4CMUA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor (10r)-7-amino-12-fluoro-1,3,10,16-tetramethyl-16,17-dihydro- 1h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11)benzoxadiazacyclotetradecin-15(10h)-one
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
294
Chain Sequence
b'NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmuA01
2JDRA 2PZIA 4YC3A 3R8MA 3KREA 3UGCA 3MN3A 4EJNA 2GHGA 4FZ6A 3DOGA 2PYWA 4X7QA 3TIZA 5IEYA 2YHVA 3R1SA 4QMTA 1O6YA 1XKKA 3G9NA 1U5QA 2IVUA 4RA4A 3P08A 3D14A 4C59A 1QPDA 3G2FA 2BDJA 4ALVA 5CU2A 4MAOA 3OCGA 4E26A 4G31A 4FV3A 4GVAA 4HYHA 3AT4A 2GU8A 2XEYA 4D2SA 3MPMA 2BHEA 2X4FA 2ZMCA 4X2GA 3D7TB 4YTIA 4UZDA 1TQIA 3R6XA 3TZMA 5AAEA 2VO3A 2YABA 1GJOA 5IA5A 4D0WA 1XWSA 3O17A 4IDVA 3UO4A 4YPSA 2J5FA 4GL9A 4W9WA 5TF9A 3QQJA 2C0IA 3ROCA 3VBXA 1H27A 2WTDA 5F94A 1IAHA 4IWOA 2I0VA 3D7ZA 1H1RA 4GFOA 2RF9A 4J1RA 4O0VA 3TJCA 2O63A 3OCTA 4Q5HA 3FLZA 4U41A 4XP2A 3LM5A 4KRDA 4KRCA 2OH4A 4BCPA 5HG5A 3A4PA 3GXLA 1CTPE 3FMNA 4E73A 4OTGA 1OUYA 3OW3A 3RAHA 3UIXA 4D0XA 3BYMA 3IQ7A 1MP8A 4CFVA 5IUIA 5EQEA 4FIIA 3RWPA 2BPMA 1YI4A 2O64A 4QMYA 5AIKA 2XBJA 2PUUA 3HECA 2VD5A 2QOCA 3TWJA 3ZXZA 4S32A 5G6VA 3PY3A 1VYZA 5KMMA 3RPYA 1OL1A 4JX3A 4FG9A 5IQGA 3F66A 4JBPA 3VUMA 1PW2A 2PHKA 3PE1A 3PSCA 1ZY4A 1ZYDA 4XH6A 4BWXA 3L1SA 3BQCA 4DTAA 2R3QA 5HCYA 5FXQA 2CGUA 3PPZA 4BCJA 1Y8GA 3OBJA 4LGHA 4AOIA 4O7YA 4GKIA 3UDBA 4DHFA 2UW3A 2HY0A 3QA8A 5IDPA 2ERZE 4N0SA 2PVFA 4FEQA 2VWWA 1OKVA 2XM9A 4MHAA 4PDOA 3FPQA 3AXWA 1Q8ZA 4E5WA 3ZDIA 1OIRA 3EN5A 5GZAA 4C2VA 3R9OA 1MRVA 4AE6A 2C1AA 2YM3A 4NK9A 5CVHA 1H26A 5A4LA 4EOMA 4IB3A 5JZNA 1VEBA 4I5MA 4FKOA 5D10A 5L8JA 4EWHA 3CY3A 4QP4A 5AR3A 3S4QA 3QALE 5EW8A 3QD4A 3FQEA 3FSKA 2R3JA 3CD8A 3COMA 3F3TA 5IH5A 1PXKA 4HVGA 5EG3A 3S95A 5EYDA 5AP1A 2UZEA 3ZEWA 3LHJA 5FD2A 2BZIB 4R3PA 5I5ZA 3MFRA 2B53A 3FLWA 2JDTA 4L3JA 4LOQA 2WMSA 4QNAA 2W17A 2YA9A 3PSBA 3I6WA 3AGLA 4UY9A 5EDQA 5FTQA 5J7HA 4O7TA 2NRYA 5L6WL 4R7IA 3QWKA 4HYIA 4BTJA 4KIQA 3ZC6A 4Y73A 2WFYA 5FBNC 2J6MA 5LOHA 4NIFA 1YDSE 3CLYA 4AA0A 4B0GA 3FY0A 3DAJA 5HD4A 4ZS4A 2Y4IC 2W7XA 4ERKA 4OTWA 5BVEA 5HO8A 4FK6A 4MXAA 5C8MA 1CM8A 1CMKE 4F9WA 4EOKA 1QPJA 3Q60A 4USDA 5E8TA 2YJSA 2GQGA 2CKEA 3VJOA 4FTIA 5IQCA 1REJA 3V5JA 2JD5A 4D4VA 3GCUA 4ASXA 3VS2A 4D2PA 3E5AA 4BL1A 2PZPA 3GC7A 4A06A 4YUQA 4F7JA 4E93A 3BHUA 5HE3A 2WMAA 1K9AA 3CD3A 4QMWA 1CSNA 2B9IA 5GZ9A 4G6LA 1O6LA 5LVLA 3MA6A 4J99A 3WIKA 2C6TA 3C5UA 3EJ1A 5A4EA 3IDCA 3KULB 4U42A 4G17A 1CKIA 3BU6A 5D41A 3B8RA 1YWNA 2C6IA 5CEMA 3KL8A 3RNYA 3FEGA 2QOQA 2CN8A 5LWNA 4EHVA 4TYHB 4FIEA 1XBCA 3G33A 4C7TA 4E6AA 1FGIA 4HGLA 5M55A 3SD0A 2REIA 3QX2A 4WOVA 3TZ8A 3ULIA 3GI3A 3JVSA 2QLQA 1Q8UA 4BCIA 2EXEA 4CMOA 2OJ9A 2X8EA 2GNFA 2QHNA 1ZYJA 4JVGA 5CU6A 2ITPA 2C5NA 3EFLA 1G8AA 4GW8A 2EXCX 2HZ4A 1FQ1B 3TUBA 4RC4A 4PTGA 3ORPA 4X3FA 4IHPA 3GBZA 4CMTA 3CJFA 5CALA 4XBRA 5E91A 5EOLA 2YERA 2QKRA 2OFUA 4B8LA 4GKHA 2UVYA 4CTBA 2VWUA 5KMIA 2I7QA 3QZIA 2XRUA 2YIQA 4BKJA 4O0TA 3OY3A 4ITIA 5K4JA 3PXYA 4A9SA 2GS6A 2A1AB 2VO0A 4PMMA 1IRKA 4JDKA 3MVLA 1P4FA 3MI9A 4KABA 4QQCA 3BV2A 3GVUA 3A61A 1JSVA 5CQUA 3I4BA 4PTEA 5IQBA 1V0OA 3WZKA 5IH4A 4MVFA 2GTMA 5CY3A 3FPMA 4H36A 3ZH8A 1Q61A 4ORKA 4FTJA 3MY1A 3GT8A 4ZSLA 2WQEA 4JS8A 2UVZA 3H0YA 3THBA 2W06A 3OUKA 5LJJA 3PIXA 4LRKA 3QCSA 2X8IA 3PTGA 2X8DA 3C4WA 3IS5A 5IA1A 4J97A 4ZLOA 5A54A 4RIYB 5IA2A 4TW9A 4RQVA 1Q8TA 5CTPA 1XH4A 3TN8A 3HEGA 4BHNA 4XMOA 1Q97A 3QAME 3ZTXA 5BVKA 2ITOA 3KB7A 3TTIA 3HRCA 2BZHB 4J95A 3ZRMA 2FUMA 4IC7A 5FXRA 3S0OA 3P79A 3O0GA 2Z7LA 3RK7A 2WTVA 3U9CA 3BQRA 5CT0A 5DN3A 3QC9A 4O2ZA 2RL5A 4M69B 2SRCA 3TV6A 2IWIA 3DNEA 5CEPA 2UZWE 3E3PA 4L3LA 4QP7A 4FICA 3T9IA 1YHWA 3PA4A 4Q2AA 5DNRA 3PPJA 5J7BA 4D1XA 4EC8A 1GZNA 3E93A 4JBVA 4KS8A 1H08A 4GV1A 5I9ZA 2WTKC 2F7ZE 5AWMA 3EN4A 2OICA 4IFCA 5HE2A 3DKGA 3V5TA 4JRVA 4O7RA 4K77A 2QR8A 5HVYA 4CXAA 3DU8A 5H2UA 4RQKA 2ITTA 3N4UA 3O96A 4DH5A 4C4GA 3A7HA 1PRYA 1PXOA 5T68A 3MH3A 4YC8A 5AUWA 3LMIA 4FZDB 4OGRA 4OTPA 4F99A 3ZU7A 3EQPA 4ZTHA 3NSZA 3Q53A 4O21A 4F9YA 3A7FA 5FEQA 4IVAA 4CG8A 2XJ1A 2XK9A 2J90A 1OBDA 5TO8A 3O51A 3MIYA 3P1AA 4FNZA 1FGKA 3GB2A 4C0TA 3MDYA 3UO6A 3R7YA 1OPLA 1YKRA 3O7LD 4IJ9A 4O96A 2C5XA 3K2LA 4LGGA 5KBRA 2XK4A 5ANEA 4QMPA 2JEDA 3CC6A 5TE0A 2IW9A 5FP6A 5M09A 4PWNA 4YBKA 4CKIA 3T3VA 3W33A 2VTJA 2IZUA 2OJGA 4GT5A 3C4EA 4XG9A 4A4OA 3OTUA 3UYSA 4A9TA 5GZ8A 3ZM4A 2JIUA 3HA8A 4YGAA 5D1JA 1M2RA 2C3LA 2NRUA 2P2IA 3DJ5A 3PYYA 2Z7SA 3CCNA 4M0YA 4ZTQA 3VUIA 2E9OA 3ZSHA 4AOJA 2UZBA 3DJ7A 4O0YA 3R1YA 3D94A 4IX5A 5CSWA 4BDBA 4HVSA 2C3IB 5L2QA 3MIAA 4JBOA 3AC5A 4O7NA 1JAMA 2BRGA 3VHKA 5AAGA 3RHXA 4MD7E 3RK5A 2IN6A 3PRFA 3GENA 4FEVA 4RFMA 4I92A 4HCVA 3OXTA 3BBWA 1P14A 4XG7A 3DS6A 4N6YA 3AD6A 1ND4A 2QOOA 2O8YA 2OI4X 2VZ6A 4FSZA 4PPCA 1IAJA 1O6KA 3OUNB 1YXSA 4NH1A 2OF4A 4MX9A 3RZFA 3FXXA 3VS0A 3NNWA 2YCQA 1YHSA 5CAUA 2IZTA 4DLIA 3KEXA 2W1GA 4YTFA 1UWJA 2OF2A 2XUUA 5DFPA 5AV1A 4OAUC 2R3GA 3MESA 4AZVA 4CSVA 3I7CA 4F65A 4JIAA 4D5KA 3A4OX 4EQMA 4ZMFA 3GU7A 4QP2A 1K3AA 2YJRA 4D2RA 2OK1A 4JIKA 4ZJJA 2YFXA 