2QO2A

Human epha3 kinase and juxtamembrane region, dephosphorylated, apo structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
282
Chain Sequence
TYVDPHEDPTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin receptor
total genus 90
structure length 282
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo2A01
5ANOA 3BHTA 4PDPA 4QYHA 3WARA 3BIZA 2B9JA 4ZSJA 2V0DA 5A14A 4NTSA 2QO7A 4C4GA 4LUEA 4KS7A 4FE2A 2H34A 3KXZA 3P4KA 3PWDA 3PRIA 2W0JA 5DPVA 3AMAA 4BGGA 2IZSA 4HPTE 2J0LA 3EQRA 4BDJA 3WZDA 1OL6A 3PYYA 4IEBA 2QU6A 2GDOA 5CS6A 1M7QA 5FP5A 3MVLA 3SHEA 3NUUA 5AP5A 4FV3A 4DCEA 3NYVA 2X9FA 4PNKA 4EEVA 3VS3A 3MGYA 4FKVA 3COHA 4O0VA 4OTRA 5AM6A 3E8EA 4GT3A 4YSJA 4JLCA 4EZ5A 3ZRMA 4NKSA 4TWNA 1XH6A 3IOKA 3UNJA 3CQWA 3OCBA 1UU9A 2IVTA 5A4CA 1OPJA 4F7NA 2ZVAA 4XX9A 4TYIA 5C8MA 1G3NA 2QOLA 3R8LA 4EC8A 3HDNA 1REJA 1OL1A 1Y6BA 3FL5A 4I6BA 2WMXA 3KCFA 4FICA 1GZ8A 3CTQA 4WKQA 5HCYA 5L2WA 3FMEA 4O91A 1GZKA 3Q9ZA 4R78A 3SXSA 3W1FA 3L8PA 4FEUA 3BBTB 4ALVA 5IQEA 2A4LA 3IW7A 4BC6A 3DNEA 4DFZE 4E6CA 3FAAA 5DNRA 2BILB 5JGBA 5HIDA 3ZRKA 4FSZA 5AP6A 3ZUUA 3OROA 3Q4ZA 3QZIA 3UYSA 5JRSA 4UMTA 1GOLA 1XH5A 4U8ZA 4YNOA 1IASA 3DS6A 3EQHA 3FC2A 4MAOA 5TO8A 2F9GA 2FYSA 5ANKA 5EYMA 4EJ7A 3MS9A 3TTIA 3ZM9A 4D5KA 1PXIA 4F0GA 2OO8X 2V22A 3CPBA 4TKSA 5DR6A 3QL8A 4YJVA 3RHXA 3OBJA 3VF9A 4DBXA 2UZOA 4BY9E 5M44A 3QQHA 4HYHA 4ZZOA 5I5ZA 2PHKA 2XBJA 4EK4A 3DGKA 3PVGA 4CGAA 3NNUA 3IOPA 4WUNA 4JQ8A 5DVRA 5L8LA 5LMKC 2ZDUA 2PMOX 1GIIA 3MPTA 4M69B 4WNKA 4XBRA 3RTPA 3VBYA 5K4IA 4JI9A 3SVVA 5DR2A 3F6XA 4GS6A 3IGGA 5KKRB 2VRXA 2UW3A 1KOAA 3Q3BA 3ZZEA 2I0VA 3SRVB 4MX9A 5HTIA 2DS1A 3NCGA 3FL4A 1FOTA 3PG1A 5E8TA 4R7BA 4B9DA 3HV3A 4ITIA 5EK7A 3COKA 2QONA 5IISA 1PKDA 1F5QA 5IQIA 5F9EA 3KF7A 4KABA 3RWPA 3AMYA 4F1TA 2XMYA 3QRKA 4L7FA 4KIKB 4EOSA 3N4UA 4D4VA 1PXOA 1E1XA 5HOAA 1Q4LA 2KTYA 4QMWA 4QD6A 3OY1A 3ZOSA 3FLQA 3KF4A 4J8NA 3OG7A 4WIHA 5EFQA 4JRVA 5I9YA 1JAMA 3MI9A 4CZTA 2YITA 4IHPA 4B6LA 4L3JA 5BVKA 2GFCA 3D14A 3F5XA 1CTPE 3R22A 3ANQA 2PUUA 3GQIA 3NEWA 3BZ3A 4IDTA 4LRMA 3F3WA 4GV1A 4R5SA 4D9TA 3NUYA 3DPKA 3ULZA 2JDTA 2X6EA 3HV6A 3LHJA 4RVKA 5M09A 3TL8A 1WVWA 2B55A 3OY3A 1Y91A 4IVBA 3DK6A 3D7ZA 1U4DA 3I7CA 3RPSA 4GL9A 4DG2E 2XNMA 3VW6A 5HLWA 5LXMA 2W1GA 3UIXA 3HMIA 5CTPA 4A4LA 2X2KA 4D1SA 1TQIA 5IQFA 1Y6AA 4JG6A 3FPQA 2WEVA 4O0WA 4ZLYA 4WHZA 4JAIA 4BCHA 4II5A 2XIZA 4OTPA 4CKRA 3POZA 4I41A 5HVYA 4FZDB 4C34A 4XG8A 5JEBA 5E4HA 5D12A 4O81A 4KSQA 3K2LA 3UNZA 4XNEA 4G3GA 4HCTA 4OTDA 5E7RA 4BN1A 1E1VA 1WBWA 2BKZA 4O7TA 4GFGA 1T46A 4CG8A 2VUWA 3QCQA 3CY3A 3KULA 5ACKA 4FSQA 3MIYA 2BTRA 4DN5A 1NT2A 3UJGA 4O0YA 3QWKA 3FMLA 3QQJA 1PMUA 5CXHA 4I92A 4GU9A 5J95A 3PJ3A 4IB0A 3LQ5A 4LOPA 3H10A 1IA8A 1OM1A 1ZYSA 4EUTA 3UO5A 2WD1A 5HBEA 3FMHA 2JDOA 1P5EA 3QRUA 4X2JA 5C8KA 4D2WA 5TOZA 3FXXA 4DT9A 3DZQA 2VTJA 4L42A 4DGMA 3GEQA 4BWKA 4JOAA 3C4FA 3UOLA 1DS5A 3SLSA 2YM4A 4MBIA 4CRLA 2C4GA 3WILA 4D1ZA 3UVQA 4EH4A 1TKIA 3A7FA 4ENYA 4F7SA 5M51A 3GCQA 3O17A 3H9FA 3Q9XA 4NU1A 5KZ0A 3R9NA 5JK3A 5CU3A 3VF8A 1KV2A 1YWNA 3HUCA 5C03A 4LRKA 4PP7A 1QPDA 4I5MA 4DEBA 3I6WA 5CALA 2PPQA 3EYGA 1Q99A 4R7IA 4FKUA 3UMXA 4M7IA 4G3EA 5B2LA 4CTBA 2W1CA 4U9AA 1ZAOA 4KIQA 3NYXA 4FNWA 4ENXA 