3TEIA

Crystal structure of human erk2 complexed with a mapk docking peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
349
structure length
339
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLAFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHEYVATRWYRAPEIMLNYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Specificity of linear motifs that bind to a common mitogen-activated protein kinase docking groove.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3teiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3teiA01
4XHKB 2WIPA 3IS5A 5BVEA 3E7OA 3K5VA 4BDEA 2ITPA 3O51A 1MQ4A 2I40A 3QQUA 3NUUA 4GKHA 2CCIA 1ZYDA 4PWNA 4FUYA 2W1DA 2LAVA 3DB6A 4PTCA 1J7LA 1K9AA 3ACJA 2BIYA 4FNWA 4J52A 3RPYA 2X2LA 1AD5A 3G5DA 4JAJA 5FLFA 4BTJA 3F5PA 4RVMA 4WBOA 3BEGA 2IO6A 3P08A 4GSBA 3BQRA 5FD2A 2IVVA 1YOJA 2VTSA 5C9CA 3DKFA 1XQZA 3LIJA 1M2PA 3FMNA 4M15A 4WG3A 3HEGA 3R7YA 3PA4A 4G6OA 4YJTA 3NVMB 1E9HA 5BYLA 3QLGA 4I4EA 5CNOA 3HAVA 4TWNA 2A2AA 3EL8A 4E4MA 5IDNA 4FTCA 3VS7A 3WF9A 1JAMA 2XF0A 4M13A 3PPKA 3VULA 4HZRA 4BDDA 2JDVA 1LR4A 3GQIA 3BWJA 2W1IA 4FT0A 4XP0A 3ZRMA 3U6JA 4EC9A 5AMNA 3ZU7A 4EKKA 1NT2A 4FZDB 5KHWA 1UU8A 5EFQA 3QTZA 4BF2A 2EXEA 2QO7A 5M56A 1BUHA 1P5EA 4GCJA 3ZLSA 4ALVA 5AA9A 3AGMA 4FOBA 4QMVA 1CM8A 3AC8A 4WKQA 1PYEA 1MRUA 3AT3A 5M4UA 2ONLC 4FGBA 4ZJVA 1H08A 2C3IB 4GFMA 1M52A 3BPRA 4GUBA 1OB3A 4I5PA 4AE9A 4EH4A 2CKOA 3PIYA 4FV4A 4EH2A 3BYSA 1WBNA 2ESMA 2H96A 4UALA 3PIZA 3REPA 4F9YA 4G9RA 1YQJA 5ANGA 2Y9QA 4U6RA 1ZZLA 2X8EA 1UWJA 1ZWSA 2CLXA 1LPUA 4RZWA 4G9CA 3R1YA 4H58A 5DN3A 2V7OA 3TKIA 3VW6A 4E6DA 4LMNA 4W9WA 4BICA 4RX8A 1Q62A 4LV8A 2OXYA 2E9PA 2XKDA 3UIXA 5FG8A 4EHZA 5M4IA 3UVQA 4R7IA 2X7GA 2XNEA 3A7GA 5CEPA 3VWAA 2UZWE 4QYEA 4R78A 2XBJA 4TWPA 3Q6UA 4FV9A 5CT0A 4IAFA 4M8TA 5LVMA 3LLAA 2W1CA 1WBVA 3HZTA 3LFEA 4KNBA 5BPYA 2YABA 3R30A 4Q2AA 1CKIA 4ZSLA 3U55A 5DNRA 2P0CA 3FMHA 4ZSAA 1UA2A 2C0OA 4TYGA 3LCOA 4ZTSA 2WAJA 2YEXA 3N4VA 3VQUA 3KQ7A 3S00A 4AF3A 2IVTA 4ARKA 3PE1A 2W06A 2ETMA 3G0FA 2OK1A 3S2PA 2QOOA 4DLJA 1V0BA 1OMWA 2ITUA 4O6EA 2GNLA 3TV7A 1XBBA 1NY3A 4P4CA 4IWOA 2VTLA 3GFWA 4WNMA 5HKMA 2QR7A 4FTMA 5BNJA 4ZTQA 4EWQA 2EVAA 3EN6A 2X9EA 4BCNA 2YM4A 2VWWA 3LCTA 5HO8A 3ZONA 2F4JA 4Q5HA 4EH7A 5KZIA 1GZOA 2QC6A 3FMMA 4HCVA 5JQ8A 4O96A 2XNNA 4EOLA 3A61A 5H2UA 3OP5A 3R8MA 4FEVA 4MBJA 3W2CA 2C5OA 1BI7A 4GEOA 2I0EA 1SYKA 2R4BA 5J8IA 3U87A 4FTRA 3QTQA 4J98A 4KA3A 3PYYA 3IK3A 2JITA 4Q9SA 4U41A 5DWRA 3Q60A 4K1BA 3ERKA 5J95A 1O6KA 5A4EA 2JIVA 4YURA 4F09A 3GT8A 4X7QA 4KB8A 3DFAA 1FGKA 2EB2A 2PYWA 2ERKA 3MH2A 4NJDA 3C4WA 4GT5A 3KB7A 5BMMA 2UW3A 4Y5QA 3OMVA 2FUMA 2EU9A 2RFDA 4JVGA 4BCQA 2XB7A 2B9FA 3KRRA 4GT4A 2ZM4A 5C27A 3DAEA 1M2QA 5AEPA 3TUCA 4XLVA 3ENHA 5HBJA 4EORA 4J7BA 2OU7A 2OXDA 4MXCA 1KV1A 4GYGA 4I94A 2WIHA 4M0YA 1RDQE 4CG9A 4Z7HA 3RI1A 4OTFA 3TG1A 4YMJA 1ZZ2A 3IW5A 4B8MA 3CP9A 5F20A 4DEDA 4JX3A 2GNIA 4TT7A 2IW6A 3Q96A 4BDHA 4XG9A 4A4LA 2JBOA 4IIRA 5BVOA 3KK9A 3R7IA 3VQHA 3BYUA 3LFDA 2Z8CA 1Y91A 4BCPA 3ZO2A 3KRJA 5D7VA 2HENA 3MESA 4S2ZA 1VR2A 2V22A 2OXXA 3CD8A 2P4IA 4O1OA 3ZM4A 3UOLA 5JZJA 3I7CA 3KCFA 4L45A 3LPBA 3PSCA 3ZLXA 3LFNA 4ANBA 4ITHA 1XJDA 5ETCA 3WARA 3QYWA 4HVHA 4LYNA 4RQKA 4UN0C 4JAIA 4BI1A 2Q0NA 3OHTA 4YJNA 3P1AA 5AIRA 4M66A 4FKWA 2RG6A 1CMKE 4FTTA 4NJ3A 3T3VA 3UP2A 3R1NA 3WYXA 3R2YA 2OO8X 5J5SA 3NZ0A 2HYYA 3AMAA 4LGDA 4RA5A 4RC4A 3HRCA 5HGIA 2YA9A 3W2RA 5LMAA 4RRVA 4U80A 2BMCA 3EN9A 5HNIX 3TZ9A 4TL0A 1PMNA 2JDRA 2BVAA 4ANLA 4ANSA 3KK8A 5IEVA 4H1JA 2IN6A 5EYMA 3OXIA 3TACA 4OAVB 3MFSA 3GU4A 4HNIA 3R9DA 5E91A 1JLUE 5D11A 3BV2A 4S34A 3TV6A 4MXXA 5CALA 3DV3A 4KIQA 3ZEWA 3HRFA 3DNEA 4YLKA 3UC3A 5CF8A 5KX8A 4ZOGA 1M7QA 2X6DA 4NM7A 3AC2A 3QC4A 4TY1A 4UXLA 3VS1A 4PV0A 3WZUA 1UNHA 5CEKA 2XZSA 4I93A 3HV6A 3QBNA 3PE2A 4OTIA 4CFWA 3B2WA 5EQYA 4DGNA 3FE3A 5JGAA 4HYUA 4L53A 4FYNA 1OBDA 4B0GA 3HV3A 3D5XA 4CTCA 5AV4A 3RTPA 3V5WA 2UW8A 4J97A 5CAPA 4ZZOA 2NO3A 4FSYA 1XWSA 4GT3A 4UZDA 1PXNA 2Z7SA 4Y95A 4M69B 4JJRA 4QMXA 4RG0A 1OITA 5L2QA 4C4HA 4O7LA 2YISA 3G6HA 4P5ZA 2PVNA 3QQHA 4EOIA 2VTQA 3OOGA 4JG8A 4ENXA 4BWPA 4HW7A 3EN7A 2HZ4A 2XJ2A 4I0TA 4BIBA 2C4GA 3SC1A 1SVHA 3F3WA 4W4YA 2XKFA 2F7XE 4PNIA 4JG7A 4RIYB 3ROYA 3ORZA 2W5BA 4FT7A 2CGWA 4DEGA 3LFSA 3QXOA 4O2PA 2C0IA 5AAGA 4MEDA 3R22A 3W8LA 1QPDA 1XHAA 3OXZA 3R00A 1J3HA 4JBQA 4PX6A 3LXNA 1O6YA 3JS2A 3PSBA 4X3FC 5DFPA 2PMOX 2WOTA 3OROA 2WPAA 3PJ8A 2PHKA 3EH9A 4FIFA 1W8CA 4GYIA 1ZYCA 5AWMA 3ZS5A 2C5NA 2GHMA 4GFGA 3FC1X 5D41A 5HIBA 5DI1A 5CSVA 5IQFA 3F66A 2F7ZE 5EHYA 4F9CA 5LMKA 5K4JA 5CENA 3SW4A 2XEZA 4GV1A 3DZQA 4L7SA 4O0RA 3WZDA 3O7LB 3RP9A 3PRIA 3DKGA 5KKRC 3CGFA 4N70A 4AN9A 3KVXA 1JKTA 3VF9A 4BR3A 5AR8A 5B0XA 4FC0A 3E8DA 1CKJA 3BLRA 4L42A 3N4TA 4RJ8A 4C4GA 3CD3A 3L1SA 4MWHA 3FI2A 3I0QA 3QKKA 2GS2A 2ZDUA 3BE9A 4JDJA 1YXTA 4KINA 3HNGA 5F9EA 5KMJA 3A7FA 3VBTA 5IH6A 3DT1A 2XKEA 1GIIA 4PDPA 3WBLA 2RFEA 3FYJX 4RC3A 5B2KA 2OJ9A 3W55A 5HICA 3CKWA 3U8WA 5GINE 1Q8YA 5L6WL 3IW6A 4GW8A 4WOVA 5LCJA 3E88A 1OKYA 5HHWA 3U6IA 2UW6A 3TUDA 2BRHA 4CEGA 3R83A 2A1AB 3RK5A 4Y85A 4ENYA 