTIA 4QP8A 4BGQA 2W17A 3BYSA 3OW3A 4IWQA 1VYZA 2HZIA 3A7IA 1ZYDA 4PMSA 4YLJA 3U4WA 1WBSA 2Q0NA 2O5KA 5FEQA 2F7XE 3LJ0A 3ZYAA 5LCJA 3UYSA 1SNUA 3NGAA 4AP7A 5CAUA 3VUTA 4YHJA 3FMLA 3FZTA 4ZXTA 2RSVA 4O0YA 1HOWA 1AGWA 1H1RA 4OTRA 4ZJIA 3ZLYA 4YBJA 2R3LA 4CGAA 5DVRA 3Q2MA 5TR6A 2PZIA 2XA4A 1YOLA 2IZTA 4BCHA 3ZCLA 3HVCA 3OY1A 1QPCA 3UPZA 3AC4A 3HP2A 1S9JA 5A54A 5EYDA 1PMNA 1O6LA 3UGCA 4DH3A 3SD0A 1YHSA 4YLLA 1KSWA 3PA3A 4RX7A 4UXQA 4IVDA 3KN5A 2W5AA 3F5PA 2QO7A 1CSNA 3D83A 4BYJA 3W10A 5KUPA 2E9UA 2X9EA 3P1AA 4WSYA 5DFPA 3LFAA 3OP5A 4FKPA 2VN9A 4JQ7A 4KABA 2W06A 3W2SA 3MPTA 4GUEA 4QRCA 2UZOA 1ZOEA 5ACKA 2JKQA 3H4JA 2C30A 3ZSGA 4AA4A 4YTFA 5A6NA 1SYKA 1WMKA 2QC6A 4WRSA 4I5CA 5F9EA 5FQDC 4M0ZA 3TNPC 1PYXA 4E20A 4EK6A 1WBTA 4RRVA 2IO6A 4F6WA 3UNJA 4L44A 4TWNA 4C0TA 4C4EA 3PG3A 4C34A 4F9AA 5DMZA 4MEDA 5IQGA 4CFFA 1B38A 3Q6UA 4C3FA 2BDFA 4JX3A 1ATPE 3A60A 4C4IA 3CY3A 1JSVA 3DBQA 4BDBA 1K9AA 4E6QA 4G3FA 5DR9A 2OZOA 2V62A 3FHIA 4GG5A 2JGZA 3DNEA 3I60A 2Z7SA 3COHA 4TN6A 3FQSA 5BYLA 3G6GA 4PWNA 4QYEA 2NNWB 4DT8A 1F5QA 3BV2A 4FSNA 4G6NA 4QOXA 4L6QA 3OUNB 2YAAA 4LOOA 1JSTA 3VJOA 3UG1A 5BPYA 3Q9WA 3VF9A 2OW3A 3OHTA 3Q04A 2C1AA 3Q9XA 5EH0A 2BZHB 5IQDA 3K2LA 3RHKA 5DT0A 2J51A 1IR3A 2XBJA 3SX9A 2XZSA 3TV7A 5IH5A 1YQJA 4IZYA 4KNBA 3NS9A 3QAME 5CEKA 3BE2A 3S95A 1FMKA 4C2VA 4P4CA 2OBJA 3W33A 2PVLA 1XQZA 4NW6A 1XBBA 4YJVA 3ZC6A 2PYWA 3LM5A 3E7OA 4DGNA 2WTKC 3FMHA 5AAGA 2E9NA 4X0MA 3R7OA 4CYJA 3ZO4A 1NXKA 5L6WL 4LMNA 4IX6A 2WB8A 3DJ5A 3ULZA 5AX3A 4BGGA 4FYNA 1WVWA 1QPDA 2Y4PA 3VUKA 3L9LA 5CNOA 2ZYBA 2PK9A 5IQCA 4O4BB 4RFZA 4YTIA 3C0HA 1UU7A 4NTSA 3PXFA 4UWBA 5BYZA 4EWQA 5CASA 2VX0A 5HG8A 4QMPA 2BAQA 2EXEA 4L46A 3BL7A 3W0SA 2XKFA 1JQHA 3KFAA 4Z3VA 3K5UA 4D0WA 1I09A 3QX2A 4MH7A 3ZOSA 3TNIA 3P7AA 4FTTA 3FAAA 5E8TA 2XIYA 3MB6A 5CF5A 3DS6A 4OBOA 3IDBA 3UZPA 4EH5A 5LQFA 2GS6A 3CXWA 4HVIA 4A4XA 5HIDA 4F9YA 4ACHA 4TY1A 4JR7A 