3LFEA 4BKYA 4S2ZA 3UOJA 3PZEA 3SGCA 5D41A 3KN6A 2R3FA 2ZMCA 4UWYA 5FWKK 4MF1A 2PMLX 4GVJA 2WQMA 1M52A 2H96A 3PLSA 4H3QA 4NKAA 3D5VA 3K54A 2PU8A 5L2QA 4BICA 2WTVA 3VVHA 5JFXA 4V04A 1H28A 2UZNA 5CNNA 4BZNA 4L46A 2PUPA 1UU8A 4GT5A 4PTEA 4PDOA 5AV3A 4HJOA 1Q3WA 3TZMA 4ALWA 2B0QA 4LUDA 2JLDA 5E1SA 3G6HA 4U0IA 2GNHA 3EKKA 3PE2A 4PTCA 4UXQA 2W1DA 3PDTA 4QP9A 4QMTA 2W5BA 1ZMUA 3FBVA 2UZVA 3A2CA 4QOXA 2NNWB 1Z5MA 1PYXA 3ACJA 3BQRA 3LLAA 4TT7A 2GPHA 1JSUA 3AD4A 2XIYA 2YM3A 1LR4A 1RJBA 3HMMA 4MWHA 3UQGA 3TZ8A 5JFSA 4DLIA 4UV0A 3TNQB 4AGUA 3U8WA 3DB6A 3R8PA 3RI1A 4BDAA 2EU9A 3E64A 4NWMA 4YZCA 2QURA 3Q52A 3S95A 5HNIX 4BF2A 2RGPA 3HAMA 2YJSA 3QQUA 5KMNA 5I9VA 4XP3A 4ACDA 4G2FA 4RIXA 3F5UA 1WFCA 1YWVA 2OZAB 3CD8A 4I6QA 4JIKA 4P7EA 1V0OA 5K9IA 2ZM3A 4U5JA 4MXOA 5D10A 5DG5A 4ANNA 4BDCA 1ZYLA 4ITHA 4H36A 4UEUA 4X2FA 5KE0A 2UZWE 3EZVA 4R6VA 3ALOA 3QCSA 1PXNA 3R83A 4J1RA 4QP4A 3FDNA 4FIHA 2G15A 2VTLA 4HNIA 4N6ZA 4V0GB 3CGOA 2XKCA 3BGZA 3PA3A 2W9FB 1YDRE 4IX3A 3MESA 4XRLA 1UKHA 3RGFA 2R7BA 5FRIA 2G9XA 1U54B 3AC5A 2X4ZA 4JX7A 3E93A 4APCA 2F2UA 5IEXA 3QD0A 3UOKA 5E9EA 1YHWA 4IVDA 2EVAA 1XH7A 4O0UA 5M06A 1FMKA 3HA6A 4C0TA 3A7HA 4XG6A 4YHFA 1XBBA 3U6IA 4MXZA 4RJ8A 4FSTA 2PZIA 4G34A 4F70A 4C36A 4OBQA 3CSVA 3QUPA 3Q6UA 2VWZA 3RCJA 3RBWA 3D5UA 1YVJA 4PMPA 4HPUE 4E6AA 3FE3A 2YHVA 4RLKA 3S00A 2RG5A 3FXZA 3KRXA 4DTBA 4O7SA 3A8XA 2XYNA 4M0ZA 2VX1A 4S30A 2PTKA 1WVYA 4BTFA 2WU7A 5E8SA 2B7AA 4O7LA 3FI8A 1OIQA 5TF9A 3VS1A 3T9IA 4O2ZA 3ENHA 3WE8A 4CT2A 3LCKA 3ET7A 5HTCA 1Q62A 2BROA 3HV4A 1HCLA 4P4CA 4RPVA 2W4OA 4YLJA 3ZO1A 4F9AA 3GU5A 1MUOA 5EW3A 4E5WA 4RVLA 1ZOHA 2QO2A 2Y6MA 5H3QA 3NNVA 4RC2A 4O82A 5JQ8A 3V6RA 2IN6A 4FV2A 3DNDA 5GNKA 3ORPA 1JPAA 2XJ0A 2IVVA 2PMNX 5CZHA 4F08A 5K0KA 3SV0A 3NPCA 1OKZA 3OWPA 4ZK5A 5AUXA 3LJ2A 1ZRZA 3LQ8A 4JBVA 5FBOA 1BYGA 2ITNA 3R7OA 5IA4A 4IQ6A 2ITZA 5AUWA 3ATSA 3QU0A 4QRCA 4PQNA 4NCTC 2Z7SA 5CSVA 3RK9A 1PXJA 4YJNA 5HE1A 2A19B 1W0XC 4AGCA 3N9XA 4X0MA 4JQEA 2VWXA 4CFUA 3LFNA 2GS2A 2R3QA 3GFWA 3NW6A 4EQMA 4HNFA 2HIWA 5E8YA 4UWCA 2RL5A 4CSVA 5FUTA 1LEZA 4AF3A 3UIUA 3C1XA 4C57A 4MXCA 3MFRA 3DT1A 2X8IA 5DA3A 3QXPA 3QTWA 2B9HA 3F61A 2VTTA 3DTWA 1VYZA 4BCOA 5HX8A 3LE6A 2GHLA 2ZB0A 2UW4A 4PRJA 2I1MA 4M0YA 2GNFA 4PMMA 4BBFA 2BR1A 4OTQA 4BCFA 4EH9A 3Q96A 1ZYJA 2P55A 5A4LA 3GU4A 2YAKA 2QOCA 3QTRA 3JYAA 4CG9A 3LFCA 5HE0A 5KZIA 3RVGA 5IUGA 5HBHA 4IXPA 4FV7A 4JR3A 3ZBFA 3VRYA 5FTQA 5DE2A 1AGWA 3ZRLA 3ZYAA 4S31A 3DBDA 1GY3A 1RQQA 2R0IA 4O7YA 5IA3A 2BDFA 3CIKA 3AD6A 4KB8A 2W1ZA 2Y4IC 4A9SA 4F6UA 3C50A 2HXQA 2GS6A 3W8LA 1SVGA 3KXNA 4IAFA 1BX6A 2QOOA 3PPZA 4JQ7A 4CEGA 2PSQA 5GIPE 1WMKA 4ZTRA 3WE4A 5CF4A 3TKIA 5ANIA 2P0CA 3GU8A 4QMYA 4TYHB 4TYJA 4EK5A 5EHLA 3DJ7A 4FKSA 4CKJA 5IH6A 4XBUA 3ZUVA 2OH0E 4DEEA 5FG8A 3IDPA 5EQPA 2IWIA 2VTRA 4FVQA 2NO3A 2OXYA 3ZDIA 1XKKA 1Q5KA 3SW7A 3C13A 3CLYA 1CSNA 3QKMA 3G0EA 3ZSHA 3LZBA 5LCKA 1OITA 4MBJA 2YIQA 4ACGA 1H1QA 4Q5EA 1PW2A 5BVEA 2RFEA 1GAGA 4FGRA 5GZAA 4RVTA 3TM0A 5CU6A 3R73A 5DN3A 2QLQA 2XF0A 4EZ7A 5JFVA 3RJCA 3U55A 3EJ1A 3KRLA 3QAME 4IADA 2GQGA 4M12A 1OPLA 3UIMA 3VUMA 4L3LA 4MD9E 3AGLA 5IG1A 2QR8A 2GCDA 2VTAA 3CR0A 4NM5A 2BUJA 2RG6A 4YC3A 2BRMA 2HW7A 3ATTA 4EBWA 4C3RA 2YIXA 4IFCA 1Y8GA 