4CMUA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor (10r)-7-amino-12-fluoro-1,3,10,16-tetramethyl-16,17-dihydro- 1h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11)benzoxadiazacyclotetradecin-15(10h)-one
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
total genus 96
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmuA01
3EN6A 3N4VA 4JOAA 2YM3A 1Q3WA 3PIXA 2HW6A 3NYXA 3ZDIA 5FQDC 3Q53A 4EYJA 3NUPA 5G6VA 5ANKA 2QCSA 3C7QA 3FEGA 5CVHA 1Q8YA 3PZEA 3R21A 5LVOA 1KOBA 2J0IA 4P5QA 4YUQA 5IDNA 4EUUA 3TUDA 2UZEA 4QPSA 4EHZA 3HV3A 5E8SA 1OIUA 3R9OA 3SRVA 5DYJA 2XM8A 2A19B 2XNOA 4O0XA 2FVDA 3HZTA 2OF4A 3HMPA 1E1VA 4IC8A 3SRVB 4EHGA 2C6OA 3DNEA 3NYOA 3S0OA 3GEQA 1ZZ2A 4U3ZA 5C8KA 3ZCLA 2ETMA 4NM7A 4QMOA 2VO6A 3FHRA 3RINA 1MP8A 3D5UA 4J52A 3SKCA 3EH9A 2VWXA 4AOTA 4F64A 5CU4A 3IW8A 4FTLA 4I41A 3UG2A 3A7FA 5HI2A 3R01A 3P79A 2IPXA 1Q41A 3QTZA 2WOUA 1O6KA 3KA0A 2WIPA 5CI6A 1P5EA 2IW8A 3E92A 2B9FA 1LPUA 5FP6A 2ITQA 4FSTA 4AZEA 1OUYA 3FC2A 2PMIA 3NUYA 4FV1A 4RLKA 5DEYA 3UIBA 5AA9A 5CF8A 5LVMA 3LM0A 4JS8A 4CCBA 1H1WA 3OTUA 5HNGA 4QP7A 4YJOA 5HIEA 4ZIMA 4OTPA 4A9YA 4J53A 5AAGA 1T46A 2OJJA 3LMGA 2YM6A 3NS9A 4GIHA 3VW6A 2RL5A 3QL8A 4BCQA 3V04A 4O0SA 4G3CA 5KMJA 3TV7A 3PIYA 4EKKA 1J7LA 4IHPA 4C4GA 1J3HA 3R2BA 4PDSA 2PUNA 3D9VA 3NUAA 4W8DA 4PMTA 4BI0A 5J5SA 5KKRB 3CLYA 4I5HA 5HNBA 4ZK5A 5CEMA 4FBXA 1F5QA 3TL8A 5ETFA 3OCBA 3AD5A 5DR6A 4F1OA 1MRVA 4QP2A 2WTKC 2BHEA 3IOKA 3T9TA 5FRIA 3HL7A 2C6TA 5KHWA 2PY3A 5IH5A 3CXWA 2YCRA 5D7VA 5KCVA 4C38A 1PYEA 5BUJA 4YLJA 3GT8A 1IG1A 2C3LA 4X7QA 5CVFA 2QLUA 4FEVA 5T68A 2X6DA 4J8NA 1XQZA 4DFZE 5FLFA 3I5NA 3BEAA 3G0EA 2HZ0A 3LFEA 3IGGA 4QMTA 4O7RA 4LL0A 4QYFA 1WBNA 2I40A 3ANRA 5KMKA 5M57A 4Z9LA 4OAVB 4USFA 2C5XA 3T3UA 4GW8A 3KEXA 4UXLA 2P2IA 5ETCA 3RNYA 2YLEA 5CTPA 5LARA 4LOPA 2BIYA 4A9TA 5IA3A 2YM5A 2Z7LA 5EDPA 4K0YA 4YO6A 4YZDA 4PPCA 2JKMA 4QQJA 3D2KA 1Q62A 1U5QA 3RJCA 2J0JA 4D9TA 3Q96A 1YKRA 4AN3A 4ERWA 4HVHA 4OUCA 2GS2A 2YIXA 3RAHA 3TG1A 4TYEA 4WUNA 1A06A 3CCNA 3FLSA 2Y7JA 4TY1A 3SX9A 2PHKA 4S31A 4YTHA 1Q4LA 2NNWB 1VR2A 2ITZA 3UC3A 4NSTA 3KXHA 2BKZA 2BIKB 3VUGA 4USEA 2W99B 2BRBA 1LEWA 3R1SA 4BIDA 2IJMA 3VC4A 1QCFA 3KULA 2VTRA 4FV4A 5JFSA 4DT9A 5AR3A 2O63A 2GSFA 4FSNA 4U7ZA 4G3GA 5D11A 2UW9A 3KL8A 3KKVA 4RQKA 5TR6A 3GGFA 1GIHA 4AAAA 3D2IA 4D4SA 3EYGA 3O0GA 3OWJA 1WBSA 3RPSA 4D28A 5M4UA 4GVAA 4YJQA 2BZIB 1YRPA 2ITYA 1H8FA 3FSFA 4M84A 3R8MA 2ESMA 2GQGA 4FT7A 2DWBA 5AV4A 4X3FC 1YXVA 2RFEA 4FZDB 2JIVA 4APCA 4L9IA 5K5XA 3MS9A 4D2SA 3P4KA 3ZO2A 2HXLA 3W55A 4RMZA 5DGZA 1OL7A 5IQAA 4FNYA 3U9NA 4JNWA 1H25A 4IX4A 4TYGA 3K54A 3RPRA 3CQEA 5F20A 4G3DA 2Q0BA 3V51A 5H2UA 2BUJA 3QGYA 3IW5A 1OIQA 2PVLA 2C6LA 4M8TA 2H6DA 4O91A 3VBVA 2J2IB 4DEAA 4IX5A 2OGVA 1GOLA 2EWAA 2FGIA 1CTPE 3LLAA 2ERKA 4U41A 4DH1A 3PJ2A 4M14A 1HOWA 5EM6A 3DAEA 2A4LA 2X4ZA 2X7OA 3AOXA 1H00A 3OXZA 3SG8A 3MB6A 3ZLSA 1OBDA 5L6PA 1W98A 2HK5A 4EK3A 3F5XA 5AR2A 4ZJIA 3UP2A 3T3VA 4I5CA 3ZXTA 4RJ5A 4LRKA 1AGWA 3EFWA 3LFSA 5AUYA 4Y8DA 4FSZA 3A7JA 1JSUA 4FSUA 4BBEA 4I0RA 4CMOA 1R39A 4Q5EA 3GU7A 4OTHA 3PJ3A 2VTSA 3G5DA 4BDFA 3BE2A 4FTMA 3K2LA 3BHTA 3HKOA 4EHEA 4F7SA 1B6CB 4X0MA 5HEZA 5CENA 4FKWA 4WT6A 3UDBA 4IWDA 4UV0A 3Q4UA 4L7SA 2ZM4A 4MD9E 3KMUA 1ZMWA 2XH5A 3G6HA 3GOPA 5M4IA 2OZAA 4DA5A 3TJDA 1R78A 3LXNA 5EKOA 2WMRA 2XIRA 3DLZA 3E64A 2JAVA 3QUPA 3UVPA 1Y8YA 3QCXA 5IEYA 3CTQA 3U4WA 2V22A 4NW5A 3KCKA 1L8TA 1P2AA 2C6DA 3BGQA 4G17A 4I4EA 1JVPP 3MJ2A 4L46A 3BHHA 3QYWA 4IX6A 1SYKA 3CPBA 3FZSA 2Y4PA 4FKLA 4JR7A 4R3RA 5K3YA 5JRQA 2JIUA 4FEWA 5TF9A 4PPBA 4AS0A 5IG1A 2ETRA 4IVBA 4I3ZA 5AR7A 1G5SA 3A62A 3KGAA 4ZJJA 3Q9YA 4X3JA 5CAPA 1JPAA 3U6IA 3SXRA 4N57A 5DOSA 3G90X 1VJYA 3OY3A 1OL1A 2R3JA 3LE6A 3CKXA 3GU6A 5D10A 3BCEA 4V01A 2NPQA 1FOTA 4FNWA 4KABA 4BI1A 3KN6A 1CSNA 5GJFA 3I7CA 4MAOA 3GB2A 4YZNA 5CVGA 4U6RA 5DH3A 4M12A 3GC8A 3DCVA 4N70A 2BROA 5HIDA 3UQCA 2OI4X 4FSMA 4MNEA 4U42A 3RAIA 4C3FA 4C3PA 4EOQA 4YTCA 4NK9A 5BMSA 4UMPA 5ETAA 3LFBA 3ZEWA 4Y95A 4CSVA 2VWBA 3AC3A 3PSBA 4MBLA 2GHMA 5E1SA 4ZSAA 5IQCA 4Y5QA 3FY2A 3VS5A 2PVYA 1DAYA 2JEDA 4IZ5A 4AQCA 5HX8A 5JSMA 4O7ZA 4KRCA 5GZ9A 1MRYA 3UGCA 1TQPA 4LFIA 3EQPA 4ANSA 4U44A 4EORA 3ULZA 1H1PA 4FV5A 3LKMA 2OIQA 1W7HA 4JRNA 2CKEA 4TZRA 5LMKC 4P5ZA 3NSZA 3ELJA 4UMQA 3SD0A 5M44A 2YWVA 3OOGA 4LRMA 1PMNA 4P7EA 3G33A 4GCJA 1O6LA 3DZOA 4UYAA 3UC4A 2J0LA 1NW1A 4UZHA 4U80A 4QPMA 3TUCA 4EOKA 1GZOA 4F9YA 2HOGA 3LCTA 2VO0A 4PWNA 4BRXA 5GIOE 2I1MA 3DT1A 2B1PA 4BYJA 5JEBA 5EI2A 3FKOA 4I6FA 4W4WA 1LP4A 3VWAA 2BDFA 4YNEA 4F7NA 3UQFA 1V0PA 4O7SA 2VTIA 4PRJA 3WZDA 4AGDA 1W83A 5CEPA 3UZTA 4JDIA 3WF9A 3LLTA 3HNGA 2PK9A 1KV1A 3PY0A 4NWMA 4WG4A 3EHAA 2HXQA 5HBJA 4LOQA 5FTOA 4P90A 4MX9A 4UWCA 1YDTE 1CDKA 5JN2A 1BKXA 3MY5A 3LFDA 1U46A 1XHAA 5FEEA 4IFCA 4JBOA 3WF6A 4CV8A 3F2RA 4AT5A 3K3JA 4OBPA 5HCZA 2OXXA 2RF9A 2IG7A 1IRKA 3FLQA 5CSHA 1ZLTA 4XG7A 4BCHA 1JNKA 1GIIA 2XJ2A 5DEWA 3UBDA 2YFXA 5BYZA 4FT5A 1FGIA 4AU8A 2R3IA 5AV1A 2C6KA 2GNJA 5DPVA 2VTOA 3W2OA 2R3PA 3LXLA 3CSVA 4DINA 4F6UA 2XB7A 4MVFA 2XCKA 4TNBA 3H10A 3ZS5A 