4DEDA 2ZAZA 3AXWA 4ZTSA 3MPAA 3ZM9A 4FKWA 1IAHA 3GU4A 4GKIA 3QZHA 4X6RA 3LAUA 3VWAA 3FLWA 3SKCA 2YJRA 3PVUA 4RVTA 1DI8A 3TXOA 4BDHA 3EN9A 3PRFA 1WZYA 4ZTQA 3SOAA 2CNUA 3BEGA 4U5JA 3BV3A 2C3KA 4U42A 5HBEA 5L2TA 4UY9A 3FMEA 5IUGA 3CLYA 1BI7A 3GB2A 2PTKA 2OJ9A 4JS8A 4TRLA 1OGYA 4TYIA 1H08A 4NH1A 4O7YA 3IG7A 3QX4A 4ITIA 1M7QA 3A2CA 3V5WA 3PSCA 3VS0A 4HGSA 4CMTA 5E8UA 2UZVA 3QUDA 1Q8TA 5A46A 1KOBA 5IQBA 4E4XA 2X8IA 1Q8UA 5TOZA 4GK4A 1OECA 5HX6A 4YNOA 2WMBA 3P5KA 3Q52A 3R8ZA 4CKIA 3LLTA 4O2ZA 2ZV2A 3MVMA 1JLUE 5HEZA 4FTMA 4J71A 1JVPP 3COIA 4G6OA 4WUNA 4EOJA 1CKIA 3G2FA 5E8XA 2WPAA 4BVUA 4WG3A 3LMGA 1JKKA 2JDRA 4CTBA 4OGRA 3CKXA 4DGGA 4X6QC 2W1FA 4ANNA 4D4VA 3F82A 5CU4A 2B55A 3KXGA 4FTAA 2XK7A 1M52A 5BVFA 2OF2A 4X2KA 4MD8E 4AW2A 3CCNA 3FBVA 3FQEA 4AZSA 1Y57A 4O84A 2C5VA 2VWVA 2B52A 5E1SA 5I9ZA 4LOQA 4IJPA 5F4NA 1MUOA 5G1XA 3VAPA 3DOGA 4FOCA 4BZOA 4DEIA 3GCSA 4F7NA 1CTPE 4HYSA 4XP3A 2QO2A 3ACJA 3LXKA 4AZWA 4BWKA 3QC9A 4IAYA 3OT3A 4R3RA 2XJ0A 2NPQA 4QEBA 2I0HA 3HA6A 3IW7A 4AZTA 5CALA 3JUHA 2A27A 1B6CB 1W2CA 4F70A 4FV6A 5HO7A 4E6AA 4QQJA 3BHTA 5IF1A 2PPQA 4TXCA 5AEPA 3NIEA 3BHVA 5EI8A 2HWOA 1KV1A 2JIIA 4A9SA 4FVPA 4PNIA 4DHFA 1P14A 5JFSA 1XMLA 4H3PA 4U44A 3JR1A 3UPXA 4BHNA 4BZDA 2J0KA 2UW0A 3C0GA 5HNIX 2XCKA 2IPXA 2FGIA 4HVDA 5IQEA 4ZK5A 5AUVA 4K33A 2G1TA 4BGHA 4P7EA 5KHWA 2R3QA 3CC6A 4BDJA 1H1SA 4D9TA 5HOAA 2W1IA 3QTZA 1H00A 2OJFE 5J8IA 4IANA 5CU6A 2JC6A 5EHOA 5GJGA 1U5RA 4YZBA 4E3CA 5FP5A 3R1SA 4WBOA 3C51A 2I6LA 2CHLA 4YNEA 3LFSA 5EFQA 4BDKA 4EBWA 3RMFA 2WOTA 3MYGA 4FKUA 3G15A 3DKOA 4EKLA 1MRYA 3EQPA 2FUMA 2W1GA 3GOKA 2XCHA 5FM3A 3SXSA 4NTTA 2YM4A 4FL1A 4CFWA 4XEYA 2WKMA 3ZRKA 1CM8A 2WMUA 4XG7A 2UUEA 5FLFA 3F69A 2XKEA 3FKOA 4RIOA 1FQ1B 3IK3A 1UA2A 2BHHA 4C36A 3IW8A 1H1QA 2YITA 2NRUA 4QP1A 5CVFA 3CP9A 2J50A 1ZRZA 2B54A 1MQBA 4NYEA 3R7YA 4BCFA 4DT9A 3R7EA 5CEIA 2R3KA 3NUYA 4F08A 5KMIA 1GIJA 4FICA 