1TVOA 4FKOA 3FMNA 2C0IA 3FQEA 4MEDA 5D9HA 4ZSGA 2CCIA 2WTKC 3A8WA 4EI4A 4RC4A 3OXTA 4PMTA 2C68A 3OBGA 5JZNA 2JC6A 5CI6A 5DGZA 4I1ZA 4GKHA 4O0TA 2Y0AA 3W2QA 4ZSAA 3CTHA 2C3KA 3G9LX 5LMAA 3Q4TA 4C62A 4ERKA 2UZLA 4ANBA 1W83A 3P78A 2FA2A 5FEQA 5HU3A 4LL0A 1JLUE 4ZTNA 4KBAA 2PUNA 2X9EA 3PSBA 4QNAA 1R3CA 3RM6A 4UMUA 2A27A 3W33A 4I93A 2DWBA 4AGDA 4KINA 2PVRA 1NY3A 2OICA 5L6WL 4ZJIA 5L2TA 2JITA 1KUTA 2XNEA 2BIKB 2PVNA 4BI1A 4S32A 4EHEA 3U6HA 3NUSA 4D2RA 5BVFA 5ITAA 2X7GA 5J9ZA 3GB2A 4F64A 2BMCA 2WMTA 2JAMA 5HG8A 3A4OX 2R64A 2I0YA 1YXXA 4X3FB 5DOSA 4EK8A 4YUQA 1DAYA 4D2SA 1B39A 3LMGA 5M57A 1JOWB 3L8SA 4AOJA 3F82A 4AT4A 4E5AX 2ETRA 3FKLA 3KQ7A 2YWPA 3CD3A 4FZAB 4Q2AA 5AAEA 2OG8A 4QQTA 1YI6A 2PVKA 5AX3A 4BTKA 3IO7A 2F4JA 3IQ7A 4LOOA 5C01A 3P7BA 4I0TA 3NWWA 4I5HA 2Z2WA 2FVDA 3PVBA 4QMOA 3PJ8A 1P2AA 1I44A 1CKJA 4IWOA 4J97A 4MQ2A 4JL9A 2CGWA 3DOGA 3NS9A 3RP9A 3PA5A 3TN8A 3LMHA 5IQGA 3LFBA 2IZTA 4PWNA 1L3RE 4O7NA 4XRJA 2WTCA 2ZB1A 5HVJA 2OIBA 2VO3A 4A7CA 2FH9A 4ZSEA 2VWUA 1Q24A 1OIYA 4FODA 4IAYA 3LFDA 4QPSA 4QP6A 4R3RA 4CXAA 2CKOA 3ZEWA 3BCEA 4HGSA 3TNIA 1YXUA 3EQPA 3KY2A 3MVMA 4RJ7A 3V01A 5FXQA 2WMBA 1BI7A 2Z7LA 3BLRA 3ORZA 2G2HA 2XNPA 5HCZA 1J7IA 4MWIA 4EQUA 3C4EA 2VTMA 4NJ3A 4PL3A 4E4MA 3DAKA 3TWJA 1ZARA 2RFSA 2R3HA 2VGOA 3WF5A 3LXKA 5HEZA 4CMUA 2A0CX 1QPEA 3HVCA 4WOVA 3COIA 4IACA 5EKNA 3ZLWA 4OAUC 2IO6A 2QHNA 2R4BA 2EXEA 5E8UA 5HGIA 4O84A 2JKMA 4TWOA 3GQLA 4FNYA 2OIQA 2WEIA 1U54A 4ZTQA 5EM8A 4BYJA 4XG4A 3ODYX 4C02A 3MN3A 3UZRA 4Y46A 3E8CA 4I6HA 1F0QA 2BDWA 5E90A 3MPAA 4FIFA 2QOHA 3UE4A 2OKRA 4DGOA 4E4LA 5HBJA 3JXWA 1YOMA 5EDQA 5KMIA 5H8EA 2JIUA 2YCRA 4YPSA 2RFDA 3QWJA 4JXFA 4JT3A 3KFAA 5IDPA 5BYLA 3R1NA 3U54A 3PXRA 2LGCA 3PVUA 4RA5A 4BCMA 1UWJA 2WPAA 1IR3A 3F5PA 5HD7A 3I5ZA 4QMQA 4B8MA 4FT7A 5J87A 4O83A 4YZDA 1H1SA 4GYGA 3C7QA 3R6XA 3RAIA 5CI7A 3F9NA 4A9TA 2C6EA 2FGIA 3KN5A 4B8LA 3MV5A 4DFYA 4E8AA 3F5GA 3L9NA 4ZY6A 5CENA 4EBVA 3UPZA 4C58A 2PE2A 3HKOA 4D2PA 2AYPA 4FKIA 4BFMA 3HA8A 4B7TA 4JVGA 3FI4A 4ZXTA 4ZTSA 1YI3A 5M4FA 3IDCA 3LXLA 4EZ3A 2YM8A 4CKIA 2J7TA 2VWIA 4XJ0A 4WUAA 4FTCA 3MPMA 4YJQA 3ZU7A 1H25A 4NFNA 4BTJA 2YIYA 4L68A 4TY1A 1ZY5A 4F09A 4CV8A 1VJYA 3ZFXA 1YXTA 2J6MA 4BBMA 3WF7A 3TT0A 1URCA 5K3YA 3BI6A 1STCE 2IVSA 2VO0A 1FQ1B 4MVFA 4CMOA 4FVRA 3PUPA 4M8TA 4YJPA 4GIHA 4FYNA 4RBLA 3NW7A 1YKRA 1EH4A 3O8PA 4N70A 1SVEA 4U97A 3QRTA 4GMYA 1OGUA 2EXCX 2Z7RA 3VBQA 1UU3A 3O7LB 3SW4A 4WSYA 4K77A 5CAVA 1MQBA 4MF0A 3E8NA 4O2PA 1A06A 4LQMA 3PY3A 4FV1A 2UZTA 4IX4A 3WI6A 4G9CA 3QQFA 4BKZA 1SYKA 4Y85A 3BRBA 4PL4A 3V5QA 5L4QA 5F1ZA 3I6UA 4G9RA 1UNHA 1BLXA 4M15A 2WOUA 2YFXA 5BVDA 4O96A 3TV6A 4QTBA 2G01A 3F7ZA 5LOHA 1O6KA 2IZRA 1E9HA 3ORLA 1H1RA 4IBMA 3TNPC 4AOTA 1GNGA 3LOKA 5A4TA 4RT7A 2GNIA 4XV3A 2VNYA 3O8TA 5FTOA 4EOQA 5L6PA 3OS3A 4K11A 5EW9A 3RNIA 4EHZA 5J9LA 3EQBA 2VWVA 2WTIA 4X2NA 3UPXA 3ID6C 4XV9A 4BDGA 4AQCA 4DGNA 3PP0A 3OF0A 4QMSA 2BZIB 2YIWA 1J3HA 4I23A 4OBPA 3WBLA 4AU8A 3G5DA 2UZEA 4BIEA 4DH7A 2GTMA 3JY0A 4JBPA 4QMXA 4W8DA 3NYOA 2UZBA 4I20A 3VIDA 2PVFA 5J1VA 3AMBA 2ITOA 3FPMA 4ANOA 2JFLA 1XQZA 3EN7A 4L53A 2ETMA 5I0BA 3QCXA 3TUDA 3KXHA 1Q8YA 4YO4A 3FMMA 4FV6A 2VV9A 5AUUA 4J8MA 5ANGA 3QQKA 2XK8A 2ITVA 4JBQA 4L01A 4PDYA 