3BZ3A 3K3IA 5IMXA 4U8ZA 4AZWA 2BRBA 5HVJA 3NNXA 4Q9SA 2A2AA 4IXPA 2FB8A 4YBJA 3WZDA 2R3IA 4I5CA 2RFSA 1FMOE 4AW1A 3AT3A 2RFNA 1SVHA 2WD1A 2GHMA 2FVDA 3LFDA 4IADA 4YPDA 5AV0A 4AFEA 4N70A 3W8LA 3TKUA 4E6QA 3SV0A 3UIMA 1BLXA 5ETCA 4G6NA 1Y6AA 4M3QA 4PPAA 2XH5A 4YHJA 3BHVA 3HV4A 3DXQA 4DFXE 1PMNA 3LM0A 1H24A 3QF9A 4S31A 4DEAA 5CYIA 2CSNA 5DVRA 5EI8A 4FT9A 4F1MA 3DBCA 3LLTA 3ODYX 4Q5EA 3CPCA 5KX8A 3LVPA 4J52A 1CKJA 1J1BA 2XIKA 2YM5A 4KBAA 5AV3A 1ZMWA 5TOZA 4YURA 5IG1A 1Q8WA 2ITYA 4YZBA 4AF3A 4TN6A 3MSSA 3KA0A 4FL1A 1VYWA 4CRLA 4RJ7A 4U79A 4ANNA 4QO9A 3R9NA 3PXFA 4IZ5A 4PDPA 3D5UA 3W55A 3ATSA 4EEVA 5LQFA 4RVKA 2XNBA 1KUTA 2CLQA 4LL0A 3QRUA 2UW0A 4F9CA 2UW8A 4C3PA 1GOLA 3NWWA 5HQ0A 4D9TA 3GUBA 3VN9A 5LMAA 2JKQA 4CV8A 3SGCA 2RFEA 4HPTE 1W98A 2JBOA 3Q5ZA 2R3PA 3C13A 3NVKI 4X3JA 1W7HA 5DBXA 2OO8X 1QMZA 3E88A 3NIEA 2RIOA 2CGVA 5JRSA 4CZYB 4PDYA 4X21A 4PP7A 4BDHA 3VF9A 5M4UA 4XV3A 5IH6A 5A3XA 2XYNA 4BTMA 1JSUA 3PWDA 5AA9A 4CCUA 4JJRA 4WNPA 1BI7A 2C6EA 2ZMDA 1SNUA 2ITXA 3I5ZA 4AQCA 5IISA 3NYXA 3UPXA 1MRYA 4C4EA 3C4ZA 3NNUA 1UWHA 2O0UA 4Z9LA 4E4NA 4FKJA 3ALOA 4NM3A 1OM1A 4QP3A 3LCDA 4GUEA 4UXLA 3UNKA 4BCHA 2GHLA 3BPRA 5IUHA 2YIXA 4MBJA 3Q6UA 2X9EA 4B6LA 3FMDA 4L3PA 3P78A 4EK3A 4IFGA 3KF7A 2BIYA 5JGAA 3G6HA 3QTUA 3ZSGA 5EHLA 3NCZA 2R3LA 4EUTA 2XMYA 2B1PA 1UU9A 3FQHA 3HP2A 2R2PA 4I0SA 3TJDA 5IU2A 4L8MA 4W4WA 5H8EA 2E9NA 4G3EA 2QOKA 4HZRA 2XF0A 1FOTA 2WTWA 4RT7A 1PF8A 5AR2A 4EHGA 3GOPA 1R0EA 2PE0A 2C1BA 5EFQA 4BWPA 3CR0A 2O2UA 4WUAA 4NYEA 4BCQA 4JG6A 4J71A 4O7SA 3E8NA 3RM6A 3ZBXA 4KD1A 5C03A 3R8VA 2P55A 1UNLA 3JPVA 3WI6A 2GMXA 3R1NA 3ZUTA 4UV0A 4HOKA 1OIYA 5CS6A 4ZLYA 5E1EA 4CLIA 3CIKA 3GCSA 3N9XA 4U3ZA 2XJ0A 5IQDA 4JNWA 3G0EA 4DFZE 2FGIA 4DA5A 3DFAA 2BAJA 2QD9A 3L9LA 2UZNA 4QQTA 2J4ZA 4YC6A 1LP4A 3QTZA 2PE1A 2X7GA 3BGZA 3HV6A 5IQAA 3WF6A 1LR4A 3FZ1A 4PNKA 3F3VA 3PXRA 4L53A 2OIBA 1QL6A 1BMKA 1REKA 4V05A 5KKRB 3I0OA 4DBXA 3TKHA 5AUZA 3B2TA 3SQQA 3BE9A 4U9AA 4O1PA 5FP5A 3T8OA 3VW6A 3JS2A 3WF8A 4C02A 4YLJA 4BY9E 1B6CB 3CQEA 1R0PA 5ANIA 4DLJA 2VTPA 2CGWA 4B9DA 4K0YA 2QOIA 4C35A 2HELA 3IW4A 4XV9A 2GNLA 2B4SB 3R83A 5HNIX 1FBNA 1KSWA 5JQ5A 2KULA 3GC8A 3I81A 4HZSA 2PE2A 3KMWA 1MUOA 4FKRA 4LRJA 4M84A 4RC2A 4EJ7A 4BR3A 2C6OA 2OWBA 3DKOA 3ENHA 2VTSA 2H96A 3PPKA 3CQWA 3KMMA 3DBQA 3DBFA 4DH7A 1XHAA 3QCXA 3VULA 3MW1A 3FKNA 3DKFA 1R39A 4K2RA 2DUVA 3SRVA 3UVPA 4NUSA 3VW8A 5LCJA 2BRMA 2QQ7A 5J1WA 3TNPC 2CKPA 3E87A 3QZGA 5JFSA 2FYSA 2XM8A 2YWVA 1YOJA 4BI0A 3C0GA 3TDVA 3O23A 1H1QA 2VX0A 4RMZA 3CPBA 3DPKA 3GFWA 3ZMMA 2BIKB 3AG9A 5FXSA 4BDJA 1XO2B 4IVCA 4CMUA 2R3HA 1NVQA 3VS4A 5IDNA 2I1MA 3QQHA 3QRKA 3WE4A 3RAKA 1LPUA 3LXNA 3NYNA 2OG8A 4ZSJA 2UW7A 4U80A 5AAFA 2B52A 3PVWA 4U0IA 3FI4A 5BUJA 1Z5MA 3BELA 5EQYA 3VF8A 3DKCA 2ESMA 3GU5A 3F82A 4C3RA 4IWQA 1ZOEA 1TQMA 3AD5A 4PQNA 3MJ1A 4BI2A 3QTRA 2PVJA 5CF8A 5M51A 2IZSA 3KC3A 5M57A 1ZOGA 1MRUA 2VNWA 1W82A 2YIYA 4IWDA 3FJQE 2ZB1A 4CV9A 4O7LA 2HIWA 3VWAA 1W83A 4W9XA 2OSCA 2C0TA 2WO6A 3V6SA 1ZZLA 2BTRA 2QU6A 3Q32A 3IGOA 3H10A 4L68A 4XOZA 5BVNA 1IA9A 3S00A 3U8WA 4EZ5A 5HLWA 2EB3A 1PMVA 2CKQA 2HENA 4F0GA 4YJRA 2VU3A 4FMQA 2F57A 4L43A 4QP6A 5KHXA 5HKMA 3LOKA 2I0EA 2AC3A 4L42A 2YDIA 2VWZA 3OFMA 4OLIA 3JVRA 5EH0A 4ENYA 4GIHA 5FLFA 2FSTX 1IASA 2OXXA 5BVOA 2PZYA 4UXQA 5CEQA 3F2NA 2X39A 4U40A 2WEVA 5K3YA 2IVSA 3QKKA 4GH2A 3TNIA 3WZUA 4B7TA 5IUGA 3BU5A 3HUBA 3BE2A 3NUAA 3ZM9A 3UZTA 5AP6A 4HJOA 4X3FC 1ZOHA 1PKDA 1WVWA 3TT0A 3SVVA 2OKRA 2ITWA 1PYXA 3N4VA 1BL7A 5AP5A 3R8ZA 3Q4TA 2QLUA 3ET7A 4I93A 4CLJA 4MNFA 1G3NA 4TL0A 2OJFE 1UU3A 4R3RA 4DCAA 4Y8DA 3OROA 2VO7A 2ZOQA 3IW7A 4F7LA 1QPEA 4OBOA 2IVVA 2CLXA 4FTNA 3DXNA 3U55A 1M2PA 5KNJA 3GC0A 3SXFA 3CBLA 4GYGA 3RCJA 2OZAA 2R7BA 4G3FA 4U43A 4V0GA 2I0HA 4YMJA 3ZLWA 1YWVA 4BC6A 2W1FA 2YEXA 3KXMA 4FGBA 4FV4A 1BKXA 3WBLA 2BAKA 4IX3A 4IM2A 1YXVA 2UZDA 4CRSA 3AOXA 3FL5A 4QYGA 4RIXA 1U4DA 5EOBA 4YJTA 4MKCA 2IVTA 1YWRA 5EM7A 5M4CA 3W16A 4KIPA 2Y6MA 2HWPA 2YCSA 3C5IA 1ZLTA 3U54A 3LE6A 3R7VA 4YO6A 5A4TA 4QMQA 4HGSA 1OPJA 3FYKX 3BYOA 3TEIA 3CTJA 4FEWA 4NU1A 3U4WA 2WMQA 3O8UA 4ANSA 3V5LA 1OIQA 4FTLA 5J5TA 4A4LA 2C5OA 4PNIA 4XUFA 1STCE 3FWQA 4FTTA 3IONA 2PVKA 3DLZA 4LOPA 2PL0A 3ZO4A 1Z57A 3R02A 3LAUA 5AADA 5IF1A 4I6BA 4C36A 2C5VA 4MCVA 5D7AA 4KIKA 2R4BA 2VTIA 3RP9A 4BTKA 4EC9A 4GEOA 5HTCA 1Q5KA 5HE0A 5CEIA 2G1TA 4RIWB 3II5A 4F09A 4Z7HA 2FSMX 5I3OA 3E8EA 3D5VA 4LV8A 5J9YA 1URWA 1OKYA 3R21A 3FZRA 3HDNA 3HVCA 3NPCA 2X0GA 2V22A 2F2CB 2WQNA 3POZA 1DM2A 3MVJA 4W4VA 4FL3A 5C9CA 5AUTA 5HU9A 2GNHA 4AT3A 1XR1A 2WU7A 3D5WA 4QMLA 4QYHA 4RJ3A 4DEBA 4I1ZA 2PWLA 2Y6OA 4FZ7A 3MH1A 3TV7A 3ALNA 2WOTA 3VNTA 3VS6A 1JSTA 4DEEA 1IEPA 2XIZA 3BLRA 3FYJX 4FV6A 3UBDA 1J7LA 5DYJA 4XOYA 2LGCA 2VGOA 3C0HA 3OXZA 3PWYA 5CLPA 3ZFMA 2EB2A 4BCOA 1K2PA 1JLUE 5E92A 4YZ9A 3OVVA 4FKQA 3OY1A 3AC2A 5CZIA 3BHYA 4R5SA 4Z55A 3HNGA 4G1WA 5IQFA 1H07A 5HESA 1UNHA 3ZS5A 5CX9A 4FV7A 4CFWA 3FI8A 3MY0A 5CNOA 4XV1A 4TYHA 4BDCA 4BDIA 2BMCA 4KAOA 2V55A 3ERKA 4FL2A 4L7SA 4PF4A 1UKIA 4XRJA 4LG4A 5HNBA 1UA2A 3WYXA 4E5BA 3KCFA 3LXLA 4S34A 4TT7A 