5DOSA 5HE0A 3UE4A 2F49A 3TZ7A 3NYOA 4YPDA 4I24A 1PXOA 2GNGA 4RVKA 4EQCA 4EOMA 4GRBA 5AAEA 4OBQA 5AUWA 5LCKA 2ZV7A 1ZMUA 5FRIA 2XIXA 3RKBA 3VNTA 4YZMA 5HG5A 4FT5A 3UVRA 3NVKI 3EMGA 4UEUA 5AP1A 1B6CB 3R73A 5TF9A 4CRSA 4EC8A 2PUNA 3PIXA 3NUSA 3E64A 2IVUA 4E4XA 1YI6A 4DHFA 4OGRA 2V62A 3LM0A 5KZ0A 2CMWA 3HRBA 3HA6A 5HX8A 3V8TA 5EOLA 2OFUA 3COHA 3PXQA 4FT9A 3QUEA 3QZFA 3HLLA 1XR1A 1BLXA 5IQBA 2IW8A 3LFCA 1V1KA 4BCIA 5HX6A 4JG6A 2GFSA 1SNUA 3O8PA 3OOMA 2NPQA 2PMLX 3F3UA 5GZAA 3R9OA 4FTNA 3OBJA 4TTHB 5J9YA 1WBTA 4WRGA 4C3RA 4NTSA 4XLIA 4II5A 4U3YA 2IPXA 4FIJA 3WYYA 5T68A 4FI1A 4S31A 3RAWA 3HUBA 3OXTA 2WEIA 4MH7A 1B39A 4FKJA 4KIKB 3LXLA 3MIYA 4OTQA 4XYFA 4KWPA 3TN8A 3ZFXA 3NX8A 4IM0A 3O71A 3MH1A 3CBLA 4M0ZA 2WEVA 4YZDA 3TNIA 4O27B 3BELA 1H00A 4D2SA 3FZRA 3BU5A 2UW5A 3ORMA 2YWVA 2R9SA 3ZLWA 2OJFE 4D1SA 3DBFA 5K0XA 5DH3A 4LGGA 4CKIA 4JRNA 5IA2A 2ETKA 4HCTA 3WF8A 5F95A 3BIZA 1KE7A 4CG8A 4Y46A 4M7IA 2HW7A 4QP1A 3NYXA 3NIEA 4WG4A 3MA3A 3PXFA 5IA3A 5IQEA 4A9YA 3FQEA 1DAYA 1DS5A 5ANOA 3QLFA 4F9BA 5BVNA 2C6TA 2HELA 2OWBA 4YR8A 3ORTA 2OH0E 4XNEA 5IQDA 1Y6BA 2R3OA 3FQSA 3PXRA 3SDJA 3VC4A 2YZLA 3I4BA 2JKMA 5CS6A 3UIUA 3UTOA 2OJGA 4AUAA 2REIA 3OY1A 4BCKA 5A4LA 1G8SA 1BI8A 3CSVA 3LJ2A 5KO1A 4C59A 4WSQA 2OIDA 2GQSA 3KMUA 4DEAA 4IDVA 2FYSA 3EQBA 3RK7A 1RJBA 3H10A 3WIGA 4Y5HA 4RX5A 4NKSA 3DBCA 5FXRA 4HVGA 1Q97A 5M06A 4L46A 1QL6A 2CNQA 1YKRA 2XNMA 3MN3A 2QHNA 3VS5A 5KE0A 2IZTA 4FOCA 3R8ZA 4USEA 5CX9A 4C02A 4BRXA 4F4PA 4LOPA 4QQCA 3SD0A 2FSTX 3B2TA 4IM3A 4K11A 2O5KA 3D7TA 4TN6A 1OBGA 1OVEA 2OICA 2BTRA 3TZ8A 4AN3A 5GIOE 2O0UA 4IANA 1IA9A 3GU8A 4G6LA 4EOOA 4IC7A 4CFMA 5C01A 3ZC5A 5DT0A 2GS7A 2ITYA 4MXAA 4D4SA 2WMQA 2YLFA 3IECA 2H34A 4IX4A 3ZLYA 4M68A 4ANQA 3OW3A 4FKQA 3FYKX 3KKVA 4D4RA 3MVHA 3Q2MA 1OIYA 3IPHA 3A62A 3QQGA 3DBDA 5E8XA 5J79A 4E1ZA 5IQAA 1OUKA 3PLSA 1KSWA 2YWPA 4QQ5A 1H27A 3Q3BA 2KTYA 4BCHA 1P4FA 2ZV8A 2XMYA 5FM2A 5J7HA 1W82A 5M09A 2X81A 4J8NA 2BUJA 3ET7A 3RAIA 1AGWA 4CV8A 4XOZA 5CEOA 3G15A 3D5VA 5C26A 3DDQA 4V0GB 4IVBA 1DI8A 4AA4A 3DAJA 1WBOA 3UC4A 3QXPA 4U3ZA 5EI2A 4O0WA 3UG2A 5JEBA 4BY9E 3DTCA 2XNBA 2XK9A 4F7LA 2VNYA 3DK7A 4H39A 5J1WA 1Q5KA 4DH5A 4XV2A 3I6WA 3RJCA 4YP8A 4CFVA 5IPJA 4H36A 5EHOA 2ITVA 3LW0A 4FNYA 3F82A 4UZHA 1XH6A 2FSLX 2XJ0A 5D7AA 5E8WA 5CEMA 5E92A 3MH0A 4N6YA 2V5QA 3W2PA 1U5RA 2PVRA 3W33A 4BCMA 5CZIA 3UZPA 4QQTA 3COMA 4UWYA 1H24A 3BEAA 3F2AA 4DTAA 4IX3A 3OWLA 1K3AA 3OEZA 4BL1A 5D10A 2NP8A 3P4KA 1Q61A 3V5JA 4RLKA 4GK4A 1HOWA 2BDJA 2YAAA 5TKDA 3C0GA 3D7ZA 3LM5A 2Y6OA 5EM8A 4M67A 3VHKA 4CT1A 3G2FA 4ZTNA 4O38A 1GZKA 2QOFA 4G5JA 3TNWA 5EKNA 3BYMA 5L2IA 2A27A 2JKQA 3ELJA 4HGTA 2R64A 3S3IA 4GK3A 2CGUA 4W8DA 4Z55A 2HWOA 4ASDA 1J1CA 3NNUA 5M4CA 2BHEA 3A4OX 4P90A 5DE2A 3T9IA 4F1MA 4O7SA 4DTKA 2GNFA 3DBEA 3SOAA 3PWDA 4BDGA 5HLPA 4E26A 4NKAA 4PTGA 4I0SA 1M2RA 2X8DA 2HWPA 2KULA 2Y4IC 2G1TA 4IWQA 5FXSA 2OSCA 3MW1A 2QG7A 5EW9A 3QA0A 4HYIA 3SG8A 2OZAB 4G3CA 3POOA 2WMWA 3KULB 3IQ7A 1URCA 4E5AX 2R3FA 4BGHA 3PUPA 2VAGA 3WE4A 4TPTA 1DI9A 3ZMMA 2ZB1A 2EB3A 5BQ0A 4D2VA 2R3HA 4WD5A 5HTIA 3ZM9A 3P86A 4NU1A 3FL5A 3RBWA 4ASEA 4DFXE 1L3RE 3P7CA 2QLQA 4BDIA 4K77A 5GZ8A 4IB1A 2UZVA 3TJCA 1OM1A 1APME 2X4ZA 4AT4A 5ETFA 3OS3A 2GFCA 4HPTE 2R0UA 4X2NA 4C4FA 3CJFA 3I6UA 4P7EA 4ALWA 3NMUF 5L2TA 5AP2A 4W4WA 3LFBA 1ZRZA 3D5WA 3GNIB 5CXHA 5FWKK 2YN8A 2B53A 3E87A 3QYZA 2ITZA 3UP7A 4O86A 4K33A 5D9HA 4E5BA 4BDCA 2IZSA 4F65A 3DLZA 4AZEA 4HGEA 4R6VA 3P7BA 5CAQA 3BHVA 4RGJA 5GJFA 4C36A 1FMKA 1UKHA 4XRLA 4XP2A 2XYUA 5B2MA 3OC1A 3OCBA 4JBOA 2ZOQA 3NNVA 2ITXA 3L8VA 1R0PA 3QAME 3S4QA 3OFMA 3OD6X 4TYIA 1RQQA 4D0XA 5L2WA 3ORXA 4DH7A 3ORKA 5FBOA 1G8AA 3KXMA 2VX0A 3IDBA 5CI7A 1P2AA 3R1QA 3TNHA 1A06A 3GEQA 1YWVA 2W7XA 3KC3A 2O8YA 3VUMA 1U54A 3OG7A 4PPBA 3FZTA 3EFWA 4ZS4A 1R1WA 2JGZA 4FK6A 2PE1A 2ZJWA 3ORLA 4FKPA 3CTQA 3DZOA 2WHBA 4HGSA 4JI9A 4NTTA 2XA4A 2DWBA 4YZNA 4NL0A 5IQIA 1JWHA 1STCE 4FODA 1OIRA 4QMTA 4DFBA 5HE1A 2G15A 2YM8A 4G16A 3LAUA 4O1PA 5H9BA 1YHSA 2E9OA 4ERWA 3V6SA 5IEXA 4OBPA 2XK6A 4O6LA 3MFRA 5HE3A 2PZ5A 1YI4A 1W84A 2FH9A 2WQEA 2ERZE 3SHEA 3DXPA 3GQLA 1LUFA 3E8CA 3AC4A 5C8KA 3B8RA 2WU6A 1PY5A 4O91A 4DAWA 1H1PA 3F3TA 3TNQB 2QU5A 2WMUA 4GUEA 4WA9A 2R3LA 2YCQA 3P5KA 4D28A 2BILB 4J1RA 3I1AA 4EONA 3RNIA 5J9LA 3AC3A 3D94A 2YIQA 1UNGA 4FMQA 3QCXA 2VWUA 2XM9A 3PJ1A 3RPRA 2DQ7X 4J71A 3D5UA 2RF9A 2PVHA 3R7GA 3TEIA 5C1QB 1FMOE 4QMSA 4IVCA 4FNZA 4ZLZA 4MD8E 1ZARA 3FWQA 5GIPE 1CKPA 4KBKA 2WTDA 2VV9A 3LLTA 3LCKA 5CEQA 4QYYA 4YUQA 3V8WA 4MF1A 4EBWA 3VUGA 2O3PA 5E1EA 3UQGA 1WAKA 1Y57A 5A46A 3F2RA 5LMKC 1BMKA 2JEDA 1URWA 3IG7A 3SXRA 3DJ7A 5DYJA 2UW0A 4DFNA 3M2WA 2FO0A 4BI0A 4EHVA 3HGKA 5ETIA 2OF2A 5CU3A 3EN4A 3LHJA 5EYKA 3UYTA 2QU6A 2J0MB 2E2BA 4V05A 3AGLA 5EDQA 3CE3A 4C34A 4IM2A 4HZSA 1OL6A 4EJ7A 3QD2B 3OF0A 4B99A 3GGFA 4FV7A 4TNDA 2W1FA 3QL8A 4BCFA 4I3ZA 2Y7JA 4V04A 3O17A 1OL1A 3UNJA 3ZFYA 4UY9A 3FKLA 4AW2A 4LUDA 4EK3A 3KREA 1A9UA 3H9FA 1VZOA 3BQCA 4ZLOA 2GS6A 4FVPA 4DG0E 4X2GA 1OPJA 3HVCA 4EH5A 5HD4A 4KS8A 1H28A 1VYWA 4YBJA 4FKUA 3R8PA 4BGQA 5HZNA 5JGDA 5LMBA 4H3QA 1UU7A 3KFAA 