2W17A 2Z7QA 2UV2A 1XH4A 5EHOA 5CVFA 1WBPA 1RE8A 5IQDA 4P5QA 5HO8A 3R9HA 2GQSA 5LVLA 3QC4A 4MNEB 1XO2B 4YJUA 2OJGA 3AG9A 3ZONA 3AT2A 3I1AA 4YGAA 4F4PA 3BLQA 1KE5A 1BI8A 4EKKA 2GU8A 2YCQA 4IFGA 4RIYA 1U5RA 3MSSA 3OOMA 4GVAA 2W1IA 1H4LA 4FT3A 2PWLA 4LGGA 2PZYA 4IWQA 3O51A 4IJPA 3MJ2A 5HX6A 3AXWA 2GHMA 4BDDA 3QKLA 4Z55A 2J0JA 4BCNA 5DI1A 3ZH8A 4KA3A 2GFSA 4Z7GA 1H8FA 2C6IA 2EWAA 5E92A 3VUDA 3H9RA 3QZFA 4UYAA 2XKFA 3K5UA 3L9LA 4KSPA 4O0RA 3TKHA 3II5A 4E73A 1CM8A 3N51A 5AP0A 3VAPA 4HCUA 3JR1A 3LFFA 3UNKA 2J0MB 3KCKA 4F7LA 1PRYA 4TYGA 5I3RA 3HMOA 1XWSA 4MTAA 2O63A 4C4FA 5HZNA 2W99B 3CQUA 4FV5A 2ITYA 2R3MA 3LCOA 4O0XA 4FA2A 4C61A 2W96B 3UG2A 2G1TA 2X81A 2WMWA 4RSSA 3VBVA 3PA4A 4I6FA 4UY9A 5FTGA 4U3ZA 4FBXA 4DG0E 3B2TA 2I0EA 3BU5A 3UBDA 4D4RA 4CMTA 3EFKA 3I60A 5DT4A 4TL0A 3UVRA 4EOLA 5HNBA 3BEGA 5A46A 5BQ0A 1VZOA 2QKWB 4FEQA 3EB0A 3HNGA 5I9XA 2XRWA 3FV8A 3Q9WA 3REPA 1JKSA 4LMNA 4RWKA 3CKXA 4YJTA 4BTMA 2F57A 4AUAA 2WMVA 2C5OA 5CEPA 1FVTA 4C38A 4QP1A 3OT3A 2OJJA 4KAOA 4E93A 4IZAA 2WQNA 3E63A 2UW0A 3NVKI 4ZTMA 2QKRA 2OJIA 2UW5A 4X3FA 3MY0A 2CGXA 5CY3A 3D2IA 3HECA 5ETIA 5F4NA 4EYMA 3P86A 3DFCB 3CJFA 2YDJA 4C4HA 5AP1A 3FLYA 1PKGA 5H2UA 4EK3A 1WBVA 4C7TA 3KXGA 4O6LA 3U87A 1JSTA 4F9WA 3RMFA 4DC2A 5CF5A 5K4JA 1GIJA 3DK7A 3E7VA 5C8NA 5KBRA 1BUHA 5CEQA 4YLKA 2HZ4A 3ELJA 3HMPA 1JNKA 5T6KA 5ANDA 4EOMA 5HIEA 2C3LA 5BVNA 3IW4A 4TYHA 4I21A 3MFTA 3RPOA 5EW8A 3ZO2A 4OGRA 4RX7A 5C4KA 4FTAA 1V1KA 3F7WA 3QQLA 4IZ7A 3OCSA 1Q61A 5B2KA 2YZAA 4Z16A 4BR3A 4E7WA 5IQAA 3UP2A 3TZ7A 3VS5A 4QP8A 2OF2A 3HV7A 2ITXA 1J1CA 3EYHA 3P23A 1JKKA 3CPCA 5AUZA 3PIYA 4YP8A 3ZDUA 4AA4A 4DBNA 5LVMA 3NUAA 3VUHA 3PE1A 3I0OA 3RK5A 2P2IA 3NAXA 1GZOA 2NP8A 3FLSA 3KVXA 4IWPA 5A54A 2XIRA 4NEUA 4K18A 5AA9A 4O7VA 3HLLA 4JAJA 3QTSA 2AUHA 3FUPA 1MRUA 2YERA 3H4JA 4YTCA 1IRKA 1MRVA 2WMQA 1W84A 4YZMA 4QNYA 5J9YA 5JKGA 4ZLOA 1H0WA 3NUXA 2AC5A 2WELA 4PDSA 3OWJA 4RJ4A 3D7TA 3DLSA 3G6GA 4BCIA 4C59A 4HZSA 4Y5HA 3NCZA 3EQCA 4AFEA 4DAWA 4Y5QA 3RPYA 3QHWA 4JDHA 1DM2A 5HCXA 3FYKX 2FSOX 4FGBA 3A99A 2ZOQA 3R8ZA 4BKJA 3H0YA 3EWHA 5CSXA 1VEBA 1OKWA 4ZLZA 3AT4A 3IW6A 5HG5A 3ZC6A 1WBOA 3R04A 4R3PA 4EWQA 3FHRA 1OI9A 3SXRA 4KWPA 3UO4A 2WKMA 3VS2A 1ZYDA 2WTJA 4GW8A 3QA0A 3G90X 5GJDA 3ZFMA 4W8EA 5E8ZA 1U59A 5CX9A 4RJ6A 2IW8A 4AAAA 4HZRA 4CCBA 4DEDA 3VO3A 3V5WA 3EH9A 5F95A 3VBTA 3LM5A 2JBOA 2ZAZA 4XV1A 5M4UA 2GSFA 3IGOA 4FV0A 4ERWA 2R3PA 4X2GA 4FTMA 1H1PA 2YLEA 4IB5A 5FEDA 3EN5A 4GYIA 3HGKA 3ZLSA 1REKA 2GMXA 4GK4A 1UNGA 4DH1A 3OD6X 2P33A 3GCSA 2WMSA 2XK3A 4EUUA 3TUCA 3WOWA 3E7OA 1ZWSA 2QCSA 2YISA 3H30A 3L9PA 3R01A 4C8BA 3MFSA 2VN9A 2V7OA 3UC3A 4G16A 4PPBA 2QVSE 3NR9A 2BHHA 4BDBA 2XH5A 2B9IA 4Q9SA 3R7IA 3DBFA 3LKMA 3DAEA 4XS2A 2GTNA 3NZ0A 3VHEA 4ANLA 4HYUA 3OUNB 1M7NA 4JX3A 4K0YA 2C6OA 2FO0A 3GNIB 4XG3A 5CLPA 4EJNA 4NSTA 1H1WA 4L67A 5HU9A 3BYUA 4UN0C 2P3GX 4U80A 5G6VA 1OPKA 2WOTA 5CZIA 2X2MA 5FXSA 4V05A 4FTQA 1SM2A 3BV2A 3EFJA 3C4CA 1PY5A 5M53A 4U6RA 3R7UA 4P2KA 2IG7A 1RDQE 1UVRA 2HENA 2PZ5A 1KE7A 2YEXA 3O50A 4FOCA 4DHFA 3PPJA 3VJOA 4EKLA 1FINA 4JG7A 2C30A 3EOCA 3R28A 2CHLA 5DRBA 3D0EA 3MW1A 4RX5A 4Z7HA 2JIIA 4I0SA 2C0OA 5K0XA 2R2PA 4AW1A 3PIXA 4G17A 4IAIA 3FZ1A 2A2AA 1OECA 2JGZA 2ZM1A 4O1OA 