4CMUA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor (10r)-7-amino-12-fluoro-1,3,10,16-tetramethyl-16,17-dihydro- 1h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11)benzoxadiazacyclotetradecin-15(10h)-one
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmuA01
3EKNA 2WMVA 4IFCA 5DIAA 4NZWB 3U8WA 3HMOA 4MVFA 2XIZA 3VRYA 2AYPA 4ANBA 4JAJA 4CZUA 5L2TA 5DYJA 4EK6A 4GIHA 1FINA 2BTSA 1FVTA 4JRNA 3ENMA 3OXIA 1K9AA 5J9YA 4DCAA 3U9NA 3U51A 5JFVA 3PXZA 4QNAA 2C3LA 4JG7A 2PYWA 2OU7A 4AN2A 2HXLA 4IAYA 1URCA 3MDYA 3R7UA 2XK4A 4YMJA 4QMPA 2QOFA 2YCRA 1PYEA 2W5HA 3AG9A 3R71A 5HO7A 4IACA 3SKCA 2NNWB 5IQGA 1UWHA 3PJ8A 5J5SA 3LXNA 3ZO2A 4EZ3A 3NAYA 2YAAA 3D0EA 2QOOA 4R3RA 4A7CA 4BB4A 4BIEA 1JSTA 5IMEA 4O0WA 2WELA 3GB2A 5IUIA 2C47A 1JBPE 4YJOA 1H8FA 1YWRA 3TT0A 3NW5A 3OP5A 4FC0A 3G9LX 2V62A 4K8AA 4KRCA 3BV3A 3FMJA 4BDGA 3KCFA 3UO5A 5E8VA 4H36A 2Y4IC 4TYHA 4KS7A 2X7GA 3ZZWA 4TYJA 4O38A 1FGIA 4J8NA 1NVRA 3PPKA 4DC2A 4QP4A 3KXNA 5DHJA 3SRVB 3DJ7A 3UOKA 3QD4A 4I3ZA 4PX6A 3WIGA 2UVXA 3G9NA 2PUIA 3I5NA 3VS1A 4PTCA 1XH5A 4OBQA 1CDKA 4FTMA 1BI7A 5ANGA 1OUKA 3UQGA 4DH8A 2NPQA 3JS2A 3WE4A 3SG8A 5CY3A 3R83A 4DLIA 3D14A 1PHKA 1OIYA 3D2KA 3FBVA 3I7BA 4HPTE 3I79A 3Q53A 3PG1A 5G6VA 5KUPA 4ACMA 4O0YA 3OZ6A 5GZAA 4TYIA 4I20A 4HYIA 4GS6A 4ZSJA 3VQHA 2R0IA 5ICPA 4AN3A 3VUKA 1PXNA 5T6KA 2JKOA 4CCUA 5ANIA 3OW3A 5M4UA 3BRBA 5BVDA 5D1JA 2WIHA 4QP2A 4MD8E 2HWPA 3H4JA 5IQHA 4ENXA 5C01A 2BRHA 4BCNA 3EIDA 3CP9A 4CVAA 4XG3A 1OPKA 2YJRA 3R8ZA 4IZ5A 3UP2A 3KXMA 4S32A 2BKKA 4FSYA 4EOLA 2W1FA 3O8TA 3UZPA 1T46A 4NTTA 3TKUA 3ELJA 5HO8A 3TCPA 4L68A 1E1XA 3HUCA 5FM3A 4O7YA 1PKGA 2C0TA 3SW4A 2OJIA 4KNBA 3QC9A 2HOGA 5CWZA 4YHJA 3W2QA 4RX7A 4CFWA 4JQ8A 3WF6A 4JAIA 3DKGA 3MJ1A 1S9IA 3LJ2A 4TKSA 3DCVA 4U80A 2JBOA 4C4GA 4EOOA 4IAZA 3CKXA 3OY3A 2X9FA 5DT4A 4JOAA 2OF4A 3NPCA 2GDOA 4D9TA 5CU3A 1Q99A 2HWOA 4I93A 4JRVA 5I3OA 4AW2A 2ITNA 3JYAA 4ZZMA 5E91A 1H1SA 4D2VA 5CALA 5KBQA 4C4EA 2FB8A 1FMOE 2G2IA 5A9UA 4BN1A 4NJ3A 4XMOA 5AUWA 3RNIA 3UNZA 1OKWA 5EM8A 4ZTNA 4RT7A 3U55A 1QMZA 3II5A 4UMPA 5M56A 3TACA 3KGAA 4CFNA 3A7JA 1CMKE 3GC7A 3AD5A 5EFQA 3R9RA 3UMXA 1QPEA 3ZRKA 4LUDA 3QD3A 2OICA 2QOIA 3HEGA 4HNIA 4RJ8A 4L7FA 4AS0A 4OTIA 5CQWA 3G2FA 5EH0A 5A54A 4GVJA 4LMNA 2WOTA 3F82A 3QYWA 5BVNA 5I9VA 4OTHA 4FKWA 4E6AA 4EJ7A 3PXQA 1GJOA 3DJ5A 2HK5A 4UV0A 2CKQA 2BCJA 3KF7A 2VWVA 2JITA 4JR3A 5KMNA 1O6KA 3HKOA 1P2AA 4ANNA 3DAKA 3G0EA 4YNEA 2E9NA 4D28A 4OLIA 3ODYX 1JLUE 2PZ5A 5HEZA 2ITZA 2GNIA 4H3BA 3RCJA 2P2HA 4F0IA 3IW8A 3OWLA 4FYNA 1WVWA 4ITJA 2G9XA 2PE2A 4RIYB 4WUAA 3FMLA 3PVWA 2JIUA 4R6VA 3LZBA 3Q9ZA 3ZS5A 4LRKA 3QWJA 5EQPA 2RFNA 3U6IA 4CMUA 2OZAA 2A19B 3I1AA 2ZM3A 2UV2A 5E8XA 3OTVA 2YIWA 3W33A 2OG8A 5AP4A 2WGJA 2R3LA 4RJ3A 1AGWA 1PW2A 3FUPA 5DRDA 3RNYA 2YDKA 3BYVA 3KA0A 4QPSA 4XH6A 3OD6X 4L3LA 4HNFA 4YC3A 3T9TA 1NA7A 4O81A 4L67A 1Q3WA 3RK9A 4D5KA 2W05A 3DK7A 1PRYA 4X2GA 3NUAA 3QQKA 2PVJA 5AADA 3D83A 2VNWA 3ALNA 3EL7A 4JIAA 1OMWA 3SQQA 4ZY5A 4KKHA 1GZOA 2PL0A 5EI6A 3O17A 4UYNA 4F7SA 2OKRA 3BE2A 2UVZA 1H1PA 3M2WA 3F6XA 2V0DA 5HZNA 4FR4A 4QP6A 5BUIA 4M84A 2EVAA 4LRJA 5B0XA 4AGCA 3LMGA 4N70A 3CR0A 2XNEA 3FLWA 2HXQA 3O2MA 4F9YA 1ZWSA 3PLSA 2R3NA 4CCBA 5CU4A 3JY9A 2QURA 3PWDA 4LV8A 3POOA 5EM5A 3R0TA 4GEOA 3VVHA 3Q5ZA 2PUNA 4FYOA 4C35A 3NCZA 3C4CA 1ZOHA 4R3CA 4HGLA 2R3GA 4II5A 4DFBA 5IQEA 2ZM1A 3I6WA 5FDXA 4RIXB 4XG7A 3RJCA 1BMKA 4A07A 4E5BA 4RWIA 3V5LA 5A4CA 4M97A 5BYYA 2YN8A 3ENHA 5I9ZA 3DLSA 5A46A 2XJ1A 2FUMA 5JZJA 2BTRA 3QA0A 1PXKA 4DEHA 3EN4A 5KX8A 5C4KA 5JFXA 1PKDA 2FA2A 2FSOX 1CKJA 4I23A 5DPVA 5CAUA 3IO7A 4NCTA 3BELA 3GI3A 4RVTA 3SXRA 5AIRA 3SG9A 3F2NA 3R7EA 4XCUA 3K54A 4JI9A 2VO7A 2VTJA 1YDRE 5L8JA 5IQAA 4FTLA 2PMLX 1I44A 3L8PA 4XBUA 2C3IB 3IDBA 4ZTHA 4I5CA 2VGPA 2Y7JA 3OG7A 2BIKB 3VUMA 4C0TA 5DA3A 4DLJA 5E9EA 5FDPA 3OWPA 3QKMA 2W1GA 4CXAA 1XQZA 3KN6A 3F5PA 2X2KA 4AP7A 5KMKA 5EDPA 3VNTA 2DWBA 3V51A 3ETAA 3JPVA 4Q9ZA 5FP5A 2ZM4A 4ITHA 3AD6A 4YPDA 4FKPA 3A7FA 3ZXTA 3PJ2A 3BLHA 4U0IA 4R77A 2WQBA 2C0OA 3F3UA 4D2WA 4CQEA 4ACHA 5TT7A 2CGUA 3RPSA 3DT1A 5JGAA 5IU2A 2HY81 4U81A 2JDSA 3RKBA 5I4NA 2JDOA 2OXXA 4P7EA 2XKCA 3O23A 5FD2A 2ITWA 3AMAA 3FSKA 3R1YA 4EQMA 2XK9A 4QTDA 4WRSA 5C9CA 4ZS0A 4CMTA 1P5EA 3B2WA 4FT7A 3UG1A 5JK3A 4M69A 3VUTA 1IEPA 4EUUA 1MUOA 4X3FA 4QT1A 4DGGA 4F70A 4KWPA 3QQUA 3IW6A 4J8MA 3PRIA 4AOTA 2ZAZA 4CQGA 5CEQA 2R2PA 4JXFA 4DYMA 5IUHA 5L8KA 4AFJA 2JLDA 4TPTA 3UG2A 4YU2A 2XEZA 3AGLA 1A9UA 4IIRA 4NM3A 1R0EA 3CGFA 3OY1A 3G33A 5EDQA 5CT7A 4IDVA 3EQIA 1H07A 2XBJA 4JIKA 4L3PA 4AW5A 1Q8ZA 3E8NA 3TDWA 5EI2A 4KSQA 1UU7A 5HD7A 1I09A 3QTRA 2F2UA 2J90A 4EQCA 3QBNA 3PXKA 4CZYB 2RF9A 2UZLA 1IR3A 3H0ZA 3P0MA 4DITA 4XG9A 4CLJA 5LVNA 4FGRA 2I40A 4GK3A 1UVRA 2X6DA 3LQ8A 1IAHA 2YZAA 5DE2A 2J6MA 1L3RE 5EYCA 5CI7A 5E4HA 4Q9SA 2OJJA 3VS6A 4E4MA 4USFA 3RALA 3T3UA 1OBGA 3V5QA 4CV8A 3COIA 5HNBA 1YW2A 3DDPA 1YXUA 4A4LA 1XWSA 3A62A 4FL2A 5L6PA 4FKLA 3QRTA 2RFEA 5FWKK 2GCDA 2C68A 3PVUA 3QLFA 4FSMA 2PVYA 4G5JA 3VBWA 4R7IA 4XG6A 4KA3A 1U54A 3WF7A 5EYMA 2VD5A 3FZSA 3UPXA 4O7RA 