3VS3A 3SG8A 3OG7A 5CI6A 3KRLA 3NNVA 2A19B 4JOAA 3BIZA 4L46A 5B0XA 4FTQA 3LFNA 4MK0A 4ZSAA 3L9PA 3WILA 5LMKA 1IA8A 1OZ1A 2G2IA 3EFJA 1HOWA 2UW4A 5HLPA 2JAMA 4QPMA 1JBPE 4TPTA 3M2WA 4NZWB 3Q3BA 4YLLA 2Q83A 3RWQA 4YU2A 5TKDA 4XG6A 4TWPA 4G6OA 1ZYCA 3F7ZA 4UEUA 3F5UA 4TYGA 4WKQA 3IW5A 5L8KA 3W10A 5DWRA 3OT8A 1DI9A 3O8TA 5EM8A 4TWNA 5CNNA 5L6OA 5F4NA 4CFFA 4U7ZA 2XIYA 4YZDA 3UQFA 3QTXA 5F9EA 3RK9A 3FZOA 2CCIA 5AUUA 4AT4A 3AMAA 2VWVA 4FOCA 4V04A 3EQHA 3PXZA 4XNEA 4O0WA 4ZS0A 5A4CA 1UVRA 2H8HA 4ZY5A 5J87A 3CKWA 4C61A 5HBEA 2WZJA 5KO1A 3T9TA 2IG7A 2UVXA 2EU9A 5T6KA 1FVRA 3PY1A 1M2QA 3NUNA 3QUPA 2ITVA 2WMBA 5I9WA 3HV5A 1O9UA 3UZRA 2W9ZB 2XNEA 2XVDA 4FGRA 3QL8A 3PIYA 5FWKK 3WF5A 4BF2A 3DTCA 1H0VA 5LVNA 4DEIA 4IAAA 2OIQA 3Q9XA 2B54A 5EDPA 2F2UA 1DAYA 3O7LB 4G2FA 4WO5A 4FSMA 4F08A 4TWOA 4RPVA 5K0KA 4ACMA 3R7UA 4FSWA 4A9RA 4MYGA 2YISA 4J8NA 4UWCA 3SHEA 1LEZA 2YM4A 1PXPA 4G34A 4GT3A 2DS1A 4AS0A 3V8TA 5L4QA 5HVKA 1KE5A 2QO9A 3V51A 4K33A 2VWIA 2J5EA 4MXCA 5C8KA 3REPA 3ZSIA 3BHHA 2ZM1A 5I4NA 4P4CA 5GIPE 3HGKA 3RMFA 3G15A 3UJGA 3AGMA 4WG4A 2R3MA 3S2PA 2YACA 2J0MB 3GP0A 4AX8A 2EVAA 4GU9A 3ZRKA 5AV2A 5AUYA 2IW8A 4E4XA 2QO2A 5DG5A 3W2SA 4BIBA 5ICPA 4R3CA 5JSMA 3EQIA 4R77A 5M08A 3UG2A 3VBVA 1Q24A 3ZUVA 3UODA 3F5GA 4EH9A 5FUTA 3PDTA 3LFFA 3L8PA 3FXWA 1XH5A 3OTVA 3QTSA 5HOAA 2P2HA 2JIVA 3KU2A 3W8QA 3QQLA 5CF5A 1YXXA 2V0DA 2QR7A 3NLBA 3ZZWA 3U6JA 2XBAA 2XNOA 3JY9A 3RPSA 2XK8A 3VS7A 4TZRA 4CG9A 2VO6A 4RA5A 2J0LA 4CZTA 4GUBA 5M56A 2X4ZA 2R9SA 2YIWA 3LXKA 1JWHA 4QP8A 2G15A 4YJPA 3TV4A 5M4IA 2G9XA 4L6QA 3KGAA 1H28A 2QOHA 2XNNA 1YRPA 1U54A 1MQBA 2X7OA 3IGGA 4R7HA 3DB8A 4RFZA 5AR7A 4BDEA 3PFQA 3I5NA 3MFUA 3PG3A 5H8BA 2Z7QA 1RQQA 5JZJA 2W1EA 1DS5A 1H1PA 4YTCA 3EKNA 1U5RA 4R7BA 3SX9A 1SMHA 2EWAA 2R3FA 3GC9A 1OITA 4MEDA 2O65A 3ZCLA 2GTNA 2B9FA 4IDTA 3DLSA 5E9EA 5EM5A 3EZVA 4C4IA 3MPTA 3KCKA 3QWJA 3MY5A 4FYOA 2PZ5A 5J1VA 5ANKA 4UYAA 4FV5A 3UVQA 4EKKA 5JGDA 2C69A 4WRSA 3KRXA 4MQ2A 2JAVA 1WFCA 4GS6A 2W5HA 2DYLA 2JKMA 3DJ6A 4U5JA 5CXHA 4WNOA 4FC0A 4GK4A 4AGWA 4MNEA 5GIOE 2ONLA 4W8DA 2J2IB 4I94A 4ERWA 4YR8A 1KOBA 4E4MA 2PMIA 4EH3A 3E7OA 4D4RA 4DG3E 4HCUA 4ITJA 4BFMA 2XZSA 1WBNA 3FBVA 5DT4A 4BYIA 3A7IA 3UMWA 5AUXA 4UYNA 2HYYA 5CU4A 3CGOA 3DDPA 4FSQA 5CWZA 3UOKA 4S33A 3L8SA 1KWPA 3MVHA 5CI7A 4NIFB 1F3MC 2XYUA 3MPAA 4RWKA 3BX5A 2ZV2A 2FA2A 1OPKA 3ZLSA 2Q0NA 3B2WA 4FYNA 3SC1A 4CKRA 2JDOA 3SOCA 4PDSA 5ANGA 1YI6A 4QOXA 1CKPA 3RPRA 1H8FA 3OZ6A 5DIAA 2AUHA 3RKBA 1URCA 5J9LA 5EW9A 2CJMA 4ANOA 2F4JA 3W18A 2PY3A 1TKIA 3RINA 3ZC5A 4A4XA 2OW3A 2OXDA 3HMOA 3HRBA 5EYCA 4D28A 5AMNA 3S1HA 3ATTA 1UV5A 2C68A 4EKLA 4D4SA 3VO3A 4ZJVA 3CGFA 3HA6A 2XA4A 3FHIA 4DGNA 2WB8A 3VUHA 4I24A 3C50A 3U6IA 3R73A 4ARKA 5J79A 2H34A 5K5XA 5EK7A 4X6QC 3GOKA 4EOQA 4AG8A 3TL8A 3ZBFA 5M44A 3C0IA 4FIJA 2CN5A 1ZMVA 2W1HA 1YW2A 3ZXTA 3DV3A 4DYMA 5BUEA 5HGIA 3F9NA 1H00A 5K0XA 4FIHA 4RBLA 4CQEA 3ZO3A 4NW5A 4B4LA 1I44A 4IB5A 4NM5A 4ZY6A 3R71A 2HZNA 4UN0C 2J51A 3ORTA 3UMXA 4APCA 1FVVA 2HXQA 1ZYSA 3P7CA 3QYZA 4HYUA 3QA0A 1W0XC 4AE9A 3FMKA 4X3FB 2YZLA 4EOJA 3POOA 4ZTSA 4ACCA 4IQ6A 4JDIA 4AA5A 4FEUA 2JBPA 3ORKA 5LMBA 4M13A 4O7ZA 4UMUA 4TNDA 3UIBA 5E8UA 4CFMA 3EYHA 4YSJA 5B2MA 5T3QA 5DR9A 2VTLA 2UZOA 2VAGA 4CFXA 4EK4A 2YIRA 4Q9ZA 3UPZA 3P9JA 1Q41A 4PL3A 3JR1A 3EB0A 4NW6A 5JK3A 1F0QA 3VUDA 4BCMA 4CEGA 5L2IA 3OMVA 4KSQA 2PSQA 4L9IA 3QQGA 3F3UA 4FSNA 3IOPA 3QHRA 2VWYA 2WELA 5DMZA 5I9XA 2DQ7X 4M68A 2BDWA 4EOOA 2X6EA 5E1SA 3CP9A 3DNDA 4FSUA 2NPQA 2JDVA 1P4OA 3C51A 3FDNA 4RWLA 4V01A 3NUYA 3L8VA 3ZHPC 5A6NA 3V04A 4QTAA 2WMWA 4JG7A 4OTRA 4DINA 4L44A 2HW7A 4L01A 3VUGA 4F6SA 3DK6A 1XJDA 2F49A 3PZHA 4CZUA 3MFSA 4FT0A 5B7VA 3W2CA 2WMTA 4FTUA 2H9VA 3QKMA 4OTDA 3EH9A 3JXWA 5I0BA 3O2MA 3R01A 5IA0A 5ITAA 4L45A 5KBQA 4DTBA 4O7WA 1BYGA 3HMIA 3VIDA 4ANLA 2W4KA 3OWPA 1OL7A 2JFLA 5E8YA 3BYUA 3MH2A 3U6HA 2VWBA 4F6UA 3HAVA 2BFYA 2R64A 1WVXA 2AC5A 2YAAA 4H05A 4PPBA 5H9BA 3BU3A 2CKOA 2Y4PA 1RJBA 1RW8A 2CDZA 3KN6A 2YCFA 2IZRA 2WAJA 3IK3A 3LQ3A 5DH3A 1FMKA 1JKTA 3Q4UA 3RNIA 2QHMA 4XG8A 5KUPA 3H0ZA 3FZSA 5EHYA 1JKLA 3AQVA 1PXIA 4KS7A 3UNJA 1VR2A 4NFMA 3RGFA 4TXCA 4EHEA 3BLHA 1T45A 5BMMA 5HU3A 3GFEA 3H3CA 5I9UA 5DT3A 2W5AA 4IJPA 1J1CA 2W5BA 1Y6BA 3QUEA 2UZTA 1WBVA 4QMZA 4H3PA 4C33A 4CCBA 4JAJA 5ETFA 3W32A 4BN1A 3QTQA 2EUFB 3W2QA 5IMEA 3A8XA 1BI8A 3KKVA 3OOGA 1T46A 2PK9A 4BCKA 3HV3A 3Q4ZA 4IAZA 3EMGA 4BGHA 4G9CA 1Y91A 4RSSA 3DGKA 3ZFXA 3H9FA 3NAXA 5FGKA 1YI3A 3TNHA 4BI1A 3QRIA 4IBMA 4JG8A 4BBMA 3EIDA 4GSBA 4DH3A 4D1ZA 2ZDTA 4FVRA 4WIHA 5CSXA 3SOAA 3COKA 3UNZA 4PX6A 3LJ0A 5G1XA 3OP5A 1XQZA 2XNGA 4O22A 3V8WA 4MF0A 4YHTA 4D1SA 2OH0E 4BGQA 4JX7A 5HD7A 5HI2A 4QQJA 2OU7A 3MV5A 2Q0BA 4ASDA 4E3CA 2YWPA 2FSLX 4FVQA 2OIDA 4KINA 5F95A 3NW6A 3SKCA 4I6HA 5M06A 4IE9A 1YXUA 4YP8A 2VWXA 2W4JA 3EYGA 4I0TA 4YJSA 4O0XA 5LVPA 2F7XE 4EH2A 1FVTA 3Q9YA 4IAFA 5AJQA 5DI1A 2ZYBA 4D55A 5HLNA 3DK3A 2XK7A 1M14A 3FI2A 3IDBA 4MBIA 3WYYA 1M17A 4EORA 3LKMA 2WIPA 1V0PA 2VX3A 3CXWA 4NCTA 4N57A 4X2FA 3PP0A 3P0MA 5BUIA 4ZTLA 5AX9A 4ENXA 3LW0A 1YDRE 1NXKA 4DGGA 2QOFA 