2X7OA 4HYSA 3FV8A 4RIWB 1E1XA 2PZPA 1VEBA 4YHJA 4ZJIA 4BHNA 4C3FA 4XG3A 3P79A 3JYAA 3UDBA 4D4YA 2VN9A 3KN5A 2XCKA 2IVSA 3E93A 4WUNA 3V5LA 5LQFA 5DEWA 4GVJA 2WTVA 1NA7A 3I60A 2EXMA 4ZSJA 3GENA 4YJQA 5ACBC 1QPJA 4A9SA 4FTKA 3IDCA 4FKIA 3ZOSA 3ZBXA 4A4OA 5ITAA 1PYXA 2YM3A 4E4LA 4NM3A 4ANOA 3B8QA 1K2PA 4BBEA 2PULA 2BFYA 4WNOA 3FJQE 2V0DA 4RJ5A 5AX3A 4OTRA 3KXGA 4AGCA 1PXPA 1ZYJA 3NUAA 3KMWA 2OGVA 3PG3A 4L52A 3S0OA 1OIQA 2R3PA 5EOBA 4BCJA 1WVWA 4DF3A 4AZTA 5JFVA 5AR5A 2X6EA 4PMSA 4EK5A 2JKKA 5FDPA 3IONA 4IACA 2G2HA 5DBXA 5IUGA 3PJCA 3FSFA 4QP8A 2WQNA 2X2MA 3QX2A 3FKNA 5AUTA 2HZ0A 4G34A 1Q3WA 4GFOA 2BZKB 5L6PA 3RZFA 2HY81 3UOHA 1JPAA 2PZRA 5EHLA 3BLQA 3HV4A 2UVYA 3O96A 3TIZA 3ZXZA 4PP9A 4BTKA 4KAOA 4F0IA 2F57A 5FEDA 3ZRLA 3DAKA 3ORIA 4D2RA 3QWJA 4JLCA 2C30A 2OG8A 4O0YA 3H9OA 4YBKA 4ZTRA 4ALUA 4C7TA 5M51A 2G2FA 2VGPA 2P2IA 3NNWA 3CJGA 3FBVA 3GU7A 4U81A 3EFLA 4QT1A 4RC2A 2BDFA 3ODZX 3EQRA 1Q4LA 3R0TA 5H3QA 4HNFA 4KIOA 4ZY6A 3HUCA 4IAIA 2WOUA 4CZUA 3PDTA 3PZHA 1IR3A 3ZO1A 2W4OA 3QCSA 4X3FB 4K2RA 4YTHA 4DFLA 3TXOA 3UO4A 4EHGA 2VO0A 4TYHB 4AA5A 3C13A 3OWKA 4O22A 4RMZA 1WCCA 4WT6A 3IDPA 4PNKA 5CVHA 2VTAA 4ITIA 2QURA 5CSHA 5AM7A 2YITA 3CR0A 4K9YA 3OCSA 3UGCA 2HIWA 3ZZWA 4BZDA 2QR8A 4O82A 3UQCA 4FV8A 4GU9A 5JSMA 3G9NA 3O8TA 4DG2E 1KE9A 2XKCA 3CQWA 5I9UA 3ZDIA 4L8MA 1L8TA 4H3BA 4RVLA 4ERKA 3DQWA 3VS6A 4AQCA 4G2FA 4AZFA 2XNPA 4UV0A 5E8TA 4YO4A 3MDYA 3EHAA 5AUYA 3FHRA 3MA6A 4NIFA 3UIMA 1OL7A 4DEHA 4R8QA 5IDPA 4IZ5A 2R7BA 3R8UA 3SRVB 4Q5EA 4ZLYA 4EKLA 5EDRA 5TOZA 2YHVA 5AP3A 4EHEA 2XEYA 3DPKA 2CGVA 4AE6A 4BKZA 3SVVA 3F3ZA 4U44A 3RPVA 3HDNA 4CZYB 1ZOHA 2B54A 2VX1A 4E4NA 3QTWA 1NW1A 4PMMA 4XOYA 4CVAA 4OTPA 3ZC6A 5KMOA 5KMLA 4G3GA 4QMZA 3MI9A 4FEQA 4L01A 4PTEA 5G6VA 5K5NA 3UO5A 1M7NA 1QPEA 1YDSE 3F5GA 3GOPA 4JX7A 3GC7A 3L9MA 5AP0A 3ZZEA 4O84A 3LKMA 1JQHA 2C6KA 2UZBA 5AV2A 4B7TA 2ITWA 4OW8A 3I5NA 2QLUA 5M44A 4OAUC 1XKKA 4UYNA 3BE2A 1YWRA 2BRBA 3GXLA 4FKVA 1ZOGA 2PVJA 3Q9XA 1PHKA 5EG3A 1V0PA 2PVKA 4NFNA 4QYHA 4CV9A 2EUFB 4QMWA 1SMHA 4BIEA 2RGPA 5IMXA 1I09A 3FY2A 4FT3A 4QP4A 3FZ1A 5FQDC 3R6XA 2GQRA 1IEPA 1Q3DA 3VRZA 3Q5ZA 4QOXA 3MV5A 4YNOA 2BRGA 4AW0A 4GH2A 3HA8A 4UMTA 3E3BX 5D1JA 2CHLA 3MSSA 4J53A 2GHLA 4FUXA 5CU6A 4YJSA 3C4CA 4Q9ZA 3VAPA 3EYHA 5JFWA 4X6RA 2R3NA 3VIDA 4AFEA 2UZTA 4ZY5A 4FEWA 3A7IA 2PMNX 2W99B 1PKDA 2R7IA 2VGOA 4FZFB 4JOAA 4L67A 4R3PA 1UU3A 2J51A 4V0GA 5E8ZA 4IHPA 5J87A 2EWAA 4YZ9A 2JFLA 3FDNA 4HPUE 1GZ8A 1PXJA 3ZHPC 4BTFA 4QTEA 5CF4A 2OLCA 1ZMVA 5EQPA 1B38A 3OUNB 4I22A 4KABA 4USDA 1P4OA 5J1VA 3NNXA 4BWXA 5A4CA 3VJOA 3K3IA 4D9UA 4FSTA 5KHXA 4F64A 2R3QA 4L7FA 4NW6A 4G17A 5J7BA 2CNUA 3FXZA 2EXCX 3NSZA 1WZYA 2JLDA 4FL1A 3AC5A 4JIKA 3GUBA 4EZ5A 3D14A 4FKGA 5E8SA 3ZYAA 4BN1A 5AR4A 3QX4A 3NPCA 4XP3A 4A06A 3AT2A 2BKKA 2PUIA 1Q41A 2PSQA 3D83A 4AGDA 4F99A 5BYYA 5HG7A 4DEBA 1YXUA 4EK4A 1Q24A 3NCZA 3KRLA 4USFA 4DTBA 4LRMA 1OUYA 1IAJA 4O83A 3R9RA 4IADA 5CZHA 3WI6A 2WTKC 3EYGA 4UWBA 5JN2A 5ANEA 4OT6A 2E9UA 3MBLA 3EQIA 4BBFA 3UOKA 4FG7A 2ZV2A 3HDMA 4K18A 3DJ5A 2QQ7A 5AX9A 3R8VA 1XH4A 2B52A 3TI1A 5L4QA 2I6LA 3FKOA 2JAMA 4FEXA 2UZOA 3QD4A 3NCGA 4EJNA 2UZUE 2UW4A 4IWPA 3A4PA 3C5IA 3UNZA 2QOBA 3NUNA 4MNEA 5CSWA 4AS0A 4LOOA 4QTDA 4WG5A 4A9UA 4LM5A 2YJSA 1W7HA 3C0IA 4GMYA 5BUIA 3KULA 2PPQA 2YZAA 3SA0A 3AMBA 1J7UA 5I9ZA 4XV1A 3L8PA 3TKHA 1YXVA 4DFYA 2YM5A 3JY0A 4F6UA 3PA5A 2VRXA 4MX9A 3TWJA 4XCUA 2C6IA 3FXWA 2YJRA 3KN6A 4ACCA 3U9NA 4BIDA 4N4SA 4NSTA 2I0HA 4QMMA 5HTBA 4G1WA 4DT9A 5M4FA 2Y6MA 3K5UA 3QQFA 2ACXA 3PVGA 3HMPA 5LOHA 3GC0A 2IWIA 4CYJA 3QCYA 2B9HA 1YHVA 2HAKA 3GI3A 4ZMEA 4MXOA 2XIKA 4EI4A 4E5WA 4F0FA 3IOKA 1BL6A 5CTPA 3R9NA 4OUCA 1YW2A 5E8VA 3V5PA 5CEIA 5EM7A 3SX9A 4RWIA 4BC6A 4D2WA 2GDOA 3KRXA 3PVBA 3ETAA 4FKRA 4YSJA 1ZYSA 3NUYA 2C3LA 2BR1A 3MH3A 5C03A 3MVMA 3VW8A 4H1MA 4CFUA 2BFXA 4D1XA 3JVRA 1OKVA 4AACA 4RIXB 4O0SA 2C69A 2VUWA 4QMPA 1PMUA 4D1ZA 3LCDA 5E7RA 2VWIA 2GQGA 3NW5A 4Y83A 5HBHA 4Z16A 3M11A 3NDMA 3UIBA 1H01A 3OEFX 5DT4A 3W2SA 4WSYA 4NFMA 5DR9A 4YSMA 4HVDA 3MS9A 4C37A 2HZNA 4F1OA 2QKWB 2Z7RA 3V5QA 1GY3A 4AW5A 2UVXA 4FKOA 4KS7A 2B55A 2WTJA 1GOLA 3VUKA 5A3XA 4CQGA 4KRCA 4M97A 3HP5A 4R7HA 4PQNA 4A9TA 3AQVA 4EZ7A 5L2SA 3BHTA 1OPLA 4IZYA 2ZAZA 4IAAA 2VWZA 1SVGA 3QA8A 3RM6A 2QO9A 3RCDA 2ZYBA 3ZCLA 4EK8A 1F3MC 5LJJA 1FVTA 4BCGA 4FA2A 3RAHA 2I0VA 4A4XA 3EOCA 3NR9A 4JNWA 1Q8UA 2HK5A 3FI4A 4KKHA 5HNGA 5HVJA 4F70A 4DT8A 3MB6A 3C9WA 5LWNA 3F61A 4NUSA 2Z2WA 2C6DA 2X0GA 3II5A 5M53A 3GCUA 2J2IB 4U40A 1FQ1B 2JDTA 4ZP5A 1KWPA 4ACHA 3FMDA 4LGHA 2CCHA 3IW8A 3SOCA 5KBQA 3VBVA 4JDKA 4LL5A 3TIYA 3PY1A 1M17A 4KKEA 2R3RA 2W9ZB 4X2FA 5E8UA 4D58A 4CTBA 3O2MA 3QZIA 2QONA 4FK3A 2QCSA 1KUTA 1FOTA 4U45A 1OL2A 3I79A 4FSUA 3R02A 2V7AA 1PXKA 1CDKA 4FSWA 2LGCA 5ANDA 3UPXA 2BAJA 2R3GA 3QALE 5I4NA 1VYZA 2J50A 2JC6A 3PY0A 4NCTA 1IAHA 3U54A 4PP7A 1JBPE 2WFYA 1JOWB 2ZM1A 5K9IA 4O7ZA 5K3YA 2J5EA 4OTHA 5DMZA 3F7WA 5TT7A 2A0CX 3Q53A 3QQLA 2JFMA 4G5PA 4QMNA 4MD9E 4YTCA 3P7AA 4FX3A 2OI4X 3NYNA 3ZSGA 2QI8A 3EKKA 2BHHA 3CQEA 2OKRA 4D4VA 1Y8YA 4XX9A 4F0GA 4C57A 4ZXTA 3L8SA 2XS0A 