3LPBA 4O27B 4ALVA 3F69A 4BYJA 2QG7A 4O7NA 2UW9A 2JFLA 4OBOA 1IG1A 4PF4A 4YTHA 4QTEA 1CKIA 2W5BA 5JKGA 1OECA 5TR6A 3PPZA 1VYZA 1OBDA 4Y73A 4QRCA 4MXOA 4BFMA 4G5PA 4BDBA 3ZCLA 3L9LA 3QZIA 3EH9A 4U3ZA 3I6UA 5FXQA 3FI8A 4FKVA 3WOWA 4IAFA 3QUPA 4PPBA 3ALOA 4M0YA 4FKJA 4D0XA 3I7CA 2Z60A 4QMLA 4K6ZA 5ANOA 4ALWA 4ORKA 2H96A 5AIKA 3MPTA 4U40A 4MXXA 3SRVA 4I6FA 5ETFA 4QMQA 4P2KA 3DXNA 4EUTA 3LMIA 3HMPA 4FICA 3GP0A 3VULA 4O0XA 4XLVA 4CGAA 3KMMA 3LCOA 3BLQA 3FY0A 5AAEA 4ASZA 3V04A 2PVMA 5LOHA 2VX3A 2ZMDA 3P1AA 4ZAUA 5KMMA 4BL1A 4L00A 2Z2WA 1YDSE 2ETMA 3D5UA 4N0SA 3MPMA 3D9VA 4WHZA 4C57A 2J50A 3KKVA 2EWAA 4BTFA 2JAVA 2Y6MA 2G2FA 3MB7A 2J0MB 3LFBA 4UBAA 4WSQA 3AC3A 2WMSA 4IAAA 4PUZA 5B2MA 3LCTA 5JT2A 3TZ7A 4LOPA 3ZO3A 3TV6A 4F63A 2W4OA 2QHMA 2XM8A 4O0UA 4PRJA 3CE3A 5CANA 3UIXA 4MK0A 5M51A 3BHTA 1DM2A 4NK9A 4HVHA 3V8SA 4EZ5A 4I5HA 1SVEA 3AD4A 1KV1A 1K3AA 3E93A 2BAJA 3FLSA 4U8ZA 2W99B 4EC8A 5IPJA 4WSYA 3LCDA 4CG8A 3F66A 4BDKA 5AP3A 5EKNA 4CKRA 4BCJA 1VZOA 2ONLC 3Q9XA 3BGQA 3EFJA 3EN9A 4I0TA 5M55A 4Y72A 1XH9A 3NNUA 2P4IA 3P4KA 4IX4A 2EU9A 3WE8A 4C3FA 4C59A 1OL5A 4XS2A 5LMKC 4YJSA 4MNFA 3C9WA 4M8TA 3QZFA 2YJSA 1YI3A 5T3QA 3ANQA 3L8VA 4QQCA 2YABA 1LP4A 3C7QA 1WMKA 4CFUA 3AC2A 5IMXA 2WU6A 3DBDA 3PY1A 2FO0A 4G3CA 4ONAA 1NVSA 5AM7A 3C4ZA 5ETAA 4AUAA 4EZ7A 4JL9A 3QCSA 4H1JA 2PVFA 1Q3DA 4RLLA 5F1ZA 2PE1A 3Q9WA 3NYNA 5HHWA 1ZYSA 3PJCA 5JRQA 2X2LA 4MD7E 2W1CA 3UDBA 1XKKA 3MH0A 4FOCA 3VO3A 5LVPA 2BR1A 4FEVA 2SRCA 5HVYA 4ASXA 2PHKA 4EWQA 2GNLA 3PVBA 5HCYA 4DEDA 1OIQA 4DGLC 3BU5A 3S3IA 1H24A 2HIWA 4AA0A 4C38A 5HG7A 3SW7A 1KOBA 3ID6C 1WBSA 1CTPE 1W8CA 3ET7A 3FI2A 3C5UA 1H25A 2KULA 2PWLA 3LM5A 4CRLA 5JGDA 3BKBA 4FBXA 3FLQA 3ZC6A 3JR1A 4QYHA 3WILA 4IM0A 3O7LD 4FV5A 4C3PA 4BDEA 1PYXA 3OBJA 2XCHA 4F7LA 4DBNA 2HW6A 3CJFA 1G8SA 3HMMA 3CCNA 5LWNA 2VTPA 3L8XA 4HYHA 3OOMA 5D41A 1PMNA 4RX9A 4Y85A 2WO6A 4QO9A 4EH8A 1WBWA 4IC8A 4AU8A 2YITA 4RFMA 3PG3A 4FG7A 3ZSIA 1MP8A 1NY3A 3KCKA 2A1AB 4RC2A 2PVLA 3P78A 4DEBA 4YC6A 4MBJA 1LEZA 3VS3A 3PYYA 3MY1A 3QL8A 3LFEA 4AGDA 1AQ1A 2ZYBA 3EHAA 3V01A 1MRYA 5ANEA 3CPBA 3S95A 5HTBA 4FTAA 3IPHA 4ZSGA 1H26A 2VWYA 4B9DA 4JDJA 3IOKA 3EN5A 3FC2A 2X0GA 3RPVA 3GUBA 2VWWA 3QTUA 3FPQA 4A9RA 4DEIA 2O65A 3SAYA 5BVOA 2C6TA 1Q8YA 5LQFA 1XJDA 3R02A 3LFDA 5EHOA 1OM1A 4C4FA 5AV4A 4AGUA 1F0QA 1LR4A 2PU8A 2R3MA 4OBPA 2WTDA 3GENA 2VWZA 2ZOQA 4RFZA 3VUHA 3QQJA 3W2RA 4GYGA 4RG0A 5IEYA 3CC6A 1Q4LA 4LOQA 4YTIA 5CF5A 1JAMA 3P7CA 1UWJA 4M13A 3RBWA 3VUIA 5KMOA 1Q62A 2OH0E 2YM8A 4M0ZA 1PMEA 5AP5A 4ZY4A 4YJQA 3NEWA 4F0GA 3HV6A 4MXCA 5JZNA 2W96B 3KREA 3Q5IA 3NYOA 3LQ5A 3HYHA 2QQ7A 1J7UA 4O1PA 3UTOA 4I24A 3BU3A 2VTOA 3CIKA 1VR2A 5D12A 3O8PA 3E7VA 4QPAA 5EW9A 3W2OA 4ZJIA 3FWQA 3IS5A 3P23A 4PV0A 4I5PA 3AC5A 3LFCA 2JDVA 3S2PA 2XK6A 4HVDA 3FMEA 3A2CA 4BI0A 3WZJA 3SDJA 4AT3A 3F5UA 2P0CA 5DT3A 3EYHA 2C3JA 1YXSA 4B8MA 4DAWA 4GCJA 4FKQA 4QP1A 3T8OA 2B7AA 2YLEA 3VRZA 2VO6A 2YIYA 1WBPA 3MVJA 1XH6A 4YZMA 2BRGA 3F5XA 4WA9A 4AZVA 2XNNA 1YI6A 3RAIA 1M2QA 2J2IB 5GJGA 4PY1A 3UO4A 5FTQA 4BCGA 3RPRA 3LVPA 3ROCA 4M15A 1GZNA 4FSWA 4PWNA 4PMTA 2UZNA 2Z7QA 3MVLA 5E92A 4EYMA 4DGOA 3KRLA 3WZDA 3OEZA 5HLWA 4MQ1A 4BCPA 3UZTA 1YHWA 4YJTA 4U3YA 2Q0NA 4ITIA 2JBPA 4JQ7A 2CN8A 2VO0A 3EQHA 4HGEA 4IMYA 4FSTA 1H0VA 4WNPA 3QD0A 3VHEA 2WFYA 2EXCX 2J9MA 3TIZA 3PXYA 1RQQA 4ZZOA 3FMNA 4E6DA 4L52A 1KOAA 4JG8A 3FE3A 3FEGA 4GFOA 2BALA 2VZ6A 4O96A 4L45A 3ORTA 3QD2B 5HG8A 2GS6A 4FK3A 3VBVA 4IWPA 3IONA 4JS8A 2J0JA 4HJOA 3TV4A 4CFVA 4Z16A 2XCKA 2ITUA 4FODA 5F20A 3W8QA 4L01A 4KD1A 2VTQA 3Q4TA 2VRXA 3BYSA 4H58A 5H3QA 5JMSA 4JBQA 4QMTA 3W10A 3E88A 1O6YA 4WKQA 4E7WA 5HX6A 3QRKA 4FNWA 2CNVA 5BVFA 4Z3VA 4D5HA 2VWXA 5J9LA 3P86A 5E1EA 4OTPA 5FXSA 3NNWA 4PQNA 3GOPA 4FX3A 4IFGA 1Q24A 2PZRA 5IDNA 2J0IA 3D7TB 4QYEA 4MXZA 1BI8A 5C8MA 4A4OA 2UZTA 2CJMA 3TUBA 4NIFB 4NSTA 4AZSA 3HNGA 5GINE 4FSUA 5HE1A 3HA8A 1R39A 4FNXA 3EQCA 4XYFA 1H01A 1ND4A 4HYUA 4N6YA 3F3ZA 3EQDA 4E4LA 5IUGA 2UZDA 2XKFA 1FOTA 3Q4UA 3ZSGA 3EFWA 4B0GA 4IZYA 3DKCA 4QP9A 5CAVA 2GNFA 3P9JA 2ITQA 4RA4A 4NL0A 4O7VA 4O7LA 4X6RA 5GIOE 3PE2A 4TW9A 4CMOA 5KNJA 1TVOA 2JEDA 2X4ZA 5IA2A 1VYWA 5HI2A 5DMZA 1WBOA 2P2IA 4EHVA 3UNJA 4KINA 3ORIA 4IDTA 2OF2A 3R1NA 4EK5A 5AMNA 3ACJA 2OFUA 2Z8CA 3UJGA 2QOQA 1XR1A 2R3JA 4IJPA 5CVHA 2RIOA 4WUNA 3S1HA 2NRUA 1UU8A 2GFCA 2PMNX 5HESA 3EKKA 3F5GA 3OMVA 3U6HA 4CT2A 1W0XC 3IQ7A 1J1CA 3ERKA 3NUYA 1U54B 4GKHA 3IGOA 1GIHA 4FUYA 4BDIA 4CYJA 2XRWA 2YEXA 2B52A 4RC3A 2R3PA 4BZOA 4FOBA 4NW5A 3R7IA 2FYSA 3E3PA 5AUYA 4D4YA 2XKEA 3DQWA 2I0YA 5L8LA 1YXXA 3BX5A 2AC5A 4F0FA 2YDIA 3LQ3A 4FKTA 5C4LA 3BGZA 4IBMA 3MPAA 4O0SA 1PF8A 4LM5A 3MN3A 3UNKA 3RZBA 1F3MC 3TL8A 4BRXA 3DFCB 2OLCA 1JNKA 5CNOA 3FZPA 4J7BA 3NCGA 3A4OX 3QAME 2WMBA 4KUJA 2DQ7X 4OTGA 1WBVA 4AX8A 5DT0A 3QALE 2J5EA 2UZOA 4IXPA 4ACCA 5IA0A 3FXXA 4LGHA 3ZLYA 2EXEA 4TNDA 1GNGA 5EKOA 5HLPA 4OAUC 1R0PA 1OIRA 3WARA 4JBOA 4U9AA 1ZOEA 4XV3A 5CEIA 2XKDA 3LXLA 3HRBA 4IVBA 1K2PA 3ORNA 5LJJA 5GIPE 2YM6A 4B8LA 5CEPA 4EKLA 3DDQA 3MA6A 3SXFA 3QTSA 4CV9A 3AGMA 2QLUA 4QPMA 4BDAA 