4AA4A 3H9OA 2C6MA 4LUDA 4ZEGA 3RGFA 4AF3A 5IPJA 5JT2A 3AG9A 4IH8A 4JIKA 2G2IA 4FZ7A 5I9XA 2W1GA 2X2LA 5IH6A 4GG7A 4AN9A 2J9MA 2XRUA 3WYYA 4FTJA 4XV9A 3VBQA 5GNKA 3PXFA 3IOPA 3GFEA 1JSVA 4CZTA 2PZIA 3OXIA 4FL1A 2BZHB 2P2HA 2HZIA 1BUHA 2WQOA 1ND4A 3RHKA 3PXKA 3BQCA 2PMLX 2EXCX 5HTCA 2X8IA 4CRSA 5K0XA 2WU7A 1H08A 3A61A 3FDNA 2B9IA 3FXXA 3QC4A 4H58A 4BDGA 2OIDA 1FMOE 3MFUA 1QPCA 4QMUA 1UU9A 3F61A 1VYWA 4CLJA 5L8LA 4H1MA 5IA1A 3BU6A 3FI2A 3O23A 5IA5A 3RMFA 3D14A 1QPDA 2XNMA 2X8EA 3DKOA 3ZEPA 4XV1A 3QBNA 2UW5A 4L01A 5I9WA 4G6NA 3QTWA 1OBGA 4FSQA 3VBXA 3WOWA 4IAAA 1FQ1B 4D0XA 3UIXA 4BGGA 5M51A 4FZAB 2VZ6A 5AEPA 3PPZA 3VF8A 1FBNA 4FV0A 1B38A 4ALUA 4KKGA 3A8XA 3VUMA 2J0KA 5M07A 2O2UA 3FXWA 3PTGA 1PXLA 4RJ7A 2H34A 4ZZMA 4B4LA 2G9XA 4MHAA 4NW6A 5L6WL 3PVUA 3FZTA 3WZUA 4ANBA 4E4MA 4QYYA 4QYHA 4CT2A 3R8VA 1LR4A 3ENHA 1DAWA 3Q9WA 4DGNA 1VYZA 3ORLA 4ZSLA 4F9WA 1AQ1A 4W4YA 4GU9A 5IA0A 2REIA 4I0TA 3ZZEA 3NW6A 1OL2A 1Q97A 3HA8A 4KBCA 4WA9A 2BKKA 2PTKA 3GCSA 3QTIA 2DYLA 4LI5A 5I0BA 4AE6A 2ERZE 2C5VA 3F3UA 3C4EA 5L8JA 3QRTA 2WXVA 4FMQA 3QLFA 4GK3A 4C2VA 4HVIA 2GDOA 4YHFA 3W8QA 2PVHA 1T45A 4DEEA 3BYUA 2ZB0A 4ID7A 4JDKA 4EBVA 3UP7A 4EZ3A 2E9NA 2OICA 3Q9XA 4JAIA 4UYNA 1OUKA 4AW2A 4CFFA 1H1RA 1CKIA 4FF8A 1OMWA 3D5WA 3OOMA 3QAME 2QHMA 3VJOA 5F9EA 3O8TA 3L8PA 4ZOGA 3FL4A 3QALE 4FKRA 5DRDA 3A4OX 2WQEA 3LZBA 5EM7A 3FMNA 5IDPA 4CZUA 4AZTA 5KMNA 5EHYA 3IS5A 2WTWA 3QZHA 3H3CA 4FIEA 3VUDA 4F7LA 4KKHA 1YI3A 4NUSA 4RBLA 4L3LA 3EKNA 4BB4A 4O2PA 3ORTA 4A06A 2OBJA 2ONLC 2ZV8A 4I23A 5AP3A 5B0XA 3MIAA 2LAVA 3TACA 3TIYA 5B7VA 5BVDA 5L2TA 2PUIA 4X2FA 3E7OA 4EH8A 4N6ZA 3OW3A 3R63A 4QPAA 4HNFA 3L8SA 3FKNA 4FL3A 4RWIA 1YOLA 4BDDA 4G1WA 4RIYA 3KC3A 4LGHA 4XG9A 4EH9A 2J4ZA 4BY9E 4XCUA 5ANIA 2C68A 3NUXA 3FPQA 2NRUA 4QQCA 5CEQA 3DK7A 2YAKA 3BGZA 3QXOA 3MH2A 2CLQA 4PTGA 2VV9A 3F3WA 3FHIA 4OTIA 4PX6A 2BHHA 5KZIA 1R0EA 3O7LB 3PUPA 4ONAA 4IE9A 3DY7A 4DLIA 4NZWB 3HP5A 2HIWA 4PL3A 3I1AA 4MBIA 2W4JA 4WUAA 3Q4ZA 4XG8A 5D9HA 3VRYA 2CGVA 3ORIA 4XOZA 3DJ7A 4YU2A 4FTAA 2JLDA 3BQRA 3C4ZA 3MB7A 4FTNA 3EN5A 4MD8E 4TWOA 5JMSA 2XNGA 4I22A 3KQ7A 4DG3E 1M7QA 4X2NA 4EOMA 4EOSA 4KSPA 2BCJA 4MNEB 4W9XA 3F88A 2QKRA 2R3HA 3CC6A 2V55A 4AZWA 4JJRA 3ZBFA 4XEYA 3QRIA 5AUXA 5FXQA 4M3QA 4M13A 4FUXA 3VQUA 2WTCA 1OPLA 4GG5A 5CQWA 1XR1A 2RSVA 4O1OA 1PMVA 5HESA 3OEZA 2O5KA 3KXNA 3W2SA 3OT3A 3POZA 4IB3A 5H8GA 4UX9A 4FA2A 5DA3A 4DFYA 2CSNA 2Y9QA 3W2PA 4DLJA 4TTHB 2VWWA 3NUUA 2PUPA 3GBZA 3LJ2A 5FEDA 4HYIA 1QL6A 5C4KA 3R7OA 2UW0A 5EHLA 2Z7RA 1OPJA 4YC3A 4O22A 5AIRA 5M55A 5BMMA 4S32A 5EI8A 2I6LA 3QQHA 4ZTMA 3TNHA 4JXFA 4AACA 3E8CA 3CD8A 3SVVA 2UZTA 1M2RA 4GEOA 4KIQA 5FBOA 4UMRA 1I44A 3UO5A 4JAJA 3F6XA 4FKSA 4I93A 3NMUF 3MGYA 5AP4A 1JOWB 4GK4A 3L8VA 5IZFA 2X9FA 3PZHA 4H3PA 3ORPA 3POOA 4G5PA 5EYCA 4C02A 4CEGA 5E8ZA 5AP5A 3WF5A 3UJGA 4UEUA 2VTMA 2QOKA 2QQ7A 4MWHA 4PY1A 3EWHA 2ITPA 5IQGA 4QTCA 2X2KA 4HCUA 4QMVA 2YN8A 3FZRA 4G9CA 2PWLA 4O86A 3R1NA 1Q8UA 3COKA 4AFEA 5L2QA 4G6OA 3ZM9A 3F5GA 2WEIA 4RVMA 2W06A 3P1AA 4FTIA 4KRDA 2YM7A 3NYNA 1AD5A 5F95A 2IN6A 3RVGA 4RZWA 1M17A 3AQVA 5JK3A 1OZ1A 2V7AA 4O1PA 4V05A 5AX9A 1ZYJA 4FKTA 4DH8A 2A27A 1YQJA 3DK3A 3BELA 3U9CA 5J9LA 2O3PA 3MPMA 2BR1A 5FM2A 4YC6A 2IZSA 3H0ZA 4ASEA 1ATPE 3CGFA 4CG9A 3MY1A 5M53A 4PTCA 3AT3A 4ZAUA 4ACGA 3E63A 4QP6A 1J7IA 4NJDA 5GJDA 1YXSA 2R3FA 4Z55A 3I0OA 4BIBA 3NVMB 4DHFA 3VULA 3GUBA 4C35A 3CTJA 4EJ7A 2RG6A 5IA4A 2GHGA 4FNXA 3QGWA 3ERKA 2UZLA 2VD5A 4FEQA 4QQ5A 4FEUA 4NFNA 3O50A 4RIOA 4X21A 5C1QB 5KX8A 4M0YA 3VS4A 5AP0A 3PE1A 4GYGA 4EOOA 3FXZA 4KSQA 2B9HA 3C0IA 2OH4A 4UXQA 3UYSA 4PP7A 2C47A 3PP1A 1IAJA 4FGBA 4PUZA 4NTTA 4BIEA 1Z57A 4AX8A 1OITA 4GH2A 4ERKA 1XKKA 2WQMA 5EQPA 4XP2A 5LOHA 3ZRMA 4WKQA 3QTSA 4RT7A 3G6GA 5BQ0A 3GFWA 5LVLA 3PVBA 4HVGA 2F7ZE 2UW3A 4FICA 1XH9A 2C30A 3RBWA 3KULB 5CAOA 2XEYA 2BAQA 4H36A 1W84A 4NCTA 1RDQE 3SAYA 4Y73A 1URCA 2GTNA 5EYKA 3R7UA 3BLQA 3ACJA 3IW6A 4QYGA 4R7IA 4EEVA 2CGUA 2WTJA 1UVRA 2JBOA 5C26A 2C1AA 4RVKA 3W16A 4YTFA 2OJIA 1YOMA 5CSXA 5M56A 5IF1A 4R3PA 3QC9A 1H01A 5DMZA 3ZC6A 4E8AA 2KTYA 4JG6A 2VX1A 3HV6A 4JRVA 4LV5A 5ANOA 5KO1A 3ZTXA 1M14A 4QMQA 1XBAA 3C9WA 4ITJA 2YA9A 1Q8WA 1Y6BA 2W7XA 3CE3A 3BEGA 3R7GA 4R1YA 4WNKA 3AMYA 3SXSA 3GQLA 4HNIA 3IECA 5EYMA 4DITA 4C4JA 3VHEA 2Y6OA 3EL8A 2R2PA 3VNTA 3E62A 4OT6A 3C0GA 3NIEA 3SC1A 4Z3VA 5IQBA 3BLHA 5J7HA 3UPZA 3K5UA 3UZRA 2B55A 5I5ZA 3EN4A 4IXPA 5A4TA 2YERA 3ZO4A 4R8QA 3ORKA 1P4OA 3VAPA 2GMXA 1KUTA 3PWYA 4N4SA 2P0CA 5BYLA 4ZJVA 2R7IA 3ALNA 1OKWA 3PG3A 5L2IA 2EVAA 5TKDA 4IM0A 3IW7A 4MH7A 3DZQA 4DH3A 3B8RA 3BE9A 1MUOA 2F49A 5CF4A 2Z60A 5CEKA 5KNJA 5L6OA 1J1BA 4IDTA 4IAFA 4TNDA 1JAMA 3BBWA 1OVEA 3BU5A 3OWLA 5A4QA 4F70A 4EOLA 5DE2A 4ZP5A 4G16A 3TI1A 5HTIA 5ETIA 1ZRZA 2IW9A 3NNUA 5HIBA 3AXWA 3KCFA 3OUNB 5JQ8A 2V5QA 4MF1A 4DCEA 3A99A 4OTRA 3VS7A 4K1BA 4ZY5A 1PXOA 4O0WA 3DU8A 4FKQA 4W4VA 5KZ0A 2IVUA 5HGIA 4JR3A 2EXMA 4LRJA 3TTIA 5EQYA 4V04A 4AFJA 2XNNA 3GC0A 4MWIA 3UOLA 3QQLA 4GFGA 3MWUA 4Q2AA 3FWQA 3D94A 4JX3A 4EK4A 4EOPA 4WSQA 2OFVA 4J99A 2X39A 2YIQA 3AC8A 4ACMA 3ODYX 