2FSMX 1M2RA 3CP9A 2CGUA 5AV1A 3GCUA 3S1HA 4V01A 2R3JA 4C37A 5IU2A 2BZJA 3IECA 4YZ9A 5IKWA 2ZMDA 4YNEA 4ZJJA 5FM3A 4D2VA 4QQCA 3U9CA 4HVGA 3FLWA 3QF9A 4BZOA 5DEYA 3PVWA 2Z02A 4U41A 3ZCLA 4FIIA 2W1FA 1PMEA 4BGQA 2OGVA 4CQGA 4OTHA 5KMMA 4EYJA 1JKLA 4LRJA 4RZWA 5JQ5A 2F7ZE 4CZUA 5IF1A 4EQCA 3VRZA 3TNWA 3A62A 4MD7E 2X1NA 3C5UA 2R3OA 3JS2A 4C4IA 3I0QA 3RAHA 4N57A 5BPYA 4QP7A 4HYIA 3VUKA 2YM7A 5AR3A 4LV5A 2XA4A 3GCPA 2BIYA 2YZLA 3TG1A 3IG7A 4F99A 5IMEA 2IJMA 2XVDA 2WB8A 2V62A 4FYOA 3PSCA 2BPMA 4D55A 4F9CA 5M4CA 5DLSA 1ZZLA 4MYGA 3S2PA 4AP7A 4FL3A 2UVYA 2A1AB 3QGWA 5I9UA 1FMOE 3PWYA 3Q5ZA 1FGKA 2B54A 2UW7A 4EH5A 2OJ9A 4QTDA 3QD2B 2C47A 2PE0A 3PPKA 4DFLA 4H3BA 3D7TB 5AUVA 4AWIA 3TACA 4PV0A 3IPHA 5KUPA 2I40A 1ZZ2A 2YABA 3ZSIA 3G15A 3M1SA 4YURA 2BHEA 4IB1A 4L7SA 3R2YA 4AX8A 1PXLA 3LQ3A 1Z9XA 3NUPA 4FKPA 3W16A 2Q83A 2X7OA 3VS4A 2J0IA 5IEVA 3BHHA 5AUTA 4M97A 4ORKA 4BIBA 5AADA 4DFUA 2QHMA 3I79A 3QTUA 4F0FA 4X3JA 2CDZA 3H0ZA 4OT5A 5ETCA 4ACHA 4Y83A 4F9BA 2OZAA 5J1WA 4WD5A 4F1MA 2J90A 1J91A 2QC6A 3WYYA 1XBCA 5HHWA 1NA7A 3PJCA 5AR5A 3SXFA 1J1BA 5AP3A 1PXPA 3TKUA 4RLLA 3VN9A 1WZYA 2BRBA 3E5AA 2QI8A 4FG9A 1P4OA 2G2IA 4FC0A 4MNFA 5CAQA 3EQGA 2BRNA 2JKQA 2NPQA 4YJOA 2IW6A 2G2FA 3EFWA 5ACBC 3T8OA 3BGPA 5A3XA 3FKOA 3AC3A 3QYWA 4FIGA 3R7EA 1OL5A 4ZIMA 2BCJA 4Q5HA 3N4VA 1OIRA 1YOLA 4GCJA 5CQUA 3VUGA 2WXVA 4FZFB 4JBOA 3NVMB 4IZ5A 5M55A 2B1PA 5D11A 2Q0BA 2PY3A 4CFNA 3FSFA 2VWWA 3KREA 3Q32A 3FLNC 1ZY4A 1KE9A 4MK0A 3QFVA 3FHIA 4YJSA 3MA3A 4P5ZA 4CQEA 5E91A 2C0TA 1ZMWA 3W8QA 3QXOA 3ZO3A 2C6DA 3Q04A 4IC7A 2J5EA 3U51A 3HRBA 3MVHA 2ETKA 2WTKB 5HG7A 3DXNA 3KRJA 4AG8A 3QZHA 5AJQA 3UQFA 1UKIA 5JGDA 5FDXA 4GK2A 3UYTA 1H01A 5E8VA 3F66A 4FIEA 4CTCA 2VGPA 3BU3A 3ENMA 3MH1A 5HQ0A 4XG2A 4FOBA 5KKRC 2PVMA 3AGMA 4JS8A 3MTFA 4O0SA 4WNOA 3ZTXA 3OC1A 3V3VA 1HOWA 4U45A 5J7HA 3QX2A 1BMKA 5EQYA 3IK3A 4QMVA 4DEAA 3MDYA 2YIRA 3GI3A 3QKKA 1K9AA 3GUBA 3NNWA 3BELA 4G6OA 3DKFA 4KD1A 4O7RA 2BFXA 3A7IA 3QLFA 3ACKA 3BYMA 3SA0A 4XEYA 4DLJA 3HP5A 1B38A 3KMWA 4UXLA 5HORA 4UB7A 3C0HA 2XIXA 2OI4X 1W82A 3FZSA 4YR8A 4X3FC 3L8VA 5HICA 1UNLA 3R7GA 1CKIA 2XKEA 2BAKA 2BRHA 1G5SA 2WZJA 4LM5A 2VTOA 4LGDA 4QYFA 2QOQA 4D2TA 4KIKA 1OL2A 3RWQA 4BDEA 2IZUA 1CMKE 4N6YA 4IJ9A 3GXLA 4WG4A 4FIJA 4DINA 4W4WA 3TV4A 4FTKA 4R7HA 3GU7A 3ORIA 2C5XA 4I0RA 4MCVA 1ZYCA 4DF3A 3UMWA 3ROCA 2P2HA 4AZSA 3NX8A 4MKCA 4UYNA 4A4XA 4CFFA 1M2QA 3THBA 3EN4A 3ANRA 4EWHA 3TXOA 5BMSA 5CAOA 1VYWA 1Y8YA 2F7EE 2ITPA 2XCHA 5JFWA 3OTVA 2HZNA 5EYKA 2XK4A 3PIZA 5IQHA 3D83A 4MH7A 3GFEA 4RIXB 5CVGA 3O96A 2J50A 2YACA 4OT6A 2R3KA 5B2MA 1YQJA 2OBJA 4EH8A 4OTWA 4RQVA 2WQOA 4M3QA 3OW4A 2W1HA 4FT0A 4FTLA 3RALA 4H39A 4ACMA 1UWHA 4FG7A 5M08A 4FSYA 3ZXTA 4BHZA 4AZTA 1PMNA 1Q3DA 3DQXA 3DDPA 4CYJA 5LMKA 4CNHA 1W7HA 3GVUA 5CEKA 4ZMFA 2FSLX 4NL0A 4I5CA 4EORA 4LL5A 3MH3A 4Y72A 4Y95A 2R0UA 3V04A 3OT8A 2OK1A 2Y4IB 3QTQA 1W98A 4MQ1A 3W2OA 4EOJA 2NRUA 5ETAA 2H6DA 3MVJA 3O0GA 3LFSA 4GT4A 3NIEA 4C2WA 5JGAA 4XH6A 4O7WA 3LM0A 5LWNA 5IUHA 4AW0A 2OFVA 3BWJA 2VU3A 2WHBA 3QUEA 4RA4A 4YU2A 3NRMA 4ZY4A 2XP2A 4GJ2A 3OXZA 3FMDA 4ZZMA 4NK9A 3DK3A 4BVUA 4F65A 5IEYA 4L3PA 2YM6A 4IB3A 3OMVA 5AAFA 2ITWA 4KRDA 4FSMA 5HLNA 3P1AA 4CFVA 2W7XA 3R1QA 