2HW7A 3FQHA 4ZJJA 3ZBXA 2WEVA 2WMRA 3VBTA 4BGHA 4FVRA 5DOSA 1Q8TA 4DINA 1OL2A 4QMUA 4I4FA 3WF5A 2IG7A 3SA0A 1SNUA 4G6NA 5CENA 3MA3A 1QPCA 3MH1A 5CQUA 2XNGA 3EOCA 3EQPA 3TDVA 1O6LA 5IA3A 5IQIA 4KABA 3DBFA 3E64A 2Y4PA 4C3RA 3FY2A 4GH2A 1OUYA 5K3YA 4H05A 3NUSA 2CGWA 4GFGA 4AW1A 5JFWA 2CNUA 2F57A 4Y5HA 3R9OA 4PL5A 4W4YA 4PL3A 3MSSA 4YBKA 2ESMA 4BKZA 5FUTA 2OI4X 3H10A 4BZNA 4HVGA 2B9JA 2BVAA 1YQJA 4NEUA 1DAWA 5TE0A 4EOMA 1ZXEA 3DOGA 4Z7GA 1V0BA 2XB7A 4FIFA 4DG3E 5K5XA 3S00A 4RJ7A 4UMUA 3BEAA 3KXXA 1XO2B 4MX9A 3AC1A 1GIIA 3WI6A 4D58A 4FUXA 3G15A 3GGFA 4QP8A 4UZDA 1APME 5CASA 3IKAA 1WVYA 4F7NA 5AUZA 3V8WA 4WNMA 2GFSA 3G0FA 3MTFA 2XP2A 3NUUA 1PXJA 3ORMA 4IB3A 2ZJWA 4PMSA 3THBA 2FSLX 4D55A 5M08A 3NLBA 5IKWA 3QXPA 2Q83A 4GVAA 2R7BA 3O0GA 3QLGA 5A4QA 3PUPA 1IAJA 3HV7A 5CI6A 1OB3A 4UYAA 3B8RA 5HNIX 1JPAA 5BYZA 3L9NA 1XHAA 3FMDA 2C5NA 1M7NA 4MKCA 5HE0A 1JOWB 4RX8A 3SV0A 1M2PA 4CYIA 1M7QA 4ENYA 3K5VA 4WG5A 3PTGA 2BUJA 1Y8GA 3LCKA 4J52A 3RK5A 5A14A 4XV1A 3UQCA 5FBNC 2PVHA 2X8DA 4LYNA 4QMZA 2RGPA 4IC7A 4MQ2A 4DEAA 3U6JA 5HIDA 2WHBA 3DU8A 3P08A 4AZEA 2OW3A 4DTAA 5C03A 3PXFA 1GZ8A 3Q9YA 5HD4A 2WOUA 1Q5KA 4HYSA 4FKIA 4LOOA 2W9FB 2YWVA 5CF8A 3BWFA 3ZM9A 1KE7A 4P5QA 4BBEA 2BZJA 3I4BA 2BDFA 2R5TA 1RE8A 3VQUA 5HVKA 5D9HA 3MTLA 3OXTA 4FV2A 5IQBA 4MBIA 2XIYA 2HAKA 1Y8YA 3P79A 4RZWA 3BBTB 3V5JA 1TKIA 1Y6BA 4FL1A 3NMUF 1UU3A 3PSDA 4YLKA 2XF0A 1R78A 5AUTA 4L46A 3I0QA 3Q2JA 4KKEA 3SX9A 2PY3A 4MF1A 1IA9A 2QVSE 2BRBA 2BRMA 4O7TA 2LAVA 5IQDA 2XYUA 4ALUA 1SZMA 3EYGA 2YWPA 4I6QA 2ERKA 4UXQA 3SC1A 3KVXA 4D2SA 4DG2E 3R7OA 1RDQE 3P7AA 4JDKA 4FKOA 4LI5A 5EI8A 1SMHA 5GHVA 3LAUA 4CRSA 2YDJA 3Q3BA 5EOLA 4KIQA 4RVMA 4O83A 3TJCA 5J95A 3Q60A 4R1VA 5TO8A 4X0MA 3BU6A 4BIDA 3KN5A 3HL7A 3KRJA 5AWMA 2ITOA 5K0KA 3W8LA 3C4XA 1GOLA 2QOHA 4TXCA 3PZHA 5AM6A 4FZAB 2OJGA 2QU6A 3FKNA 2UZVA 3QUDA 2X39A 2WMWA 4YLLA 3ZO1A 3FI3A 4O22A 3PE1A 1YXVA 2FGIA 3FDNA 5JH6A 5CXHA 2C5XA 1SVHA 2VWBA 3VS0A 5IF1A 4J95A 2Y9QA 3CQUA 2YIXA 3PXRA 5CNNA 3TKHA 3ZUTA 1FVRA 1WZYA 2GQGA 2X8EA 4GG7A 4IW0A 2UZBA 3L9MA 3DXQA 3KU2A 2J4ZA 3DB8A 1DS5A 3HMIA 4FT9A 4XV9A 2Y4IB 3E87A 1UNGA 3PIZA 4K2RA 4UB7A 4PDPA 5EK7A 2YM4A 4EOJA 5IH6A 3BBWA 3VJOA 3ODZX 3DJ6A 3FV8A 4U79A 4B7TA 1UKHA 5BMSA 3GFWA 5J9ZA 2PPQA 4D1XA 5JGBA 4C36A 3F3WA 4Z55A 4YJUA 2XIKA 2OJFE 3S4QA 4G9RA 4UXLA 2QI8A 1UNLA 3DA6A 4YJRA 4APPA 2B1PA 2IJMA 4KB8A 4MF0A 1H1QA 4GT4A 1TQMA 1NT2A 4L53A 3Q32A 3ANRA 4O7SA 2VTSA 1T45A 4IX6A 4W9XA 4ERKA 4IWDA 2Z7LA 3GCUA 4GYIA 3VBQA 3ZOSA 4CSVA 4MXAA 4ERWA 4C4HA 5A4LA 3N51A 4ANLA 3KULB 4H39A 3LLAA 3PDTA 2ZV8A 3COMA 4RWLA 4HZSA 2ONLA 2HENA 3FZ1A 4I94A 4OTFA 2W7XA 5JN2A 2BAKA 3IDPA 3NZ0A 2GQSA 2IN6A 4A9TA 2WNTA 3E62A 5LMKA 5M44A 3RAWA 1TQIA 2WKMA 2H6DA 4QNYA 5AP1A 2XNOA 5AEPA 4G6OA 4W4VA 2CGXA 5AP0A 1OPJA 3MFUA 1DAYA 4A4XA 4DT9A 2JKQA 4DFLA 1Z57A 1KE6A 4FIEA 4XNEA 4F1TA 2IVTA 2I7QA 4IB0A 3D7TA 4EHGA 2CCHA 4E3CA 4Z7HA 1J3HA 3IW4A 3PSCA 4NIFA 3DKOA 4CKJA 4DTBA 5EOBA 3RHKA 4G2FA 4LUEA 4GT5A 4IX5A 3C1XA 4YC8A 2ERZE 3NS9A 4ZLOA 3BE9A 4MNEB 4X21A 4BHNA 4JJRA 4IWOA 4DT8A 5JQ5A 3L9PA 5LWMA 3VWAA 3SVVA 5IA5A 5FM2A 5BUJA 5CSVA 2O63A 3KK8A 2PZPA 2QOBA 4YR8A 5BYLA 3O8UA 2E2BA 4RGJA 3NVMB 3SOCA 2W4JA 2F7EE 3CY3A 2H8HA 4G3DA 3ZEWA 3EFKA 4XEYA 1URWA 3IK3A 3UVPA 4GK2A 4O1OA 3F7ZA 2RL5A 2CKEA 2JIIA 2IO6A 4FEWA 4IM3A 3EZRA 1KE5A 2ZV9A 2ETKA 2PMOX 3G6GA 4DA5A 2CHLA 3VBYA 4CTCA 4D4RA 2CPKE 5CZHA 3HDMA 3DGKA 3SXSA 4DFYA 4GL9A 5LCKA 1M52A 2F4JA 4EL9A 4BDJA 3R2YA 3W1FA 1KE8A 1MQ4A 4MCVA 5KZIA 3VN9A 5IEVA 5D7AA 5I0BA 3QQHA 4I4EA 5LMAA 2W1EA 1XH7A 3ORLA 5B2KA 3K5UA 5BQ0A 4FTJA 3ROYA 3V5WA 1V0OA 5BX0A 5IEXA 3FMKA 2CLXA 5H9BA 2VTRA 4FTUA 3GOKA 3GU8A 1LEWA 3E63A 3OWJA 5CZIA 3ZDUA 4AZTA 4G3FA 3EMGA 1WCCA 3MB6A 4YLJA 4ZLZA 5CAOA 3CJGA 3D2IA 4M67A 3DXPA 3WIKA 2XK7A 3QC4A 4KBAA 3G51A 4DFZE 2H9VA 3DPKA 3Q96A 5E8ZA 4WG3A 4BCHA 1H08A 3Q6UA 3A99A 3FYKX 4UY9A 5HLNA 5KMIA 4QOXA 1HCKA 1H0WA 5D7VA 3UIBA 2QNJA 2W1DA 3R00A 1U5QA 2R9SA 4FIIA 3R8VA 2ITTA 3JUHA 5GNKA 4AA5A 4EH6A 3DTCA 3PIXA 3QX2A 4UMQA 4KIOA 5HORA 5AA9A 4DFNA 2CKOA 4XOZA 4FI1A 5F9EA 5FG8A 4ZEGA 2GTNA 5HKMA 4C2WA 4RWJA 1ZZLA 4YUQA 3N4UA 2IW8A 1FVVA 2BZIB 4FV6A 4H1MA 5J79A 1YOJA 2QHNA 4G9CA 3ITZA 4E4XA 4BBMA 2GQRA 2GHLA 3GU6A 2Z02A 1Z9XA 3PRFA 5ITAA 1ZZ2A 3NYVA 3MVMA 3E92A 3GT8A 4MYGA 4R7HA 3ZYAA 2EXMA 4DEGA 3E5AA 3SLSA 4AT5A 4O91A 4IM2A 4AE6A 4G16A 4FEUA 3GC0A 5KE0A 2UZEA 3ULIA 3OCBA 3QTWA 2GSFA 3CTJA 3AMBA 3V6RA 4M14A 2IW6A 2XM9A 4LL5A 3U4WA 4AZWA 2PVKA 3UPZA 4E5AX 3N9XA 2JDRA 3GCSA 3RM7A 4BCIA 3WYYA 4MBLA 2B53A 2XEYA 5DR2A 4AOIA 4BC6A 4B6LA 4BCOA 3LE6A 4EI4A 3QKLA 4QMVA 3R9HA 4HVIA 2R3HA 2RKUA 2XRUA 4FT5A 5H8EA 4LG4A 4HVSA 4BDFA 2VNYA 4EOIA 5CT0A 3ZONA 2DUVA 1Y91A 3UGCA 3OTUA 5FTGA 4L3JA 5CU0A 4S2ZA 4TN6A 4MHAA 4EKKA 2V55A 5GZ9A 5EYDA 2PUUA 1BKXA 4FZFB 1ATPE 5CVFA 5DBXA 3QCYA 5FBOA 2VTIA 1MRVA 1W98A 3Q04A 3DTWA 1SM2A 3OT8A 3R8MA 5LCJA 4I6HA 2YM5A 2BIYA 3NW7A 2CSNA 3V5TA 3BGPA 4FV9A 2VTLA 3R9DA 2I1MA 5AR4A 3QUEA 1U5RA 3LCSA 2O0UA 1YRPA 4B99A 3VIDA 1JSUA 4IB5A 4RC4A 3OW4A 1PXLA 