3WF7A 2EB3A 2XYUA 4TWNA 3ZZWA 3GC9A 4E3CA 3FY0A 1STCE 1Y8GA 2RFSA 3LMIA 1ZOGA 4L42A 5EG3A 3AMBA 4WNPA 4FYNA 4E20A 4O0TA 4XV2A 2Y4IB 4G31A 2C3KA 5A6OA 4CXAA 1FMKA 4I24A 3IQ7A 4RX9A 5IMEA 4W8EA 4OTFA 4Z7GA 2XNPA 5HTBA 4FV6A 3FKLA 4DFBA 3QLGA 2WIHA 2OK1A 4FODA 5AX3A 5IUGA 4O84A 4LM5A 3EFLA 5DT3A 2BDJA 3CY3A 3OY1A 4G3FA 5FXSA 4FIJA 5AUZA 4MF0A 5CSPA 1H1QA 3MVJA 3EIDA 5AUVA 1L3RE 4E5BA 3QF9A 4FT3A 5CXHA 5EOLA 2XZSA 4W9WA 3P23A 3PXYA 3QKKA 5D1JA 3REPA 3OVVA 4II5A 3ORNA 3U8WA 3HV5A 2ZV2A 4FEXA 2A2AA 3W33A 3ATTA 4BKJA 2WTKB 2FO0A 5EKNA 4JLCA 3F7ZA 3O17A 1ZAOA 3VHKA 4ZLYA 2BRGA 3LAUA 2CN5A 5H9BA 2PE0A 1NVRA 3QD2B 4BDBA 3UODA 5AM6A 2VO3A 2B0QA 3KK8A 2E2BA 1K3AA 1YHWA 3QRUA 3JY9A 5CASA 2UZNA 2ZYBA 1KWPA 2C5OA 3TWJA 3PDTA 3R28A 4QMSA 3COMA 4DFUA 4IJ9A 1PHKA 1P4FA 3DB8A 3KY2A 3UIUA 3NRMA 3SOCA 5I3RA 4M97A 4CTBA 3QTRA 3FMLA 4E6QA 3M42A 4C37A 3E8EA 4PQNA 4E26A 2OIBA 1W0XC 2EU9A 4NIFA 4TYHA 5J9YA 1S9JA 2F7XE 3IO7A 3NW7A 3FL5A 3RNIA 3JXWA 1YXXA 4HYUA 4BBMA 4OAUC 5E1EA 4O7TA 3C4CA 3F5PA 2W1CA 4CZYB 3C0HA 3HRBA 1PXMA 2OXYA 1E9HA 3HLLA 2XIZA 4UMTA 3NYVA 1FINA 1CKJA 3TZ8A 2VWZA 3VS0A 4ZSJA 3O96A 4GU6A 4IW0A 5ANGA 3SW7A 3FBVA 2XJ1A 3ORMA 4J8MA 4JQ8A 5H8BA 4AW1A 4DGOA 3D83A 4PMSA 3CBLA 3PWDA 1Q61A 1FVRA 3NCZA 4BKZA 5IU2A 4Q9SA 3DXPA 4FV7A 5C27A 4E5AX 5IQIA 5GINE 4Z7HA 4BWKA 2GS7A 2ITTA 3RWPA 4EYMA 4L3JA 4KS7A 2BILB 5AM7A 2R5TA 3OBJA 1G3NA 4I6BA 2QR8A 3JPVA 1Y57A 4NYEA 1A9UA 3FQEA 5LCJA 3BHVA 3BBTB 4YNOA 4B7TA 2QU5A 4YC8A 4EK5A 1UU3A 4ENYA 3VVHA 2YHVA 2ZDUA 1R3CA 4F0GA 4D4VA 2I0VA 4EKLA 3L8XA 2QO9A 1QPJA 3T9IA 3QZIA 4C34A 4XG2A 5LQFA 3QTXA 1V1KA 2WEVA 2BZKB 5AAEA 1GAGA 3MA3A 2VNYA 1X8BA 3DDQA 5B2KA 4C58A 2C6EA 1E1XA 3ZLXA 2UZOA 2WPAA 2RIOA 2XCHA 2VTPA 3EJ1A 3R8PA 4BZNA 1VEBA 4CKRA 3NR9A 5AP1A 3GCVA 3P7CA 3QTQA 2QHNA 1ZY4A 3SV0A 3QCQA 2ZMDA 4FKGA 5ACBC 3EQDA 3ENMA 2YIWA 3G9NA 3NAYA 4FG8A 4PDPA 3PRFA 3PYYA 3SGCA 4QRCA 5LMAA 3JY0A 3NIZA 2GNHA 3GNIB 2F2CB 5CY3A 5J95A 2CKPA 4GT4A 5JFWA 4YJPA 2PE2A 4DFXE 1OKZA 1H28A 3MV5A 4GL9A 5L3AA 4GYIA 4KIKA 4BDKA 4CFUA 2WU6A 1JWHA 5LXMA 3LFQA 4YPDA 4CFXA 4WBBB 3OFMA 4BR3A 2J7TA 4B8LA 3HEGA 5DN3A 2O8YA 5DBXA 3M11A 4RX8A 1ZMVA 2W5HA 4FIFA 1OM1A 4DC2A 4L8MA 3VJNA 4EONA 3HVCA 3IDBA 5F94A 2R0UA 3ORZA 3EB0A 4LMUA 4KIPA 4EOJA 4BYIA 3CJGA 4U43A 4U79A 4EQUA 5A9UA 4CG8A 3G0FA 4EH6A 5DNRA 2PSQA 3WZEA 1H0VA 4RX5A 2X7FA 2UVZA 2JD5A 4A4LA 3MTLA 3PLAE 5EW9A 4C4IA 4RJ8A 4ZY4A 2B54A 2JIIA 2NRYA 2G15A 5A46A 4JDHA 2XIYA 4F6WA 2WTVA 4L3PA 4XRJA 4E73A 4ZSEA 3HAMA 3QQFA 3FMJA 2UW4A 4CLIA 4QMNA 4RIXA 3ZRLA 2VGPA 4QMWA 1JSTA 3V8WA 4C62A 4OTWA 2FB8A 5JRSA 3TV6A 2IZTA 1Q3DA 2HZ4A 1U5RA 3HYHA 1OKYA 2CLXA 2YITA 3COHA 4Y83A 4AWIA 3PSCA 1UKIA 4IVAA 3ZONA 4RJ6A 4H05A 3W2CA 2PULA 2X9EA 4S2ZA 3FUPA 4FV2A 3PVWA 4I4FA 4O0VA 5HD7A 2A1AB 1Q8ZA 3UVQA 2OFUA 1H07A 4FG7A 3DTCA 2XJ0A 2IVTA 2HYYA 3G9LX 3KB7A 4GK2A 5JZJA 1KE8A 3V5QA 2VWUA 5EHOA 4HZSA 2QG7A 5IKWA 1OECA 4FKPA 4K33A 4FTRA 4YBJA 3QRJA 3ZYAA 3TN8A 5AUWA 4Q5HA 5E8YA 4MXOA 4FTKA 4ZTHA 5CF6A 2FSLX 2PVMA 2CDZA 2WQBA 1UV5A 1I09A 2EUFB 4YJRA 4NCTC 1VZOA 2CHLA 4I6QA 2PL0A 5E92A 5CNOA 3WBLA 2PZRA 4EBWA 4CVAA 3G51A 5CSVA 1PRYA 5JQ5A 2VO7A 3RK9A 5A4EA 3O7LD 1PXIA 2QOCA 3KXZA 3F7WA 1ZOEA 4DTBA 3EZRA 4LMNA 2SRCA 2ZOQA 2V7OA 3L9MA 3OCGA 3A7HA 4LV8A 1REKA 5FUTA 3QYZA 4KB8A 4JQ7A 4IWOA 1OB3A 3LJ0A 1M2PA 1OIRA 5E8TA 5LVNA 1YDSE 5ANJA 3GOKA 3EL7A 3ANQA 3IPHA 1Y91A 3I4BA 4F9BA 2PVFA 5IA2A 5E8UA 4K11A 5D12A 5IISA 2VWIA 4PF4A 4OTDA 4V0GA 2R3KA 4YP8A 3RCJA 3OWKA 1YI4A 3DJ6A 5I3OA 4CT1A 2ITXA 3BU3A 1M52A 3EN9A 3LQ3A 5EH0A 3E3BX 4R1VA 4PDOA 2WOTA 3SA0A 1UU7A 4OTGA 4RIWA 4IAZA 4M66A 4M15A 4TL0A 4UWYA 5H3QA 1ZMUA 4IVDA 3NZ0A 2X81A 1IEPA 4RJ4A 4AGWA 2YWPA 1OI9A 5A4LA 5LMKA 5HX6A 3KRRA 1NXKA 3FYJX 1SVHA 5CNNA 5CZIA 4EH4A 3WE4A 2YEXA 3GXLA 3Q04A 5HZNA 3FQHA 5DLSA 2VU3A 3N9XA 2YIYA 3QZGA 2OLCA 2DQ7X 4FTUA 5CI7A 3EZVA 4BCNA 3JR1A 4M69A 2BTRA 3HECA 4X3FA 4DCAA 3KF4A 3KRLA 1ZOHA 3B2WA 2R7BA 3D7TA 2C3JA 2HCKA 3TZ7A 4R77A 3VRZA 3ZDUA 4DT8A 4TT7A 1WVWA 3PY3A 5L8KA 4I20A 2FA2A 2QD9A 2FH9A 3LCKA 4O38A 2ZJWA 4XYFA 2BFYA 1DI8A 1MRUA 4IANA 3HV4A 5AV0A 4RG0A 3WI6A 2C6IA 2JC6A 5A14A 2XKFA 4L68A 4ACDA 1W8CA 2WB8A 1GIJA 2BMCA 3MPAA 5DHJA 5FEQA 1SM2A 3I6WA 5C8NA 4N6YA 5HE0A 5BVKA 3LHJA 3NNVA 3CEKA 3W32A 2OSCA 1PYXA 2CN8A 4OT5A 3RCDA 3GVUA 2A0CX 3FI3A 4QP1A 2EB2A 4FK6A 4HPTE 4UBAA 3KXXA 2X6EA 3VW8A 3ZUUA 2ZM3A 1KE6A 5KMIA 3TNWA 3KMWA 4BCGA 3DBFA 3JYAA 3UOKA 5FDPA 4CFVA 3EN7A 4E6CA 4CYIA 4I1ZA 3OP5A 4S30A 2ITWA 3AGMA 3E88A 1CKPA 2XIXA 5M4FA 3D7ZA 4AZSA 4ZLOA 2Y4IC 3UPXA 2GNFA 3QD3A 4OLIA 2QLQA 2H96A 3DDPA 3KFAA 3DPKA 4J97A 4RGJA 2BTSA 2WTIA 4MNFA 3TKHA 4BTJA 3F66A 2OKRA 4JDJA 3FSKA 4FK3A 4IM3A 4CCUA 4D2RA 2Z02A 4QP8A 2XF0A 4WBOA 1V0OA 3AC1A 3FMHA 4IB1A 3B2TA 4FOCA 2FSOX 3DK6A 4QMXA 4YO4A 2ITOA 3D5VA 1G8SA 2RFDA 2WMXA 2R9SA 1UNGA 5HBHA 4GKHA 2GNGA 2C1BA 4EK8A 2XKCA 4X2KA 2YLFA 4C4HA 3G2FA 5HLNA 1PKDA 3RZFA 4FV8A 3LW0A 1V0BA 4I5MA 3TT0A 3OBGA 1H26A 3MIYA 4Y46A 5EDRA 4ITIA 1QPEA 4DGMA 3OF0A 4FOBA 2DUVA 4C61A 1U54B 4ZSGA 4TYJA 4BDIA 