3I6UA 4XLIA 5FEDA 3QGWA 5DR6A 1Q62A 3R2YA 4P5QA 4YZNA 2LAVA 5CEOA 2BROA 2Z7RA 4A9UA 2QC6A 3PJCA 5C4KA 2OZOA 4XX9A 3V01A 2PMNX 4C57A 4PL5A 3UC3A 5ACKA 5DA3A 4RLKA 1JKKA 5I3RA 5CSPA 1R3CA 4MXYA 4DCEA 5CXZA 4CT1A 4FKUA 3EQCA 3CE3A 1Q8YA 4FUYA 1F5QA 2Y4IB 5CANA 4YLKA 3BCEA 3OEZA 4I22A 4UWYA 5ETIA 4DH8A 1OL6A 4FG7A 3BV3A 5E8XA 3TG1A 4MH7A 1YXTA 1Q3DA 5JFXA 4HNFA 4DE4A 3ETAA 4UBAA 3G51A 1NW1A 3UYTA 2XCKA 4CFNA 1OIUA 4JQ8A 4BCNA 4E20A 5IEVA 3Q2JA 1GIHA 1UKHA 2QCSA 4MD9E 1GZOA 4D4YA 3GU4A 5KHWA 4RLLA 5DOSA 2PPQA 3ZLXA 4FK3A 4FKLA 4FKWA 4JBQA 5DRBA 5CU0A 2XRWA 1DI8A 1PYEA 3NW7A 4OTQA 4RJ6A 5J8IA 3GCQA 4GRBA 4YTHA 5LCKA 5LMKC 2B9JA 4USFA 4XEYA 4KBCA 5GJGA 2XNPA 1JNKA 1OKZA 1Z9XA 4RVLA 3DT1A 2ZM3A 2GQRA 4S30A 4LRMA 1SVGA 4IB0A 5EYKA 2R3NA 4C3FA 3ID6C 4EONA 3K5VA 4DT9A 2CMWA 3DB6A 4QMUA 3NEWA 3A62A 4AU8A 2W05A 3QD0A 3GCVA 3F88A 4XHKB 2RGPA 5A6OA 4IC8A 2HY81 1WBWA 3QXOA 4YZCA 4A7CA 5KMOA 4FVPA 2VTMA 4GG7A 4QTBA 4JDHA 3HMMA 3OCBA 5LARA 4AN2A 3H9RA 3FAAA 3D83A 3FE3A 3IPHA 4YSMA 3AC4A 3S3IA 4EI4A 3W2OA 3PIZA 3Q52A 3BHTA 2H6DA 2XJ2A 4Y5QA 3PP1A 4W8EA 3EWHA 2I6LA 4FNWA 4JT3A 4EOPA 2BZKB 4RJ5A 4FNXA 4OTIA 4DAWA 5AM7A 4CVAA 2G2HA 2B9HA 3R7IA 5D12A 3R00A 5E8ZA 3TUDA 2R0UA 3ZO1A 4AA4A 4BZNA 3GNIB 2XKEA 3R8LA 4IX4A 3W2PA 4DFLA 5HIEA 4GT4A 4BB4A 5A9UA 5IQIA 2F7EE 2WKMA 4U97A 2X7FA 4TWCA 3WZEA 4L7FA 3QKLA 4F0IA 3DZQA 3FY2A 1PMEA 4FT5A 4H58A 4M67A 4DH1A 3BWJA 4PMSA 5BVWA 3UP7A 4OBQA 5EI2A 2W1CA 5BYZA 1KOAA 3QD3A 4RVMA 4F9BA 1SVEA 2JC6A 4QRCA 5D11A 4O0RA 4QPSA 4ZY4A 3QQFA 5E4HA 3C4XA 3LJ1A 3AMYA 1H0WA 4EYJA 3RHKA 2ZB0A 4TY1A 4M66A 1H1SA 3D7TA 2J7TA 3SA0A 3LMGA 3LMHA 4IACA 3QXPA 4MXOA 4BICA 3UOJA 1S9JA 4IVBA 3QBNA 4Z7GA 3GU6A 4I4FA 5KCVA 4K6ZA 2WQMA 5DLSA 1H25A 5CVFA 1GZ8A 3JUHA 5IKWA 4AGDA 5K5NA 4ITHA 3QZFA 5C01A 3UQGA 2GFCA 1Q3WA 3R1QA 4FZFB 5HICA 3ZRLA 2X6DA 4I6QA 1HCLA 4JI9A 4AXAA 2ITZA 2QONA 5AUVA 3UQCA 3RZBA 4GIIA 5AEPA 3P86A 2W1ZA 4K9YA 2WU6A 4WG5A 5CAOA 4H1MA 2J50A 2PVHA 4UALA 1ZXEA 4QYFA 5AP7A 4K11A 4EHZA 2YAKA 2V7AA 5EKOA 3H30A 3OS3A 4ONAA 1GIJA 4APPA 3KFAA 3E92A 4OAVB 1OECA 5EQPA 3LPBA 4S2ZA 5FRIA 3R9HA 2WTKB 3H4JA 4MWIA 5DHJA 2GNIA 4UX9A 3PLSA 4IH8A 4BDDA 3D9VA 4RRVA 4CT2A 3K3JA 3D5XA 2JIIA 2VTAA 3DTWA 3LFQA 5GNKA 4QMSA 4O84A 5BYLA 4QPAA 2PVNA 4AUAA 3OT3A 4PTCA 1WBTA 2QVSE 3DQWA 4FR4A 4GFMA 5HG9A 4C37A 3Q4CA 1AGWA 4TNBA 4DTKA 3HZTA 5L6PA 3VQHA 5KMNA 3QCYA 4C2WA 2JGZA 2VV9A 3EQRA 3VRZA 3AC1A 4NM0A 4PV0A 2ETKA 1GNGA 3ZZEA 3QLFA 5FDPA 5DEYA 2QG7A 2JFMA 4QQ5A 3TUCA 1P2AA 2WMVA 3ACJA 3KRWA 2ITQA 3MTLA 4DGMA 2OXYA 4AFJA 2IW6A 3ORZA 2BDFA 4O6EA 4IVDA 3V5WA 3QTWA 4F64A 4FTAA 3M11A 4A07A 3Q96A 2ONLC 2VTRA 2A0CX 3FQSA 5CZHA 3GQLA 4G9RA 5HTBA 5K9IA 2HZIA 3LFSA 5FG8A 5A46A 2PVLA 5DEWA 3SRVB 4WUNA 4LI5A 1J3HA 1ZARA 4Y72A 3W2RA 4D2VA 4U6RA 4F6WA 3F6XA 1OVEA 2VN9A 3ORXA 3V5QA 2IO6A 2PUIA 4R1VA 1NT2A 2OLCA 3TM0A 2A4LA 3HRFA 3KQ7A 2AYPA 3NCGA 4CNHA 3Q2MA 5IA3A 4DF3A 1TQPA 4PMPA 3PJ2A 3UOLA 1U59A 3NW5A 3R30A 4BBFA 5HTIA 1KV2A 3UO5A 4ZOGA 3HDMA 5AP0A 4AT5A 3HKOA 2XNMA 4IAIA 3RAIA 4ASEA 4ASZA 5M4FA 5CASA 2BILB 5ANDA 4EH7A 5M53A 2ETMA 4FT3A 1JPAA 5LXMA 4GCJA 3OWLA 1KE6A 3VBYA 3E64A 1OUKA 2WNTA 4NT4A 1OMWA 3M1SA 4QTDA 4EYMA 2BHHA 5CQWA 5L2SA 5BVFA 4H3BA 3OWKA 3MS9A 4KKGA 1GAGA 4RIOA 2W0JA 4P90A 2X81A 4NKSA 3KRJA 4RJ4A 4NTSA 4ZTNA 3EN7A 3SDJA 1GY3A 4JAIA 4RG0A 2ACXA 5D7VA 3U9NA 4ZP5A 4BIDA 2FH9A 4ANBA 3KULA 1YOMA 1ZAOA 4EOIA 1WMKA 3QHWA 2EXMA 2JDSA 3BGQA 4ZTRA 3HAMA 3BI6A 4HGTA 4C4JA 4XG4A 3FZPA 3MGYA 4FTMA 2V62A 4LGDA 3ACKA 3PA3A 4WBOA 4EQUA 4QMNA 2HAKA 2E9PA 3PJ3A 5DT0A 2HWOA 5FTOA 2HK5A 4QMVA 2B7AA 3TIYA 3I1AA 3ENMA 3HUCA 3WOWA 3F3WA 3NR9A 3PSDA 2C0OA 3KMUA 1QCFA 4XP3A 3PVUA 3ZFYA 2Y0AA 3ORMA 4KWPA 5KZIA 3SXSA 2J0JA 4BDGA 2J9MA 3F69A 3QU0A 2Z60A 3QZHA 5GINE 4DBNA 2RSVA 3D15A 3AT2A 4GMYA 3VUTA 5JKGA 4NJDA 2XCHA 3RPOA 3OBGA 3CEKA 3D0EA 3P7BA 4BWKA 2BALA 4F1OA 5BVDA 3PA5A 3K54A 3NX8A 2OZAB 5GJDA 1YHVA 3VUKA 4KKHA 4V0GB 2QI8A 2C3JA 3G90X 4GJ3A 4QMXA 1Y8YA 4P7EA 1PJKA 3A7GA 5E8WA 3RAWA 2YM6A 3JY0A 4EOSA 4U3YA 5JQ8A 4O91A 1J91A 4FX3A 4HYSA 3MFTA 3P5KA 2W1IA 4RIXB 4HCTA 4PMTA 3FL4A 1ATPE 5BX0A 3E62A 4F63A 5CAQA 3DBEA 5JRQA 3NVMB 2F9GA 3TNWA 1I09A 5J95A 2PMOX 2VTOA 2C6DA 3TZ7A 2W96B 3NIZA 3MA3A 5AR4A 3V3VA 1Q4LA 2UZVA 3OEFX 4ZSGA 2WMXA 4HPUE 4O7VA 5L2TA 4BZOA 4IB1A 3MTFA 2WQBA 2OGVA 4DG0E 3EZRA 1H1WA 4JQ7A 4QYEA 4FNYA 4WBBB 4ZAUA 4RIYA 4ALWA 2VRXA 3MB7A 4M12A 3WE8A 2WGJA 3LJ2A 4D2TA 4KIKB 5ANJA 2GSFA 3LFCA 3KF4A 4MXXA 2WQOA 3QC4A 4AACA 1LUFA 5HBHA 4C58A 4FV9A 2QOLA 4IWPA 5KKRC 3C4CA 1SNXA 3IOKA 1IR3A 2Z8CA 3FLSA 4LUDA 3CQUA 4M69A 4QP9A 3SAYA 4CYIA 5CF4A 2JITA 3H9OA 4O1OA 1Y57A 1PXMA 4GU6A 4YNOA 1Q99A 3C9WA 4FV0A 1A9UA 3VHEA 3O8PA 4G5PA 4BCFA 3A8WA 4M97A 4WNKA 3F3ZA 2OJIA 1YOLA 3A7JA 3R9DA 2QURA 4PY1A 1XH6A 5FQDC 4QTEA 4NL0A 4FIFA 4HVHA 5C1QB 5J5SA 3AMBA 3LCSA 2WMRA 4GK2A 2PUNA 4EK6A 4EK5A 4K1BA 4TKSA 4M8TA 4RFYA 4U81A 2XKFA 3EN9A 4KBKA 2XK3A 3CS9A 4UMQA 2IPXA 4WT6A 4RZWA 4I41A 4WNMA 3QQUA 5HO6A 1E9HA 2RG5A 4C4FA 3NRMA 3ORIA 4O2PA 2C30A 4PP9A 4C62A 5F1ZA 