4NH1A 3CQWA 4EH4A 4RFYA 3DQXA 4C8BA 3TNQB 4MTAA 4XRLA 4O7ZA 2RSVA 1ZY4A 1UV5A 2OO8X 5C27A 4TWNA 4DBXA 3NVKI 4G1WA 3ZM4A 3HAVA 2WTKC 2X2MA 5CVGA 4PPAA 4O86A 4RJ6A 2V7OA 4V0GB 4OUCA 4ACGA 4ZXTA 3CEKA 3IW5A 4FZDB 4C62A 4EORA 2HZNA 3B8QA 1G5SA 1E9HA 5DGZA 4KS8A 2WTJA 2C6EA 5M07A 2QU5A 4DFXE 5IA4A 1JWHA 3E8EA 3EZVA 3M42A 3R2BA 4XP0A 1ZMUA 3HZTA 5L2SA 4F7JA 1LPUA 3MH2A 3TKIA 1Q41A 4FK6A 5E8UA 4E5WA 2FSMX 2HZ4A 3RMFA 1QCFA 2A0CX 4O2PA 5FP6A 5AX9A 5CSXA 3HV3A 4ANSA 2IZRA 2OGVA 3EN6A 4GUEA 3PY3A 4FIGA 1MQBA 2W0JA 5DR6A 4JG6A 3RGFA 2R4BA 3NSZA 2WTCA 1YOLA 4L7SA 4YJPA 5HE2A 3W18A 4M3QA 3N4TA 4FEXA 1BYGA 5HU3A 4ZTQA 4D1ZA 1A06A 4CNHA 4EBWA 2C5OA 3HUBA 2J0LA 3NWWA 3Q4CA 2WEIA 3R28A 4OGRA 4W8EA 5HCZA 2XUUA 1UNHA 3RWQA 4TT7A 4NFNA 1F5QA 5E8WA 3UO6A 2J51A 3EN7A 4OT6A 4XP2A 3WZKA 5I3RA 3OXZA 2W1ZA 2F49A 1NVQA 5LXMA 5HNGA 4AW0A 4EOQA 4GIIA 3REPA 5KBRA 3GQIA 3RVGA 3LFFA 4IZ7A 4X3JA 4YNOA 5EDRA 4BIBA 5IG1A 2OFVA 3DK3A 4GRBA 1OZ1A 4PMPA 2JD5A 3VF9A 4YZ9A 3R6XA 4HGSA 4C4JA 2VTHA 2O2UA 4OTQA 4E4NA 5HX8A 4U45A 4EH3A 5M09A 4ZIMA 5F95A 3MFTA 5J5TA 4WG4A 2QLQA 2GS7A 3NGAA 3FHRA 2Z7RA 4DN5A 5LVMA 3H9RA 3NNXA 2C0IA 4G34A 5AR8A 3GC8A 5E1SA 4UWCA 3KMWA 3LXPA 2Z7SA 4NM0A 4RPVA 3EQFA 4X2FA 4EH7A 4KBCA 5DI1A 1HCLA 5L6OA 3C5IA 3V6SA 3LXKA 3NYXA 3DBQA 5L2IA 5B7VA 4WNKA 5LARA 3UOHA 4AAAA 4AOJA 3TM0A 4QQTA 4YURA 3UC4A 2OZOA 2PE0A 4FSZA 4CLIA 2GHGA 4O0VA 3TUCA 4PMMA 4UMRA 4GFMA 1W83A 3F7WA 3UC3A 4IVAA 3BYMA 5DEYA 3RZFA 4K77A 4BTJA 1STCE 4RSSA 4FSRA 2C4GA 4F9AA 5FEEA 4L44A 3BCEA 3TTJA 2OJ9A 5A6NA 3BV2A 2VV9A 5IH5A 3WYXA 2XS0A 4WD5A 2IW9A 1OI9A 3NRMA 2ZB0A 4LQMA 5AR2A 2ITXA 3KULA 3FZOA 3PJ3A 2X1NA 4ID7A 5CYIA 3VUDA 2WQNA 4JT3A 4E73A 5ANDA 4JDHA 4YO6A 4U97A 2WB8A 4FTTA 4ZS4A 5E8SA 2G1TA 4MXYA 3DZQA 3QHRA 2E9VA 3TG1A 2DS1A 4BCMA 3COHA 3VS2A 4D0WA 4R3PA 4R78A 3AC8A 4IZAA 4Y5QA 4OW8A 2EB3A 4EK4A 2ZV2A 3D7ZA 4JBVA 2GMXA 3F61A 5I5ZA 3R01A 3TNIA 4NJDA 5HE3A 4YJVA 4C4IA 2CN5A 5CLPA 5CSHA 4BKYA 4D1SA 1Q61A 1KSWA 3UQFA 2P55A 2WU7A 4EJNA 3A7IA 3TI1A 2PULA 3BQRA 1Q8UA 5H8GA 4RIWB 4FZ6A 5AP2A 3ZRLA 5HQ0A 4C34A 4YP8A 2IVVA 4PNIA 4PP7A 2W9ZB 4U41A 3OOGA 2C3KA 4MNEA 4UMTA 2XIRA 3QFVA 3ORPA 4EYJA 3LIJA 3O51A 1REKA 3C50A 5I9YA 4IANA 5AV2A 2OSCA 3D15A 4GU6A 1JSVA 2GS2A 2W1HA 4RX5A 3GEQA 1J7LA 2UW6A 3OVVA 2RFDA 1OKZA 3D5VA 3TNPC 4LFIA 4H3PA 2XK3A 3FPMA 5FLFA 5AA8A 2V7AA 5EG3A 2CCIA 3GFEA 4EBVA 3VS7A 4BWKA 4DF3A 3TEIA 4KIKB 3F2RA 1UKIA 3BPRA 4KRDA 4S31A 1OL1A 2R3OA 5KZ0A 4BDCA 2CLQA 3QX4A 2FH9A 3EFLA 4ASDA 4AZFA 3RI1A 1YOMA 4OTRA 3C13A 3QRIA 3BYUA 4O84A 3W2SA 4F4PA 2WTKB 3Q2MA 2IVSA 4IVCA 2J7TA 2WZJA 4GV1A 4QMXA 4WBBB 5GJDA 3TZ8A 2BAQA 3CS9A 5IQFA 2UW7A 4GT3A 3PY0A 3AT2A 4MWHA 1DI9A 2QD9A 4LGDA 1SYKA 4FNZA 4HOKA 5FEDA 4XLIA 3R7YA 4AFEA 3TJDA 5C8KA 4AF3A 4NYEA 4W9WA 2VTAA 4JDIA 3A4PA 4C61A 5HTCA 1NW1A 4C37A 4G6LA 3T3VA 4P4CA 3RAHA 2B9FA 2PZYA 4FGBA 5HG9A 2BZKB 1BL7A 3ZH8A 1U4DA 4QMYA 4YSMA 3HRCA 4F1OA 2VN9A 4A06A 2F7XE 3ZZEA 1YDTE 5ANJA 4FTKA 4MAOA 3ZLXA 4TTHB 2XYNA 4ZZNA 1ZYCA 3FZTA 4E93A 4QMSA 4PNKA 1UA2A 5C26A 3P7BA 5KKRC 3FQEA 1YVJA 4FNYA 4XG2A 5CEMA 5HICA 3HV4A 3Q52A 3KL8A 3NIZA 4U5JA 4PTEA 4C02A 3E8CA 3UIMA 4GU9A 4Q2AA 3ZHPC 5CU2A 4I1ZA 5DLSA 2G2HA 5IZFA 4DH1A 2C5VA 2PK9A 4DE4A 4DTKA 3G90X 3GCQA 4I6BA 4JNWA 1H4LA 1O9UA 4JLCA 4RVLA 3CQEA 3NIEA 3OHTA 4FF8A 3TXOA 1LUFA 3VC4A 3WF9A 5AFVA 3QTZA 3K3JA 5DR9A 2GU8A 3UOJA 4Q5EA 3ZLSA 3MFSA 1RJBA 1V0PA 4QTAA 3ZRMA 5E90A 3ZMMA 3FC1X 4G3EA 4FV3A 4KBKA 2QOKA 3DK6A 4DH3A 3HP2A 5AV0A 1ZARA 4FV7A 4S30A 3GQLA 1XH4A 2I0EA 5DNRA 1BX6A 3QU0A 4TWPA 2YM7A 4FA2A 2WMXA 3UVRA 2OXYA 5T68A 4AWIA 3PFQA 1KE9A 2UW5A 2GHMA 4O2ZA 3ZTXA 3IGGA 3ORZA 3DBCA 5EW8A 3KVWA 3D5WA 2BHEA 2V5QA 4MD9E 2HZIA 3QTQA 4BCQA 2BDWA 4BYIA 2O3PA 3Q6WA 4USEA 2WQMA 2XVDA 3R04A 2XMYA 5TOZA 1WBNA 2XNBA 4I21A 4U43A 4CEGA 4EK8A 1ZY5A 5JQ8A 2WIPA 4V01A 3HMNA 4Q5HA 2WQEA 3LM0A 4G31A 1W84A 3PA3A 3HVCA 5J87A 5I9XA 4L42A 5AV3A 3ACKA 2DYLA 4ZSLA 5BUEA 2VWIA 3UMWA 4HCUA 3ZFMA 2YISA 4YZDA 1BUHA 4E20A 3KXZA 4EC9A 4BR3A 4BHZA 2IZUA 4NKAA 3BHVA 3ZXZA 4IVDA 4ZSAA 3KQ7A 3R1QA 5BNJA 1VJYA 3PWYA 2JGZA 4TWOA 3W16A 5L4QA 4J71A 3K3IA 2YIQA 3IG7A 2W5AA 1OITA 3OUKA 3QQGA 3LFQA 1E1VA 2JKKA 4JX7A 2JKMA 3ZU7A 2NRYA 3TZMA 3KRWA 1GZKA 2PTKA 4GK4A 1J1BA 2EUFB 4V0GA 1Y6AA 3FZRA 4FEQA 1ZRZA 3NUPA 3I81A 2E9UA 2BPMA 2C30A 4LL0A 5GJFA 2VO3A 4IE9A 3CTQA 1UU9A 3NAXA 3BHHA 3G6HA 1PXPA 3KRRA 3ATTA 2PSQA 3CGOA 4UEUA 2IVUA 2XZSA 3EL8A 3MH3A 3NUNA 3OUNB 4TZRA 1RW8A 2XIXA 5HOAA 2QKRA 5A4EA 3RP9A 5AP7A 1QPJA 4WRGA 3FXZA 3UODA 4TYGA 3NUXA 1XBCA 2RG5A 3GBZA 5EHYA 3H30A 5ACKA 1L8TA 4BDHA 5BMMA 4IHPA 4QQ5A 5FGKA 2R0UA 3EQRA 4X2NA 5TF9A 3R7GA 5CAQA 4I92A 1HOWA 4NCTC 4XHKB 5BVWA 4PP9A 2YFXA 5EYKA 4FZ7A 3UIUA 2WMUA 4ZTLA 5CSPA 2YZLA 2W17A 2R3RA 3A61A 4FV8A 4K11A 1OKYA 3RHXA 5E8TA 2YCFA 3PP1A 3VHKA 2X8IA 3H3CA 4F1MA 4CKIA 3T9IA 4LGGA 2OIQA 4UWBA 5IH4A 2GNGA 1Z5MA 2GNHA 5AR7A 4BVUA 3BWJA 2ZB1A 2QR7A 1NXKA 3R22A 4N6ZA 1GY3A 2W4KA 3I0OA 4Y95A 5ACBC 4F09A 3DV3A 4QMWA 2C6KA 3PIYA 3C4WA 3COKA 2JIVA 3JVSA 2HELA 3L1SA 