4YSMA 1SNUA 4AW5A 3NPCA 4FTCA 4AOJA 3Q3BA 3VBTA 3V01A 4H1JA 3ODZX 4AA0A 3ATSA 1UNHA 5CWZA 3UMWA 2R0IA 1KE7A 3O51A 3KN5A 2YCQA 4J7BA 4YR8A 5KBQA 3AC2A 1YWRA 5HBEA 3S95A 2Y8OA 2XVDA 5ANDA 3ZSHA 2CKQA 2ITUA 5HD4A 3EQGA 3LXPA 4IIRA 4O7LA 5FTQA 3SLSA 1YDRE 3E8NA 4KA3A 1IASA 4JBPA 5BVNA 1XH5A 5C8MA 3R7YA 2R4BA 3EYHA 4FSWA 4FTQA 4AGUA 4DAWA 2R3NA 4E4XA 3DQWA 5C03A 3CTHA 2VTJA 3QTUA 4MKCA 4IM2A 1GZNA 4BDJA 3BHYA 3IDPA 4B9DA 5IUIA 3EQBA 3C1XA 3HUCA 4GS6A 4RA4A 3I81A 5FGKA 4BDAA 4O7VA 2AC3A 2P4IA 3ROYA 2W1IA 4O7WA 5DT0A 4E4LA 3PA4A 3T8OA 4YHTA 3OZ6A 4HZRA 4RZVA 3VS1A 4R5SA 4AGCA 4DGGA 3NW5A 3Q5IA 3DGKA 1LUFA 4H3BA 4OR5A 4PTEA 3F9NA 2CGWA 2XKDA 4RPVA 4ITHA 2VTHA 2XP2A 3Q4TA 3RHXA 2B52A 2KULA 2WELA 3BLRA 3COIA 2XBJA 4YPSA 3RP9A 4JL9A 2BRNA 3TNPC 2UW6A 3ZFYA 4I21A 4RVTA 2F4JA 2PVNA 3BZ3A 3VUHA 3MVHA 4AG8A 5K4JA 1JLUE 2BVAA 4RC3A 4YBKA 1TQMA 5EM5A 3HGKA 3TNQB 4ARKA 3OCSA 3QA0A 2VTQA 3ZO3A 3H9RA 3NNWA 3ZUTA 2NP8A 3P9JA 5EM8A 3R7VA 1S9IA 3C4XA 1REJA 4G6LA 4IJPA 1LEZA 3C4FA 4NJ3A 2J5EA 4OBQA 3SOAA 3RKBA 2UZDA 2BZJA 4FTOA 3OW4A 4EH3A 4A4XA 5E90A 4FKJA 4K6ZA 1XBBA 3KXGA 4E6AA 4IACA 4AXAA 2VTNA 2VX0A 1W82A 4XMOA 3QQUA 3LCSA 2B7AA 3RPOA 4TYHB 1R0PA 2BPMA 3PLSA 3H4JA 2JKKA 5F4NA 1IAHA 1PMUA 5AR5A 4ALVA 5CZHA 1WBWA 1ZXEA 4AT3A 2GNLA 4BF2A 4L53A 4F1MA 1ZYDA 4APPA 3D15A 4HVSA 2ZM1A 1DS5A 4F4PA 5KMOA 1M7NA 1XO2B 3GP0A 5EW3A 2PVJA 4C4EA 5KHXA 4BHZA 2XK6A 4F65A 5AUTA 5T6KA 4EQMA 3MFRA 4PPAA 4QTBA 4A7CA 3DTWA 2VGOA 1XBCA 2J90A 4QT1A 4PMMA 5BVWA 4C0TA 3ACKA 3FZPA 1PMEA 4GJ3A 4K9YA 5E4HA 4EZ5A 4EWHA 2E9VA 2G01A 4QOXA 1P14A 2QOLA 2RFNA 3FQSA 3AGLA 3EFJA 5HE2A 3TUBA 3HDMA 4I5PA 5CF5A 3DNDA 3KRJA 4C3RA 3HUBA 1ZWSA 4RVLA 5KMLA 4BC6A 2GNIA 3C51A 3R9DA 3FLYA 1H0WA 3MI9A 3OWPA 5DRBA 4OGRA 3OC1A 2W05A 4MXCA 3GENA 1YW2A 4ZS0A 2GPHA 2GQSA 3LXKA 4FVPA 4GFMA 2UW8A 3I7BA 4AP7A 4C7TA 2NO3A 4TPTA 4USDA 3GCQA 4ZTNA 4EH2A 3FMDA 4U0IA 3V6RA 3QCYA 2WMUA 2YZAA 3BYVA 3ZLYA 5I9UA 4IMYA 4N0SA 4WD5A 5AWMA 3VN9A 1IR3A 4F0FA 5HE3A 1U4DA 3QKLA 1Y6AA 4YZMA 1XH4A 3PY1A 2QU6A 3IGOA 5J87A 3W18A 3F2AA 2AYPA 3Q6WA 4M67A 4XBUA 5HO7A 2C0IA 4R3CA 4D5HA 2QONA 1YHVA 2BDWA 1PY5A 2ACXA 4I92A 5HG5A 5TOZA 3QHWA 4D2PA 1H4LA 2PE1A 3FZOA 3UOHA 2CJMA 3FPMA 4KUJA 2W0JA 2W4OA 4L00A 3UQGA 4YHJA 3LFCA 2YCFA 5BX0A 3FMKA 4K77A 4UALA 4D4YA 2QR7A 4B0GA 3A8WA 3R8UA 2I7QA 2I0YA 4IEBA 4XP3A 2BFXA 4QNAA 4FNZA 1DM2A 2O0UA 4BFMA 3TTJA 4E6DA 3R9NA 4HPUE 3P5KA 4GT3A 3QD4A 5J8IA 4F09A 2UUEA 2BAJA 3DOGA 4D1ZA 4ZLZA 3DA6A 3BKBA 3UOJA 4D0WA 3IKAA 1G8AA 3ULIA 3DJ5A 2X2MA 1KOAA 5CYIA 4RC2A 5HICA 5AJQA 3RM6A 3MSSA 4LQMA 5HU3A 4FC0A 2VTAA 1O9UA 3R8ZA 4TWPA 4XRLA 3ZFMA 4CFMA 4CMUA 4EH5A 3LMHA 5C01A 3LPBA 1TVOA 3FLWA 4MQ1A 4CTCA 3JUHA 5HU9A 3LM5A 2IZRA 3DKFA 4D1XA 3RK5A 3Q32A 3TKUA 2OWBA 3DBEA 3F3VA 5KMMA 4C33A 4P2KA 3LQ8A 4IZYA 3DBDA 4ORKA 2BALA 4TRLA 4DEGA 2W1DA 4RJ3A 4BL1A 3UNKA 4EHVA 2F2UA 3I0QA 2JDSA 2X8DA 4DFLA 3LCDA 5KKRC 4J96A 5CANA 4XP0A 2YIRA 4GRBA 2XIKA 2YAAA 5BUEA 3HMNA 3CY2A 5CXZA 4DBXA 3BWFA 2Z7QA 2OO8X 1PXPA 3I5ZA 5IMXA 2OH0E 4MXAA 4EH7A 3BPRA 4BHNA 5ANEA 3MA6A 1ZARA 4QNYA 4RIYB 4TYIA 1NA7A 5C9CA 5K9IA 4QMPA 2W5BA 2W9ZB 3W10A 4BCMA 4UMUA 3RWQA 2E9PA 4XX9A 4KNBA 2G2HA 4F63A 2ZMCA 4EZ7A 3AT2A 3S4QA 4BCJA 1UU8A 4J71A 5FP5A 3U4UA 1F3MC 3V5LA 3MVMA 3ZUVA 2UVYA 3C13A 3F69A 3RZBA 5GZ8A 5IEVA 4NEUA 1Q24A 3UMXA 3MH0A 5GIPE 4HGSA 5AADA 4PV0A 4UZDA 5BPYA 3Q60A 2XM9A 1KE9A 4RFZA 4JBVA 1XH6A 3GC7A 4W4XA 4YLKA 5J1WA 3UVRA 2JDVA 1FGKA 3BYSA 5CALA 4JBQA 1ZY5A 2GU8A 1Q8TA 3R30A 2QURA 4BDEA 3LOKA 4EUTA 3RAWA 3UNZA 4BZDA 3MDYA 4JG7A 5A3XA 3RTPA 2V0DA 1Q5KA 3S1HA 4C2WA 4H39A 2Y0AA 1RE8A 4QMMA 4RA5A 3RPVA 3U54A 3ZBXA 5CAQA 4XS2A 2WQNA 2J6MA 3KF7A 3GCUA 3QWJA 3RALA 4DH7A 4DYMA 3GU5A 5BNJA 5TT7A 3H30A 3AC4A 4WG5A 3EFKA 4FKOA 1MQ4A 3WF8A 2OJ9A 1XJDA 4O0YA 4Q9ZA 2FSTX 4OTQA 5HKMA 3PSDA 4IAKA 4OBOA 3R22A 4YJVA 4D4RA 3SQQA 4D2WA 1TQIA 3QUDA 3V5PA 5EQEA 5CU6A 3V5TA 4D1SA 1O6YA 3NUNA 3FZ1A 1JBPE 3FC1X 5IQFA 3P0MA 1HCKA 2W1ZA 3Q9ZA 1RJBA 4ALWA 3E8DA 2HY0A 2OZOA 4DN5A 4ZTLA 2R3GA 4YZBA 4BGHA 2R3MA 5DR2A 2C5YA 3LQ5A 5FTGA 4XOYA 4B8MA 1PKGA 4IDVA 4JX7A 4WO5A 3WILA 4RWJA 5IUHA 4QD6A 3Q2MA 4LYNA 4NT4A 4O6EA 3GCPA 2GQRA 5J5TA 4DG2E 5GZAA 3QU0A 3MY0A 3UZPA 3CKWA 5HORA 3OCTA 1CMKE 4TKSA 2QOFA 4RWLA 3VS3A 4X2GA 2YJSA 1GY3A 1OPKA 3NCGA 4U9AA 3KREA 3HX4A 4JIAA 3DBQA 4S33A 4J1RA 4D2TA 1WBTA 2YDKA 3MFTA 2UZUE 3V3VA 1UWHA 4XG6A 5E8VA 3VS6A 3C4WA 2C69A 2W4KA 4IAIA 4XH6A 4U8ZA 1UKHA 3TV4A 3RI1A 2HW7A 3SHEA 4DE4A 3A2CA 3MTFA 3MVLA 4XG3A 4RX7A 2P3GX 3NNXA 1MQBA 1RW8A 3LVPA 4R6VA 4BTKA 2G2FA 4D9UA 4QTDA 4FT0A 2JDRA 5CT7A 1OL6A 4O2ZA 2PVKA 4I0SA 3LFFA 3M2WA 4XV3A 5HO8A 2YDJA 2PPQA 2JKQA 4CQEA 1NY3A 3F5UA 4BZOA 3DQXA 3QRKA 3CPCA 5F1ZA 5L2SA 4U45A 2JDTA 2OU7A 2WTDA 3IK3A 3GU4A 4L7FA 3R6XA 2VUWA 5DIAA 3DBCA 3R00A 3BYMA 4K8AA 2XK9A 4GIIA 5LCKA 3D0EA 2CMWA 2B9JA 3ZSGA 4NU1A 1WMKA 1IA9A 3O8PA 1WAKA 2W9FB 5HVJA 2ZDTA 4HVDA 3PJ8A 4GV1A 3QWKA 4MEDA 3H0YA 3BYOA 4HYSA 5TO8A 1BLXA 4MXZA 3VO3A 4BI2A 4UN0C 4KWPA 2R64A 2IWIA 4O81A 2QOQA 3ORXA 4ZMEA 4BDCA 4CD0A 