5F95A 5IG1A 5E91A 1H1PA 4W4WA 3CE3A 2H96A 5ANOA 2OIDA 4UMQA 2GHGA 1YXUA 4O1OA 1U5QA 3MN3A 4UYNA 1JPAA 3POZA 4KIKA 1W83A 3KRLA 3VIDA 2PMOX 1FPUA 2UVXA 4LG4A 5H8EA 1A48A 3TNQB 4NJ3A 1RQQA 4EH7A 3FYJX 4XUFA 5AAFA 1YI6A 4C7TA 4MBJA 4NKAA 4CV9A 2ITQA 2ONLC 3NW6A 3PP0A 4EUTA 3W2RA 1ZAOA 1OL7A 2XK8A 4IXPA 4JXFA 3QTWA 3ZO3A 2BKZA 1XH4A 3LFEA 4MQ2A 4NZWB 3LQ8A 2WQNA 3MDYA 4W9XA 4BBEA 4D5KA 2IW9A 4QTDA 1RE8A 4A06A 5AX9A 4BJJA 2C3JA 3HZTA 4O4FA 2B1PA 3OG7A 3QLGA 4IACA 4F63A 3KXHA 3SA0A 1PXPA 5JSMA 3AGMA 4C3RA 3R2BA 4MAOA 3DLZA 3NNXA 4M14A 3TIZA 3W55A 4CRSA 2F9GA 3WZDA 4Z55A 3FE3A 5EHLA 4GV1A 4FG8A 2ZFYA 1PF8A 2ZM4A 3SOCA 3PJCA 4MXAA 2ITPA 3MV5A 4EOSA 2ETMA 4PQNA 5JQ8A 3BIZA 3UOKA 1NVSA 4MXYA 1BYGA 3LKMA 1OUYA 3ZSIA 1B39A 3EHAA 2PWLA 3OT8A 1H24A 4MX9A 3QYZA 2XIZA 3FUPA 4FI1A 4CTCA 3BYMA 2XAMA 3UVQA 4ZJVA 4KIKB 4MQ1A 2OIBA 3C50A 4ONAA 4C38A 1BX6A 3V3VA 1OIUA 5FGKA 3U6JA 3GU5A 4U41A 4AUAA 3HV4A 3GVUA 4GU6A 4ZTHA 4ZY5A 5FBNC 4ZSLA 3DFAA 4PMPA 4A7CA 4BHZA 4MBLA 1ND4A 3GCVA 3MWUA 3OZ6A 2BVAA 4DTBA 5CEPA 2YCQA 1GZOA 4X2JA 1W84A 4JDHA 1MRVA 1ZYCA 3IDCA 4YC8A 4GS6A 4FSQA 3FPMA 3HLLA 3AD5A 2FVDA 3D2KA 4FSTA 4BJJB 3VS2A 4RWLA 4BC6A 3EN7A 4B99A 3UMWA 4AZEA 2X2MA 1XKKA 5AV0A 4MXXA 4QMZA 5FTGA 3RK5A 3O71A 2NYAA 1YHWA 5L2IA 2Z02A 4UMTA 4N6ZA 2OFUA 4QMNA 1K2PA 3ZXTA 3AC1A 4GIIA 1KOAA 4QMMA 3VNTA 3MTFA 3U4UA 2BDJA 2VNYA 5C4LA 1O9UA 5C01A 4B7TA 2CPKE 3F88A 3MBLA 5EQYA 4IZ7A 3UP2A 3S00A 4LQMA 3GCQA 4W4VA 2IVSA 1H0VA 4GT5A 5JN2A 5E8VA 4JLCA 1PXNA 3QKMA 3R71A 2UZWE 1Z9XA 3I7CA 4YHFA 5JGAA 2AUHA 3QHWA 4KBKA 1GOLA 3CD3A 2QU5A 3I5ZA 3QCYA 4RC3A 2QHNA 4BCOA 4C2WA 4QQTA 2C68A 2CKEA 5C8MA 4L7SA 4YZDA 3SW7A 5AM7A 1WBWA 5K0KA 3DCVA 4QMTA 5AR8A 1NVRA 2O0UA 3OMVA 5D1JA 2WTJA 1UU3A 4CG8A 4TYJA 4ZAUA 4NEUA 3PIZA 4GL9A 3DK3A 3DKGA 3MVJA 1XH6A 1JNKA 4IDTA 3RM7A 2A19B 2WTKB 4HYHA 2F2UA 1G8AA 5ANEA 2W1EA 2IEWA 3JXWA 4RJ3A 1REKA 3EIDA 3Q5ZA