4K9YA 1VEBA 4E6CA 3R30A 2F2CB 2H34A 3HDNA 2XBAA 1OGUA 4GKIA 4YHFA 4UN0C 3QRJA 2IZSA 3UBDA 4HW7A 3V3VA 5AAFA 4KSPA 4ZJVA 2E9OA 3W2CA 2QR8A 4UALA 4WOVA 5AX3A 3IDCA 4XG8A 5EW3A 3QTIA 4FTRA 4QMOA 3W32A 4ZP5A 1ZAOA 2ITYA 4BZDA 2NP8A 1OL6A 1Q97A 3MESA 1IASA 5K0XA 2W06A 3OT3A 5K4JA 3Q4ZA 3M1SA 3PZEA 2CDZA 1U46A 2XK8A 4YHTA 2PUPA 5F94A 1XBBA 1B39A 2VAGA 2JAMA 4O6LA 2QG5A 4BBFA 2ITVA 3ZBFA 4BKJA 3R21A 3C51A 4YGAA 1PXOA 3IW7A 3WF8A 4DH5A 2VTMA 4EH5A 4U42A 2Y8OA 4V04A 1TQPA 4YJNA 4BY9E 4BI2A 4CFFA 1OVEA 3KXHA 3O7LB 3IECA 4FG8A 4S33A 4NUSA 4DCEA 4F9BA 1REJA 5M53A 1JVPP 3FAAA 1OKVA 3PPJA 4HZRA 3VAPA 2ITPA 4BI1A 1Q8WA 5KKRB 1P4FA 2I0HA 4FKSA 4PL4A 2VX1A 2X9EA 4U44A 2XJ2A 3AXWA 4QP7A 4XRJA 2QC6A 5D11A 5GZ8A 1JKSA 5M4IA 5H8BA 3HECA 3U4UA 2C6OA 5AR5A 4XOYA 4S34A 1FBNA 5B2LA 1H1WA 2BFYA 3HP5A 5AUUA 3DY7A 3R63A 1ZLTA 3MW1A 4APCA 2X7FA 3AT3A 3FL4A 1R1WA 4EOKA 1V1KA 3LFNA 3LHJA 3BIZA 4O0RA 4K33A 2IPXA 4OR5A 1PJKA 2A2AA 5BPYA 3KXGA 4FV1A 3RPOA 4EOPA 3FXWA 3OBGA 4W8DA 4M66A 4P90A 3FQSA 5AP6A 1A48A 4TL0A 3NW6A 3KK9A 3O50A 2W1IA 4R7BA 1JKKA 3LOKA 4P5ZA 4NW6A 3FHIA 3KC3A 4AA4A 5M4FA 4AGWA 2WPAA 1R3CA 3L8SA 5IQCA 4D9UA 5L3AA 2C6DA 2C6MA 2XNMA 4TWCA 4K1BA 3W2PA 2HCKA 4G3GA 3R8LA 4RIWA 4Y46A 4HCTA 4X6QC 3A7GA 2UVYA 3WBLA 3UYSA 4J1RA 2R3QA 3MGYA 3FMHA 5J7HA 4QP3A 2P3GX 3AMYA 3KY2A 1PY5A 2REIA 3CD8A 2VU3A 5FRIA 2HYYA 3KB7A 2WXVA 3MBLA 2YA9A 4GJ3A 4F6UA 5J7BA 4MH7A 4OTWA 3QGYA 4X7QA 3QQLA 1SNXA 3QRUA 5KMLA 4HPUE 1B6CB 3GVUA 4CFXA 4BWXA 3ULZA 2O8YA 4XBRA 3V5PA 5KCVA 4L8MA 1OL7A 3TUDA 2OXDA 3FYJX 5DG5A 3CPCA 5C1QB 3CLYA 2YERA 3F2AA 1YHVA 4JX3A 5AJQA 2UW8A 3BYOA 3D5XA 4KIKA 4IH8A 5K9IA 4ZOGA 4NM7A 2O64A 3DLZA 3DAJA 1IRKA 5J1WA 4RA5A 2CMWA 2OH4A 3QTXA 3A7HA 2FSTX 3I5ZA 3VS5A 4DGNA 4IQ6A 3D4QA 3DB6A 1U59A 3IOPA 3PP0A 4FTNA 1H1RA 5HBEA 2B54A 2ZDUA 3DNDA 4C7TA 4G17A 4QMMA 3POZA 4FTQA 5ETIA 4MWIA 4ZTRA 4RJ4A 4XV2A 4BWPA 2BROA 2R3KA 3EJ1A 5CXZA 1ZOGA 5C8NA 4ACDA 4ZSEA 1BLXA 3U54A 4XUFA 4JBPA 4PDSA 1PMVA 2BDJA 2GTMA 3VW8A 2C6LA 4RRVA 2VWUA 3DNEA 3QF9A 5KHWA 2C6IA 2ACXA 2OIDA 3DFAA 2BFXA 4BDDA 4UX9A 4X2JA 3TN8A 4LV5A 5KHXA 1DI8A 1FMKA 3LKMA 3MWUA 1EH4A 3G5DA 3CKWA 3OF0A 5FEQA 1H00A 4I5MA 3LFAA 2B55A 4FVQA 3SHEA 3C0IA 4EONA 5CS6A 5M4CA 4DEEA 2EB2A 3W55A 2YACA 3UZRA 1PMUA 2RFSA 2QOCA 4D2TA 1J7IA 4FL3A 3QXOA 2IWIA 2ZDTA 4D4SA 3QGWA 3MIAA 4I0RA 1W7HA 2A27A 2Y0AA 5A3XA 3UP7A 2VGOA 3KRXA 3FMMA 4ZY6A 4GMYA 2HZ0A 3OFMA 3HGKA 3MJ2A 4A9YA 4L43A 3AT4A 3PA4A 1KV2A 3F3VA 3QZGA 4FSNA 4WO5A 5DEWA 4C2VA 5I9WA 5JEBA 5HCXA 2OWBA 3AC4A 4AXAA 4WT6A 1JKLA 1G3NA 3DAEA 3QHWA 3GC9A 4R5SA 3E8DA 3AOXA 4GSBA 4GG5A 4NFMA 4B4LA 4F99A 3CSVA 4FV4A 5EQYA 1YXTA 4OTDA 1XH8A 2R3FA 3OEFX 2JC6A 3NDMA 2XJ0A 4FT0A 1YKRA 4EHZA 2LGCA 5EM7A 5HO6A 1KUTA 2WD1A 4ZK5A 4EWHA 1FPUA 3CD3A 2VTTA 2XH5A 3DBEA 1BL6A 3F88A 1CKPA 3GXLA 3TTIA 3SOAA 4FE2A 5CEKA 3MYGA 4TYHB 3OWKA 1JKTA 4XG4A 3H9OA 4OAVB 3FSFA 4YZBA 5ANKA 4C33A 3KFAA 1YHSA 2X6EA 1MRUA 2C5YA 3VS4A 4D4VA 3LJ0A 4U7ZA 2CGVA 1H27A 4QQJA 5AR3A 3R9NA 4FIJA 5M06A 4J53A 4BTMA 3MFRA 1OPLA 5DRBA 4FSQA 5FXRA 3F9NA 2WTVA 2UZWE 3QYZA 2CNQA 3R8UA 5JFSA 4EH9A 4QYYA 5CF4A 3O96A 5DFPA 4V05A 1GIJA 1AD5A 3QKKA 3GNIB 4EK3A 3F3TA 3HA6A 1J91A 2OBJA 4EOSA 3TWJA 4KKGA 2X7OA 3QCXA 5IISA 2ETRA 4GJ2A 3BQCA 2G01A 5I9UA 3ORKA 4AQCA 3UYTA 4W4XA 5IDPA 5LMBA 3EQGA 2OK1A 3R1SA 5L2WA 4LMUA 3ATSA 2WQOA 2RG6A 5CTPA 5HVJA 2AUHA 2AC3A 4J99A 2UUEA 3LFSA 4F6WA 1WBTA 2PZIA 3UVQA 2B4SB 4W4WA 2WMTA 4M7IA 4USDA 4F9CA 2R7IA 4KIPA 2UW4A 3MY0A 4M68A 1P4OA 4GUBA 4IWQA 4UZHA 3FLYA 4ZLYA 1ZYDA 4HGTA 4TNBA 5IA1A 2NO3A 3OCGA 4K18A 4LRMA 4X3FC 3DZOA 4FIHA 2WTWA 5HG5A 5HBHA 4BICA 5EQEA 4FKGA 4F08A 3FLZA 3ZEPA 2QKWB 3HLLA 3MI9A 3OC1A 3SD0A 3ZDIA 2CKPA 3M11A 4IEBA 4CZTA 4NM5A 1ZYLA 4XX9A 2YAKA 3K2LA 1WVXA 4PTGA 1KWPA 4DHFA 1G8AA 4N57A 2C1AA 1ZMWA 3FJQE 4BTKA 4WIHA 4JR7A 1GAGA 1W82A 3LJ1A 5A4TA 5KMJA 3R73A 2B9HA 3NNVA 4L9IA 3RM6A 4RQVA 3GU5A 2I6LA 4R5YA 3C0GA 3TZ9A 4CFMA 2YM3A 3C4EA 3OS3A 5AUXA 3RTPA 3CTHA 4A9UA 2KTYA 3E7OA 4ZMFA 1M17A 4YZNA 3TIYA 3HRFA 2C1BA 5AV1A 2QODA 4R8QA 4M12A 5HU9A 5CAPA 3E3BX 2ZVAA 4ASEA 3ZFXA 4H3QA 3QCQA 4YBJA 5DH3A 3ORXA 4FVPA 2V22A 2J0KA 3AQVA 3KEXA 4TRLA 4ZTSA 4PDOA 2YIRA 4FTCA 2BHHA 1OIUA 4AN9A 3ZO4A 4RWKA 5DN3A 4AT4A 2Y6OA 3C0HA 2VTNA 3MS9A 3BHYA 2QOLA 4J96A 4PPCA 3CXWA 3FKLA 3A8XA 4NKSA 4O0TA 5H2UA 2O5KA 4NWMA 4RIYA 2G15A 2JDTA 3FL5A 5D10A 2WMQA 1M2RA 3ZUUA 4HCVA 4XP3A 4E8AA 2B0QA 4RMZA 4AE9A 3OROA 5HBJA 3LLTA 3QQFA 4PDYA 2XNPA 4QYGA 2GPHA 2J5FA 1JQHA 2YCSA 5HIEA 4WNOA 4D2PA 4Z9LA 4FMQA 4DGMA 5CSWA 3RINA 4AG8A 4DG0E 2OZAB 4IX3A 4O21A 2VUWA 2YLFA 4FG9A 3CBLA 4YPSA 5L2QA 3SGCA 3GCVA 3V8TA 2OIBA 3O71A 4O82A 4DFUA 4A9SA 3EWHA 3VBXA 1QL6A 4NT4A 4CTBA 3VJNA 3MY5A 4L6QA 2UZUE 2PVNA 3OCSA 5KO1A 2IZTA 4RJ5A 5K5NA 3ZSHA 2F9GA 4ZMEA 4IJ9A 1B38A 2C69A 2BKZA 4F65A 3FKOA 5EM6A 3I60A 1IA8A 2X81A 3BLRA 3HV5A 3QA8A 5CEOA 4EEVA 1M14A 1ZMVA 4RLKA 2PVRA 1CM8A 4FKRA 3VW6A 5JRSA 4FTIA 3PLAE 2R3IA 5FTOA 3VF8A 4I41A 3ZUVA 4FV0A 5G1XA 4YTCA 2HY0A 2I0VA 1FQ1B 1SVGA 5J1VA 2F7ZE 4RBLA 4TYEA 