4R5YA 4FSRA 4A07A 1WVXA 4QP9A 2PMNX 2PZ5A 3C5UA 3ZC5A 4AA5A 2C0OA 2VAGA 4JI9A 4XJ0A 5I9YA 4MD7E 4BCKA 2B53A 2YM4A 3QXPA 3VQHA 5LWMA 4TW9A 3UE4A 4L45A 2WD1A 2Z2WA 4BKYA 3PE2A 1GNGA 3PJ1A 3BI6A 3PPKA 4ZTQA 3MPTA 4EWQA 4YJUA 3VBWA 4ANLA 1B39A 3II5A 3OMVA 1TKIA 2PUUA 3RPYA 1PXNA 2JBPA 3CD3A 3ZFXA 3I60A 5E9EA 3E3PA 3LCOA 4RFMA 4AZFA 1WCCA 1J7UA 5EDQA 3ROCA 4EOIA 4AOIA 4U5JA 2OF2A 4WIHA 3ZRKA 2IW6A 3S3IA 4A9RA 2GCDA 4FIIA 4IC7A 1YXTA 3MYGA 2UV2A 3TIZA 3DB6A 2E9OA 3QKMA 3OHTA 1JKKA 2R3OA 4G34A 2FSMX 3PXZA 4ZXTA 4IB5A 4C36A 4O0RA 3IDCA 2QOBA 3A4PA 4KD1A 4BGQA 3CS9A 3W1FA 1GZKA 3D5XA 2VWYA 3P7BA 3VUKA 4Y5HA 4RLLA 4EC8A 3NLBA 4X6QC 5JFXA 5CAVA 4L44A 4NH1A 4X3FB 3DKGA 4CNHA 3TXOA 5J1VA 2UZVA 3EQHA 3NUSA 4DBNA 1BYGA 3KK9A 4X2JA 3HP2A 2WO6A 4CRLA 3CGOA 1BL7A 3WZJA 4IBMA 3VUTA 3AD4A 4LOOA 3V5JA 5FXRA 3IONA 3F3TA 4LUEA 1EH4A 3KU2A 3C5IA 4FGRA 2BAKA 4YURA 5AAFA 3R1YA 2IO6A 5HVYA 2J50A 4G3EA 5HG9A 5EYDA 3CQUA 3ZLWA 5HHWA 3BV3A 2AC5A 5H8EA 2JDOA 3EMGA 3U51A 4RIWB 1OKVA 2QVSE 2R3RA 3V8SA 3WYXA 2XRWA 3WE8A 4GMYA 1NT2A 3PA3A 4E1ZA 2XK8A 4BCFA 4D5KA 2F9GA 3HDNA 1JKLA 4WOVA 5CAUA 5HQ0A 4NL0A 4V0GB 4BN1A 2UW7A 2Z7SA 1J91A 4NKAA 4FT9A 3UNJA 5A54A 5D7AA 3DV3A 3ZSIA 3UG1A 4F9AA 2QOOA 3DLSA 3BX5A 1ZYLA 5EW8A 4QMYA 5KE0A 3W2QA 3S2PA 5M4CA 4BWXA 3TJCA 3KXMA 2Q83A 2HAKA 1F0QA 2C0TA 3EOCA 5CU2A 2VTLA 3SDJA 4CKIA 5EOBA 3OT8A 3TM0A 3TDVA 2QOHA 5ITAA 1KSWA 3QHRA 3E5AA 5EK7A 4U40A 2OJGA 3PJCA 4GVJA 2ZVAA 3K3IA 2XK7A 4XG4A 4RC4A 4O7NA 3PP0A 2PZPA 5HCXA 3NGAA 2ETKA 2UZBA 4ANOA 4NM0A 4FVQA 1H27A 3ZH8A 1A48A 1SNXA 2YABA 4LGGA 3R9HA 3ZO1A 3F82A 4E7WA 3TCPA 4IB0A 1XH7A 1BMKA 2HZNA 2P33A 1QMZA 2OW3A 2X0GA 3KRXA 3QX2A 3Q4CA 4MBJA 5DT4A 1ZZLA 4AZVA 1YWVA 5ACKA 3A60A 3QQGA 5L2WA 2DS1A 5HG8A 4BTFA 3THBA 3PIZA 4ANNA 3F2NA 3VF9A 4NM3A 4RQVA 2CNUA 3BHUA 1IA8A 3V8TA 2P55A 1JQHA 4R7HA 3QFVA 4HGTA 5HE1A 3E87A 4WHZA 3R9RA 5BUIA 4LG4A 3IG7A 3TEIA 4G9RA 3WIKA 4IFGA 2WMSA 2ZV7A 3NDMA 4KKEA 3WARA 5FG8A 4C4FA 3PG1A 4Z16A 1U54A 2CCIA 3QQJA 4FKVA 4C57A 2XEZA 3L9NA 4I94A 1PF8A 4DEIA 3P78A 5DR9A 2CNQA 2X4FA 2CNVA 4O82A 4RIXB 4RWKA 2WMVA 4F0IA 4HOKA 2YZLA 4D58A 3OS3A 4RFYA 1NVSA 3LIJA 3EQIA 2GFCA 3HMMA 4FL2A 4RSSA 3JVSA 4HJOA 3PRIA 4FVRA 3MW1A 4KAOA 1YVJA 5BVOA 2LGCA 3F3ZA 2JAMA 4YJSA 2AUHA 4IZ7A 2HY81 5DFPA 4A9UA 5BVEA 1JKTA 3HRCA 4E93A 1BX6A 4S34A 1WBVA 2J5FA 4GUBA 4H3QA 1YHSA 2WMBA 4M68A 5CLPA 3VBYA 3EKKA 3KRWA 1DI9A 4YSJA 2WNTA 4IAYA 2R3LA 4L43A 2C4GA 2XUUA 3DAJA 4FI1A 1FVVA 2QODA 3JVRA 5CSWA 3P7AA 2QC6A 5FDXA 2XK4A 4F9CA 3K5VA 2I0HA 2CCHA 4ZZNA 2GFSA 5CEOA 3G15A 4P4CA 5D41A 3R83A 5AIKA 4WNOA 1WFCA 4Y85A 4NM5A 5M08A 5AV2A 4DH5A 2QKWB 2QI8A 2ZV9A 4U3YA 5AA8A 4EJNA 5CS6A 5E91A 3CP9A 3HMIA 5K4IA 5BVFA 3NEWA 2WKMA 3ETAA 3KVXA 4L6QA 4D55A 4YTIA 3QX4A 5JGDA 4L52A 2VN9A 3DFAA 4PL5A 4WSYA 2WZJA 4GKIA 5K5NA 1CM8A 1KE5A 4FKUA 3UIMA 4OW8A 3HRFA 1Z9XA 3DXNA 2YACA 4MK0A 4U97A 1R1WA 2JGZA 5IH4A 3R04A 2VNWA 4O7YA 4FX3A 3MBLA 2CPKE 5HO6A 1WVYA 3FMMA 3DFCB 2HELA 3I79A 3MH3A 4RRVA 2ZB1A 5AR8A 4QP3A 3E93A 4WRGA 4ANQA 4M0ZA 5I4NA 4ZY6A 3PVGA 4ACHA 5BYYA 2F57A 4KBKA 3A7GA 3GU8A 1K2PA 2B4SB 4K2RA 1YOJA 5CQUA 3U6JA 5CEIA 2WMWA 2W5AA 5IEXA 4DTKA 4E5WA 3D7TB 4R7BA 2QNJA 2Q0NA 3FLZA 2PZYA 5LVPA 3DKCA 4FYOA 3R71A 4ZTRA 4M69B 3FMEA 4CYJA 4ASDA 2ITVA 3O2MA 3ITZA 3FYKX 3ALOA 3FE3A 4J95A 3QD0A 5FBNC 4IZAA 4ASZA 4YGAA 5JH6A 4DEDA 2J0MB 5C4LA 3CIKA 3HA6A 1BI8A 2Z8CA 4UY9A 4PNKA 4BVUA 3BWJA 3R2YA 1SVEA 4F7JA 5AUUA 4ASXA 4HYHA 2E9UA 3CQWA 4QYEA 2HENA 3PPJA 4CFNA 4FTTA 5I9VA 3PFQA 2FYSA 1APME 3PXQA 4EI4A 4IWQA 4GJ2A 3I6UA 1PXJA 4FR4A 4HCTA 5AV3A 4BCOA 3AD6A 5HNIX 4XNEA 3ZXZA 3SXFA 2QOIA 3Q6UA 5FM3A 2OXDA 4NFMA 2JFMA 2EXEA 5CU3A 4TN6A 2JITA 2WMTA 3RAKA 4AE9A 4BICA 1BI7A 1PJKA 3Q5ZA 4O83A 3BIZA 1J1CA 2V62A 3FLNC 2W1FA 1URWA 2UZWE 4PDYA 4G5JA 4ZTSA 5DI1A 4NKSA 3W8LA 4O27B 3ZMMA 4F1TA 4AN2A 2XNBA 3AC5A 2HWOA 4Y72A 2XK3A 2XS0A 2UVXA 2XBAA 3R0TA 4QMZA 5G1XA 5KUPA 1XH8A 3TKIA 5JGAA 5LJJA 2H9VA 2ONLA 1KV2A 2X1NA 3MESA 3HAVA 3NWWA 4C59A 5HVKA 4MCVA 4IWPA 4EK6A 5JZNA 3P86A 3JS2A 4BWPA 1ZYCA 4QTEA 5J9ZA 3ZU7A 2VRXA 3UO6A 1WZYA 5J7BA 5HLWA 4O0UA 3W2RA 4BDHA 3L9LA 1NVQA 3KVWA 4F99A 3QZFA 1YI6A 2QO2A 4HGEA 2JKOA 4JG8A 4KS8A 3R73A 5EFQA 3V5WA 4BTMA 1YWNA 4ZMFA 2OZAB 2ZAZA 3L1SA 1FVTA 1SZMA 2PU8A 4ZS4A 3B8QA 3EQFA 1OL5A 3D4QA 3QA8A 2WAJA 3NAXA 1UNLA 1ZYSA 4GFOA 4ZZOA 2W1EA 2JFLA 4EC9A 4O96A 4J98A 4DEHA 2C3IB 4CQGA 1Q99A 4FZ6A 4D2VA 3RK7A 3N51A 5LWNA 3Q2JA 1OIYA 2HWPA 3O71A 5AP6A 4UB7A 4AT4A 1WBPA 4M7IA 3S00A 5DVRA 4PMPA 4CMTA 3TDWA 2W1HA 1GZ8A 4FIHA 2QG5A 4BCPA 1BL6A 5B2LA 5AMNA 4FV9A 2XA4A 4HW7A 1ERKA 2RG5A 3HMOA 3ZHPC 4I6HA 2J51A 4R78A 2XMYA 5HG7A 1U59A 3UO4A 1M2QA 3EQCA 5IQDA 3Q52A 3R7EA 1FPUA 4F6SA 5A6NA 4PL4A 2R3QA 3IW4A 4MTAA 1SMHA 2GTMA 5HLPA 4FG9A 4WG3A 4EQCA 3WZKA 3ZOSA 2YISA 4DFNA 5AR4A 5FWKK 4ANMA 3VIDA 5JKGA 1XWSA 3UTOA 4G2FA 3U6HA 4MQ2A 3BGPA 4IVCA 2O64A 4DGLC 4IQ6A 3R1QA 4ACCA 3N4TA 3L9PA 3FI8A 3V6SA 4CKJA 5E7RA 5KBRA 2XNEA 2IVVA 4KBAA 4QMLA 4KIKB 4JQEA 2OJFE 5HOAA 4F08A 4YZ9A 4B99A 2O65A 3MN3A 4CGAA 