5AV1A 3L8XA 2NRUA 2PWLA 4I23A 4LOQA 5BVKA 3MY5A 3MY0A 4IXPA 4K8AA 1UWHA 4ZIMA 4C3PA 4RFYA 4QNAA 2AC5A 4EOKA 5CF5A 2C6LA 4ACMA 4MAOA 4BYJA 1H1QA 4AG8A 5G1XA 4XS2A 1KE6A 3MTLA 3L9LA 3SXSA 5I9XA 1ZAOA 3PLAE 2QOCA 2YIYA 2VX3A 3IKAA 4FVQA 5IA4A 5E4HA 4CCUA 3IGOA 3DB8A 4QMOA 4PDOA 2P3GX 2PVYA 1P14A 2UZNA 3SAYA 2G9XA 2HXQA 4PDYA 5A4QA 3E63A 4FIIA 5CASA 5JKGA 2B1PA 4S32A 2VTIA 3JVSA 4TWCA 5M55A 4DC2A 4A7CA 3IO7A 4YC8A 3E8EA 5DGZA 4CLJA 5KMMA 4DITA 2UVZA 4MXYA 3GC8A 4TYEA 3C4XA 4I20A 1E1VA 1R0EA 4G31A 4CFNA 3BHHA 4EYMA 1JSUA 5EM6A 2W1EA 1H0VA 3EQHA 4V01A 4JDIA 3CQUA 1SVEA 3F7ZA 3PXZA 4C58A 1TKIA 3C1XA 4QRCA 4RWJA 3W1FA 4F9WA 5KCVA 3Q5IA 3UNKA 3GB2A 2R0IA 5FEEA 5CU2A 5CQUA 4LG4A 5AM6A 3I7BA 3TT0A 3LQ3A 2YIXA 2ITNA 2XCHA 4XG8A 4NWMA 1FINA 4A9RA 2I7QA 3ZXTA 3GCVA 4XMOA 1RW8A 3OT8A 4UMRA 1PMEA 1XBAA 3MPMA 3QQKA 4KRDA 4L43A 5E8YA 4AZVA 2F2CB 3WZKA 4ACDA 4BDAA 4D0WA 3CTHA 3CEKA 3CTJA 3H0YA 4YJUA 5JRSA 2CNVA 5FDXA 4EQUA 1WBPA 2XIZA 2R2PA 4FZ7A 1JKSA 4RLLA 5AP6A 4CNHA 5HIEA 4IJPA 2UZEA 4JR3A 4C61A 3S1HA 4IAZA 3MVLA 4GG5A 4TW9A 5GNKA 3HKOA 4CRLA 5I0BA 2DYLA 4F9AA 4QNYA 5T6KA 3FXXA 2XRWA 3CY2A 2C5YA 4QPAA 4B8LA 3PY3A 3F5UA 3U4UA 5HD7A 5AUXA 2F2UA 4UMPA 5HG9A 4AZSA 3G9LX 4NM0A 3UQFA 3EKNA 5CY3A 2BZIB 4RPVA 3SG9A 3BU6A 4BZNA 1WVXA 3RPOA 4CT2A 4ZSGA 4O7VA 4XJ0A 4C33A 4NZWB 4J8MA 4PL4A 4MF0A 5JGBA 3Q4UA 3RNYA 4BZOA 5IA1A 3S95A 3FAAA 4RX9A 4C4EA 2VWVA 4ZTLA 2OJIA 4JIAA 4BDFA 3JR1A 3UG1A 4QMYA 1OIUA 4RFZA 4E20A 4IW0A 3UOJA 4YJVA 5DR6A 3QRIA 3TV4A 3V6RA 4TYHA 3VN9A 2QOLA 3AC1A 2RIOA 4CQEA 3FLZA 3L9NA 4FTUA 2OZOA 3SV0A 3F88A 4DH3A 3LJ0A 2W9FB 2UW7A 3UZTA 1NVSA 5M07A 4R7BA 1H0WA 5EW8A 3AOXA 3F5XA 4B9DA 3E8NA 2XVDA 3QHRA 4KSPA 1GJOA 3Q9WA 4U0IA 5HG8A 4Z7GA 5BVDA 1PXLA 3EQFA 2J5FA 3EZVA 3M1SA 4JXFA 2NRYA 4W4VA 3ID6C 5HO7A 5JMSA 4E6AA 3LZBA 2CJMA 4XG7A 5LVPA 3RHKA 5KMKA 1KE8A 1GZNA 3CXWA 4FZ6A 5ANJA 3V51A 4U43A 5AAFA 2IJMA 2WQBA 3DOGA 4FGRA 3C7QA 4TXCA 3G0EA 3EZRA 4QYGA 4UXQA 5BUEA 4O0TA 4UX9A 3PSDA 1W83A 2HW6A 2ZDTA 2WTWA 4NH1A 1WFCA 1YDTE 3ALNA 3ALOA 2J9MA 4DGMA 1NXKA 1Y8GA 4EOPA 5ANIA 4C38A 2W1ZA 4LV5A 5E9EA 4YGAA 2ZMCA 4DA5A 5AJQA 3DTWA 4QP9A 2XM8A 5BVWA 5LVNA 3Q4TA 4AU8A 2RFSA 5BUJA 5J5TA 1FVVA 2WU7A 4OTDA 4FKSA 4PPCA 3MJ2A 4WNPA 3FZOA 5FXQA 3ZH8A 3MVJA 4EOQA 2XRUA 2J0JA 5A6NA 2XYNA 3ANQA 3OT3A 4DE4A 3ATTA 2HY0A 3ZRKA 3ZBFA 5CXZA 3QGWA 4MXZA 4S33A 4LMUA 2BAKA 2J4ZA 3D9VA 3WOWA 4BKYA 4M14A 2VTMA 2IG7A 3GBZA 4QO9A 3FPQA 2GTMA 5IEYA 4CXAA 4ID7A 4QQJA 1Q8ZA 4F6SA 4ACGA 4M12A 4PDSA 1UKIA 3VVHA 2UZDA 4FV0A 2FSOX 1YHWA 4X2KA 4BDBA 4WNKA 4GJ3A 5A6OA 5HLNA 3H4JA 4M3QA 2JDOA 3FZPA 5AIKA 1FGIA 4QPMA 4FSNA 3WZJA 4UMQA 3N4UA 5CLPA 4ZZNA 5H8GA 2RFNA 2Y4PA 4EUTA 4K6ZA 1KOAA 3QRTA 4M69A 2ZB0A 4IDTA 2XBAA 2VU3A 3UO6A 2BRNA 4AFJA 2RKUA 3P0MA 4IQ6A 1OGUA 2J0LA 3PWYA 3L9PA 1KOBA 3FL4A 3Q6WA 2JIIA 3H30A 3DXQA 1S9JA 3FMLA 2YDJA 2QVSE 4RJ7A 3ZSHA 2G2IA 4EK6A 4IJ9A 4GK2A 2OIBA 3UZRA 3OCTA 3N51A 4RIYA 3ZO4A 5IG1A 4Z9LA 1MP8A 3HV5A 1PW2A 3QZHA 5IA0A 3QTIA 3R8LA 3ZO3A 2OBJA 5DIAA 3CS9A 5I9VA 4EH8A 3W32A 5HTCA 2R3JA 5AR2A 3LOKA 3IW7A 1VJYA 3HMOA 4L9IA 2WTIA 1IG1A 4LL0A 4UMUA 2J0IA 4BHZA 2VTPA 3MB7A 4ANMA 5CWZA 4HJOA 5DHJA 1CTPE 1MQBA 3H3CA 5HVYA 4O7NA 3NLBA 1R3CA 3MPTA 4J96A 2WMXA 3PPJA 4IAKA 3DKCA 4N0SA 3LJ1A 5F94A 3VUTA 3RWPA 4PRJA 5C8NA 4HCUA 3UODA 4JBPA 3HMNA 2E9VA 2Z7QA 4FEUA 2PZIA 5JFSA 4ZK5A 3Q4ZA 3KVWA 4ZTHA 3QUPA 5K0KA 3KXZA 2QNJA 4RX7A 5FBNC 4ONAA 5AUUA 3CPCA 3FLWA 4EH6A 3QD3A 5HOAA 4FNXA 3A2CA 4I6BA 2PL0A 2H9VA 2GTNA 3KMMA 3BLHA 1H25A 3Q9YA 4IX5A 4MCVA 1M14A 1REKA 1TQIA 2P33A 4EQMA 4WIHA 4P2KA 5IA5A 2JBPA 5FTQA 4ASZA 4KBCA 2PY3A 3E7VA 1FBNA 2BKZA 5CANA 4O7WA 4EUUA 3DK6A 3WILA 5KMNA 5EYDA 5BX0A 2YFXA 3QC9A 4X2JA 1LEZA 3R7UA 3C4ZA 2CKQA 4YLLA 1ZY5A 5E1SA 2V55A 4YTIA 4BCOA 3SW7A 5ACKA 2YDIA 4QP2A 5AP7A 4PMPA 3PPZA 4W4XA 2O63A 4MQ1A 4OBOA 2ITTA 4KBAA 2QD9A 3ATSA 4Y8DA 5C4LA 2Q83A 3ACKA 3Q2JA 4MKCA 4RT7A 1FVRA 3D7TB 3TKUA 5HORA 5AFVA 2JIUA 2O64A 3QD0A 2XK7A 3GU5A 4XG2A 2QKRA 1ATPE 3PXYA 5HVKA 3R1SA 3COKA 3RVGA 4F7JA 3NYVA 2W4KA 4U5JA 4EBVA 2VNWA 4FIHA 3QKMA 3PRFA 3FY0A 3KXNA 4LRKA 4XBUA 4F63A 4H05A 3R01A 2VWBA 4I0RA 3MIAA 4FTIA 4DINA 3NS9A 4MNFA 5I3OA 3GP0A 4RIXA 3VRYA 4RFMA 4JQ7A 2BTSA 4U42A 5IKWA 2CGXA 3FSKA 1YVJA 1UVRA 4GL9A 5JRQA 4O7TA 5HI2A 3MFTA 4NK9A 5AP4A 3EQPA 4LQMA 2PVLA 4C62A 5LXMA 2CN8A 5HCYA 4YZCA 2C3JA 2X9FA 3EN5A 2VO3A 3PP0A 5CAUA 3BKBA 5CQWA 4KD1A 4DYMA 3EWHA 3Q52A 1ZOEA 4MYGA 1CSNA 4QD6A 3VBYA 1PF8A 2CN5A 3DU8A 3C0HA 5F4NA 4KIKA 2HXLA 3V8SA 1HCKA 4FIGA 2X1NA 2ZMDA 4FTQA 1Q99A 4C35A 2HZIA 4UB7A 2CKEA 3MPAA 5HCZA 5LVOA 4O2ZA 4D2TA 2FVDA 4IZAA 4DBNA 2BZJA 1JSVA 2O65A 3NW6A 1BKXA 1WMKA 1G5SA 4FG9A 4ORKA 4PY1A 1OKZA 3P23A 5TE0A 3KF4A 3V3VA 4C4JA 4DN5A 4I5CA 4C4IA 3EQCA 3D4QA 5BVFA 1Y6AA 2QOHA 3R7OA 2PU8A 4Y73A 1TVOA 1MRYA 5HE2A 4E3CA 3MYGA 4FL3A 3COIA 4CKJA 4GU6A 1X8BA 5JQ5A 3CLYA 1OZ1A 2BDWA 3FPMA 3O7LD 3PJ2A 3VHEA 3WF6A 4D55A 4G3EA 4L68A 3NUPA 1DAWA 4MBLA 4CMTA 2W4JA 3BHUA 2C6MA 4BWKA 5L8KA 4C2VA 2WTKB 1GAGA 2FGIA 3OTVA 2W1HA 2XIRA 3FLYA 3IW4A 4FIEA 4S30A 5FTGA 