3RCDA 5CX9A 5HTIA 4MEDA 3EQBA 3KMUA 5CU6A 4RIXA 3H0YA 4ANQA 3NR9A 3C4FA 3H9FA 3JVRA 3GU4A 2P33A 2QONA 3HX4A 2GNJA 3DS6A 3R8PA 4RVKA 2ZMCA 3U9CA 2FVDA 2XA4A 3LMHA 3LW0A 2UW0A 3CY2A 4WBOA 3TNWA 4D2RA 5TKDA 3NX8A 1P14A 3R7VA 2WAJA 1WFCA 3ZLWA 4YTFA 1Y57A 2ZV7A 2BRNA 4J97A 4F64A 5LVOA 4CT1A 1FGKA 2R64A 5A6OA 3OCTA 4BF2A 5BVEA 4QTBA 4FTOA 5AAGA 2YHVA 4U6RA 5L6WL 4UWYA 5J8IA 4DH7A 3RPYA 5EHLA 1XBAA 5E7RA 4YO4A 4N4SA 3EB0A 4CG9A 4I22A 4NTSA 5DVRA 5LVLA 3RWPA 3UOLA 1X8BA 4YSJA 5K4IA 3WZEA 4JQEA 5DWRA 1S9JA 1YI4A 4BGQA 5JSMA 4R1YA 4E6QA 3GCPA 3N4VA 4AACA 4K0YA 4EHEA 4ARKA 2BILB 3BEGA 3DKFA 3BI6A 3BZ3A 4QYFA 4RZVA 4EH2A 4F9WA 2BMCA 2UW3A 4GW8A 3RK7A 4QD6A 4ZTMA 3PSBA 3P5KA 4X2KA 1CSNA 5BVKA 3TNHA 5HGIA 4KAOA 4TY1A 3WZUA 4C58A 4BCKA 1ZYJA 4IADA 4Y83A 3PA5A 3S0OA 3MVHA 3ZFYA 2VX0A 4XJ0A 2X4FA 3PJ1A 4IAIA 3A60A 4O7WA 4BCFA 1ERKA 3VUGA 4M69B 2PMIA 3D94A 5AUVA 4X3FB 3FI4A 3KF4A 4J98A 4RQKA 1PXMA 3ZC5A 1YWVA 4IB1A 3FLNC 2QO7A 5F4NA 4E26A 2QO2A 3MIYA 4QMNA 4RIOA 4OT5A 5E8YA 2Q0BA 4I0SA 2QCSA 2WMAA 3A8WA 3QZHA 2B9IA 4NU1A 5FQDC 4BGGA 4EQUA 3PVGA 5M57A 5CF6A 4ANMA 3GU7A 4FKUA 5ETCA 3UE4A 2JFMA 3MV5A 4F6SA 3HAMA 4ANOA 1WAKA 4IAKA 5HIBA 3QWKA 3RAKA 2WTIA 4JVGA 1PXIA 3TV7A 3BHUA 4QTCA 1H28A 4Y8DA 2QO9A 4FT3A 4O6EA 4E1ZA 4YZCA 2A4LA 3JY0A 2YCQA 3JXWA 1QPDA 3U87A 2BZHB 3B2TA 4CD0A 1YWNA 2E9PA
chains in the Genus database with same CATH superfamily
3EKNA 2WMVA 4IFCA 5DIAA 4NZWB 3U8WA 3HMOA 4MVFA 2XIZA 3VRYA 2AYPA 4ANBA 4JAJA 4CZUA 5L2TA 5DYJA 4EK6A 4GIHA 1FINA 2BTSA 1FVTA 4JRNA 3ENMA 3OXIA 1K9AA 5J9YA 4DCAA 3U9NA 3U51A 5JFVA 3PXZA 4QNAA 2C3LA 4JG7A 2PYWA 2OU7A 4AN2A 2HXLA 4IAYA 4LV7A 1URCA 3MDYA 3R7UA 2XK4A 4YMJA 4QMPA 2QOFA 2YCRA 1PYEA 2W5HA 3AG9A 3R71A 5HO7A 4IACA 3SKCA 2NNWB 5IQGA 1UWHA 3PJ8A 5J5SA 3LXNA 3ZO2A 4EZ3A 3NAYA 2YAAA 3D0EA 2QOOA 4R3RA 4A7CA 4BB4A 4BIEA 1JSTA 5IMEA 4O0WA 2WELA 3GB2A 5IUIA 2C47A 1JBPE 4YJOA 1H8FA 1YWRA 3TT0A 3NW5A 3OP5A 4FC0A 3G9LX 2V62A 4K8AA 4KRCA 3BV3A 3FMJA 4BDGA 3KCFA 3UO5A 5E8VA 4H36A 2Y4IC 4TYHA 4KS7A 2X7GA 3ZZWA 4TYJA 4O38A 1FGIA 4J8NA 1NVRA 3PPKA 4DC2A 4QP4A 3KXNA 5DHJA 3SRVB 3DJ7A 3UOKA 3QD4A 4I3ZA 4PX6A 3WIGA 2UVXA 3G9NA 2PUIA 3I5NA 3VS1A 4PTCA 1XH5A 4OBQA 1CDKA 4FTMA 1BI7A 5ANGA 1OUKA 3UQGA 4DH8A 2NPQA 3JS2A 3WE4A 3SG8A 5CY3A 3UDTA 3R83A 4DLIA 3D14A 1PHKA 1OIYA 3D2KA 3FBVA 3I7BA 4HPTE 3I79A 3Q53A 3PG1A 5G6VA 5KUPA 4ACMA 4O0YA 3OZ6A 5GZAA 4TYIA 4I20A 4HYIA 4GS6A 4ZSJA 3VQHA 2R0IA 5ICPA 4AN3A 3VUKA 1PXNA 5T6KA 2JKOA 4CCUA 5ANIA 3OW3A 5M4UA 3BRBA 5BVDA 5D1JA 2WIHA 4QP2A 4MD8E 2HWPA 3H4JA 5IQHA 4ENXA 5C01A 2BRHA 4BCNA 3EIDA 3CP9A 4CVAA 4XG3A 1OPKA 2YJRA 3R8ZA 4IZ5A 3UP2A 3KXMA 4S32A 2BKKA 4FSYA 4EOLA 2W1FA 3O8TA 3UZPA 1T46A 4NTTA 3TKUA 3ELJA 5HO8A 3TCPA 4L68A 1E1XA 3HUCA 5FM3A 4O7YA 1PKGA 2C0TA 3SW4A 2OJIA 4KNBA 3QC9A 2HOGA 5CWZA 4YHJA 3W2QA 4RX7A 4CFWA 4JQ8A 3WF6A 4JAIA 3DKGA 3MJ1A 1S9IA 3LJ2A 4TKSA 3DCVA 4U80A 2JBOA 4C4GA 4EOOA 4IAZA 3CKXA 3OY3A 2X9FA 5DT4A 4JOAA 2OF4A 3NPCA 2GDOA 4D9TA 5CU3A 1Q99A 2HWOA 4I93A 4JRVA 5I3OA 4AW2A 2ITNA 3JYAA 4ZZMA 5E91A 1H1SA 4D2VA 5CALA 5KBQA 4C4EA 2FB8A 1FMOE 2G2IA 5A9UA 4BN1A 4NJ3A 4XMOA 5AUWA 3RNIA 3UNZA 1OKWA 5EM8A 4ZTNA 4RT7A 3U55A 1QMZA 3II5A 4UMPA 5M56A 3TACA 3KGAA 4CFNA 3A7JA 1CMKE 3GC7A 3AD5A 5EFQA 3R9RA 3UMXA 1QPEA 3ZRKA 4LUDA 3QD3A 2OICA 2QOIA 3HEGA 4HNIA 4RJ8A 4L7FA 4AS0A 4OTIA 5CQWA 3G2FA 5EH0A 5A54A 4GVJA 4LMNA 2WOTA 3F82A 3QYWA 5BVNA 5I9VA 4OTHA 4FKWA 4E6AA 4EJ7A 3PXQA 1GJOA 3DJ5A 4AQKA 2HK5A 4UV0A 2CKQA 2BCJA 3KF7A 2VWVA 2JITA 4JR3A 5KMNA 1O6KA 3HKOA 1P2AA 4ANNA 3DAKA 3G0EA 4YNEA 2E9NA 4D28A 4OLIA 3ODYX 1JLUE 2PZ5A 5HEZA 2ITZA 2GNIA 4H3BA 3RCJA 2P2HA 4F0IA 3IW8A 3OWLA 4FYNA 1WVWA 4ITJA 2G9XA 2PE2A 4RIYB 4WUAA 3FMLA 3PVWA 2JIUA 4R6VA 3LZBA 3Q9ZA 3ZS5A 4LRKA 3QWJA 5EQPA 2RFNA 3U6IA 4CMUA 2OZAA 2A19B 3I1AA 2ZM3A 2UV2A 5E8XA 3OTVA 2YIWA 3W33A 2OG8A 5AP4A 2WGJA 2R3LA 4RJ3A 1AGWA 1PW2A 3FUPA 5DRDA 3RNYA 2YDKA 3BYVA 3KA0A 4QPSA 4XH6A 3OD6X 4L3LA 4HNFA 4YC3A 3T9TA 1NA7A 4O81A 4L67A 1Q3WA 3RK9A 4D5KA 2W05A 3DK7A 1PRYA 4X2GA 3NUAA 3QQKA 2PVJA 5AADA 3D83A 2VNWA 3ALNA 3EL7A 4JIAA 1OMWA 3SQQA 4ZY5A 4KKHA 1GZOA 2PL0A 5EI6A 3O17A 4UYNA 4F7SA 2OKRA 3BE2A 2UVZA 1H1PA 3M2WA 3F6XA 2V0DA 5HZNA 4FR4A 4QP6A 5BUIA 4M84A 2EVAA 4LRJA 5B0XA 4AGCA 3LMGA 4N70A 3CR0A 2XNEA 3FLWA 2HXQA 3O2MA 4F9YA 1ZWSA 3PLSA 2R3NA 4CCBA 5CU4A 3JY9A 2QURA 3PWDA 4LV8A 2IF8A 3POOA 5EM5A 3R0TA 4GEOA 3VVHA 3Q5ZA 2PUNA 4FYOA 4C35A 3NCZA 3C4CA 1ZOHA 4R3CA 4HGLA 2R3GA 4II5A 4DFBA 5IQEA 2ZM1A 3I6WA 5FDXA 4RIXB 2X0OA 4XG7A 3RJCA 1BMKA 4A07A 4E5BA 4RWIA 3V5LA 5A4CA 4M97A 5BYYA 2YN8A 3ENHA 5I9ZA 3DLSA 5A46A 2XJ1A 2FUMA 5JZJA 2BTRA 3QA0A 1PXKA 4DEHA 3EN4A 5KX8A 5C4KA 5JFXA 3W0PA 1PKDA 2FA2A 2FSOX 1CKJA 4I23A 5DPVA 5CAUA 3IO7A 4NCTA 3BELA 3GI3A 4RVTA 3SXRA 5AIRA 3SG9A 3F2NA 3R7EA 3PFYA 4XCUA 3K54A 4JI9A 2VO7A 2VTJA 1YDRE 5L8JA 5IQAA 3UDSA 4FTLA 2PMLX 1I44A 3L8PA 4XBUA 2C3IB 3IDBA 4ZTHA 4I5CA 2VGPA 2Y7JA 3OG7A 2BIKB 3VUMA 4C0TA 5DA3A 4DLJA 5E9EA 5FDPA 3OWPA 3QKMA 2W1GA 4CXAA 1XQZA 3KN6A 3F5PA 2X2KA 