5CU0A 5B2MA 3OEFX 3PA5A 4YLLA 5CT0A 1UA2A 4L67A 3PXRA 1SVGA 3LFNA 3DS6A 4XUFA 2ITNA 3FI4A 3LFAA 4NTSA 4QTAA 2W96B 5T3QA 4WRSA 3R8LA 4EL9A 3KMMA 4O6LA 2YDIA 1PXKA 5E8WA 1GJOA 5M06A 5L4QA 4LGDA 3MJ1A 3U87A 3GQIA 2VTTA 4U81A 5AP2A 3SW4A 3VS2A 3N4UA 3QUEA 4HCVA 4ENXA 4FIGA 3H9FA 5IQHA 2PYWA 3TZ9A 4CFWA 3VUIA 5IQEA 5M09A 3TZMA 3U55A 4GSBA 3CJFA 4PNIA 4BBFA 2WHBA 1Z5MA 4CV9A 4MXYA 3DXQA 4FZFB 2YJRA 5HCYA 2FUMA 2GS6A 4K18A 1K9AA 5JFVA 3LJ1A 2WMAA 3NX8A 3WIGA 2W17A 2RKUA 3AMAA 4KINA 5GHVA 4BCIA 1YXUA 4FUYA 4HGLA 4XBRA 3NVKI 5LMBA 3E7VA 3RM7A 3EQRA 3BRBA 3M1SA 4A9SA 3AT4A 3BV2A 4YJTA 4XLIA 4DEBA 5A4CA 2CKOA 2WGJA 2WFYA 3DAKA 3GI3A 3OUKA 2H8HA 4PP9A 1PW2A 4LL5A 2X7GA 2VX3A 3QCSA 2F7EE 4FE2A 3P08A 4JT3A 4JVGA 1H1SA 4TWCA 5I9ZA 3SG9A 4DF3A 1H24A 4MXXA 5AFVA 4UWBA 4GT5A 2YM8A 3OXTA 4DTAA 4FKIA 1UWJA 1HCLA 3A7IA 4XHKB 2YCSA 4GUEA 5GJGA 3ZM4A 3ET7A 4AW0A 2GHLA 4YJNA 2XKEA 2IVSA 5CX9A 4FV3A 4X6RA 5E8XA 2OG8A 3C50A 1OGUA 3FV8A 2VWVA 3OROA 5K0KA 3OG7A 1WBOA 2BRMA 4MYGA 1JKSA 2WMQA 3OTVA 4XLVA 4WNMA 3FAAA 5EI6A 4QQTA 4B6LA 4NIFB 3FJQE 4E4NA 3MFSA 1RQQA 4TXCA 4YZCA 3HV7A 4KIOA 2C5NA 3TNIA 5AP7A 3R02A 3CR0A 4QO9A 3MH1A 4IX3A 3OD6X 4DG0E 2PMOX 2Y6MA 2I0EA 5JGBA 2XYNA 4C8BA 2BRHA 3ID6C 3QQKA 2CGXA 3O8UA 5TE0A 5ICPA 2QO7A 2IZUA 4O21A 3R7IA 4A4OA 4YMJA 5FD2A 2G1TA 2PVRA 4QP4A 2RGPA 4AUAA 5J79A 4IADA 4FSYA 5DG5A 3UYTA 5DWRA
chains in the Genus database with same CATH superfamily
3EN6A 3N4VA 4JOAA 2YM3A 1Q3WA 3PIXA 2HW6A 3NYXA 3ZDIA 5FQDC 3Q53A 4EYJA 3NUPA 5G6VA 5ANKA 2QCSA 3C7QA 3FEGA 5CVHA 1Q8YA 3PZEA 3R21A 5LVOA 1KOBA 2J0IA 4P5QA 4YUQA 5IDNA 4EUUA 3TUDA 2UZEA 4QPSA 4EHZA 3HV3A 5E8SA 1OIUA 3R9OA 3SRVA 5DYJA 2XM8A 2A19B 2XNOA 4O0XA 2FVDA 3HZTA 2OF4A 3HMPA 1E1VA 4IC8A 3SRVB 4EHGA 2C6OA 1ST4A 3DNEA 3NYOA 3S0OA 3GEQA 1ZZ2A 4U3ZA 5C8KA 3ZCLA 2ETMA 4NM7A 4QMOA 2VO6A 3FHRA 3RINA 1MP8A 3D5UA 4J52A 3SKCA 3EH9A 2VWXA 4AOTA 4F64A 5CU4A 3IW8A 4FTLA 4I41A 3UG2A 3A7FA 5HI2A 3R01A 3P79A 2IPXA 1Q41A 3W0NA 3QTZA 2WOUA 1O6KA 3KA0A 2WIPA 5CI6A 4BJJB 1P5EA 2IW8A 3E92A 2B9FA 1LPUA 5FP6A 2ITQA 4FSTA 4AZEA 1OUYA 3FC2A 2PMIA 3NUYA 4FV1A 4RLKA 5DEYA 3UIBA 5AA9A 5CF8A 5LVMA 3LM0A 4JS8A 4CCBA 1H1WA 3OTUA 5HNGA 4QP7A 4YJOA 5HIEA 4ZIMA 4OTPA 4A9YA 4J53A 5AAGA 1T46A 2OJJA 3LMGA 2YM6A 3NS9A 4GIHA 3VW6A 2RL5A 3QL8A 4BCQA 3V04A 4O0SA 4G3CA 5KMJA 3TV7A 3PIYA 4EKKA 1J7LA 4IHPA 4C4GA 1J3HA 3R2BA 4PDSA 2PUNA 3D9VA 3NUAA 4W8DA 4PMTA 4BI0A 5J5SA 5KKRB 3CLYA 4I5HA 5HNBA 4ZK5A 5CEMA 4FBXA 1F5QA 3TL8A 5ETFA 3OCBA 3AD5A 5DR6A 4F1OA 1MRVA 4QP2A 2WTKC 2BHEA 3IOKA 3T9TA 5FRIA 3HL7A 2C6TA 5KHWA 2PY3A 2X0PA 5IH5A 3CXWA 2YCRA 5D7VA 5KCVA 4C38A 1PYEA 5BUJA 4YLJA 3O5AA 3GT8A 1IG1A 2C3LA 4X7QA 5CVFA 2QLUA 4FEVA 5T68A 2X6DA 4J8NA 1XQZA 4DFZE 5FLFA 3I5NA 3BEAA 3G0EA 2HZ0A 3LFEA 3IGGA 4QMTA 4O7RA 4LL0A 4QYFA 1WBNA 2I40A 3ANRA 5KMKA 5M57A 4Z9LA 4OAVB 4USFA 2C5XA 3T3UA 4GW8A 3KEXA 4UXLA 2P2IA 5ETCA 3RNYA 2YLEA 5CTPA 5LARA 4LOPA 2BIYA 4A9TA 5IA3A 2YM5A 2Z7LA 5EDPA 4K0YA 4YO6A 4YZDA 4PPCA 2JKMA 4QQJA 3D2KA 1Q62A 1U5QA 3RJCA 2J0JA 4D9TA 3Q96A 1YKRA 4AN3A 4ERWA 4HVHA 4OUCA 2GS2A 2YIXA 3RAHA 3TG1A 4TYEA 4WUNA 1A06A 3CCNA 3FLSA 2Y7JA 4TY1A 3SX9A 2PHKA 4S31A 4YTHA 1Q4LA 2NNWB 1VR2A 2ITZA 3UC3A 4NSTA 3KXHA 2BKZA 2BIKB 3VUGA 4USEA 2W99B 2BRBA 1LEWA 3R1SA 4BIDA 2IJMA 3VC4A 1QCFA 3KULA 2VTRA 4FV4A 5JFSA 4DT9A 5AR3A 2O63A 2GSFA 4FSNA 4U7ZA 4G3GA 5D11A 2UW9A 3KL8A 3KKVA 4RQKA 5TR6A 3W0OA 3GGFA 1GIHA 4AAAA 3D2IA 4D4SA 3EYGA 3O0GA 3OWJA 1WBSA 3RPSA 4D28A 5M4UA 4GVAA 4YJQA 2BZIB 1YRPA 2ITYA 1H8FA 3FSFA 4M84A 3R8MA 2ESMA 2GQGA 4FT7A 2DWBA 5AV4A 4X3FC 1YXVA 2RFEA 4FZDB 2JIVA 4APCA 4L9IA 5K5XA 3MS9A 4D2SA 3P4KA 3ZO2A 2HXLA 3W55A 4RMZA 5DGZA 1OL7A 5IQAA 4FNYA 3U9NA 4JNWA 1H25A 4IX4A 4TYGA 3K54A 3RPRA 3CQEA 5F20A 4G3DA 2Q0BA 3V51A 5H2UA 2BUJA 3QGYA 3IW5A 1OIQA 2PVLA 2C6LA 4M8TA 2H6DA 4O4DA 4O91A 3VBVA 2J2IB 4DEAA 4IX5A 2OGVA 1GOLA 2EWAA 2FGIA 1CTPE 3LLAA 2ERKA 4U41A 4DH1A 3PJ2A 4M14A 1HOWA 5EM6A 3DAEA 2A4LA 2X4ZA 2X7OA 3AOXA 1H00A 3OXZA 3SG8A 3MB6A 3ZLSA 1OBDA 5L6PA 1W98A 2HK5A 4EK3A 3F5XA 5AR2A 4ZJIA 3UP2A 3T3VA 4I5CA 3ZXTA 4RJ5A 4LRKA 1AGWA 3EFWA 3LFSA 5AUYA 4Y8DA 4FSZA 3A7JA 1JSUA 4FSUA 4BBEA 4I0RA 4CMOA 1R39A 4Q5EA 3GU7A 4OTHA 3PJ3A 2VTSA 3G5DA 4BDFA 3BE2A 4FTMA 3K2LA 3BHTA 3HKOA 4EHEA 4F7SA 1B6CB 4X0MA 5HEZA 5CENA 4FKWA 4WT6A 3UDBA 4IWDA 4UV0A 3Q4UA 4L7SA 2ZM4A 4MD9E 3KMUA 1ZMWA 2XH5A 3G6HA 3GOPA 5M4IA 2OZAA 4DA5A 3TJDA 1R78A 3LXNA 5EKOA 2WMRA 2XIRA 3DLZA 3E64A 2JAVA 3QUPA 3UVPA 1Y8YA 3QCXA 5IEYA 3CTQA 3U4WA 2V22A 4NW5A 3KCKA 1L8TA 1P2AA 2C6DA 3BGQA 4G17A 4I4EA 1JVPP 3MJ2A 4L46A 3BHHA 3QYWA 4IX6A 1SYKA 3CPBA 3FZSA 2Y4PA 4FKLA 4JR7A 4R3RA 5K3YA 5JRQA 2JIUA 4FEWA 5TF9A 4PPBA 4AS0A 5IG1A 2ETRA 4IVBA 4I3ZA 5AR7A 1G5SA 3A62A 3KGAA 4ZJJA 3Q9YA 4X3JA 5CAPA 1JPAA 3U6IA 3SXRA 4N57A 5DOSA 3G90X 1VJYA 3OY3A 1OL1A 2R3JA 3LE6A 3CKXA 3GU6A 5D10A 3BCEA 4V01A 2NPQA 1FOTA 4FNWA 4KABA 4BI1A 3KN6A 1CSNA 5GJFA 3I7CA 4MAOA 3GB2A 4YZNA 5CVGA 4U6RA 5DH3A 4M12A 3GC8A 3DCVA 4N70A 2BROA 5HIDA 3UQCA 2OI4X 4FSMA 3UDSA 4MNEA 4U42A 3RAIA 