4NCTC 5HQ0A 5L8LA 5DG5A 4E6CA 5KKRB 3ZDUA 3HMIA 4Z3VA 5IQHA 2QODA 2YCSA 2RG5A 3FUPA 1Z57A 1O9UA 2WMSA 2E9NA 4JQ8A 1GNGA 3NRMA 4ANNA 3FI3A 2C1AA 3MTFA 4XRJA 4RQVA 4HYHA 4FV3A 1HCLA 3C4FA 4IC8A 3O50A 4ZEGA 4RWLA 4GVAA 4NEUA 2W96B 5JH6A 4JDHA 2WMVA 4EWHA 2O2UA 4NT4A 4G3DA 1H1SA 3QF9A 4GG7A 3KCKA 4I92A 1YI3A 1JSTA 3RK9A 1XO2B 4AX8A 2C0TA 1UV5A 3UPZA 4F08A 1OECA 3R28A 4UBAA 3FLNC 2IZUA 3DS6A 3BWFA 5IU2A 2BRMA 4L44A 4I21A 3RGFA 3SXFA 3OWPA 3AT4A 4R5YA 4XV3A 2WTCA 1JVPP 2RSVA 3CGOA 4OLIA 5FUTA 1W98A 3ITZA 5CSXA 4QMQA 3BYOA 2FB8A 3QRJA 2VTTA 4DBXA 5CYIA 3ZUTA 2HCKA 2PE2A 2YLEA 3NGAA 2I1MA 4MQ2A 4DG3E 3KA0A 1NVRA 3GCPA 3QRKA 1O6LA 4M84A 3A8XA 3THBA 3U4WA 2CLQA 2IW9A 5LWMA 3AD5A 3AG9A 5D12A 2R3IA 5ANKA 3W16A 3RWQA 1RE8A 5T3QA 3POZA 3LMGA 4N57A 3IGGA 3BYVA 1BL7A 3RZBA 3BX5A 5HIDA 2DUVA 3PTGA 4AT3A 4EH9A 5CSPA 2PK9A 2CKPA 1KV2A 2CSNA 5BMSA 4ZTMA 1TQPA 3KF7A 4MVFA 3TJDA 1YXXA 4AOJA 3VO3A 5JFXA 2Z02A 3RM7A 4X6QC 2A19B 2WMAA 1XH8A 2R3MA 3D2IA 3LFQA 5TO8A 3W2OA 4CKRA 4EEVA 5KMIA 4O7RA 5FTOA 5JT2A 3LFFA 4ZY4A 3A60A 4O7YA 4IB5A 2PVMA 1BX6A 1FPUA 1U54B 3TCPA 1PXIA 5M57A 1T45A 4GIIA 4U79A 3NEWA 3UMWA 2BPMA 4FTLA 2RL5A 5L6OA 3BBTB 4EYJA 4BGGA 3QTXA 4RBLA 4L3PA 3V5TA 3PVWA 4YZBA 5DA3A 3DK3A 4PPAA 2HOGA 1V0OA 4DLIA 2AUHA 4IB3A 5K5XA 4DEEA 2XH5A 3OW4A 1U46A 2WO6A 4NM5A 5KNJA 4PMTA 4QPSA 3ULIA 1GIJA 2AC3A 4WBBB 3O8UA 1EH4A 1S9IA 3DCVA 5CT7A 4L00A 5HESA 1Q8WA 5JK3A 1QPCA 3JXWA 3BRBA 1F5QA 2VD5A 4AN2A 2OW3A 3F6XA 2QOQA 4X0MA 5I9WA 1IRKA 2VZ6A 3VF8A 5C4KA 5IUHA 5LVLA 4BKJA 2XNOA 3DBQA 3MWUA 1SNXA 1ZYLA 2W17A 2GSFA 4F1TA 4IVAA 3SQQA 4BBMA 4DCAA 3P78A 4D2PA 2YM7A 3QTRA 3Q32A 2YCFA 3DJ6A 3ZTXA 1H1RA 3JUHA 5GJDA 1PMVA 2YIWA 4KSQA 2F7EE 4XG6A 3ULZA 1LP4A 4HOKA 3C50A 4GKIA 3Q04A 4R1VA 3NAYA 5CU0A 3RPSA 2AYPA 2PTKA 2VTHA 4B6LA 3BGPA 3QFVA 1QMZA 4YJPA 1XH7A 3MY1A 3H9RA 3QWKA 4K0YA 4BFMA 5JZNA 1DM2A 3GVUA 1IASA 2VWYA 3G90X 1Z9XA 4AT5A 2ONLA 4FKTA 5DR2A 2OZAA 3WIKA 4Y72A 1ND4A 3HMMA 4WHZA 2B4SB 3RALA 3C5UA 3NAXA 1J1BA 4FL2A 3W10A 4YHTA 4CZTA 4KIPA 4P5QA 2I0YA 3VS2A 2CPKE 3R7EA 4KUJA 1OI9A 5DRBA 1ZXEA 3KXHA 5AADA 5AP5A 2QOIA 4PUZA 5DPVA 4R77A 4YU2A 2WMRA 4RZVA 1PXMA 2OJJA 2YIRA 5DEYA 5EM5A 3ORPA 4E6QA 3TTJA 5DRDA 4LFIA 3PXKA 3CKXA 4CYIA 5A9UA 2PUPA 5EYCA 3RAKA 4FG8A 3OY3A 4FR4A 3DY7A 3E5AA 5B2LA 4I41A 3D0EA 2XP2A 2NNWB 3W8QA 3I5ZA 2G01A 4DGOA 3PP1A 4AA0A 3T3UA 2WXVA 3DNDA 3GC9A 5BYZA 3SGCA 1YWNA 4DH8A 4AZWA 4MK0A 4YTFA 1MUOA 2C3KA 5IH5A 3KY2A 3TM0A 4R5SA 4DGGA 5KBRA 4QP6A 3PFQA 4FICA 4PL5A 5ETAA 5CAOA 5IQCA 2XUUA 2X4FA 5B7VA 4EOSA 1REJA 2VTRA 3AD6A 5I3RA 4YO6A 2J6MA 2VWXA 4HVSA 4XEYA 4RJ6A 5HU9A 4ZSEA 4LUEA 4JBVA 4XG4A 3EL7A 3VS4A 3BBWA 2YCRA 3OUKA 5HBEA 3EFKA 3FZSA 5M08A 4DFUA 4R3RA 5AUZA 4BYIA 4AWIA 1OPKA 5TR6A 1PRYA 4QYFA 2BROA 3ZUVA 5L8JA 3U51A 2PVFA 4FSQA 2C68A 2PE0A 3EFJA 3FHIA 3ZEPA 3E62A 4OR5A 2UW9A 4BDKA 2J7TA 3Q9ZA 1ZY4A 3CC6A 4BI2A 2ZM3A 5F1ZA 3V01A 5HU3A 4YNEA 3R7VA 3CCNA 4RVTA 1TQMA 3BCEA 4LRJA 5CAVA 4IAYA 1W0XC 4NYEA 1JKLA 4EL9A 5GZ9A 2PZYA 3O0GA 1BYGA 3EIDA 1R78A 3VS0A 3RMFA 3LE6A 4I6HA 3DDPA 1IA8A 1T46A 2OIQA 4CGAA 4WRSA 3U9CA 5EDPA 4MBIA 3U6HA 1H1WA 3EJ1A 1UU9A 3FI8A 2XK3A 2Z60A 2JDSA 3C4EA 3K2LA 3N9XA 2C6OA 3DFCB 3HAMA 4DH1A 3ENMA 1YXSA 1H4LA 3ROCA 3KRWA 3D2KA 4G6NA 1U5QA 5EH0A 4L3JA 5J9ZA 2YAKA 4YJRA 4G3FA 4YHFA 4I5MA 3VS3A 4APCA 4EZ3A 4IMYA 3HV7A 3CIKA 4RJ4A 4ITJA 2VTNA 2C47A 4GS6A 1J91A 2C1BA 3F2NA 3DA6A 4OTGA 3Q4CA 2JAVA 1UNLA 4QP7A 2BCJA 5A4TA 4GJ2A 3BV3A 2QO2A 3FMEA 5HEZA 3UJGA 3GU6A 2Y4IB 2YDKA 3M42A 4PL3A 3TTIA 3QQJA 1PKGA 1YOLA 2DS1A 4FSZA 4BB4A 4FKLA 4IH8A 2P2HA 2ITOA 2JD5A 3HX4A 4IX6A 2UV2A 3V04A 3GOKA 3FLQA 5EK7A 3KXXA 4FV5A 4TRLA 3E92A 2OF4A 3WF7A 3LMIA 3ODYX 5ICPA 3R71A 3UBDA 3RCJA 1I44A 1SZMA 2BZHB 3G51A 3R2BA 4YPSA 5EKOA 2BALA 4NIFB 4U7ZA 4FTOA 3QZGA 2F9GA 2PUUA 4IFCA 2B7AA 3A99A 4W8EA 1H26A 3ZSIA 4CMOA 4U9AA 5LARA 3BI6A 4IWDA 4AP7A 4F7NA 2XNGA 4WUAA 3ORNA 1WBWA 2B9JA 3D15A 4QTCA 4UYAA 3NUXA 2R3KA 3QU0A 2GMXA 4YC3A 3VBWA 1YRPA 3QRUA 4RWKA 4W9XA 4RIWA 3MJ1A 1XBCA 4U8ZA 2Y0AA 3WZEA 4C2WA 3LCSA 3OTUA 4AOIA 3LXPA 4CFFA 4X3JA 1U4DA 3WE8A 3I81A 2YACA 3P9JA 2WNTA 4MHAA 4QMLA 3PZEA 4YC6A 1KE5A 3R9HA 4GIHA 3QKLA 4RIOA 2VTOA 2X7FA 2IZRA 4QMUA 4HGLA 4TZRA 5AR3A 4FTAA 4CCBA 2CDZA 3KL8A 3BU3A 3H0ZA 5AV3A 2C5XA 4IB0A 2VO7A 3TNPC 3FEGA 4D9TA 5EI6A 4WO5A 5H8EA 2P55A 4DGLC 2W05A 5CVGA 4EOJA 4AGWA 4JL9A 4YJOA 2WELA 2WD1A 3BZ3A 1YOMA 4IFGA 3F9NA 3GFEA 3AMYA 4FV2A 4TKSA 5DLSA 5I5ZA 4FTJA 3IOPA 2C5VA 4JRVA 4E73A 5A14A 4QP3A 4FBXA 4YLJA 5HLWA 3OBGA 4A07A 1JKKA 3F3VA 3LMHA 4BTMA 4PF4A 1ZMWA 2WQOA 2SRCA 3DGKA 2GHGA 3VUDA 3DQXA 3LFAA 4TYJA 3WF5A 4ZMFA 3G33A 5GHVA 3ZUUA 1OL5A 4FVRA 3E3PA 3F69A 3RINA 2OFVA 3EB0A 4RA4A 2UZLA 5EQEA 3C51A 2UUEA 3MFUA 4EH3A 1U59A 3OCGA 4CFXA 1R39A 2YERA 2W1GA 1QCFA 3LXKA 3OVVA 2VO6A 4TNBA 4CSVA 3FC2A 3LVPA 5HO6A 3ANRA 1H07A 4AOTA 4B4LA 3PA3A 4FYOA 1WVYA 2WMBA 2J0KA 3OWJA 3QGYA 1H8FA 3EQDA 4JT3A 4AW1A 4JQEA 5FM3A 3TZMA 3BGZA 3CPBA 5IZFA 3R04A 3VJNA 2H6DA 3MGYA 4OTWA 3TL8A 2R5TA 3UMXA 4ASXA 3O23A 4DFZE 4BDJA 5K4IA 4FE2A 5IMEA 3R21A 