3HDMA 5CU2A 5DR9A 1YDTE 2QOBA 3QUDA 3R9OA 3VNTA 3PXKA 4UMPA 3DXQA 1ZOGA 2XK6A 3I5NA 4IC8A 1U5QA 3WIGA 1R0EA 4NM0A 5TT7A 5AV2A 4RFZA 5GZ8A 5M07A 4IVCA 4UALA 1M2PA 3ZC5A 4BCPA 3NMUF 3V5LA 4RWLA 4BGHA 5J7BA 4U79A 2HELA 3NAYA 1S9JA 4YC8A 4K6ZA 2EUFB 4UMQA 4YLLA 3V51A 1IAHA 5EQEA 3VHKA 3VWAA 4CRSA 2W06A 4U42A 4TN6A 2O0UA 5HE3A 4J99A 2C5NA 2F2CB 4TNBA 4FR4A 1K3AA 2J2IB 2PVJA 4QMMA 1WAKA 4LOQA 4C3FA 2H9VA 3B8RA 4BYIA 3LFQA 2UW6A 4IIRA 2Y9QA 4GG7A 3ZUTA 1SNXA 1BL7A 4H1JA 5EM5A 3V8TA 3A60A 3FEGA 3EKNA 4FZ6A 3P5KA 3GC0A 3NLBA 1B6CB 3D4QA 4E6QA 4JNWA 4FK6A 4K2RA 5LVPA 1YRPA 5DIAA 3LMIA 3MBLA 4I24A 4CLJA 3P0MA 3S0OA 4KBCA 4E26A 1KE8A 5E1EA 3Q2MA 3FZPA 4RG0A 2BVAA 3G2FA 1JSVA 5JMSA 5AAGA 2O3PA 3ORMA 4ASZA 4G5PA 2OJFE 5CASA 3GU6A 3I81A 3A7GA 3CJGA 4EOPA 5AV0A 2PVHA 3R1YA 1RW8A 2XEYA 1Z57A 3CTJA 3NIZA 4IAKA 4U81A 4ZTHA 4RIWA 4E20A 1LPUA 4NYEA 3UGCA 3UP7A 4RFMA 3KRWA 5HD4A 3CC6A 3GC7A 4G3CA 4WT6A 4QPMA 4L44A 3AT3A 3UG1A 2O5KA 2XS0A 4ZMEA 2R3IA 4F63A 4UZDA 4YC6A 3SX9A 2ERZE 3UOHA 2VTIA 5A6NA 2VAGA 1MP8A 3EQIA 4AXAA 2XK7A 4FTOA 4AN9A 3R9RA 3NUNA 4D4SA 4MNEA 3VS7A 2X0GA 5C9CA 3ZMMA 4LFIA 5J5TA 3LCTA 4D4YA 3HRFA 2VD5A 3EQFA 4J98A 4LYNA 3G9NA 5TE0A 1S9IA 4CFXA 1KSWA 4X6QC 2VO6A 4TNDA 3UZPA 3LIJA 3NDMA 2NRYA 3VJNA 4K1BA 4L8MA 4MBLA 5LJJA 3CCNA 2X2LA 4X2KA 3DKGA 4S34A 3KMMA 1OMWA 3UTOA 2RSVA 5CU4A 3AC1A 5FP6A 3R30A 4U3YA 4XOYA 3FZRA 3CS9A 2CN8A 3M2WA 3BE2A 4TZRA 3MB6A 1OL7A 4O6EA 2C3JA 4TYEA 3VS6A 4AS0A 4DGGA 4QP2A 4IDVA 2FB8A 4FTJA 4KKEA 2VTQA 4TXCA 4WNMA 1XHAA 3QLGA 2GHGA 1G8AA 4S33A 4NW6A 4DT8A 5HO7A 4O22A 3R7VA 1OBGA 4AW5A 3PXFA 2PL0A 4NZWB 4ZOGA 4CD0A 5I9ZA 3ZSGA 2YAAA 2JBPA 3WZJA 4BDHA 4USFA 3EIDA 2UUEA 2RKUA 2R3NA 2HWPA 4J96A 3ZBXA 4CZYB 3RZBA 3DKCA 2R3LA 3ZZWA 5GJGA 4G3FA 5CF6A 3MIAA 3OXIA 3OHTA 3TNHA 4W9XA 4HVDA 4YTHA 3PJ2A 2V7AA 3C9WA 4FKQA 4JDIA 2CLXA 3ULIA 3OZ6A 3FY0A 4BI2A 3TI1A 4FEVA 4E5BA 2WGJA 3M11A 3NYNA 3EQDA 3OWLA 5DH3A 3V5JA 4IE9A 4AZVA 2IVUA 2HY81 5AIKA 5EYDA 2QOFA 2QO9A 3GBZA 5EDRA 2JKKA 3DV3A 4CV9A 3RAKA 5BNJA 1DI8A 2CKPA 2X8EA 3FMKA 3GOPA 4XUFA 4Y73A 4AT5A 5DT0A 3SG8A 3S4QA 4BZDA 2YN8A 1TQMA 2Q0NA 4GFOA 3OVVA 4F6WA 4GSBA 1FPUA 2HCKA 2YCSA 4WNPA 5CSHA 3GP0A 3MWUA 3ZLYA 4C2VA 3IDBA 1TQPA 1HCKA 5BVWA 1ZLTA 4BWPA 2BZKB 1JBPE 4FSNA 5L6OA 5M4IA 3FZTA 1OUKA 5AM7A 3DKOA 2XYUA 4KIOA 4YMJA 3DQWA 3D15A 2EXMA 4KKHA 5H8BA 5IPJA 4I4FA 4HCVA 4PPAA 4RGJA 4E3CA 3SG9A 2OWBA 4RIYB 1R78A 1JWHA 3QZGA 5CEMA 3O8UA 1NW1A 4FG8A 4QMLA 4RFYA 5A9UA 5ICPA 2PZPA 3N4TA 4CLIA 2I7QA 3KKVA 5CVHA 3EL8A 4ZP5A 2WTWA 4ASEA 4OTFA 5IUIA 4BCGA 4XMOA 1J7LA 2WNTA 3R9DA 1PHKA 4WG5A 3DLZA 2YWVA 1ZMVA 3R8MA 3M42A 4QO9A 2QNJA 2JD5A 5KNJA 4FTIA 3FC1X 4D0WA 1IA9A 2JKOA 4Q9ZA 3BKBA 3C4XA 4NM7A 4X21A 4B0GA 2JEDA 3OW3A 3SC1A 5FQDC 1XH8A 3QALE 3MY5A 4QTEA 3T3VA 2J0KA 5J5SA 2PYWA 3C51A 3P7CA 5HI2A 4G6LA 3WZUA 4AZFA 4XG7A 5L8KA 3SDJA 4AA0A 4TWCA 4XG9A 1J7UA 4APPA 2EB3A 4DITA 5AR4A 3FQSA 4E4NA 4EH2A 4TWPA 5E8WA 4EH3A 4KUJA 5BMMA 3I4BA 4FI1A 2HZIA 1H08A 1CDKA 4D5HA 3CQEA 4YHTA 2HAKA 4EC9A 5BUEA 2ITQA 3BWFA 1IEPA 1P4FA 4J95A 5CNOA 3V5PA 2QR7A 4QMPA 2VWYA 3KEXA 3BLHA 3R00A 3OCTA 3CEKA 3QHRA 3HUBA 3SOCA 3ZLXA 4DGLC 1U46A 3U4UA 5LVOA 5DBXA 4K9YA 2W05A 2ZDTA 4YJRA 