4AP7A 5KMKA 5EDPA 3VNTA 2DWBA 3V51A 3ETAA 3JPVA 4Q9ZA 5FP5A 2ZM4A 4ITHA 3AD6A 4YPDA 4FKPA 3W0MA 3A7FA 3ZXTA 3PJ2A 3BLHA 4U0IA 4R77A 2WQBA 2C0OA 3F3UA 4D2WA 4CQEA 4ACHA 5TT7A 2CGUA 3RPSA 3DT1A 5JGAA 5IU2A 2HY81 4U81A 2JDSA 3RKBA 5I4NA 2JDOA 2OXXA 4P7EA 2XKCA 3O23A 5FD2A 2ITWA 3AMAA 3FSKA 3R1YA 4EQMA 2XK9A 4QTDA 4WRSA 5C9CA 4ZS0A 4CMTA 1P5EA 3B2WA 4FT7A 3UG1A 5JK3A 4M69A 3VUTA 1IEPA 4EUUA 1MUOA 4X3FA 4QT1A 4DGGA 4F70A 4KWPA 3QQUA 3IW6A 4J8MA 3PRIA 4AOTA 2ZAZA 4CQGA 5CEQA 2R2PA 4JXFA 4DYMA 5IUHA 5L8KA 4AFJA 2JLDA 4TPTA 3UG2A 4YU2A 2XEZA 3AGLA 1A9UA 4IIRA 4NM3A 1R0EA 3CGFA 3OY1A 3G33A 5EDQA 5CT7A 4IDVA 3EQIA 1H07A 2XBJA 4JIKA 4L3PA 4AW5A 1Q8ZA 3E8NA 3TDWA 5EI2A 4KSQA 1UU7A 5HD7A 1I09A 3QTRA 2F2UA 2J90A 4EQCA 3QBNA 3PXKA 4CZYB 2RF9A 2UZLA 1IR3A 3H0ZA 3P0MA 4DITA 4XG9A 4CLJA 5LVNA 4FGRA 2I40A 4GK3A 1UVRA 2X6DA 3LQ8A 1IAHA 2YZAA 5DE2A 2J6MA 1L3RE 5EYCA 5CI7A 5E4HA 4Q9SA 2OJJA 3VS6A 4E4MA 4USFA 3RALA 3T3UA 1OBGA 3V5QA 4CV8A 3COIA 5HNBA 1YW2A 3DDPA 1YXUA 4A4LA 1XWSA 3A62A 4FL2A 5L6PA 4FKLA 3QRTA 2RFEA 5FWKK 2GCDA 2C68A 3PVUA 3QLFA 4FSMA 2PVYA 4G5JA 3VBWA 4R7IA 4XG6A 4KA3A 1U54A 3WF7A 5EYMA 2VD5A 3FZSA 3UPXA 4O7RA 3LPBA 4O27B 4ALVA 3F69A 4BYJA 2QG7A 4O7NA 2UW9A 2JFLA 4OBOA 1IG1A 4PF4A 4YTHA 4QTEA 1CKIA 2W5BA 5JKGA 1OECA 5TR6A 3PPZA 1VYZA 1OBDA 4Y73A 4QRCA 4MXOA 4BFMA 4G5PA 4BDBA 3ZCLA 3L9LA 3QZIA 3EH9A 4U3ZA 3I6UA 5FXQA 3FI8A 4FKVA 3WOWA 4AXFA 4IAFA 3QUPA 4PPBA 3ALOA 4M0YA 4FKJA 4D0XA 3I7CA 2Z60A 4QMLA 4K6ZA 5ANOA 4ALWA 4ORKA 2H96A 5AIKA 3MPTA 4U40A 4MXXA 3SRVA 4I6FA 5ETFA 4QMQA 4P2KA 3DXNA 4EUTA 3LMIA 3HMPA 4FICA 3GP0A 3VULA 4O0XA 4XLVA 4FJVA 4CGAA 3KMMA 3LCOA 3BLQA 3FY0A 5AAEA 3KIOC 4ASZA 3V04A 2PVMA 5LOHA 2VX3A 2ZMDA 3P1AA 4ZAUA 5KMMA 4BL1A 4L00A 2Z2WA 1YDSE 2ETMA 3D5UA 4N0SA 3MPMA 3D9VA 4WHZA 4C57A 2J50A 3KKVA 2EWAA 4BTFA 2JAVA 2Y6MA 2G2FA 3MB7A 2J0MB 3LFBA 4UBAA 4WSQA 3AC3A 2WMSA 4IAAA 4PUZA 5B2MA 3LCTA 5JT2A 3TZ7A 4LOPA 3ZO3A 3TV6A 4F63A 2W4OA 2QHMA 2XM8A 4O0UA 4PRJA 3CE3A 5CANA 3UIXA 4MK0A 5M51A 3BHTA 1DM2A 4NK9A 4HVHA 3V8SA 4EZ5A 4I5HA 1SVEA 3AD4A 1KV1A 1K3AA 3E93A 2BAJA 3FLSA 4U8ZA 2W99B 4EC8A 5IPJA 4WSYA 3LCDA 4CG8A 3F66A 4BDKA 5AP3A 5EKNA 4CKRA 4BCJA 1VZOA 2ONLC 3Q9XA 3BGQA 3EFJA 3EN9A 4I0TA 5M55A 4Y72A 1XH9A 3NNUA 2P4IA 3P4KA 4IX4A 2EU9A 3WE8A 4C3FA 4C59A 1OL5A 4XS2A 5LMKC 4YJSA 4MNFA 3C9WA 4M8TA 3QZFA 2YJSA 1YI3A 5T3QA 3ANQA 3L8VA 4QQCA 2YABA 1LP4A 3C7QA 1WMKA 4CFUA 3AC2A 5IMXA 2WU6A 3DBDA 3PY1A 2FO0A 4G3CA 4ONAA 1NVSA 5AM7A 3C4ZA 5ETAA 4AUAA 4EZ7A 4JL9A 3QCSA 4H1JA 2PVFA 1Q3DA 4RLLA 5F1ZA 2PE1A 3Q9WA 3NYNA 5HHWA 1ZYSA 3PJCA 5JRQA 2X2LA 4MD7E 2W1CA 3UDBA 1XKKA 3MH0A 4FOCA 3VO3A 5LVPA 2BR1A 4FEVA 2SRCA 5HVYA 4ASXA 2PHKA 4EWQA 2GNLA 3PVBA 5HCYA 4DEDA 1OIQA 4DGLC 3BU5A 3S3IA 1H24A 2HIWA 4AA0A 4C38A 5HG7A 3SW7A 1KOBA 3ID6C 1WBSA 4QEBA 1CTPE 1W8CA 3ET7A 3FI2A 3C5UA 1H25A 2KULA 2PWLA 3LM5A 4CRLA 5JGDA 3BKBA 4FBXA 3FLQA 3ZC6A 3JR1A 4QYHA 3WILA 4IM0A 3O7LD 4FV5A 4C3PA 4BDEA 1PYXA 3OBJA 2XCHA 3BL9A 4F7LA 4DBNA 2HW6A 3CJFA 1G8SA 3HMMA 3CCNA 5LWNA 2VTPA 3L8XA 4HYHA 3OOMA 5D41A 1PMNA 4RX9A 4Y85A 2WO6A 4QO9A 4EH8A 1WBWA 4IC8A 4AU8A 2YITA 4RFMA 3PG3A 4FG7A 3ZSIA 1MP8A 1NY3A 3KCKA 2A1AB 4RC2A 2PVLA 3P78A 1W2DA 4YC6A 4MBJA 4DEBA 1LEZA 3VS3A 3PYYA 3MY1A 3QL8A 3LFEA 4AGDA 1AQ1A 2ZYBA 3EHAA 3V01A 1MRYA 5ANEA 3CPBA 3S95A 5HTBA 4FTAA 3IPHA 4ZSGA 1H26A 2VWYA 4B9DA 4JDJA 3IOKA 3EN5A 3FC2A 2X0GA 3RPVA 3GUBA 2VWWA 3QTUA 3FPQA 4A9RA 4DEIA 2O65A 1VLRA 3SAYA 5BVOA 2C6TA 1Q8YA 5LQFA 1XJDA 3R02A 3LFDA 5EHOA 1OM1A 4C4FA 5AV4A 4AGUA 1F0QA 1LR4A 2PU8A 2R3MA 4OBPA 2WTDA 3GENA 2VWZA 2ZOQA 4RFZA 3VUHA 3QQJA 3W2RA 4GYGA 4RG0A 5IEYA 3CC6A 1Q4LA 4LOQA 4YTIA 5CF5A 1JAMA 3P7CA 1UWJA 4M13A 3RBWA 3VUIA 5KMOA 1Q62A 2OH0E 2YM8A 4M0ZA 1PMEA 5AP5A 4ZY4A 4YJQA 3NEWA 4F0GA 3HV6A 4MXCA 5JZNA 2W96B 3KREA 3Q5IA 3NYOA 3LQ5A 3HYHA 2QQ7A 1J7UA 4O1PA 3UTOA 4I24A 3BU3A 2VTOA 3CIKA 1VR2A 5D12A 3O8PA 3E7VA 4QPAA 5EW9A 3W2OA 4ZJIA 3FWQA 3IS5A 3P23A 4PV0A 4I5PA 3AC5A 3LFCA 2JDVA 3S2PA 2XK6A 4HVDA 3FMEA 3A2CA 4BI0A 3WZJA 3SDJA 4AT3A 3F5UA 2P0CA 5DT3A 3EYHA 2C3JA 1YXSA 4B8MA 4DAWA 4GCJA 4FKQA 4QP1A 3T8OA 2B7AA 1G8KA 2YLEA 3VRZA 2VO6A 2YIYA 1WBPA 3MVJA 1XH6A 4YZMA 2BRGA 3F5XA 4WA9A 4AZVA 2XNNA 1YI6A 3RAIA 1M2QA 2J2IB 5GJGA 4PY1A 3UO4A 5FTQA 4BCGA 3RPRA 3LVPA 3ROCA 4M15A 1GZNA 4FSWA 4PWNA 4PMTA 2UZNA 2Z7QA 3MVLA 5E92A 4EYMA 4DGOA 3KRLA 3WZDA 3OEZA 5HLWA 4MQ1A 4BCPA 3UZTA 1YHWA 4YJTA 4U3YA 2Q0NA 4ITIA 2JBPA 4JQ7A 2CN8A 2VO0A 3EQHA 4HGEA 4IMYA 4FSTA 1H0VA 4WNPA 3QD0A 3VHEA 2WFYA 2EXCX 2J9MA 3TIZA 3PXYA 1RQQA 4ZZOA 3FMNA 4E6DA 4L52A 1KOAA 4JG8A 3FE3A 3FEGA 4GFOA 2BALA 2VZ6A 4O96A 4L45A 3ORTA 3QD2B 5HG8A 2GS6A 4FK3A 3VBVA 4IWPA 3IONA 4JS8A 2J0JA 4HJOA 3TV4A 4CFVA 4Z16A 2AEGA 2XCKA 2ITUA 4FODA 5F20A 3W8QA 4L01A 4KD1A 2VTQA 3Q4TA 2VRXA 3BYSA 4H58A 5H3QA 5JMSA 4JBQA 4QMTA 3W10A 3E88A 1O6YA 4WKQA 2XALA 4E7WA 5HX6A 3QRKA 4FNWA 2CNVA 4AXEA 5BVFA 4Z3VA 4D5HA 2VWXA 5J9LA 3P86A 5E1EA 4OTPA 5FXSA 3NNWA 4PQNA 3GOPA 4FX3A 4IFGA 1Q24A 2PZRA 5IDNA 2J0IA 3D7TB 4QYEA 4MXZA 1BI8A 