3U87A 5A4QA 3PJ8A 2CPKE 2YZAA 5BPYA 4I3ZA 3EOCA 2GFSA 1G8SA 3FLNC 3HL7A 2WTCA 4B99A 3MJ2A 1QPCA 3E8DA 3BWFA 5HHWA 5AFVA 1WBPA 1BL6A 1M7NA 4DEDA 4QP1A 4XRLA 3NAYA 4LL5A 3FV8A 4RZVA 2BRNA 5CT7A 2XIRA 3RALA 3UIUA 3KK9A 2QKWB 3U51A 4DG2E 1OKWA 1WVYA 5IPJA 4J98A 3VS1A 2PZRA 5L3AA 4IZAA 5FDXA 5JH6A 2E9UA 3DK7A 3FMHA 4G3CA 4BTFA 4DEGA 4NWMA 3F5PA 1OBGA 3BEGA 2E9VA 3GCPA 3ORLA 4GVJA 4R5YA 3PG1A 4Y46A 4YZMA 3ROYA 2XKDA 4NKAA 4EH8A 5KMKA 5C4LA 3FXZA 4PUZA 3QGYA 4NCTC 3V5PA 4U44A 2YDKA 3PVGA 4LOOA 4MWHA 3TACA 4ALUA 2ZJWA 1J7IA 2I40A 4F9AA 4ZZMA 2OJJA 4ZZOA 4R8QA 4USEA 5C26A 2CNQA 1GZKA 3QQKA 4NEUA 2BFXA 5C8NA 3LFAA 1V0BA 3HP5A 4AW5A 2BRHA 5A14A 4WSQA 5EM6A 4WA9A 1PKGA 1B39A 5B2LA 3EQBA 4BHZA 2R5TA 2C6MA 4TTHB 4I5PA 5E90A 1S9IA 2X2KA 1ZYLA 3LFBA 3HYHA 3ITZA 3Q04A 2VTTA 4FV8A 3COIA 2QOBA 1PXLA 3VS5A 4IX6A 5ANOA 3AC8A 4MQ1A 1UU7A 4CQGA 2GNJA 2GS7A 2PVRA 4OBPA 2NNWB 3HX4A 1AD5A 3UVRA 4WG3A 5DE2A 3UZPA 2JKKA 2C3KA 1XH7A 2R3RA 2Y8OA 4XG3A 3NMUF 3TKIA 4R1YA 3LLAA 3OCSA 4X2NA 2J0IA 3LXPA 3ORNA 5H3QA 2X2LA 4BIEA 4F1TA 3PXKA 4JR3A 3KK8A 2PU8A 3GQIA 1J7UA 3DDQA 5JMSA 1KE7A 2WXVA 4FKVA 4QYYA 5HIBA 1LEWA 3Q5IA 1NY3A 1M7QA 3QFVA 4LMNA 4O82A 4RC3A 5IA4A 5LWMA 5CU3A 4W4XA 4Y95A 4NM7A 3TTJA 2BAQA 3I7BA 2NP8A 2HW6A 2P0CA 2GNGA 2XK6A 4LUEA 3IDPA 1AQ1A 4AWIA 1H01A 4O6LA 3CTHA 3L9NA 4J53A 3FMMA 4O27B 2V5QA 2VGPA 3UP2A 4UMRA 3G9LX 3MBLA 3NUSA 3FKLA 4DGLC 3DAKA 4O86A 4X0MA 3Q9ZA 3WZJA 5AV4A 4CKJA 3LZBA 3V8SA 4EWQA 4E8AA 1U54B 2UZUE 1WZYA 1WCCA 2Y7JA 3B8QA 3G6GA 4I0RA 4FBXA 3L8XA 3VQUA 1ERKA 5AP4A 4FKIA 4UMTA 5AIRA 5AX3A 4D2WA 3FZTA 3TXOA 3MWUA 2RKUA 4FOBA 2X2MA 2ZV9A 1KE8A 4FSRA 3VJNA 5I9YA 3EKKA 2R7IA 1P5EA 2ZV8A 4YJNA 3ANRA 3MH0A 4YJVA 2O5KA 3LCKA 4ACHA 1SZMA 3F2RA 1WBSA 3MB6A 3BYVA 5K4IA 5JN2A 2UW6A 3LCTA 4FV1A 3BBTB 4E4LA 2HOGA 4RWIA 3PVBA 3BRBA 3AD4A 5HG8A 2C4GA 3DXPA 4FG8A 5GJFA 4BZDA 4OUCA 1B38A 4M7IA 4MNEB 4H3QA 4OR5A 3NUXA 3RM7A 3P4KA 1FPUA 5DGZA 3OWJA 4R6VA 3OOMA 5IQEA 4YJOA 2VTNA 2WIHA 3VRYA 2XB7A 3R0TA 4YJUA 3WIGA 4KA3A 3CTQA 1VZOA 3ANQA 3R7GA 1ZZ2A 4HVDA 5HO7A 3ZOSA 4G3DA 1PXNA 4EH4A 2O3PA 1XBAA 4EUUA 1VJYA 3KRRA 4II5A 1X8BA 3GGFA 4QT1A 4RVTA 4BYJA 5LVMA 3DAEA 2GPHA 3LQ8A 3ZO2A 3P23A 2VTHA 4FTOA 4YO4A 2I0YA 2ZVAA 3P7AA 4O0SA 4U45A 4FT7A 3OHTA 3E8CA 3FC1X 3ZEPA 3DFCB 5CAVA 3CSVA 4TRLA 4BDKA 5J9ZA 3CJGA 4JQEA 3QRJA 4QMOA 1MQ4A 2IJMA 5EDRA 4WRGA 3IO7A 4DITA 3ULZA 4IMYA 2W4OA 3L9MA 3OXIA 2YLFA 1GIIA 3HMNA 4MXZA 3VBTA 3ZONA 4ACDA 2WHBA 3BKBA 2ERKA 1WAKA 3AC3A 4ANQA 2B0QA 4NTTA 2JLDA 2YLEA 2ZAZA 4FI1A 2PVYA 4G16A 2R3OA 1OL2A 3Q9WA 2BR1A 3I79A 1DAWA 3RJCA 4DC2A 1UNGA 4JLCA 4OW8A 3FUPA 5AM6A 5DPVA 3VC4A 3C1XA 3COHA 3VBWA 4LV5A 2GS2A 5KZ0A 3FLYA 4LYNA 4RX7A 4FUXA 4YHFA 1OGUA 3RCDA 4C8BA 4DFYA 4E6CA 4FKGA 5BQ0A 4BKYA 2RG6A 2C47A 1BUHA 2XIXA 3GEQA 4TYIA 3VVHA 4E6DA 3PZEA 4X2KA 4I20A 4OT5A 1RE8A 2QU5A 4YJQA 1M52A 4F0FA 3HV7A 4RX5A 3PXQA 4QMMA 2YN8A 3OW4A 1A06A 3R7OA 4GG5A 4N4SA 5DRDA 4WHZA 2G01A 5IQHA 2WMUA 4LM5A 4BRXA 4GJ2A 4KKEA 4UWBA 4AGCA 3A60A 3W1FA 4Z3VA 4I21A 1E1XA 5JFVA 2PUPA 2YDJA 4I4EA 5ETAA 5GHVA 4CD0A 4AW0A 1JQHA 3NDMA 5E7RA 4BDAA 3R9RA 3QCQA 3EFKA 4RGJA 4C34A 4I5HA 4KUJA 2R3KA 5HG7A 4J96A 5HCZA 2DWBA 4AGUA 4DN5A 5JFWA 5CEKA 5FEEA 3UC4A 3TDWA 4FODA 3FSFA 2OFVA 4GYIA 4CGAA 2QODA 4P5ZA 3G0FA 1ZY5A 5CSHA 5KMLA 2Y9QA 2VNYA 4EZ3A 2PULA 4AZFA 2R0IA 5TR6A 4E1ZA 2E2BA 4FZAB 3CKXA 1TVOA 4M14A 2B55A 5HNGA 4EZ7A 5HX8A 1A48A 4JL9A 5JT2A 4JDJA 3Q6WA 3F2AA 4M0ZA 2VTQA 4EH5A 2BTSA 3NUUA 5BYYA 1R78A 3WF9A 5KE0A 2KTYA 3D2KA 4H1JA 4ZMEA 3IG7A 5EI6A 5HORA 2HCKA 2QO7A 4ZEGA 1XBBA 2WEIA 1FINA 3EQDA 3QLGA 4LFIA 4GK3A 4Y85A 3N4TA 2C6LA 2FO0A 3RI1A 4DFNA 1U46A 2CGXA 1CDKA 2ITUA 2PTKA 4WSYA 3NUPA 3NGAA 1L8TA 4BCGA 3D4QA 4MTAA 4EL9A 3QRTA 3M42A 3QYWA 4RX9A 4XCUA 4Y83A 3V6RA 3EN6A 1V1KA 2W99B 3VAPA 3EQGA 4KNBA 3BLQA 2WTIA 5FM3A 4DFBA 3C7QA 4G5JA 4TYEA 4XP0A 2BCJA 1L3RE 1OI9A 3BEAA 4FTRA 4LQMA 4ANMA 5CAPA 2Z02A 4FF8A 4C4HA 2W9FB 4BVUA 4IM0A 3R04A 4QNYA 2X1NA 3IW6A 4I6FA 2FSOX 3A99A 4EBWA 4EQCA 3PJ1A 4IEBA 4D5HA 3UE4A 3KXHA 3C4FA 4P2KA 1HCKA 5AP2A 3ZDUA 2HXLA 3KVXA 4R78A 2GCDA 1H4LA 2XS0A 1NVSA 2P33A 4HGEA 3FI3A 3K5UA 5FBOA 4PRJA 3FC2A 4FTCA 3DCVA 3BYSA 3R8UA 3RBWA 3U4UA 4FEXA 1SYKA 1W8CA 4NFNA 3RTPA 3FMJA 4FSTA 2HZ0A 4OTHA 3LFEA 4Z16A 1UU8A 2ETRA 4UB7A 3R2BA 2YCRA 4D9UA 5HE1A 4ZIMA 3R63A 3NYVA 4MBLA 4XYFA 2ZDUA 4JR7A 5EYMA 3TI1A 1OB3A 2ITNA 4JXFA 4F70A 4BBEA 4FA2A 3KXNA 4JRNA 5EHOA 5ACBC 1R1WA 2P4IA 4DGOA 2BVAA 4IZYA 4IW0A 4L52A 4ZXTA 3DQXA 3FMLA 4FKPA 4IZ7A 2BUJA 3MVMA 4CYJA 2UV2A 2A27A 3EL8A 3G5DA 4XJ0A 3LCOA 5FM2A 3SLSA 3IECA 3R8PA 3DA6A 4IAKA 2CNVA 2ZM4A 1WBOA 3KXGA 4M15A 4F7SA 4ZLZA 1PHKA 3FKOA 3OD6X 4RJ8A 1E1VA 3EQFA 4QTCA 5E8SA 5C27A 4CFUA 2Z2WA 4DEHA 2UW5A 1YVJA 5F20A 1W84A 2UZLA 4BDFA 3WARA 1NVRA 3KVWA 4OT6A 5AR8A 4XS2A 4XG2A 3BGPA 5CVGA 2BKZA 4O83A 5LVOA 3ELJA 3OF0A 4ZJIA 5TT7A 1JVPP 2QG5A 4UZHA 4AN9A 4ZTMA 5AA8A 1G5SA 3OC1A 5JGBA 4LMUA 4O38A 2JKOA 3A2CA 4J8MA 4EH6A 2CNUA 1PY5A 2VX1A 3F7WA 3ZYAA 3MYGA 4OTFA 5HZNA 4EOLA 4K8AA 4O0UA 2YM7A 4NSTA 3O50A 