3T3UA 3F3TA 1PYEA 1WBSA 1WBNA 3IONA 4ZZNA 5D7AA 3DBQA 1APME 2XK9A 2CPKE 3OTUA 4GRBA 2HY0A 5F20A 4RC3A 2C6KA 1Q97A 2YDKA 2OSCA 2ZV2A 3DCVA 4WG3A 5EKOA 4IX5A 3BEAA 1PF8A 3PY0A 3W55A 4A07A 4F7JA 4PMSA 4L6QA 4FUYA 3O7LD 3PJ1A 4BB4A 3AC8A 4C35A 3QTXA 4YZNA 3LXPA 2J4ZA 4DEIA 4EHVA 2OU7A 5CEOA 3F69A 3MA6A 5EYCA 1M17A 3TTJA 2WFYA 2JDSA 2SRCA 5G1XA 2XNBA 2HWOA 2R9SA 2PMIA 3HRCA 2P4IA 4FEWA 5IH4A 2YA9A 3PRFA 5KMJA 2QOKA 5CQWA 3UZTA 2CKQA 4O7ZA 4FNXA 4U44A 3LW0A 4YBKA 2E9NA 3OP5A 5BYZA 4IX6A 2WQEA 4PP9A 4NJDA 2XKDA 4O21A 3C0GA 2Z8CA 4QQ5A 4R8QA 1GZNA 3FWQA 4EOOA 4ANSA 2VWBA 3IW5A 4OW8A 4PY1A 4BCQA 3H3CA 1DAWA 3R1SA 4ZAUA 3KULB 4Z3VA 3QRJA 5L2IA 3TJDA 5T68A 3ZXZA 3QYZA 2RFNA 1ZOEA 4NFMA 4AGWA 1L8TA 3B2WA 1CKPA 5FDPA 4RVMA 1PXMA 3PXYA 3MTLA 5EOBA 2R5TA 1Y57A 5DT3A 3GC9A 3DAJA 2CKEA 4XP2A 2XEZA 2VNWA 2XBAA 4WO5A 4UX9A 3QD3A 5E8XA 2VTHA 1UV5A 4OTGA 3W10A 3F88A 3W2CA 2C3IB 5DMZA 5J8IA 3A7JA 4ANQA 5I3OA 3LLTA 5TR6A 3KGAA 5JH6A 3WZKA 4ITJA 5KMLA 2X39A 1YXSA 2C1AA 3RHKA 2W4JA 2GNLA 3P9JA 3Q4UA 4XP0A 4L9IA 4V0GA 5AA8A 4BWXA 1O6LA 4GK3A 1XH9A 4I4EA 3DA6A 5EI8A 2YJRA 4FVPA 4O27B 5L8JA 3UDBA 4A06A 2GNGA 5GHVA 3H9OA 3DTCA 5CU0A 4A9YA 4ZS0A 2B9FA 2VZ6A 2WMAA 5J79A 4IMYA 3D94A 3W2PA 4WRGA 3GOKA 2VTPA 3EZRA 2OLCA 3F2RA 3BX5A 4FTUA 4YBJA 1GIHA 4K33A 3SD0A 4USEA 2I6LA 5C1QB 1FBNA 4BCJA 3VUIA 1R39A 2GNJA 4D58A 4G31A 5I4NA 2XM9A 2HYYA 2OW3A 2RIOA 3FZOA 4IVAA 3DY7A 2QG5A 1YXVA 4HVHA 4FKGA 4KKGA 4FKJA 5AR7A 5HESA 3CGFA 3UO6A 2ZV7A 3BHVA 2H8HA 4M13A 3ALNA 1R1WA 1V0PA 3NW5A 3W2SA 3DBCA 4DH8A 5C27A 4ZTLA 5H9BA 4XOZA 2YLFA 4ANMA 2XUUA 1MRYA 5K5XA 4U7ZA 4YZBA 3JY9A 4AE6A 3HZTA 4OR5A 5JRQA 2REIA 5KMOA 3E8DA 2C5YA 3O23A 4NTTA 3U9NA 4MXXA 3VC4A 1O6YA 3QCYA 3TEIA 4JJRA 2B52A 2WTDA 3MYGA 5IA0A 3TJCA 3HYHA 2HZ0A 4HW7A 3JPVA 4K8AA 2HW6A 5JSMA 3FQHA 4OLIA 5HKMA 3S3IA 4TRLA 2ITUA 2C69A 5HNGA 3ZEPA 4O38A 1MQ4A 5KBQA 4B99A 4EHGA 3KL8A 4R77A 5LWMA 4J7BA 4WBBB 3QTZA 3AOXA 4RX8A 1ATPE 2E2BA 3D2KA 5L2SA 4BDFA 3CXWA 5CAUA 4AFJA 1NVQA 4M67A 2JDVA 4HVIA 4AZWA 2ZM4A 2LAVA 4QPAA 3KXXA 4YSMA 4Z9LA 3E92A 4AOIA 4EL9A 3HL7A 3F2AA 5AP2A 3RZFA 1JVPP 2WU6A 4RQKA 3QRIA 2ESMA 3D5XA 4FKLA 4ZY5A 4L52A 3TIZA 4AT3A 4PNIA 4RMZA 4PF4A 4IWDA 3CE3A 1AD5A 4FK3A 2XJ2A 4XYFA 4DTKA 4QMUA 2HXLA 2C6LA 4TTHB 2WIPA 3COMA 3KB7A 4HGEA 2J9MA 4QMZA 4RJ3A 3DBEA 3RINA 4A9UA 1Q8UA 3PP1A 2VO7A 2VX3A 5EI6A 3L1SA 1W8CA 4NIFA 2R7IA 1H26A 1JQHA 3KA0A 4QTCA 4UWBA 5D7VA 5JN2A 3ROYA 5AFVA 4EOKA 2BAJA 1VR2A 4WBOA 5IA1A 1OIUA 3MFUA 3ODZX 3VQUA 3WYXA 5BVOA 3KVWA 1ND4A 1A9UA 2OH4A 3FMJA 2DYLA 1BL6A 5EI2A 5FLFA 3V8SA 2IW9A 3G51A 1NVSA 5HVKA 1FVVA 1GJOA 3O2MA 1AQ1A 5EHYA 3GGFA 4MXYA 4E4XA 4TW9A 5BUIA 3TDVA 3MY1A 3POOA 2W4KA 4MHAA 4PX6A 4W4VA 3Q4CA 3EMGA 5CWZA 2PVYA 1IAJA 4XCUA 3WF9A 3Q53A 4QTAA 1KOBA 3Q5IA 4RIOA 3AC4A 3K5VA 3T9TA 1JKTA 1LP4A 1K2PA 4ARKA 3KK8A 5T3QA 3QBNA 4M66A 3DFAA 2F49A 2O64A 3ITZA 1OBDA 3P7AA 4BL1A 3Q6WA 1OKVA 5CANA 2X8DA 4D28A 4L45A 3HP2A 4LV8A 4NW5A 2QODA 4UBAA 3TCPA 3R21A 2Y4PA 1YOJA 4G3DA 4KIPA 3R7YA 3BU6A 4JDKA 2C6MA 5IZFA 1WBTA 5IA2A 3ORTA 2Y7JA 3BE9A 4GG5A 4BIDA 5CT0A 3E62A 4XLIA 1QCFA 4ONAA 3OOGA 3VW8A 4HYSA 5AR8A 1KWPA 2QOIA 1OUYA 3LVPA 4MXAA 2KULA 1PXKA 2QU5A 1XJDA 3IKAA 3LFAA 