5C8MA 4A4OA 2UZTA 2CJMA 3TUBA 4NIFB 4NSTA 4AZSA 3HNGA 5GINE 4FSUA 5HE1A 3HA8A 1R39A 4FNXA 3EQCA 4XYFA 1H01A 1ND4A 4AAYA 4HYUA 4N6YA 3F3ZA 3EQDA 4E4LA 5IUGA 2UZDA 2XKFA 1FOTA 3Q4UA 3ZSGA 3EFWA 4B0GA 4IZYA 3DKCA 4QP9A 5CAVA 2GNFA 3P9JA 2ITQA 4RA4A 4NL0A 4O7VA 4O7LA 4X6RA 4F78A 5GIOE 3PE2A 4TW9A 4CMOA 5KNJA 1TVOA 2JEDA 2X4ZA 5IA2A 1VYWA 5HI2A 5DMZA 1WBOA 2P2IA 4EHVA 3UNJA 4KINA 3ORIA 4IDTA 2OF2A 3R1NA 4EK5A 5AMNA 4QDEA 3ACJA 2OFUA 2Z8CA 3UJGA 2QOQA 1XR1A 2R3JA 4IJPA 5CVHA 2RIOA 4WUNA 3S1HA 2NRUA 1UU8A 2GFCA 2PMNX 5HESA 3EKKA 3F5GA 3OMVA 3U6HA 4CT2A 1W0XC 3IQ7A 1J1CA 3ERKA 3NUYA 1U54B 4GKHA 3IGOA 1GIHA 4FUYA 4BDIA 4CYJA 2XRWA 2YEXA 2B52A 4RC3A 2R3PA 4BZOA 4FOBA 4NW5A 3R7IA 2FYSA 3E3PA 5AUYA 4D4YA 2XKEA 3DQWA 2I0YA 5L8LA 1YXXA 3BX5A 2AC5A 4F0FA 2YDIA 3LQ3A 4FKTA 5C4LA 3BGZA 4IBMA 3MPAA 4O0SA 1PF8A 4LM5A 3MN3A 3UNKA 3RZBA 1F3MC 3TL8A 4BRXA 3DFCB 2OLCA 1JNKA 5CNOA 3FZPA 4J7BA 3NCGA 3A4OX 3W0QA 3QAME 2WMBA 4KUJA 2DQ7X 4OTGA 1WBVA 4AX8A 5DT0A 3QALE 2J5EA 2UZOA 4IXPA 4ACCA 5IA0A 3VONA 3FXXA 4LGHA 3ZLYA 2EXEA 4TNDA 1GNGA 5EKOA 5HLPA 4OAUC 1R0PA 1OIRA 3WARA 4JBOA 4U9AA 1ZOEA 4XV3A 5CEIA 2XKDA 3LXLA 3HRBA 4IVBA 1K2PA 3ORNA 5LJJA 5GIPE 2YM6A 4B8LA 5CEPA 4EKLA 3DDQA 3MA6A 3SXFA 3QTSA 4CV9A 3AGMA 2QLUA 4QPMA 4BDAA 2HW7A 3FQHA 4ZJJA 3ZBXA 2WEVA 2WMRA 3VBTA 4BGHA 4FVRA 5DOSA 1Q8TA 4DINA 4DDGA 1OL2A 4QMUA 4I4FA 3WF5A 2IG7A 3SA0A 1SNUA 4G6NA 5CENA 3MA3A 1QPCA 3MH1A 5CQUA 4BJJB 2XNGA 3EOCA 3EQPA 3TDVA 1O6LA 5IA3A 5IQIA 4KABA 3DBFA 3E64A 2Y4PA 4C3RA 3FY2A 4GH2A 1OUYA 5K3YA 4H05A 3NUSA 2CGWA 4GFGA 4AW1A 5JFWA 2CNUA 2F57A 4Y5HA 3R9OA 4PL5A 4W4YA 4PL3A 3MSSA 4YBKA 2ESMA 4BKZA 5FUTA 2OI4X 3H10A 3W0NA 4BZNA 4HVGA 2B9JA 2BVAA 1YQJA 4NEUA 1DAWA 5TE0A 4EOMA 1ZXEA 3DOGA 4Z7GA 1V0BA 2XB7A 4FIFA 4DG3E 5K5XA 3S00A 4RJ7A 4UMUA 3BEAA 3KXXA 1XO2B 4MX9A 1G8JA 3AC1A 1GIIA 3WI6A 4D58A 4FUXA 3G15A 3GGFA 4QP8A 4UZDA 1APME 5CASA 3IKAA 1WVYA 4F7NA 5AUZA 3V8WA 4WNMA 2GFSA 3G0FA 3MTFA 2XP2A 3NUUA 1PXJA 3ORMA 4IB3A 2ZJWA 4PMSA 3THBA 2FSLX 4D55A 5M08A 3NLBA 4DDIA 5IKWA 3QXPA 2Q83A 4GVAA 2R7BA 3O0GA 3QLGA 5A4QA 3PUPA 1IAJA 3HV7A 5CI6A 1OB3A 4UYAA 3B8RA 5HNIX 1JPAA 5BYZA 3L9NA 1XHAA 3FMDA 2C5NA 1M7NA 4MKCA 5HE0A 1JOWB 4RX8A 3SV0A 3TMOA 1M2PA 4CYIA 1M7QA 4ENYA 3K5VA 4WG5A 3PTGA 2BUJA 1Y8GA 3LCKA 4J52A 3RK5A 5A14A 4XV1A 3UQCA 5FBNC 2PVHA 2X8DA 4LYNA 4QMZA 2RGPA 4IC7A 4MQ2A 4DEAA 3U6JA 5HIDA 2WHBA 3DU8A 3P08A 4AZEA 2OW3A 4DTAA 5C03A 3PXFA 1GZ8A 3Q9YA 5HD4A 2WOUA 1Q5KA 4HYSA 4FKIA 4LOOA 2W9FB 2YWVA 5CF8A 3BWFA 3ZM9A 1KE7A 4P5QA 4BBEA 2BZJA 3I4BA 2BDFA 2R5TA 1RE8A 3VQUA 5HVKA 5D9HA 3MTLA 3OXTA 4FV2A 5IQBA 4MBIA 2XIYA 2HAKA 1Y8YA 3P79A 4RZWA 3BBTB 3V5JA 1TKIA 1Y6BA 4FL1A 3NMUF 1UU3A 3PSDA 4YLKA 2XF0A 1R78A 5AUTA 4L46A 3I0QA 3Q2JA 4KKEA 3SX9A 2PY3A 4MF1A 1IA9A 2QVSE 2BRBA 2BRMA 4O7TA 2LAVA 5IQDA 2XYUA 4ALUA 1SZMA 3EYGA 2YWPA 4I6QA 2ERKA 4UXQA 3SC1A 3KVXA 4D2SA 4DG2E 3R7OA 1RDQE 3P7AA 4JDKA 4FKOA 4LI5A 5EI8A 1SMHA 5GHVA 3LAUA 4CRSA 2YDJA 3Q3BA 5EOLA 4KIQA 4RVMA 4O83A 3TJCA 5J95A 3Q60A 4R1VA 5TO8A 3O5AA 4X0MA 3BU6A 4BIDA 3KN5A 3HL7A 3KRJA 5AWMA 2ITOA 5K0KA 3W8LA 3C4XA 4O4FA 1GOLA 2QOHA 4TXCA 3PZHA 5AM6A 4FZAB 2OJGA 2QU6A 3FKNA 2UZVA 3QUDA 2X39A 2WMWA 4YLLA 3ZO1A 3FI3A 4O22A 3PE1A 1YXVA 2FGIA 3FDNA 5JH6A 5CXHA 2C5XA 1SVHA 2VWBA 3VS0A 5IF1A 4J95A 2Y9QA 3CQUA 2YIXA 3PXRA 5CNNA 3TKHA 3ZUTA 1FVRA 1WZYA 2GQGA 2X8EA 4GG7A 4IW0A 2UZBA 3L9MA 3DXQA 3KU2A 2J4ZA 3DB8A 1DS5A 3HMIA 4FT9A 4XV9A 2Y4IB 3E87A 1UNGA 3PIZA 4K2RA 4UB7A 4PDPA 5EK7A 2YM4A 4EOJA 5IH6A 3BBWA 3VJOA 3ODZX 3DJ6A 3FV8A 4U79A 4B7TA 1UKHA 5BMSA 3GFWA 5J9ZA 2PPQA 4D1XA 5JGBA 4C36A 3F3WA 4Z55A 4YJUA 2XIKA 2OJFE 3S4QA 4G9RA 4UXLA 2QI8A 1UNLA 3DA6A 4YJRA 4APPA 2B1PA 2IJMA 4KB8A 4MF0A 1H1QA 4GT4A 1TQMA 1NT2A 4L53A 3Q32A 3ANRA 4O7SA 2VTSA 1T45A 4IX6A 4W9XA 4ERKA 4IWDA 2Z7LA 3GCUA 4GYIA 3VBQA 3ZOSA 4CSVA 4MXAA 4ERWA 4C4HA 5A4LA 3N51A 4ANLA 3KULB 4H39A 3LLAA 3PDTA 2ZV8A 3COMA 4RWLA 4DHIB 4HZSA 2ONLA 2HENA 3FZ1A 4I94A 4OTFA 2W7XA 5JN2A 2BAKA 3IDPA 3NZ0A 2GQSA 2IN6A 4A9TA 2WNTA 3E62A 5LMKA 5M44A 3RAWA 1TQIA 2WKMA 2H6DA 4QNYA 5AP1A 2X0QA 2XNOA 5AEPA 4G6OA 4W4VA 2CGXA 5AP0A 1OPJA 3MFUA 1DAYA 4A4XA 4DT9A 2JKQA 4DFLA 1Z57A 1KE6A 4FIEA 4XNEA 4F1TA 2IVTA 2I7QA 4IB0A 3D7TA 4O4CA 4EHGA 2CCHA 4E3CA 4Z7HA 1J3HA 3IW4A 3PSCA 4NIFA 3DKOA 4CKJA 4DTBA 5EOBA 3RHKA 4G2FA 4LUEA 4GT5A 4IX5A 3C1XA 4YC8A 2ERZE 3NS9A 4ZLOA 3BE9A 4MNEB 4X21A 4BHNA 4JJRA 4IWOA 4DT8A 5JQ5A 3L9PA 5LWMA 3VWAA 3SVVA 5IA5A 5FM2A 5BUJA 5CSVA 2O63A 3KK8A 2PZPA 2QOBA 4YR8A 3BL7A 3O8UA 2E2BA 4RGJA 3NVMB 5BYLA 3SOCA 2W4JA 2F7EE 3CY3A 2H8HA 4G3DA 3ZEWA 3EFKA 4XEYA 1URWA 3IK3A 3UVPA 4GK2A 4O1OA 2ZFYA 3F7ZA 2RL5A 2CKEA 2JIIA 2AQXA 2IO6A 4FEWA 4IM3A 3EZRA 1KE5A 2ZV9A 2ETKA 2PMOX 3G6GA 4DA5A 2CHLA 3VBYA 4CTCA 4D4RA 2CPKE 5CZHA 3HDMA 3DGKA 3SXSA 4DFYA 4GL9A 5LCKA 1M52A 2F4JA 4EL9A 4BDJA 3R2YA 3W1FA 1KE8A 1MQ4A 4MCVA 5KZIA 3VN9A 5IEVA 5D7AA 5I0BA 3QQHA 4I4EA 5LMAA 2W1EA 1XH7A 3ORLA 5B2KA 3K5UA 5BQ0A 4FTJA 3ROYA 3V5WA 1V0OA 5BX0A 5IEXA 3FMKA 2CLXA 5H9BA 2VTRA 4FTUA 3GOKA 3GU8A