2RFDA 3TZ9A 4NJ3A 1RDQE 2YM8A 1BX6A 1ZRZA 3KXXA 2WOUA 3QX4A 2BKKA 3RPVA 1ZWSA 5H8GA 4AAAA 4EBVA 2QNJA 3O71A 4AN3A 2XKCA 3R7EA 3ZLYA 3F61A 1PXJA 4ID7A 3JYAA 1NA7A 3I0QA 4D58A 1KE9A 3PE2A 4HNIA 5CSVA 4RX8A 4RIWA 3SXRA 3FLQA 1ZMUA 3PLAE 4J7BA 3PY0A 3CY2A 5D9HA 4DFUA 4XLVA 5HX6A 4I23A 3NYOA 3QUDA 3FMEA 3TCPA 3EL7A 1JKSA 2W1DA 2GDOA 4F4PA 4L00A 5CENA 3UG1A 1KV1A 3UOHA 4ZK5A 1JOWB 2WPAA 3E7VA 4E7WA 4KIOA 4IIRA 3QTIA 4CTCA 3EFWA 3KY2A 3F5XA 5IEXA 5IZFA 4WD5A 4IANA 2CCHA 3PUPA 4UMPA 3ZUUA 3SG9A 4XBUA 4PL4A 2V7OA 2G2FA 2CHLA 4O81A 4FV2A 3E3BX 3KN5A 4L67A 2XEZA 4ZSEA 4MF1A 3FHRA 3TNQB 5I9VA 2YITA 3LQ5A 5EKNA 2OBJA 3PRIA 4IAYA 4A9YA 4FKSA 4TYJA 4F7NA 3DY7A 3GU8A 3DBDA 1XH8A 2UW9A 4KSPA 4FIGA 4XV2A 5L2WA 3N51A 5AP3A 1YDTE 4AZSA 4FKTA 3SW4A 5KMJA 4AP7A 5HIDA 4DT8A 4E5AX 5FTGA 4HVIA 4QD6A 5B2KA 4KB8A 3WF7A 5HEZA 2J0KA 4AW2A 3R22A 4N6ZA 1OL5A 3EHAA 4Y5HA 4ZZNA 2PMLX 2PVMA 3VBQA 5L8LA 3NZ0A 4HW7A 2GQSA 2VUWA 2BZJA 5BMSA 3D2IA 1XH9A 2NO3A 5DR2A 4W4YA 5EW3A 1IG1A 4AZTA 4FTKA 4IM3A 5E8VA 5AR5A 3RVGA 4EK8A 4H39A 2XP2A 3QD2B 3UTOA 3IKAA 4BGGA 4MD8E 5HCXA 5HBJA 4AOTA 2ZV7A 4FSYA 3LIJA 4GFGA 4K18A 3R28A 3T3UA 1APME 4X2JA 5BNJA 4BKZA 1EH4A 4RWJA 3DZOA 5M07A 2C6KA 3IW8A 4ACGA 2P3GX 3HLLA 4G3GA 5CF6A 1YQJA 4AZEA 4YNEA 3SW7A 3E63A 3I60A 2C5YA 3NS9A 4X6RA 4B8MA 4FE2A 3HMPA 1SM2A 2X9FA 3ODZX 4C38A 5JEBA 2WTJA 1PMUA 3KXZA 2UUEA
chains in the Genus database with same CATH superfamily
2JDRA 2PZIA 4YC3A 3R8MA 3KREA 3UGCA 3MN3A 4EJNA 2GHGA 4FZ6A 3DOGA 2PYWA 4X7QA 3TIZA 5IEYA 2YHVA 3R1SA 4QMTA 1O6YA 1XKKA 3G9NA 1U5QA 2IVUA 4RA4A 3P08A 3D14A 4C59A 1QPDA 3G2FA 2BDJA 4ALVA 5CU2A 3W0OA 4MAOA 3OCGA 4E26A 4G31A 4FV3A 4GVAA 4HYHA 3AT4A 2GU8A 2XEYA 4D2SA 3MPMA 2BHEA 2X4FA 2ZMCA 4X2GA 3D7TB 4YTIA 4UZDA 1TQIA 3R6XA 3TZMA 5AAEA 2VO3A 2YABA 1GJOA 5IA5A 4D0WA 1XWSA 3O17A 4IDVA 3UO4A 4YPSA 2J5FA 4GL9A 4W9WA 5TF9A 3QQJA 2C0IA 3ROCA 3VBXA 1H27A 2WTDA 5F94A 1IAHA 4IWOA 2I0VA 3D7ZA 1H1RA 4GFOA 2RF9A 4J1RA 4O0VA 3TJCA 2O63A 3OCTA 4Q5HA 3FLZA 4U41A 4XP2A 3LM5A 4KRDA 4KRCA 2OH4A 4BCPA 5HG5A 3A4PA 3GXLA 1CTPE 3FMNA 4E73A 4OTGA 1OUYA 3OW3A 3RAHA 3UIXA 4D0XA 3BYMA 3IQ7A 1MP8A 4CFVA 5IUIA 5EQEA 4FIIA 3RWPA 2BPMA 1YI4A 2O64A 4QMYA 5AIKA 2XBJA 2PUUA 3HECA 2VD5A 2QOCA 3TWJA 3ZXZA 4S32A 5G6VA 3PY3A 1VYZA 5KMMA 3RPYA 1OL1A 4JX3A 4FG9A 5IQGA 3F66A 4JBPA 3VUMA 1PW2A 2PHKA 3PE1A 3PSCA 1ZY4A 1ZYDA 4XH6A 4BWXA 3L1SA 3BQCA 1VLRA 4DTAA 2R3QA 5HCYA 5FXQA 2CGUA 3PPZA 4BCJA 1Y8GA 3OBJA 4LGHA 4AOIA 4O7YA 4GKIA 3UDBA 4DHFA 2UW3A 2HY0A 3QA8A 5IDPA 2ERZE 4N0SA 2PVFA 4FEQA 2VWWA 1OKVA 2XM9A 4MHAA 4PDOA 3FPQA 3AXWA 1Q8ZA 4E5WA 3ZDIA 1OIRA 3EN5A 5GZAA 4C2VA 3R9OA 1MRVA 4AE6A 2C1AA 2YM3A 4NK9A 5CVHA 1H26A 5A4LA 4EOMA 4IB3A 5JZNA 1VEBA 4I5MA 4FKOA 5D10A 5L8JA 4EWHA 3CY3A 4QP4A 5AR3A 3S4QA 3QALE 5EW8A 3QD4A 3FQEA 3FSKA 2R3JA 3CD8A 3COMA 3F3TA 5IH5A 1G8KA 1PXKA 4HVGA 5EG3A 3S95A 5EYDA 5AP1A 2UZEA 3ZEWA 3LHJA 5FD2A 2BZIB 4R3PA 5I5ZA 3MFRA 2B53A 3FLWA 2JDTA 4L3JA 4LOQA 2WMSA 4QNAA 4AXEA 2W17A 2YA9A 3PSBA 3I6WA 4LV7A 3AGLA 4UY9A 5EDQA 5FTQA 5J7HA 4O7TA 2NRYA 5L6WL 4R7IA 3QWKA 4HYIA 4BTJA 4KIQA 3ZC6A 4Y73A 2WFYA 5FBNC 2J6MA 5LOHA 4NIFA 1YDSE 3CLYA 4AA0A 4B0GA 3FY0A 3DAJA 5HD4A 4ZS4A 2Y4IC 2W7XA 4ERKA 4OTWA 5BVEA 5HO8A 4FK6A 4MXAA 5C8MA 1CM8A 1CMKE 4F9WA 4EOKA 1QPJA 3Q60A 4USDA 5E8TA 2YJSA 2GQGA 2CKEA 3VJOA 4FTIA 5IQCA 1REJA 3V5JA 2JD5A 4D4VA 3GCUA 4ASXA 3VS2A 4D2PA 3E5AA 4BL1A 2PZPA 3GC7A 4A06A 4YUQA 4F7JA 4E93A 3BHUA 5HE3A 2WMAA 1K9AA 3CD3A 4QMWA 1CSNA 2B9IA 5GZ9A 4G6LA 1O6LA 5LVLA 3MA6A 4J99A 3W0PA 3WIKA 2C6TA 3C5UA 3EJ1A 5A4EA 3IDCA 3KULB 4U42A 4G17A 1CKIA 3BU6A 5D41A 3B8RA 1YWNA 2C6IA 5CEMA 3KL8A 3RNYA 3FEGA 2QOQA 2CN8A 5LWNA 4EHVA 4TYHB 4FIEA 1XBCA 1G8JA 3G33A 4C7TA 4E6AA 1FGIA 4HGLA 5M55A 3SD0A 2REIA 3QX2A 4WOVA 3TZ8A 3ULIA 3VONA 3GI3A 3JVSA 2QLQA 1Q8UA 4BCIA 2EXEA 4CMOA 2OJ9A 2X8EA 2GNFA 2QHNA 1ZYJA 4JVGA 5CU6A 2ITPA 2C5NA 3EFLA 1G8AA 4GW8A 2EXCX 2HZ4A 1FQ1B 3TUBA 4RC4A 4PTGA 3ORPA 4X3FA 4IHPA 3GBZA 4CMTA 3CJFA 5CALA 4XBRA 5E91A 5EOLA 2YERA 2QKRA 2OFUA 4B8LA 4GKHA 2UVYA 4CTBA 2VWUA 5KMIA 2I7QA 3QZIA 2XRUA 2YIQA 4BKJA 4O0TA 3OY3A 4ITIA 5K4JA 3PXYA 4A9SA 2GS6A 2A1AB 2VO0A 4PMMA 1IRKA 4JDKA 3MVLA 1P4FA 3MI9A 4KABA 4QQCA 3BV2A 3GVUA 3A61A 1JSVA 5CQUA 3I4BA 4PTEA 5IQBA 1V0OA 3WZKA 5IH4A 4MVFA 2GTMA 5CY3A 2AEGA 3FPMA 4H36A 4AXCA 3ZH8A 1Q61A 4ORKA 4FTJA 3MY1A 3GT8A 4ZSLA 2WQEA 4JS8A 2UVZA 3H0YA 3THBA 2W06A 3OUKA 5LJJA 3PIXA 4LRKA 3QCSA 2X8IA 3PTGA 2X8DA 3C4WA 3IS5A 3O5AA 5IA1A 4J97A 4ZLOA 5A54A 4RIYB 5IA2A 4TW9A 4RQVA 1Q8TA 5CTPA 1XH4A 3TN8A 3HEGA 4BHNA 4XMOA 1Q97A 3QAME 3ZTXA 5BVKA 2ITOA 3KB7A 3TTIA 3HRCA 2BZHB 4J95A 3ZRMA 2FUMA 4IC7A 5FXRA 3S0OA 3P79A 3O0GA 2Z7LA 3RK7A 2WTVA 3U9CA 3BQRA 5CT0A 5DN3A 3QC9A 4O2ZA 2RL5A 4M69B 2SRCA 3TV6A 2IWIA 3DNEA 5CEPA 2UZWE 3E3PA 4L3LA 4QP7A 4FICA 3T9IA 1YHWA 3PA4A 4Q2AA 5DNRA 3PPJA 5J7BA 4D1XA 4EC8A 1GZNA 3E93A 4JBVA 4KS8A 1H08A 4GV1A 5I9ZA 2WTKC 2F7ZE 5AWMA 3EN4A 2OICA 4IFCA 5HE2A 3DKGA 3V5TA 4JRVA 4O7RA 4K77A 2QR8A 5HVYA 4CXAA 3DU8A 5H2UA 4RQKA 2ITTA 3N4UA 3BL9A 