4C3FA 4C3PA 4EOQA 4YTCA 4NK9A 5BMSA 4UMPA 5ETAA 4F78A 3LFBA 3ZEWA 4Y95A 4CSVA 2VWBA 3AC3A 3PSBA 4MBLA 2GHMA 5E1SA 4ZSAA 4DDIA 5IQCA 4Y5QA 3FY2A 3VS5A 2PVYA 1DAYA 2JEDA 4IZ5A 4AQCA 5HX8A 5JSMA 4O7ZA 4AAYA 4KRCA 5GZ9A 1MRYA 3UGCA 1TQPA 4LFIA 3EQPA 4ANSA 4U44A 4EORA 3ULZA 1H1PA 4FV5A 3LKMA 2OIQA 1W7HA 4JRNA 2CKEA 4TZRA 5LMKC 4P5ZA 3NSZA 3ELJA 4UMQA 3SD0A 5M44A 2YWVA 3OOGA 4LRMA 1PMNA 4P7EA 3G33A 4GCJA 1O6LA 3DZOA 4UYAA 3UC4A 2J0LA 1NW1A 4UZHA 4U80A 4QPMA 3TUCA 5BV3A 4EOKA 1GZOA 4F9YA 2HOGA 3LCTA 2VO0A 4PWNA 4BRXA 5GIOE 2I1MA 3DT1A 2B1PA 4BYJA 5JEBA 5EI2A 3FKOA 4I6FA 4W4WA 1LP4A 3VWAA 2BDFA 4YNEA 4F7NA 3UQFA 1V0PA 4O7SA 2VTIA 4PRJA 3WZDA 4AGDA 1W83A 5CEPA 3UZTA 4JDIA 3WF9A 3LLTA 2IEWA 3HNGA 2PK9A 1KV1A 3PY0A 4NWMA 4WG4A 3EHAA 2HXQA 5HBJA 4LOQA 5FTOA 4P90A 4MX9A 4UWCA 1YDTE 1CDKA 5JN2A 1BKXA 3MY5A 3LFDA 1U46A 1XHAA 5FEEA 4IFCA 4JBOA 3WF6A 4CV8A 3F2RA 4AT5A 3K3JA 4OBPA 5HCZA 2OXXA 2RF9A 2IG7A 1IRKA 3FLQA 5CSHA 1ZLTA 4XG7A 4BCHA 3BLAA 1JNKA 1GIIA 2XJ2A 5DEWA 3UBDA 2YFXA 5BYZA 4FT5A 1FGIA 4AU8A 2R3IA 5AV1A 2C6KA 2GNJA 5DPVA 2VTOA 1XMMA 3W2OA 2R3PA 3LXLA 3CSVA 4DINA 4F6UA 2XB7A 4MVFA 2XCKA 4TNBA 3H10A 3ZS5A 4AA4A 3H9OA 2C6MA 4LUDA 4ZEGA 3RGFA 4AF3A 5IPJA 5JT2A 3AG9A 4IH8A 4JIKA 2G2IA 4FZ7A 5I9XA 2W1GA 2X2LA 5IH6A 4GG7A 4AN9A 2J9MA 2XRUA 3WYYA 4FTJA 4XV9A 3VBQA 5GNKA 3PXFA 3IOPA 3GFEA 1JSVA 4CZTA 2PZIA 3OXIA 4FL1A 2BZHB 2P2HA 2HZIA 1BUHA 2WQOA 1ND4A 3RHKA 3PXKA 3BQCA 2PMLX 2EXCX 5HTCA 2X8IA 4CRSA 5K0XA 2WU7A 1H08A 3A61A 3FDNA 2B9IA 3FXXA 3QC4A 4H58A 4BDGA 2OIDA 1FMOE 3MFUA 1QPCA 4QMUA 1UU9A 3F61A 1VYWA 4CLJA 5L8LA 4H1MA 5IA1A 3BU6A 3FI2A 3O23A 5IA5A 3RMFA 3D14A 1QPDA 2XNMA 2X8EA 3DKOA 3ZEPA 4XV1A 3QBNA 2UW5A 4L01A 4O4CA 4G6NA 3QTWA 5I9WA 1OBGA 4FSQA 3VBXA 3WOWA 4IAAA 1FQ1B 4D0XA 3UIXA 4BGGA 5M51A 4FZAB 2VZ6A 5AEPA 3PPZA 3VF8A 1FBNA 4FV0A 1B38A 4ALUA 4KKGA 3A8XA 3VUMA 2J0KA 5M07A 2O2UA 3FXWA 3PTGA 1PXLA 4RJ7A 2H34A 4ZZMA 4B4LA 2G9XA 4MHAA 4NW6A 5L6WL 3PVUA 3FZTA 3WZUA 4ANBA 4E4MA 1G8JA 4QYYA 4QYHA 4CT2A 3R8VA 1LR4A 3ENHA 1DAWA 3Q9WA 4DGNA 1VYZA 3ORLA 4ZSLA 4F9WA 1AQ1A 4W4YA 4GU9A 5IA0A 2REIA 4I0TA 3ZZEA 3NW6A 1OL2A 1Q97A 3HA8A 4KBCA 4WA9A 2BKKA 2PTKA 3GCSA 3QTIA 2DYLA 4LI5A 5I0BA 4AE6A 2ERZE 2C5VA 3F3UA 3C4EA 2IF8A 3QRTA 2WXVA 4FMQA 5L8JA 3QLFA 4GK3A 4C2VA 4HVIA 2GDOA 4YHFA 3W8QA 2PVHA 1T45A 4DEEA 3BYUA 2ZB0A 4ID7A 4JDKA 4EBVA 3UP7A 4EZ3A 2E9NA 2OICA 3Q9XA 4JAIA 4UYNA 1OUKA 4AW2A 4CFFA 1H1RA 1CKIA 4FF8A 1OMWA 3D5WA 3OOMA 3QAME 2QHMA 3VJOA 5F9EA 3O8TA 3L8PA 4ZOGA 3FL4A 3QALE 4FKRA 5DRDA 3A4OX 2WQEA 4AXDA 3LZBA 5EM7A 3FMNA 5IDPA 4CZUA 4AZTA 5KMNA 5EHYA 3IS5A 2WTWA 3QZHA 3H3CA 4FIEA 3VUDA 4F7LA 4KKHA 1YI3A 4NUSA 4RBLA 4L3LA 3EKNA 4BB4A 4O2PA 3ORTA 4A06A 2OBJA 2ONLC 2ZV8A 4I23A 5AP3A 5B0XA 3MIAA 2LAVA 3TACA 3TIYA 5B7VA 5BVDA 5L2TA 2PUIA 4X2FA 3E7OA 4EH8A 4N6ZA 1TZDA 3OW3A 3R63A 4QPAA 4HNFA 3L8SA 3FKNA 4FL3A 4RWIA 1YOLA 4BDDA 4G1WA 4RIYA 3KC3A 4LGHA 4XG9A 4EH9A 2J4ZA 4BY9E 4XCUA 5ANIA 2C68A 3NUXA 3FPQA 2NRUA 4QQCA 5CEQA 3DK7A 2YAKA 3BGZA 3QXOA 3MH2A 2CLQA 4PTGA 2VV9A 3F3WA 3FHIA 4OTIA 4PX6A 2BHHA 5KZIA 3W0SA 1R0EA 3O7LB 3PUPA 4ONAA 4IE9A 3DY7A 4DLIA 4NZWB 3HP5A 2HIWA 4PL3A 3I1AA 4MBIA 2W4JA 4WUAA 3Q4ZA 4XG8A 5D9HA 3VRYA 2CGVA 3ORIA 4XOZA 3DJ7A 4YU2A 4FTAA 2JLDA 3BQRA 3C4ZA 3MB7A 4FTNA 3EN5A 4MD8E 4TWOA 5JMSA 2XNGA 4I22A 3KQ7A 4DG3E 1M7QA 4X2NA 4EOMA 4EOSA 4KSPA 2BCJA 4MNEB 4W9XA 3F88A 2QKRA 2R3HA 3CC6A 2V55A 4AZWA 4JJRA 3ZBFA 4XEYA 3QRIA 5AUXA 5FXQA 4M3QA 4M13A 4FUXA 3VQUA 2WTCA 1OPLA 4GG5A 5CQWA 1XR1A 2RSVA 4O1OA 1PMVA 5HESA 3OEZA 2O5KA 3KXNA 3W2SA 3OT3A 3POZA 4IB3A 5H8GA 4UX9A 4FA2A 5DA3A 4DFYA 2CSNA 2Y9QA 3W2PA 4DLJA 3W0PA 4TTHB 2VWWA 3NUUA 2PUPA 3GBZA 3LJ2A 5FEDA 4HYIA 1QL6A 5C4KA 3R7OA 2UW0A 5EHLA 2Z7RA 1OPJA 4YC3A 4O22A 5AIRA 5M55A 5BMMA 4S32A 5EI8A 2I6LA 3QQHA 4ZTMA 3TNHA 4JXFA 4AACA 3E8CA 3CD8A 3SVVA 2UZTA 1M2RA 4GEOA 4KIQA 5FBOA 4UMRA 1I44A 3UO5A 4JAJA 3F6XA 4FKSA 4I93A 3NMUF 3MGYA 5AP4A 1JOWB 4GK4A 3L8VA 5IZFA 2X9FA 3PZHA 4H3PA 2XAMA 3ORPA 3POOA 4G5PA 5EYCA 4C02A 4CEGA 5E8ZA 5AP5A 3WF5A 3BL9A 3UJGA 4UEUA 2VTMA 2QOKA 2QQ7A 4MWHA 4PY1A 3EWHA 2ITPA 5IQGA 4QTCA 2X2KA 4HCUA 4QMVA 3UDZA 2YN8A 3FZRA 4G9CA 2PWLA 4O86A 3R1NA 1Q8UA 4AXEA 3COKA 4AFEA 5L2QA 4G6OA 3ZM9A 3F5GA 2WEIA 3BL7A 4RVMA 2W06A 3P1AA 4FTIA 4KRDA 2YM7A 3NYNA 1AD5A 5F95A 2IN6A 3RVGA 4RZWA 1M17A 3AQVA 5JK3A 1OZ1A 2V7AA 4O1PA 4V05A 5AX9A 1ZYJA 4FKTA 4DH8A 2A27A 1YQJA 3DK3A 3BELA 3U9CA 5J9LA 2O3PA 3MPMA 2BR1A 5FM2A 1OGYA 4YC6A 2IZSA 3H0ZA 4ASEA 1ATPE 3CGFA 4CG9A 3MY1A 5M53A 4PTCA 3AT3A 4ZAUA 4ACGA 3E63A 4QP6A 1J7IA 4NJDA 5GJDA 1YXSA 2R3FA 4Z55A 3I0OA 4BIBA 3NVMB 4DHFA 3VULA 3GUBA 4C35A 3CTJA 4EJ7A 2RG6A 5IA4A 2GHGA 4FNXA 3QGWA 3ERKA 2UZLA 2VD5A 4FEQA 4QQ5A 4FEUA 4NFNA 3O50A 4RIOA 4X21A 5C1QB 5KX8A 4M0YA 3VS4A 5AP0A 3PE1A 3AKJA 4GYGA 4AXCA 4EOOA 3FXZA 4KSQA 2B9HA 3C0IA 2OH4A 4UXQA 3UYSA 4PP7A 2C47A 3PP1A 1IAJA 4FGBA 4PUZA 4NTTA 4BIEA 1Z57A 4AX8A 1OITA 4GH2A 4ERKA 1XKKA 2WQMA 5EQPA 4XP2A 5LOHA 3ZRMA 4WKQA 3QTSA 4RT7A 3G6GA 5BQ0A 3GFWA 5LVLA 3PVBA 4HVGA 2F7ZE 2UW3A 