2WB8A 2FA2A 3W18A 4L3LA 3A7JA 4D5KA 3DLSA 3NWWA 4X3FA 5IISA 1ZLTA 4MD7E 1SM2A 4AGUA 4TWOA 2W5HA 4MWIA 4D5HA 1A48A 2ITQA 2VTJA 3FMKA 1G3NA 1YDRE 3JY9A 3QCQA 4CLIA 2WMTA 5FGKA 2H8HA 2W5AA 4IZ7A 4MTAA 3HP2A 3RHXA 4F7SA 2GNJA 4UWCA 2OH4A 3A8WA 2C6EA 2GNHA 1PJKA 2PMIA 3DXNA 2BAQA 4QTBA 4XV9A 5EW3A 1Q8TA 2WGJA 3A7HA 3FMJA 4I5HA 3SRVA 4IVDA 4NW5A 4ZS0A 4I6FA 2X2KA 2X39A 4FV1A 4MNEB 5H8BA 2B0QA 4H3PA 1LEWA 2XK4A 4FZAB 4IBMA 5FP5A 4L6QA 5IUIA 4RSSA 3GCQA 2J90A 2W0JA 2Z7LA 5L3AA 1XH5A 3TUBA 3SKCA 4CD0A 5EI8A 1J7IA 4ZJJA 4CMUA 4JR7A 2ETRA 3VUHA 2A4LA 4LI5A 3UVPA 3HECA 4E7WA 2QOKA 3LQ5A 5FEQA 4QTAA 2WKMA 3NW7A 4BVUA 4N6ZA 4DCEA 3LQ8A 5HNBA 5IF1A 4IE9A 4R3CA 3VBXA 1NVQA 3I0OA 1JNKA 3FQHA 3ZFMA 3GCSA 3NIZA 5AUVA 5GJGA 4FSRA 4AXAA 2GU8A 4ZAUA 2XK8A 1XH9A 2GCDA 1Z5MA 5HCXA 4FF8A 4ZZMA 2XJ1A 4E8AA 4F6WA 4OT5A 3PVUA 5DVRA 4HVIA 3OZ6A 5CU4A 3SLSA 3FLSA 3BGQA 4J99A 5IQGA 4O0UA 5AV0A 3K54A 4JS8A 4U97A 4XUFA 5C8MA 3T8OA 4APPA 4C8BA 4O81A 2FSMX 4FSMA 5KUPA 4AAAA 2ZVAA 3R63A 2QHMA 2ZV9A 5CNNA 1WBSA 5AR7A 4DEIA 4I1ZA 4O0VA 3KU2A 4O21A 1AQ1A 2YM6A 3DKOA 4IEBA 5AA8A 2XIYA 4I4FA 4R1YA 5E90A 2X8IA 2BIKB 5DT3A 3VUIA 3HL7A 5CF6A 3PJ3A 4KKGA 3QHWA 4FV6A 3W2QA 3QTUA 2JKOA 3CY3A 4E93A 2QG5A 3AD4A 3K3JA 1OKWA 3PG1A 5FP6A 4XBRA 2GPHA 3QUDA 3G6GA 4RJ3A 4XH6A 4C0TA 5I9YA 3TDWA 2Y8OA 2Q0BA 1MRVA 5CVFA 4O0XA 5CI6A 3JPVA 3KGAA 4I6QA 3KEXA 2B9IA 2WQMA 3BHYA 3QTSA 4X21A 3T9TA 1ERKA 2WZJA 3UYSA 3VBQA 1GIHA 3TDVA 4J95A 5A54A 5IH4A 3AXWA 1F0QA 3HYHA 3EQGA
chains in the Genus database with same CATH superfamily
4XHKB 2WIPA 3IS5A 5BVEA 3E7OA 3K5VA 4BDEA 2ITPA 3O51A 1MQ4A 2I40A 3QQUA 3NUUA 4GKHA 2CCIA 1ZYDA 4PWNA 4FUYA 2W1DA 2LAVA 3DB6A 4PTCA 1J7LA 1K9AA 3ACJA 2BIYA 4FNWA 4J52A 3RPYA 2X2LA 1AD5A 3G5DA 4JAJA 5FLFA 4BTJA 3F5PA 4RVMA 4WBOA 3BEGA 2IO6A 3P08A 4GSBA 3BQRA 5FD2A 2IVVA 1YOJA 2VTSA 5C9CA 3DKFA 1XQZA 3LIJA 4DHIB 1M2PA 3FMNA 4M15A 4WG3A 3HEGA 3R7YA 3PA4A 4G6OA 4YJTA 3NVMB 1E9HA 5BYLA 3QLGA 4I4EA 5CNOA 3HAVA 4TWNA 2A2AA 3EL8A 4E4MA 5IDNA 4FTCA 3VS7A 3WF9A 1JAMA 2XF0A 4M13A 3PPKA 3VULA 4HZRA 4BDDA 2JDVA 1LR4A 3GQIA 3BWJA 2W1IA 4FT0A 4XP0A 3ZRMA 3U6JA 4EC9A 5AMNA 3ZU7A 4EKKA 1NT2A 4FZDB 5KHWA 1UU8A 5EFQA 3QTZA 4BF2A 2EXEA 2QO7A 5M56A 1BUHA 1P5EA 4GCJA 3ZLSA 4ALVA 5AA9A 3AGMA 4FOBA 4QMVA 1CM8A 3AC8A 4WKQA 1PYEA 1MRUA 3AT3A 5M4UA 2ONLC 4FGBA 4ZJVA 1H08A 2C3IB 4GFMA 1M52A 3BPRA 4GUBA 1OB3A 4I5PA 4AE9A 4EH4A 2CKOA 3PIYA 4FV4A 4EH2A 3BYSA 1WBNA 2ESMA 2H96A 4QEBA 4UALA 3PIZA 3REPA 4F9YA 4G9RA 1YQJA 5ANGA 2Y9QA 4U6RA 1ZZLA 2X8EA 1UWJA 1ZWSA 2CLXA 1LPUA 4RZWA 4G9CA 3R1YA 4H58A 5DN3A 2V7OA 3TKIA 3VW6A 4E6DA 4LMNA 4W9WA 4BICA 4RX8A 2XAMA 1Q62A 4LV8A 2OXYA 2E9PA 2XKDA 3UIXA 5FG8A 4EHZA 5M4IA 4F78A 3UVQA 4R7IA 2X7GA 2XNEA 3A7GA 5CEPA 3VWAA 2UZWE 4QYEA 4R78A 2XBJA 4TWPA 3Q6UA 4FV9A 5CT0A 4IAFA 4M8TA 5LVMA 3LLAA 2W1CA 1WBVA 3HZTA 3LFEA 4KNBA 5BPYA 2YABA 3R30A 4Q2AA 1CKIA 4ZSLA 3U55A 5DNRA 2P0CA 3FMHA 4ZSAA 1UA2A 2C0OA 4TYGA 3LCOA 4ZTSA 2WAJA 2YEXA 3N4VA 3VQUA 3KQ7A 3S00A 4AF3A 2IVTA 4ARKA 3PE1A 2W06A 2ETMA 3G0FA 2OK1A 3S2PA 3UDSA 2QOOA 4DLJA 1V0BA 1OMWA 2ITUA 4O6EA 2GNLA 3TV7A 1XBBA 1NY3A 4P4CA 4IWOA 2VTLA 3GFWA 4WNMA 5HKMA 2QR7A 4FTMA 5BNJA 4ZTQA 4EWQA 2EVAA 3EN6A 2X9EA 4BCNA 2YM4A 2VWWA 3LCTA 5HO8A 3ZONA 2F4JA 4Q5HA 4EH7A 5KZIA 1GZOA 2QC6A 3FMMA 4HCVA 5JQ8A 4O96A 2XNNA 4EOLA 3A61A 5H2UA 3OP5A 3R8MA 4FEVA 4MBJA 3W2CA 2C5OA 1BI7A 4GEOA 2I0EA 1SYKA 2R4BA 5J8IA 3U87A 4FTRA 3QTQA 4J98A 4KA3A 3PYYA 3IK3A 2JITA 4Q9SA 4U41A 5DWRA 3Q60A 4K1BA 3ERKA 5J95A 1O6KA 5A4EA 2JIVA 4YURA 4F09A 3GT8A 4X7QA 4KB8A 4MUQA 3DFAA 1FGKA 2EB2A 2PYWA 2ERKA 3MH2A 4NJDA 3C4WA 4GT5A 3KB7A 5BMMA 2UW3A 4Y5QA 3OMVA 2FUMA 2EU9A 2RFDA 4JVGA 4BCQA 4LDTA 2XB7A 2B9FA 3KRRA 4GT4A 2ZM4A 5C27A 3DAEA 1M2QA 5AEPA 3TUCA 4XLVA 1XMMA 3ENHA 5HBJA 4EORA 4J7BA 2OU7A 2OXDA 4MXCA 1KV1A 4GYGA 4I94A 2WIHA 4M0YA 1RDQE 4CG9A 4Z7HA 3RI1A 4OTFA 3TG1A 4YMJA 1ZZ2A 3IW5A 4B8MA 3CP9A 5F20A 4DEDA 4JX3A 2GNIA 4TT7A 2IW6A 3Q96A 4BDHA 4XG9A 4A4LA 2JBOA 4IIRA 5BVOA 3KK9A 3R7IA 3VQHA 3BYUA 3LFDA 2Z8CA 1Y91A 4BCPA 3ZO2A 3KRJA 5D7VA 2HENA 3MESA 4S2ZA 1VR2A 2V22A 2OXXA 3CD8A 2P4IA 4O1OA 3ZM4A 3UOLA 5JZJA 3I7CA 3NFFB 3KCFA 4L45A 3LPBA 3PSCA 3ZLXA 3LFNA 4ANBA 4ITHA 1XJDA 5ETCA 3WARA 3QYWA 4HVHA 4LYNA 4RQKA 4UN0C 4JAIA 4BI1A 2Q0NA 3OHTA 4YJNA 3P1AA 5AIRA 4M66A 4FKWA 2RG6A 1CMKE 4FTTA 4NJ3A 3T3VA 3UP2A 3R1NA 3WYXA 3R2YA 2OO8X 5J5SA 3NZ0A 2HYYA 3AMAA 4LGDA 4RA5A 4RC4A 3HRCA 5HGIA 2YA9A 3W2RA 5LMAA 4RRVA 4U80A 2BMCA 3EN9A 5HNIX 3TZ9A 4TL0A 1PMNA 4O4DA 2JDRA 2BVAA 4ANLA 4ANSA 3KK8A 5IEVA 3KIOC 4H1JA 2IN6A 5EYMA 3OXIA 3TACA 4OAVB 3MFSA 3GU4A 4HNIA 3R9DA 5E91A 1JLUE 5D11A 3BV2A 4S34A 3TV6A 4MXXA 5CALA 3DV3A 4KIQA 3ZEWA 3HRFA 3DNEA 4YLKA 3UC3A 5CF8A 5KX8A 4ZOGA 1M7QA 2X6DA 4NM7A 3AC2A 3QC4A 4TY1A 4UXLA 3VS1A 4PV0A 3WZUA 1UNHA 5CEKA 2XZSA 4I93A 3HV6A 3QBNA 3PE2A 4OTIA 4CFWA 3B2WA 5EQYA 4DGNA 3FE3A 5JGAA 4HYUA 4L53A 4FYNA 1OBDA 4B0GA 3HV3A 3D5XA 4CTCA 5AV4A 3RTPA 3V5WA 2UW8A 3AKKA 4J97A 5CAPA 4ZZOA 2NO3A 4FSYA 1XWSA 4GT3A 4UZDA 1PXNA 2Z7SA 4Y95A 4M69B 4JJRA 4QMXA 