3O96A 4DH5A 4C4GA 3A7HA 1PRYA 1PXOA 5T68A 3MH3A 4YC8A 5AUWA 3LMIA 4FZDB 4OGRA 2XANA 4OTPA 4F99A 3ZU7A 3EQPA 4ZTHA 3NSZA 3Q53A 4O21A 4F9YA 3A7FA 5FEQA 4IVAA 4CG8A 2XJ1A 2XK9A 2J90A 1OBDA 5TO8A 3O51A 3MIYA 3P1AA 4FNZA 1FGKA 3GB2A 4C0TA 3MDYA 3UO6A 3R7YA 1OPLA 1YKRA 3O7LD 4IJ9A 4O96A 2C5XA 3K2LA 4LGGA 5KBRA 2XK4A 5ANEA 4QMPA 2JEDA 3CC6A 5TE0A 2IW9A 5FP6A 5M09A 4PWNA 4YBKA 4QEBA 4CKIA 3T3VA 3W33A 2VTJA 2IZUA 2OJGA 4GT5A 1ST0A 3C4EA 4XG9A 4A4OA 3OTUA 3UYSA 4A9TA 5GZ8A 3ZM4A 2JIUA 3HA8A 4YGAA 5D1JA 1M2RA 2C3LA 2NRUA 2P2IA 3DJ5A 3PYYA 2Z7SA 3CCNA 4M0YA 4ZTQA 3VUIA 2E9OA 3ZSHA 4AOJA 2UZBA 3DJ7A 4O0YA 3R1YA 3D94A 4IX5A 5CSWA 4BDBA 4HVSA 2C3IB 5L2QA 3MIAA 4JBOA 3AC5A 4O7NA 1JAMA 2BRGA 3VHKA 5AAGA 3RHXA 4MD7E 3RK5A 2IN6A 3PRFA 3UDTA 3GENA 4FEVA 4RFMA 4I92A 4HCVA 3OXTA 3BBWA 1P14A 4XG7A 3DS6A 4N6YA 3AD6A 1ND4A 2QOOA 2O8YA 2OI4X 2VZ6A 4FSZA 4PPCA 1IAJA 1O6KA 3OUNB 1YXSA 4NH1A 2OF4A 4MX9A 3RZFA 3FXXA 3VS0A 3NNWA 2YCQA 1YHSA 5CAUA 2IZTA 4DLIA 3KEXA 2W1GA 4YTFA 1UWJA 2OF2A 2XUUA 5DFPA 5AV1A 4OAUC 2R3GA 3MESA 4AZVA 4CSVA 3TMOA 3I7CA 4F65A 4JIAA 4D5KA 3A4OX 4EQMA 4AAYA 3GU7A 4ZMFA 4QP2A 1K3AA 2YJRA 4D2RA 2OK1A 4JIKA 4ZJJA 2YFXA 3BZ3A 3K3IA 5IMXA 4U8ZA 4AZWA 2BRBA 5HVJA 3NNXA 4Q9SA 2A2AA 4IXPA 2FB8A 4YBJA 3WZDA 2R3IA 4I5CA 2RFSA 1FMOE 4AW1A 3AT3A 2RFNA 1SVHA 2WD1A 2GHMA 2FVDA 3LFDA 4IADA 4YPDA 5AV0A 4AFEA 4N70A 3W8LA 3TKUA 4E6QA 3SV0A 3UIMA 1BLXA 5ETCA 4G6NA 1Y6AA 4M3QA 4PPAA 2XH5A 4YHJA 3BHVA 3HV4A 3DXQA 4DFXE 5BV3A 1PMNA 3LM0A 1H24A 3QF9A 4S31A 4DEAA 5CYIA 2CSNA 5DVRA 5EI8A 4FT9A 4F1MA 3DBCA 3LLTA 3ODYX 4Q5EA 3CPCA 5KX8A 3LVPA 4J52A 1CKJA 1J1BA 2XIKA 2YM5A 4KBAA 5AV3A 1ZMWA 5TOZA 4YURA 5IG1A 1Q8WA 2ITYA 4YZBA 4AF3A 4TN6A 3MSSA 3KA0A 4FL1A 1VYWA 4CRLA 4RJ7A 4U79A 4ANNA 4QO9A 3R9NA 3P5JC 3PXFA 4IZ5A 4PDPA 3D5UA 3W55A 3ATSA 4EEVA 5LQFA 4RVKA 2XNBA 1KUTA 2CLQA 4LL0A 3QRUA 2UW0A 4F9CA 2UW8A 4C3PA 1GOLA 3NWWA 5HQ0A 4D9TA 3GUBA 3VN9A 5LMAA 2JKQA 4CV8A 3SGCA 2RFEA 4HPTE 1W98A 2JBOA 3Q5ZA 2R3PA 3C13A 3NVKI 4X3JA 1W7HA 5DBXA 2OO8X 1QMZA 3E88A 3NIEA 2RIOA 2CGVA 5JRSA 4CZYB 4PDYA 4X21A 4PP7A 4BDHA 3VF9A 5M4UA 4XV3A 5IH6A 5A3XA 2XYNA 4BTMA 1JSUA 3PWDA 5AA9A 4CCUA 4JJRA 4WNPA 1BI7A 2C6EA 2ZMDA 1SNUA 2ITXA 3I5ZA 4AQCA 5IISA 3NYXA 3UPXA 1MRYA 4C4EA 3C4ZA 3NNUA 1UWHA 2O0UA 4Z9LA 4E4NA 4FKJA 3ALOA 4BJJA 4NM3A 1OM1A 4QP3A 3LCDA 4GUEA 4UXLA 3UNKA 4BCHA 2GHLA 3BPRA 5IUHA 2YIXA 4MBJA 3Q6UA 2X9EA 4B6LA 3FMDA 4L3PA 3P78A 4EK3A 4IFGA 3KF7A 2BIYA 5JGAA 3G6HA 3QTUA 3ZSGA 5EHLA 3NCZA 2R3LA 4EUTA 2XMYA 2B1PA 1UU9A 3FQHA 3HP2A 2R2PA 4I0SA 3TJDA 5IU2A 4L8MA 4W4WA 5H8EA 2E9NA 4G3EA 2QOKA 4HZRA 2XF0A 1FOTA 2WTWA 4RT7A 1PF8A 5AR2A 4EHGA 2XAOA 3GOPA 1R0EA 2PE0A 2C1BA 5EFQA 4BWPA 3CR0A 2O2UA 4WUAA 4NYEA 4BCQA 4JG6A 4J71A 4O7SA 3E8NA 3RM6A 3ZBXA 4KD1A 5C03A 3R8VA 2P55A 1UNLA 3JPVA 3WI6A 2GMXA 3R1NA 3ZUTA 4UV0A 4HOKA 1OIYA 5CS6A 4ZLYA 5E1EA 4CLIA 3CIKA 3GCSA 3N9XA 4U3ZA 2XJ0A 5IQDA 4JNWA 3G0EA 4DFZE 2FGIA 4DA5A 3DFAA 2BAJA 2QD9A 3L9LA 2UZNA 4QQTA 2J4ZA 4YC6A 1LP4A 3QTZA 2PE1A 2X7GA 3BGZA 3HV6A 5IQAA 3WF6A 1LR4A 3FZ1A 4PNKA 3F3VA 3PXRA 3AKKA 4L53A 2OIBA 1QL6A 1BMKA 1REKA 4V05A 5KKRB 3I0OA 4DBXA 3TKHA 5AUZA 3B2TA 3SQQA 3BE9A 4U9AA 4O1PA 5FP5A 3T8OA 3VW6A 3JS2A 3WF8A 4C02A 4YLJA 4BY9E 1B6CB 3CQEA 1R0PA 5ANIA 4DLJA 2VTPA 2CGWA 4B9DA 4K0YA 2QOIA 4C35A 2HELA 3IW4A 4XV9A 2GNLA 2B4SB 3R83A 5HNIX 1FBNA 1KSWA 5JQ5A 2KULA 3GC8A 3I81A 4HZSA 2PE2A 3KMWA 1MUOA 4FKRA 4LRJA 4M84A 4RC2A 4EJ7A 4BR3A 2C6OA 2OWBA 3DKOA 3ENHA 2VTSA 2H96A 3PPKA 3CQWA 3KMMA 3DBQA 3DBFA 4DH7A 1XHAA 3QCXA 3VULA 3MW1A 3FKNA 3DKFA 1R39A 4K2RA 2DUVA 3SRVA 3UVPA 4NUSA 3VW8A 5LCJA 1TZDA 2BRMA 2QQ7A 5J1WA 3TNPC 2CKPA 3E87A 3QZGA 5JFSA 2FYSA 2XM8A 2YWVA 1YOJA 4BI0A 3C0GA 3TDVA 3O23A 1H1QA 2VX0A 4RMZA 3CPBA 3DPKA 3GFWA 3ZMMA 2BIKB 3AG9A 5FXSA 4BDJA 1XO2B 4IVCA 4CMUA 2R3HA 1NVQA 3VS4A 5IDNA 2I1MA 3QQHA 3QRKA 3WE4A 3RAKA 1LPUA 3LXNA 3NYNA 2OG8A 4ZSJA 2UW7A 4U80A 5AAFA 2B52A 3PVWA 4U0IA 3FI4A 5BUJA 1Z5MA 3BELA 5EQYA 3VF8A 3DKCA 3BL7A 2ESMA 3GU5A 3F82A 4C3RA 4IWQA 1ZOEA 1TQMA 3AD5A 4PQNA 3MJ1A 4BI2A 3QTRA 2PVJA 5CF8A 5M51A 2IZSA 3KC3A 5M57A 1ZOGA 1MRUA 2VNWA 1W82A 2YIYA 4IWDA 3FJQE 2ZB1A 4CV9A 4O7LA 2HIWA 3VWAA 1W83A 4W9XA 2OSCA 2C0TA 2WO6A 3V6SA 1ZZLA 2BTRA 2QU6A 3Q32A 3IGOA 3H10A 4L68A 4XOZA 1W2FA 5BVNA 3S00A 1IA9A 3U8WA 4EZ5A 5HLWA 2EB3A 1PMVA 2CKQA 2HENA 4F0GA 4YJRA 2VU3A 4FMQA 2F57A 4L43A 4QP6A 5KHXA 5HKMA 3LOKA 2I0EA 2AC3A 4L42A 2YDIA 2VWZA 3OFMA 4OLIA 3JVRA 5EH0A 4ENYA 4GIHA 5FLFA 2FSTX 1IASA 2OXXA 5BVOA 2PZYA 4UXQA 5CEQA 3F2NA 2X39A 4U40A 2WEVA 5K3YA 2IVSA 3QKKA 4GH2A 3TNIA 3WZUA 4B7TA 5IUGA 3BU5A 3HUBA 3BE2A 3NUAA 3ZM9A 3UZTA 5AP6A 4HJOA 4X3FC 1ZOHA 1PKDA 1WVWA 3TT0A 3SVVA 2OKRA 2ITWA 1PYXA 3N4VA 1BL7A 5AP5A 3R8ZA 3Q4TA 2QLUA 3ET7A 4I93A 4CLJA 4MNFA 1G3NA 4TL0A 2OJFE 1UU3A 4R3RA 4DCAA 4Y8DA 3OROA 2VO7A 2ZOQA 3IW7A 4F7LA 1QPEA 4OBOA 2IVVA 2CLXA 4FTNA 3DXNA 3U55A 1M2PA 5KNJA 3GC0A 3SXFA 4I6LA 3CBLA 4GYGA 3RCJA 2OZAA 2R7BA 4G3FA 4U43A 4V0GA 2I0HA 4YMJA 3ZLWA 1YWVA 4BC6A 2W1FA 2YEXA 3KXMA 4FGBA 4FV4A 1BKXA 3WBLA 