4FICA 1XH9A 2C30A 3RBWA 3KULB 5CAOA 2XEYA 2BAQA 4H36A 1W84A 4NCTA 1RDQE 3SAYA 4Y73A 1URCA 2GTNA 5EYKA 3R7UA 3BLQA 3ACJA 3IW6A 4QYGA 4R7IA 4EEVA 2CGUA 2WTJA 1UVRA 2JBOA 5C26A 2C1AA 4RVKA 3W16A 4YTFA 2OJIA 1YOMA 5CSXA 5M56A 5IF1A 4R3PA 3QC9A 1H01A 5DMZA 3ZC6A 4E8AA 4QDVA 2KTYA 4JG6A 2VX1A 3HV6A 4JRVA 4LV5A 5ANOA 5KO1A 3ZTXA 1M14A 4QMQA 1XBAA 3C9WA 4ITJA 2YA9A 1Q8WA 1Y6BA 2W7XA 3CE3A 3BEGA 3R7GA 4R1YA 4WNKA 3AMYA 3SXSA 3GQLA 4HNIA 3IECA 5EYMA 4DITA 4C4JA 3VHEA 2Y6OA 3EL8A 2R2PA 3VNTA 3E62A 4OT6A 3C0GA 3NIEA 3SC1A 4Z3VA 5IQBA 3BLHA 5J7HA 3UPZA 3K5UA 3UZRA 2B55A 5I5ZA 3EN4A 4IXPA 5A4TA 2YERA 3ZO4A 1W2FA 4R8QA 3ORKA 1P4OA 3VAPA 2GMXA 1KUTA 3PWYA 2A98A 4N4SA 2P0CA 5BYLA 4ZJVA 2R7IA 3ALNA 1OKWA 3PG3A 5L2IA 2EVAA 5TKDA 4IM0A 3IW7A 4MH7A 3DZQA 4DH3A 3B8RA 3BE9A 1MUOA 2F49A 5CF4A 2Z60A 5CEKA 5KNJA 5L6OA 1J1BA 4IDTA 4IAFA 4TNDA 1JAMA 3BBWA 1OVEA 3BU5A 3OWLA 5A4QA 4F70A 4EOLA 5DE2A 4ZP5A 4G16A 3TI1A 5HTIA 5ETIA 1ZRZA 2IW9A 3NNUA 5HIBA 3AXWA 3KCFA 3OUNB 5JQ8A 2V5QA 4MF1A 4DCEA 3A99A 4OTRA 3VS7A 4K1BA 4ZY5A 1PXOA 4O0WA 3DU8A 4FKQA 4W4VA 5KZ0A 2IVUA 5HGIA 4JR3A 2EXMA 4LRJA 3TTIA 5EQYA 4V04A 4AFJA 2XNNA 3GC0A 4MWIA 3UOLA 3QQLA 4GFGA 3MWUA 4Q2AA 3FWQA 3D94A 4JX3A 4EK4A 4EOPA 4WSQA 2OFVA 4J99A 2X39A 2YIQA 3AC8A 4ACMA 3ODYX 3WF7A 2EB3A 2XYUA 4TWNA 3ZZWA 3GC9A 4E3CA 3FY0A 1STCE 4FRFA 1Y8GA 2RFSA 3LMIA 1ZOGA 4L42A 5EG3A 3AMBA 4WNPA 4FYNA 4E20A 4O0TA 4XV2A 2Y4IB 4G31A 2C3KA 5A6OA 4CXAA 1FMKA 4I24A 3IQ7A 4RX9A 5IMEA 4W8EA 4OTFA 4Z7GA 2XNPA 5HTBA 4FV6A 3FKLA 4DFBA 3QLGA 2WIHA 2OK1A 4FODA 5AX3A 5IUGA 4O84A 4LM5A 3EFLA 5DT3A 2BDJA 3CY3A 3OY1A 4G3FA 5FXSA 4FIJA 5AUZA 4MF0A 5CSPA 1H1QA 3MVJA 3EIDA 5AUVA 1L3RE 4E5BA 3QF9A 4FT3A 5CXHA 5EOLA 2XZSA 4W9WA 3P23A 3PXYA 3QKKA 5D1JA 3REPA 3OVVA 4II5A 3ORNA 3U8WA 3HV5A 2ZV2A 4FEXA 2A2AA 3W33A 3ATTA 4BKJA 2WTKB 2FO0A 5EKNA 4JLCA 3F7ZA 3O17A 1ZAOA 3VHKA 4ZLYA 2BRGA 3LAUA 2CN5A 5H9BA 2PE0A 1NVRA 3QD2B 4BDBA 3UODA 5AM6A 2VO3A 2B0QA 3KK8A 2E2BA 1K3AA 1YHWA 3QRUA 3JY9A 5CASA 2UZNA 2ZYBA 1KWPA 2C5OA 3TWJA 3PDTA 3R28A 4QMSA 4O4EA 3COMA 4DFUA 4IJ9A 1PHKA 1P4FA 3DB8A 3KY2A 3UIUA 3NRMA 3SOCA 5I3RA 4M97A 4CTBA 3QTRA 3FMLA 4E6QA 3M42A 4C37A 3E8EA 4PQNA 4E26A 2OIBA 1W0XC 2EU9A 4NIFA 4TYHA 5J9YA 1S9JA 2F7XE 3IO7A 3NW7A 3FL5A 3RNIA 3JXWA 1YXXA 4HYUA 4BBMA 4OAUC 5E1EA 4O7TA 3C4CA 3F5PA 2W1CA 4CZYB 3C0HA 3HRBA 1PXMA 2OXYA 1E9HA 3HLLA 2XIZA 4UMTA 3NYVA 1FINA 1CKJA 3TZ8A 2VWZA 3VS0A 4ZSJA 3O96A 4GU6A 4IW0A 5ANGA 3SW7A 3FBVA 2XJ1A 3ORMA 4J8MA 4JQ8A 5H8BA 4AW1A 4DGOA 3D83A 4PMSA 3CBLA 3PWDA 1Q61A 1FVRA 3NCZA 4BKZA 5IU2A 4Q9SA 3DXPA 4FV7A 5C27A 4E5AX 5IQIA 5GINE 4Z7HA 4BWKA 2GS7A 2ITTA 1W2DA 3RWPA 4EYMA 4L3JA 4KS7A 2BILB 5AM7A 2R5TA 3OBJA 1G3NA 4I6BA 2QR8A 3JPVA 1Y57A 4NYEA 1A9UA 3FQEA 5LCJA 3BHVA 3BBTB 4YNOA 4B7TA 2QU5A 4YC8A 4EK5A 4DDGA 1UU3A 4ENYA 3VVHA 2YHVA 2ZDUA 1R3CA 4F0GA 4D4VA 2I0VA 4EKLA 3L8XA 2QO9A 1QPJA 3T9IA 3QZIA 4C34A 4XG2A 5LQFA 3QTXA 1V1KA 2WEVA 2BZKB 5AAEA 1GAGA 3MA3A 2VNYA 1X8BA 3DDQA 5B2KA 4C58A 2C6EA 1E1XA 3ZLXA 2UZOA 2WPAA 2RIOA 2XCHA 2VTPA 3EJ1A 3R8PA 4BZNA 1VEBA 4CKRA 3NR9A 5AP1A 3GCVA 3P7CA 3QTQA 2QHNA 1ZY4A 3SV0A 3QCQA 2ZMDA 4FKGA 5ACBC 3EQDA 3ENMA 2YIWA 3G9NA 3NAYA 4FG8A 4PDPA 3PRFA 3PYYA 3SGCA 4QRCA 5LMAA 3JY0A 3NIZA 2GNHA 3GNIB 2F2CB 5CY3A 5J95A 2CKPA 4GT4A 5JFWA 4YJPA 2PE2A 4DFXE 1OKZA 1H28A 3MV5A 4GL9A 5L3AA 4GYIA 4KIKA 4BDKA 4CFUA 2WU6A 1JWHA 5LXMA 3LFQA 4YPDA 4CFXA 4WBBB 3OFMA 4BR3A 2J7TA 4B8LA 3HEGA 5DN3A 2O8YA 5DBXA 3M11A 4RX8A 1ZMVA 2W5HA 4FIFA 1OM1A 4DC2A 4L8MA 3VJNA 4EONA 3HVCA 3IDBA 5F94A 2R0UA 3ORZA 3EB0A 4LMUA 4KIPA 4EOJA 4BYIA 3CJGA 4U43A 4U79A 4EQUA 5A9UA 4CG8A 3G0FA 4EH6A 5DNRA 2PSQA 3WZEA 1H0VA 4RX5A 2X7FA 2UVZA 2JD5A 4A4LA 3MTLA 3PLAE 5EW9A 4C4IA 4RJ8A 4ZY4A 2B54A 2JIIA 2NRYA 2G15A 5A46A 4JDHA 2XIYA 4F6WA 2WTVA 4L3PA 4XRJA 4E73A 4ZSEA 3HAMA 3QQFA 3FMJA 2UW4A 4CLIA 4QMNA 4RIXA 3ZRLA 2VGPA 4QMWA 1JSTA 3V8WA 4C62A 4OTWA 2FB8A 5JRSA 3TV6A 2IZTA 1Q3DA 2HZ4A 1U5RA 3HYHA 1OKYA 2CLXA 2YITA 3COHA 4Y83A 4AWIA 3PSCA 1UKIA 4IVAA 3ZONA 4RJ6A 4H05A 3W2CA 2PULA 2X9EA 4S2ZA 3FUPA 4FV2A 3PVWA 4I4FA 4O0VA 5HD7A 2A1AB 1Q8ZA 3UVQA 2OFUA 1H07A 4FG7A 3DTCA 2XJ0A 2IVTA 2HYYA 3G9LX 3KB7A 4GK2A 5JZJA 1KE8A 3V5QA 2VWUA 5EHOA 4HZSA 2QG7A 5IKWA 1OECA 4FKPA 4K33A 4FTRA 4YBJA 3QRJA 3ZYAA 3TN8A 5AUWA 4Q5HA 5E8YA 4MXOA 4FTKA 4ZTHA 2XALA 5CF6A 2FSLX 2PVMA 2CDZA 2WQBA 1UV5A 1I09A 2EUFB 4YJRA 4NCTC 1VZOA 2CHLA 4I6QA 2PL0A 5E92A 5CNOA 3WBLA 2PZRA 4EBWA 4CVAA 3G51A 5CSVA 1PRYA 5JQ5A 4AQKA 2VO7A 3RK9A 5A4EA 3O7LD 2ZFYA 1PXIA 2QOCA 3KXZA 3F7WA 1ZOEA 4DTBA 3EZRA 4LMNA 2SRCA 2ZOQA 2V7OA 3L9MA 3OCGA 3A7HA 4LV8A 1REKA 5FUTA 3QYZA 4KB8A 4JQ7A 4IWOA 1OB3A 3LJ0A 1M2PA 1OIRA 5E8TA 5LVNA 1YDSE 5ANJA 3GOKA 3EL7A 3ANQA 3IPHA 1Y91A 3I4BA 4F9BA 2PVFA 5IA2A 5E8UA 4K11A 5D12A 5IISA 2VWIA 4PF4A 4OTDA 4V0GA 2R3KA 4YP8A 3RCJA 3OWKA 1YI4A 3DJ6A 5I3OA 4CT1A 2ITXA 3BU3A 1M52A 3EN9A 3LQ3A 5EH0A 3E3BX 4R1VA 4PDOA 2WOTA 3SA0A 1UU7A 4OTGA 4RIWA 4IAZA 4M66A 4M15A 4TL0A 4UWYA 5H3QA 1ZMUA 4IVDA 3NZ0A 2X81A 1IEPA 4RJ4A 4AGWA 4LV7A 2YWPA 1OI9A