4RG0A 1OITA 5L2QA 4C4HA 4O7LA 2YISA 3G6HA 4P5ZA 2PVNA 3QQHA 4EOIA 2VTQA 3OOGA 4JG8A 4ENXA 4BWPA 4HW7A 3EN7A 2HZ4A 2XJ2A 4I0TA 4BIBA 2C4GA 3SC1A 1SVHA 3F3WA 4W4YA 2XKFA 2F7XE 4PNIA 4JG7A 4RIYB 3ROYA 3ORZA 2W5BA 4FT7A 2CGWA 4DEGA 3LFSA 3QXOA 4O2PA 2C0IA 5AAGA 4MEDA 3R22A 3W8LA 1QPDA 1XHAA 3OXZA 3R00A 1J3HA 4JBQA 4PX6A 3LXNA 1O6YA 3JS2A 3PSBA 4X3FC 5DFPA 2PMOX 2WOTA 3OROA 2WPAA 3PJ8A 2PHKA 3EH9A 4FIFA 1W8CA 4GYIA 1ZYCA 5AWMA 3ZS5A 2C5NA 2GHMA 4GFGA 3FC1X 5D41A 5HIBA 5DI1A 5CSVA 5IQFA 3F66A 2F7ZE 5EHYA 4F9CA 5LMKA 5K4JA 5CENA 3SW4A 2XEZA 4GV1A 3DZQA 4L7SA 4O0RA 3WZDA 3O7LB 3RP9A 3PRIA 3DKGA 5KKRC 3CGFA 4N70A 4AN9A 3KVXA 1JKTA 3VF9A 4BR3A 5AR8A 5B0XA 4FC0A 3E8DA 1CKJA 3BLRA 4L42A 3N4TA 4RJ8A 4C4GA 3CD3A 3AKJA 2X0OA 3L1SA 4MWHA 3FI2A 3I0QA 3QKKA 2GS2A 2ZDUA 3BE9A 4JDJA 1YXTA 4KINA 3HNGA 5F9EA 5KMJA 3A7FA 3VBTA 5IH6A 3DT1A 2XKEA 1GIIA 4PDPA 3WBLA 2RFEA 3FYJX 4RC3A 5B2KA 2OJ9A 3W55A 5HICA 3CKWA 3U8WA 5GINE 1Q8YA 5L6WL 3IW6A 4GW8A 4WOVA 5LCJA 3E88A 1OKYA 5HHWA 3U6IA 2UW6A 3TUDA 2BRHA 4CEGA 3R83A 2A1AB 3RK5A 4Y85A 4ENYA 5DOSA 5HE0A 3UE4A 2F49A 3TZ7A 3NYOA 4YPDA 4I24A 1PXOA 2GNGA 4RVKA 4EQCA 4EOMA 4GRBA 5AAEA 4LV7A 4OBQA 5AUWA 5LCKA 2ZV7A 1ZMUA 5FRIA 2XIXA 3RKBA 3VNTA 4YZMA 5HG5A 4FT5A 3UVRA 3NVKI 3EMGA 4UEUA 5AP1A 1B6CB 3R73A 5TF9A 4CRSA 4EC8A 2PUNA 3PIXA 3NUSA 3E64A 2IVUA 4E4XA 1YI6A 4DHFA 4OGRA 2V62A 3LM0A 5KZ0A 2CMWA 3HRBA 3HA6A 5HX8A 3V8TA 5EOLA 2OFUA 3COHA 3PXQA 4FT9A 3QUEA 3QZFA 3HLLA 1XR1A 1BLXA 5IQBA 2IW8A 3LFCA 1V1KA 4BCIA 5HX6A 4JG6A 1VLRA 2GFSA 1SNUA 3O8PA 3OOMA 2NPQA 2PMLX 3F3UA 5GZAA 3R9OA 4FTNA 3OBJA 4TTHB 5J9YA 1WBTA 4WRGA 3BL7A 4C3RA 4NTSA 4XLIA 4II5A 4U3YA 2IPXA 4FIJA 3WYYA 5T68A 4FI1A 4S31A 3RAWA 3HUBA 3OXTA 2WEIA 4MH7A 1B39A 4FKJA 4KIKB 3LXLA 3MIYA 4O4FA 4OTQA 4XYFA 4KWPA 3TN8A 3ZFXA 1G8JA 3NX8A 4IM0A 3O71A 3MH1A 3CBLA 4M0ZA 2WEVA 4YZDA 3TNIA 4O27B 3BELA 1H00A 4D2SA 3FZRA 3BU5A 2UW5A 3ORMA 2YWVA 2R9SA 3ZLWA 2OJFE 4D1SA 3DBFA 5K0XA 5DH3A 4LGGA 4CKIA 4JRNA 5IA2A 2ETKA 4HCTA 3WF8A 5F95A 3BIZA 1KE7A 4CG8A 4Y46A 4M7IA 2HW7A 4QP1A 3NYXA 3NIEA 4WG4A 3MA3A 3PXFA 5IA3A 5IQEA 4A9YA 3FQEA 1DAYA 1DS5A 5ANOA 3QLFA 4F9BA 5BVNA 2C6TA 2HELA 2OWBA 4YR8A 3ORTA 2AEGA 2OH0E 4XNEA 3TYKA 1Y6BA 2R3OA 3FQSA 5IQDA 3PXRA 3SDJA 3VC4A 2YZLA 3I4BA 2JKMA 5CS6A 3UIUA 3UTOA 2OJGA 4AUAA 2REIA 3OY1A 4BCKA 5A4LA 1G8SA 1BI8A 3CSVA 3LJ2A 5KO1A 4C59A 4WSQA 2OIDA 2GQSA 3KMUA 4DEAA 4IDVA 2FYSA 3EQBA 3RK7A 1RJBA 3H10A 3WIGA 4Y5HA 4RX5A 4NKSA 3DBCA 5FXRA 4HVGA 1Q97A 5M06A 4L46A 1QL6A 2CNQA 1YKRA 2XNMA 3MN3A 2QHNA 3VS5A 2A98A 5KE0A 2IZTA 4FOCA 3R8ZA 3W0MA 4USEA 5CX9A 4C02A 4BRXA 4F4PA 4LOPA 4QQCA 3SD0A 2FSTX 3B2TA 4IM3A 4K11A 2O5KA 3D7TA 4TN6A 1OBGA 1OVEA 2OICA 2BTRA 3TZ8A 4AN3A 5GIOE 2O0UA 4IANA 1IA9A 3GU8A 4G6LA 4EOOA 4IC7A 4CFMA 5C01A 3ZC5A 5DT0A 2GS7A 2ITYA 4MXAA 4D4SA 2WMQA 2YLFA 3IECA 2H34A 4IX4A 3ZLYA 4M68A 4ANQA 3OW3A 4FKQA 3FYKX 3KKVA 4D4RA 3MVHA 3Q2MA 1OIYA 3IPHA 3A62A 3QQGA 3DBDA 5E8XA 5J79A 4E1ZA 5IQAA 1OUKA 3PLSA 1KSWA 2YWPA 4QQ5A 1H27A 3Q3BA 2KTYA 4BCHA 1P4FA 2ZV8A 2XMYA 5FM2A 5J7HA 1W82A 5M09A 2X81A 4J8NA 2BUJA 3ET7A 3RAIA 1AGWA 4CV8A 4XOZA 5CEOA 3G15A 3D5VA 5C26A 3DDQA 4V0GB 4IVBA 1DI8A 4AA4A 3DAJA 1WBOA 3UC4A 3QXPA 4U3ZA 5EI2A 4O0WA 3UG2A 5JEBA 4BY9E 3DTCA 2XNBA 2XK9A 4F7LA 2VNYA 3DK7A 4H39A 5J1WA 1Q5KA 4DH5A 4XV2A 3I6WA 3RJCA 4YP8A 4CFVA 5IPJA 4H36A 5EHOA 2ITVA 3LW0A 4FNYA 3F82A 4UZHA 1XH6A 2FSLX 2XJ0A 5D7AA 5E8WA 5CEMA 5E92A 3MH0A 4N6YA 2V5QA 3W2PA 1U5RA 2PVRA 3W33A 4BCMA 5CZIA 3UZPA 4QQTA 2IF8A 3COMA 4UWYA 1H24A 3BEAA 3F2AA 4DTAA 4IX3A 3OWLA 1K3AA 3OEZA 4BL1A 5D10A 2NP8A 3P4KA 1Q61A 3V5JA 4RLKA 4GK4A 1HOWA 2BDJA 2YAAA 5TKDA 3C0GA 3D7ZA 3LM5A 2Y6OA 5EM8A 4M67A 3VHKA 4CT1A 3G2FA 4ZTNA 4O38A 1GZKA 2QOFA 4G5JA 3TNWA 5EKNA 4AXCA 3BYMA 5L2IA 2A27A 2JKQA 3ELJA 4HGTA 2R64A 3S3IA 4GK3A 2CGUA 4W8DA 4Z55A 2HWOA 4ASDA 2XAOA 1J1CA 3NNUA 5M4CA 2BHEA 3A4OX 4P90A 5DE2A 3T9IA 4F1MA 4O7SA 4DTKA 2GNFA 3DBEA 3SOAA 3PWDA 4BDGA 5HLPA 4E26A 4NKAA 4PTGA 4I0SA 1M2RA 2X8DA 2HWPA 2KULA 2Y4IC 2G1TA 4IWQA 5FXSA 2OSCA 3MW1A 2QG7A 5EW9A 3QA0A 4HYIA 3SG8A 2OZAB 4G3CA 3POOA 2WMWA 3KULB 3IQ7A 1URCA 4E5AX 2R3FA 4BGHA 3PUPA 2VAGA 3WE4A 4TPTA 1DI9A 3ZMMA 2ZB1A 2EB3A 5BQ0A 4D2VA 2R3HA 4WD5A 5HTIA 3ZM9A 3P86A 4NU1A 3FL5A 3RBWA 4ASEA 4DFXE 1L3RE 3P7CA 2QLQA 4BDIA 4K77A 5GZ8A 4IB1A 2UZVA 3TJCA 3W0OA 1OM1A 1APME 2X4ZA 4AT4A 5ETFA 3OS3A 2GFCA 4HPTE 2R0UA 4X2NA 4C4FA 3CJFA 3I6UA 4P7EA 4ALWA 3NMUF 5L2TA 5AP2A 2XALA 4W4WA 3LFBA 1ZRZA 3D5WA 3GNIB 5CXHA 5FWKK 2YN8A 2B53A 3E87A 3QYZA 2ITZA 3UP7A 4O86A 4K33A 5D9HA 4E5BA 4BDCA 2IZSA 4F65A 3DLZA 4AZEA 4HGEA 4R6VA 4AQKA 3P7BA 5CAQA 3BHVA 4RGJA 5GJFA 4C36A 1FMKA 1UKHA 4XRLA 4XP2A 2XYUA 5B2MA 3OC1A 3OCBA 4JBOA 2ZOQA 3NNVA 2ITXA 3L8VA 1R0PA 3QAME 3S4QA 3OFMA 3OD6X 4TYIA 1RQQA 4D0XA 5L2WA 3ORXA 4DH7A 3ORKA 5FBOA 1G8AA 3KXMA 2VX0A 3IDBA 5CI7A 1P2AA 3R1QA 3TNHA 1A06A 3GEQA 1YWVA 2W7XA 3KC3A 2O8YA 3VUMA 1U54A 3OG7A 4PPBA 3FZTA 3EFWA 4ZS4A 1R1WA 2JGZA 4FK6A 2PE1A 2ZJWA 3ORLA 4FKPA 3CTQA 3DZOA 2WHBA 4HGSA 4JI9A 4NTTA 2XA4A 2DWBA 4YZNA 4NL0A 5IQIA 