2BAKA 4IX3A 4IM2A 1YXVA 2UZDA 4CRSA 3AOXA 3FL5A 4QYGA 4RIXA 1U4DA 5EOBA 4YJTA 4MKCA 2IVTA 1YWRA 5EM7A 5M4CA 3W16A 4KIPA 2Y6MA 2HWPA 2YCSA 3C5IA 1ZLTA 3U54A 3LE6A 3R7VA 4YO6A 5A4TA 4QMQA 4HGSA 1OPJA 3FYKX 3BYOA 3TEIA 3CTJA 4FEWA 4NU1A 3U4WA 2WMQA 3O8UA 4ANSA 3V5LA 1OIQA 4FTLA 5J5TA 4A4LA 2C5OA 4PNIA 4XUFA 1STCE 3FWQA 4FTTA 3IONA 2PVKA 3DLZA 4LOPA 2PL0A 3ZO4A 1Z57A 3R02A 3LAUA 5AADA 5IF1A 4I6BA 4C36A 2C5VA 4MCVA 5D7AA 4KIKA 2R4BA 2VTIA 3RP9A 4BTKA 4EC9A 4GEOA 5HTCA 1Q5KA 5HE0A 5CEIA 2G1TA 4RIWB 3II5A 4F09A 4Z7HA 2FSMX 5I3OA 3E8EA 3D5VA 4LV8A 5J9YA 1URWA 1OKYA 3R21A 3ML1A 1XMLA 3FZRA 3HDNA 3HVCA 3NPCA 2X0GA 2V22A 2F2CB 2WQNA 3POZA 1DM2A 3MVJA 4W4VA 4FL3A 5C9CA 5AUTA 5HU9A 2GNHA 4AT3A 1XR1A 2WU7A 3D5WA 4QMLA 4QYHA 4RJ3A 4DEBA 4I1ZA 2PWLA 2Y6OA 4FZ7A 3MH1A 3TV7A 3ALNA 2WOTA 3VNTA 3VS6A 1JSTA 4DEEA 1IEPA 2XIZA 3BLRA 3FYJX 4FV6A 3UBDA 1J7LA 5DYJA 4XOYA 2LGCA 2VGOA 3C0HA 3OXZA 3PWYA 5CLPA 3ZFMA 2EB2A 4BCOA 1K2PA 1JLUE 5E92A 4YZ9A 3OVVA 2XALA 4FKQA 3OY1A 3AC2A 5CZIA 3BHYA 4R5SA 4Z55A 3HNGA 4G1WA 5IQFA 1H07A 5HESA 1UNHA 3ZS5A 5CX9A 3W0RA 4FV7A 4CFWA 3FI8A 3MY0A 5CNOA 4XV1A 4TYHA 4BDCA 4BDIA 2BMCA 4KAOA 2V55A 3ERKA 4FL2A 4L7SA 4PF4A 1UKIA 4XRJA 4LG4A 5HNBA 1UA2A 3WYXA 4E5BA 3KCFA 4O4BB 3LXLA 4S34A 4TT7A 3VS3A 3SG8A 3OG7A 5CI6A 3KRLA 3NNVA 2A19B 4JOAA 3BIZA 4L46A 5B0XA 4FTQA 3LFNA 4MK0A 4ZSAA 3L9PA 3WILA 5LMKA 1IA8A 1OZ1A 2G2IA 3EFJA 1HOWA 2UW4A 2IF8A 5HLPA 2JAMA 4QPMA 1JBPE 4TPTA 3M2WA 4NZWB 3Q3BA 4YLLA 2Q83A 3RWQA 4YU2A 5TKDA 4XG6A 4TWPA 4AQKA 4G6OA 1ZYCA 3F7ZA 4UEUA 3F5UA 4TYGA 4WKQA 3IW5A 5L8KA 3W10A 5DWRA 3NFFB 3OT8A 1DI9A 3O8TA 5EM8A 4TWNA 5CNNA 5L6OA 5F4NA 4CFFA 4U7ZA 2XIYA 4YZDA 3UQFA 3QTXA 5F9EA 3RK9A 3FZOA 2CCIA 5AUUA 4AT4A 3AMAA 2VWVA 4FOCA 4V04A 3EQHA 3PXZA 4XNEA 4O0WA 4ZS0A 5A4CA 1UVRA 2H8HA 4ZY5A 5J87A 3CKWA 4C61A 5HBEA 2WZJA 5KO1A 3T9TA 2IG7A 2UVXA 2EU9A 5T6KA 1FVRA 3PY1A 1M2QA 3NUNA 3QUPA 2ITVA 2WMBA 5I9WA 3HV5A 1O9UA 3UZRA 2W9ZB 2XNEA 2XVDA 4FGRA 3QL8A 3PIYA 5FWKK 3WF5A 4BF2A 3DTCA 1H0VA 5LVNA 4DEIA 4IAAA 3PUFC 2OIQA 3Q9XA 2B54A 5EDPA 2F2UA 1DAYA 1TFFA 3O7LB 4G2FA 4WO5A 4FSMA 4F08A 4TWOA 4RPVA 5K0KA 4ACMA 3R7UA 4FSWA 4A9RA 4MYGA 2YISA 4J8NA 4UWCA 3SHEA 1LEZA 2YM4A 1PXPA 4G34A 4GT3A 2DS1A 4AS0A 3V8TA 5L4QA 5HVKA 1KE5A 2QO9A 3V51A 4K33A 2VWIA 2J5EA 4MXCA 5C8KA 3REPA 3ZSIA 3BHHA 2ZM1A 5I4NA 4P4CA 3W0QA 3HGKA 3RMFA 5GIPE 3G15A 3UJGA 3AGMA 4WG4A 2R3MA 3S2PA 2YACA 2J0MB 3GP0A 4AX8A 4LDTA 2EVAA 4GU9A 3ZRKA 5AV2A 5AUYA 2IW8A 4E4XA 2QO2A 5DG5A 3W2SA 4BIBA 5ICPA 4R3CA 5JSMA 3EQIA 2XAMA 4R77A 3UG2A 3VBVA 4F78A 5M08A 1Q24A 3ZUVA 3UODA 3F5GA 4EH9A 5FUTA 3PDTA 3LFFA 3L8PA 3FXWA 1XH5A 3OTVA 3QTSA 5HOAA 2P2HA 2JIVA 3KU2A 3W8QA 3QQLA 5CF5A 1YXXA 2V0DA 2QR7A 3NLBA 3ZZWA 3U6JA 2XBAA 2XNOA 3JY9A 3RPSA 2XK8A 3VS7A 4TZRA 4CG9A 2VO6A 4RA5A 2J0LA 4CZTA 4GUBA 5M56A 2X4ZA 2R9SA 2YIWA 3LXKA 1JWHA 4QP8A 2G15A 4YJPA 3TV4A 5M4IA 2G9XA 4L6QA 3KGAA 1H28A 2QOHA 2XNNA 1YRPA 1U54A 1MQBA 2X7OA 3IGGA 4R7HA 3DB8A 4RFZA 5AR7A 4BDEA 3PFQA 3I5NA 3MFUA 3PG3A 5H8BA 2Z7QA 1ST4A 1RQQA 5JZJA 2W1EA 1DS5A 1H1PA 4YTCA 3EKNA 1U5RA 4R7BA 3SX9A 1SMHA 2EWAA 4AXDA 2R3FA 3GC9A 1OITA 4MEDA 2O65A 3ZCLA 2GTNA 2B9FA 4IDTA 3DLSA 5E9EA 5EM5A 3EZVA 4C4IA 3MPTA 3KCKA 3QWJA 3MY5A 4FYOA 2PZ5A 5J1VA 5ANKA 4UYAA 4FV5A 3UVQA 4EKKA 5JGDA 2C69A 4WRSA 3KRXA 4MQ2A 2JAVA 1WFCA 4GS6A 4DHZA 2W5HA 2DYLA 2JKMA 3DJ6A 4U5JA 5CXHA 4WNOA 4FC0A 4GK4A 4AGWA 4MNEA 5GIOE 2ONLA 4W8DA 2J2IB 4I94A 4ERWA 4YR8A 1KOBA 4E4MA 2PMIA 4EH3A 3E7OA 4D4RA 4DG3E 4HCUA 4ITJA 4BFMA 2XZSA 1WBNA 3FBVA 5DT4A 4BYIA 3A7IA 3UMWA 5AUXA 4UYNA 2HYYA 5CU4A 3CGOA 3DDPA 4FSQA 5CWZA 3UOKA 4S33A 3L8SA 3W0NA 1KWPA 3MVHA 5CI7A 4NIFB 1F3MC 2XYUA 3MPAA 4RWKA 3BX5A 2ZV2A 2FA2A 1OPKA 3ZLSA 2Q0NA 3B2WA 4FYNA 3SC1A 4CKRA 2JDOA 3SOCA 4PDSA 5ANGA 1YI6A 4QOXA 1CKPA 3RPRA 1H8FA 3OZ6A 5DIAA 2AUHA 3RKBA 1URCA 5J9LA 5EW9A 2CJMA 4ANOA 2F4JA 3W18A 2PY3A 1TKIA 3RINA 3ZC5A 4A4XA 2OW3A 2OXDA 3HMOA 3HRBA 5EYCA 4D28A 5AMNA 3S1HA 3ATTA 1UV5A 2C68A 4EKLA 4D4SA 3VO3A 4ZJVA 3CGFA 3HA6A 2XA4A 3FHIA 4DGNA 2WB8A 3VUHA 4I24A 3C50A 3U6IA 3R73A 4ARKA 5J79A 2H34A 5K5XA 5EK7A 4X6QC 3GOKA 4EOQA 4AG8A 4O4DA 3TL8A 3ZBFA 5M44A 3C0IA 4FIJA 2CN5A 1ZMVA 2W1HA 1YW2A 3ZXTA 3DV3A 4DYMA 5BUEA 5HGIA 3F9NA 1H00A 5K0XA 4FIHA 4RBLA 4CQEA 3ZO3A 3AKLA 4NW5A 4B4LA 1I44A 4IB5A 4NM5A 4ZY6A 3R71A 2HZNA 4UN0C 2J51A 3ORTA 4O4FA 3UMXA 4APCA 1FVVA 2HXQA 1ZYSA 3P7CA 3QYZA 4HYUA 3QA0A 1W0XC 4AE9A 3FMKA 4X3FB 2YZLA 4EOJA 3POOA 4ZTSA 4ACCA 4IQ6A 4JDIA 4AA5A 4FEUA 2JBPA 3ORKA 5LMBA 4M13A 4O7ZA 4UMUA 4TNDA 3UIBA 5E8UA 4CFMA 3EYHA 4YSJA 4QDEA 5B2MA 5T3QA 5DR9A 2VTLA 2UZOA 2VAGA 4CFXA 4EK4A 2YIRA 4Q9ZA 3UPZA 3P9JA 1Q41A 4PL3A 3JR1A 3EB0A 4NW6A 5JK3A 1F0QA 3VUDA 4BCMA 4DDGA 4CEGA 5L2IA 3OMVA 4KSQA 2PSQA 4L9IA 3QQGA 3F3UA 4FSNA 3IOPA 3QHRA 2VWYA 2WELA 5DMZA 5I9XA 2DQ7X 4M68A 2BDWA 4EOOA 2X6EA 5E1SA 3CP9A 3DNDA 4FSUA 2NPQA 2JDVA 1P4OA 3C51A 3FDNA 4RWLA 4V01A 3NUYA 3L8VA 3ZHPC 5A6NA 3V04A 4QTAA 2WMWA 4JG7A 4OTRA 4DINA 4L44A 2HW7A 4L01A 3VUGA 4F6SA 3DK6A 1XJDA 2F49A 3PZHA 4CZUA 3MFSA 4FT0A