1JWHA 1STCE 4FODA 1OIRA 4QMTA 4DFBA 5HE1A 2G15A 2YM8A 4G16A 3LAUA 4O1PA 5H9BA 1YHSA 2E9OA 4ERWA 3V6SA 5IEXA 4OBPA 2XK6A 4O6LA 3MFRA 5HE3A 2PZ5A 1YI4A 1W84A 2FH9A 2WQEA 2ERZE 3SHEA 4O4EA 3DXPA 3GQLA 1LUFA 3E8CA 3AC4A 5C8KA 3B8RA 2WU6A 1PY5A 4O91A 4DAWA 4O4BB 1H1PA 3F3TA 3TNQB 2QU5A 2WMUA 4GUEA 4WA9A 2R3LA 2YCQA 3P5KA 4D28A 2BILB 4J1RA 3I1AA 4EONA 3RNIA 5J9LA 3AC3A 3D94A 2YIQA 1UNGA 4FMQA 3QCXA 3UDTA 2VWUA 2XM9A 3PJ1A 3RPRA 2DQ7X 4J71A 1XMLA 3D5UA 2RF9A 2PVHA 3R7GA 3TEIA 5C1QB 1FMOE 4QMSA 4IVCA 4FNZA 4ZLZA 4MD8E 1ZARA 3FWQA 5GIPE 1CKPA 4KBKA 2WTDA 2VV9A 3LLTA 3LCKA 5CEQA 4QYYA 4YUQA 3V8WA 4MF1A 4EBWA 3VUGA 2O3PA 5E1EA 3UQGA 1WAKA 1Y57A 5A46A 3F2RA 5LMKC 1BMKA 2JEDA 1URWA 3IG7A 3SXRA 3DJ7A 5DYJA 2UW0A 4DFNA 3M2WA 2FO0A 3O5AA 4BI0A 4EHVA 3HGKA 5ETIA 2OF2A 5CU3A 3EN4A 3LHJA 5EYKA 4FRFA 2QU6A 3UYTA 2J0MB 2E2BA 4V05A 3AGLA 5EDQA 3CE3A 4C34A 4IM2A 4HZSA 1OL6A 4EJ7A 3QD2B 3OF0A 4B99A 3GGFA 4FV7A 4TNDA 2W1FA 3QL8A 4BCFA 4I3ZA 2Y7JA 4V04A 3O17A 1OL1A 3UNJA 3ZFYA 4UY9A 3FKLA 4AW2A 4LUDA 4EK3A 3KREA 1A9UA 3H9FA 4BJJA 1VZOA 3BQCA 4ZLOA 2GS6A 4FVPA 4DG0E 4X2GA 1OPJA 3HVCA 4EH5A 5HD4A 4KS8A 1H28A 1VYWA 4YBJA 4FKUA 3R8PA 4BGQA 5HZNA 5JGDA 5LMBA 4I6LA 4H3QA 1UU7A 3KFAA 2X7OA 4HYSA 3FV8A 4RIWB 1E1XA 2PZPA 1VEBA 4YHJA 4ZJIA 4BHNA 4C3FA 4XG3A 3P79A 3JYAA 3UDBA 4D4YA 2VN9A 3KN5A 2XCKA 2IVSA 3E93A 4WUNA 3V5LA 5LQFA 5DEWA 4GVJA 4QDEA 2WTVA 1NA7A 3I60A 2EXMA 4ZSJA 3GENA 4YJQA 5ACBC 1QPJA 4A9SA 4FTKA 3IDCA 4FKIA 3ZOSA 1TFFA 3ZBXA 4A4OA 5ITAA 1PYXA 2YM3A 4E4LA 4NM3A 4ANOA 3B8QA 1K2PA 4BBEA 2PULA 2BFYA 4WNOA 3FJQE 2V0DA 4RJ5A 5AX3A 4OTRA 3KXGA 4AGCA 1PXPA 1ZYJA 3NUAA 3KMWA 2OGVA 3PG3A 4L52A 3S0OA 1OIQA 2R3PA 5EOBA 4BCJA 1WVWA 4DF3A 4AZTA 5JFVA 5AR5A 2X6EA 4PMSA 4EK5A 2JKKA 5FDPA 3IONA 4IACA 2G2HA 5DBXA 5IUGA 3PJCA 3FSFA 4QP8A 2WQNA 2X2MA 3QX2A 3FKNA 5AUTA 2HZ0A 4G34A 1Q3WA 4GFOA 2BZKB 5L6PA 3RZFA 2HY81 3UOHA 1JPAA 2PZRA 5EHLA 3BLQA 3HV4A 2UVYA 3O96A 1OGYA 3TIZA 3ZXZA 4PP9A 4BTKA 4KAOA 4F0IA 2F57A 5FEDA 3ZRLA 3DAKA 3ORIA 4D2RA 3QWJA 4JLCA 2C30A 2OG8A 4O0YA 3H9OA 4YBKA 4ZTRA 4ALUA 4C7TA 5M51A 2G2FA 2VGPA 2P2IA 3NNWA 3TMOA 3CJGA 3FBVA 3GU7A 4U81A 3EFLA 4QT1A 4RC2A 2BDFA 3ODZX 3EQRA 1Q4LA 3R0TA 5H3QA 4HNFA 4KIOA 4ZY6A 3HUCA 4IAIA 2WOUA 4CZUA 3PDTA 3PZHA 1IR3A 3ZO1A 2W4OA 3QCSA 4X3FB 4K2RA 4YTHA 4DFLA 3TXOA 3UO4A 4EHGA 2VO0A 4TYHB 4AA5A 3C13A 3OWKA 4O22A 4RMZA 1WCCA 4WT6A 3IDPA 4PNKA 5CVHA 2VTAA 4ITIA 2QURA 5CSHA 5AM7A 2YITA 3CR0A 4K9YA 3OCSA 3UGCA 2HIWA 3ZZWA 4BZDA 2QR8A 4O82A 3UQCA 4FV8A 4GU9A 5JSMA 3G9NA 3O8TA 4DG2E 1KE9A 2XKCA 3CQWA 5I9UA 3ZDIA 4L8MA 1L8TA 4H3BA 4RVLA 4ERKA 3DQWA 3VS6A 4AQCA 4G2FA 4AZFA 2XNPA 4UV0A 5E8TA 4YO4A 3MDYA 3EHAA 5AUYA 3FHRA 3MA6A 4NIFA 3UIMA 1OL7A 4DEHA 4R8QA 5IDPA 4IZ5A 2R7BA 3R8UA 3SRVB 4Q5EA 4ZLYA 4EKLA 5EDRA 5TOZA 2YHVA 5AP3A 4EHEA 2XEYA 3DPKA 2CGVA 4AE6A 4BKZA 3SVVA 3F3ZA 4U44A 3RPVA 3HDNA 4CZYB 1ZOHA 1W2DA 2B54A 2VX1A 4E4NA 3QTWA 1NW1A 4PMMA 4XOYA 4CVAA 4OTPA 3ZC6A 5KMOA 5KMLA 4G3GA 4QMZA 3MI9A 4FEQA 4L01A 4PTEA 5G6VA 5K5NA 3UO5A 1M7NA 1QPEA 1YDSE 3F5GA 3GOPA 4JX7A 3GC7A 3L9MA 5AP0A 3ZZEA 4O84A 3LKMA 1JQHA 2C6KA 2UZBA 5AV2A 4B7TA 2ITWA 4OW8A 3I5NA 2QLUA 5M44A 4OAUC 1XKKA 4UYNA 3BE2A 1YWRA 2BRBA 3GXLA 4FKVA 1ZOGA 2PVJA 3Q9XA 1PHKA 5EG3A 1V0PA 2PVKA 4NFNA 4QYHA 4CV9A 2EUFB 4QMWA 1SMHA 4BIEA 2RGPA 5IMXA 1I09A 3FY2A 4FT3A 4QP4A 3FZ1A 5FQDC 3R6XA 2GQRA 1IEPA 1Q3DA 3VRZA 3Q5ZA 4QOXA 3MV5A 4YNOA 2BRGA 4AW0A 4GH2A 3HA8A 4UMTA 3E3BX 5D1JA 2CHLA 3MSSA 4J53A 2GHLA 4FUXA 5CU6A 4YJSA 3C4CA 4Q9ZA 3VAPA 3EYHA 5JFWA 4X6RA 2R3NA 3VIDA 4AFEA 2UZTA 4ZY5A 4FEWA 3A7IA 2PMNX 2W99B 1PKDA 2R7IA 2VGOA 4FZFB 4JOAA 4L67A 4R3PA 1UU3A 2J51A 4V0GA 5E8ZA 4IHPA 5J87A 2EWAA 4YZ9A 3P5JC 2JFLA 3FDNA 4HPUE 1GZ8A 1PXJA 3ZHPC 4BTFA 4QTEA 5CF4A 2OLCA 1ZMVA 5EQPA 1B38A 1TZDA 3OUNB 4I22A 4KABA 4USDA 1P4OA 5J1VA 3NNXA 4BWXA 5A4CA 3VJOA 3K3IA 4D9UA 4FSTA 5KHXA 4F64A 2R3QA 4L7FA 4NW6A 4G17A 5J7BA 2CNUA 3FXZA 2EXCX 3NSZA 1WZYA 2JLDA 4FL1A 3AC5A 4JIKA 3GUBA 4EZ5A 3D14A 4FKGA 5E8SA 3ZYAA 4BN1A 5AR4A 3QX4A 3NPCA 4XP3A 4A06A 3AT2A 2BKKA 2PUIA 1Q41A 2PSQA 3D83A 4AGDA 4F99A 5BYYA 5HG7A 4DEBA 1YXUA 4EK4A 1Q24A 3NCZA 3KRLA 4USFA 4DTBA 4LRMA 1OUYA 1IAJA 4O83A 3R9RA 4IADA 5CZHA 3WI6A 2WTKC 3EYGA 4UWBA 5JN2A 5ANEA 4OT6A 2E9UA 3MBLA 3EQIA 4BBFA 3UOKA 4FG7A 2ZV2A 3HDMA 4K18A 3DJ5A 2QQ7A 5AX9A 3R8VA 1XH4A 2B52A 3TI1A 5L4QA 2I6LA 3FKOA 2JAMA 4FEXA 2UZOA 3QD4A 3NCGA 4EJNA 2UZUE 2UW4A 4IWPA 3A4PA 3C5IA 3UNZA 2QOBA 3NUNA 4MNEA 5CSWA 4AS0A 4LOOA 4QTDA 4WG5A 4A9UA 4LM5A 2YJSA 1W7HA 3C0IA 4GMYA 5BUIA 3KULA 2PPQA 2YZAA 3SA0A 3AMBA 1J7UA 5I9ZA 4XV1A 3L8PA 2IEWA 3TKHA 1YXVA 4DFYA 2YM5A 3JY0A 4F6UA 3PA5A 2VRXA 4MX9A 3TWJA 4XCUA 2C6IA 3FXWA 2YJRA 3KN6A 4ACCA 3U9NA 4BIDA 4N4SA 4NSTA 2I0HA 4QMMA 5HTBA 4G1WA 4DT9A 5M4FA 2Y6MA 3K5UA 3QQFA 2ACXA 3PVGA 3HMPA 5LOHA 3GC0A 2IWIA 4CYJA 3QCYA 2B9HA 1YHVA 2HAKA 3GI3A 4ZMEA 4MXOA 2XIKA 4EI4A 4E5WA 4F0FA 3IOKA 1BL6A 5CTPA 3R9NA 4OUCA 1YW2A 5E8VA 3V5PA 5CEIA 5EM7A 3SX9A 4RWIA 4BC6A 4D2WA 2GDOA 3KRXA 3PVBA 3ETAA 4FKRA 4YSJA 1ZYSA 3NUYA 2C3LA 2BR1A 3MH3A 5C03A