3ORKA 4GEOA 5FM2A 4AE9A 5DWRA 4O86A 3PY1A 4FTNA 4U40A 3VS0A 4DYMA 1QL6A 4RRVA 3K3JA 4I5PA 3R2BA 3SOAA 3BYSA 5F94A 4ASDA 3IW8A 3E88A 5D1JA 2JFMA 3W2RA 4DFBA 1P14A 5HIBA 2GS7A 3QC9A 4C4EA 3HAVA 2C6TA 2W1EA 5IDNA 4I22A 3SRVA 1SVHA 4QYYA 2UVXA 4IAAA 1OVEA 1UU7A 3TIYA 5ANJA 3VQHA 1KE6A 3ZS5A 1QPCA 3CBLA 4KBKA 4ZSLA 5AIRA 4DEHA 1A48A 1IG1A 5ANEA 2E9VA 5KHWA 1Q41A 2PZRA 2PK9A 4P90A 2JAVA 3JUHA 4NUSA 5LQFA 2E9UA 3D9VA 3C5IA 3TUBA 3I7BA 4H05A 4GKIA 2UW9A 2HK5A 1Q8TA 4IANA 3RM7A 1G8SA 3PZHA 3FI3A 2CGVA 2FUMA 3BYOA 4YO6A 1WVXA 3FI2A 4J71A 3D5WA 3UVPA 4XHKB 2UVZA 3OUKA 2UZUE 4AA5A 5IQCA 4YPDA 2CNUA 3DJ5A 4EH7A 1I09A 2CMWA 2WQBA 1UA2A 3QGYA 5JT2A 5EM7A 4M68A 4R1VA 4RWIA 4AN3A 5LCJA 5A4QA 2C5VA 4B4LA 4FV8A 4RX9A 1ERKA 4HGTA 5AV4A 2O8YA 3E3BX 2ERKA 1NXKA 3LPBA 3VBWA 3QA8A 2PULA 2OZOA 1PJKA 3C4WA 1FGIA 4M84A 4NIFB 5AX9A 3R0TA 5LMBA 2X7FA 3ORXA 4FNZA 4CFMA 3TV7A 5L3AA 4FMQA 3VULA 3SKCA 2XNGA 2VX0A 4DEGA 2DUVA 3UODA 3MH0A 2ZV9A 1H24A 1YHSA 2I0HA 2J51A 5B0XA 5A6OA 3LCSA 5BUJA 3SQQA 5HG9A 1YWRA 3CY2A 3AC2A 5AP7A 3WIKA 5CSWA 5KO1A 1X8BA 2OXXA 2XB7A 1H0VA 3F3VA 2OF4A 4I3ZA 2B53A 4LI5A 3BYVA 3PFQA 5KCVA 2XM8A 2ZV8A 4H1MA 3BV3A 4D9UA 5IQBA 3ORNA 3KK9A 5B7VA 5DHJA 3KRRA 3GENA 4QYEA 3E87A 5JZJA 3V5TA 1O9UA 4HOKA 4EK6A 3V6SA 5FBNC 4DFXE 1LUFA 4LMUA 4LGHA 2CLQA 1H27A 4FKWA 5AEPA 3DB8A 4OUCA 2JDRA 2BAQA 2XZSA 5I9WA 2HOGA 4QP3A 4EONA 1YDSE 2EB2A 1Q8WA 1QPJA 3FKNA 2XJ1A 4BDIA 2JIVA 4HVSA 2XRUA 4FEXA 4IM3A 4DCAA 3PXQA 4LG4A 5M56A 2W5HA 1BKXA 3R63A 2ONLC 4FL1A 1QMZA 4W4YA 2V55A 3PLAE 4FTTA 3MH2A 3Q9YA 4YTFA 4FKRA 4ACCA 4UMRA 5FD2A 3PSDA 1H07A 2IPXA 4IZYA 5GJFA 2AC3A 2BZHB 2QLUA 4JR7A 3FY2A 4OTIA 3U6JA 3BQCA 3G33A 4FV9A 5GINE 1XBAA 4WA9A 5AMNA 3HX4A 5EH0A 3BGQA 3QQGA 2GQRA 4GUEA 2V5QA 4USDA 3W18A 4Y8DA 1SNUA 3AQVA 4J52A 4CVAA 3EFLA 1FVRA 1YW2A 4F0IA 5HTBA 2YM5A 4BHNA 2QQ7A 4CT1A 3LJ0A 5CAPA 4DFNA 2X4FA 3JVRA 4WRSA 5EG3A 4YTIA 3R8VA 4X7QA 2Y8OA 3C4ZA 3L9MA 4BRXA 2YDIA 4R5YA 2W5AA 4G1WA 4A4OA 2BALA 2BKKA 3WF6A 4X6RA 4OBOA 4NCTA 4IM2A 2CCHA 4NT4A 3W32A 5HE2A 4N4SA 4J53A 3RK7A 2Z60A 1KV1A 4FSWA 4CYIA 2WMUA 3NSZA 5CF8A 4CCUA 4XLVA 3JVSA 4PPCA 3RAWA 3ETAA 5GZ9A 3FYJX 5EM6A 4NH1A 2ACXA 3P08A 3BBWA 4FSRA 4PL5A 5LVNA 3CKWA 5FXRA 5KMKA 4AW2A 3QD4A 4DTAA 5AR2A 2R3RA 5FEEA 3UIBA 5GIOE 3LCDA 4U43A 5EDPA 2XCKA 1R0PA 3F3UA 4RJ5A 3QX4A 4GH2A 4DG3E 5CSPA 2OIDA 3KU2A 4PUZA 3OEZA 3TDWA 4FV4A 4GUBA 4TPTA 4DH3A 3KC3A 5DFPA 2UZDA 4FZ7A 4F6SA 4ID7A 2PUIA 4JDJA 5AUYA 1WCCA 4C3PA 1M14A 4FT5A 5C26A 2CN5A 4PTGA 5IA5A 3DDQA 3ZHPC 1Q8ZA 4RWJA 3ZM4A 3WZEA 3A4PA 3VBXA 3E3PA 4KNBA 4H3PA 4WSQA 2O65A 2W9ZB 2ONLA 2BFYA 4UZHA 3BHYA 3BHUA 1V0BA 4D1XA 1OB3A 3KMUA 4F1OA 2XIKA 3KXMA 4GU6A 4R3CA 4OAVB 4G6NA 1XR1A 3UC4A 4DA5A 1YI4A 3DXPA 4F9YA 5BYYA 1OKYA 3RKBA 2OFUA 4H58A 4IM0A 5AP4A 2R3GA 4A9RA 5C4LA 5LARA 4BI0A 3L8XA 3OFMA 3MB7A 2QD9A 3LJ1A 3SAYA 5EOLA 3ERKA 3WF8A 1DI9A 2UW8A 3GT8A 4KRCA 4MD8E 4QQJA 4GJ3A 3PTGA 2YCFA 4DE4A 4FF8A 4W4XA 2Y6OA 3R02A 2O2UA 5ETFA 5CEIA 2BRGA 4KS8A 3U4WA 5HLPA 4AN2A 2PE1A 5CXZA 5AWMA 2ZJWA 4EOIA 1LEWA 2CJMA 4JIAA 2E9PA 2WAJA 5IMXA 4ZS4A 3C0IA 5K5NA 1OZ1A 3HEGA 5H8GA 5DYJA 4RZVA 3A61A 3PXZA 4M69A 4R1YA 4HGLA 5CT7A 5DEWA 5KHXA 2XNOA 4N0SA 3F2NA 4IAZA 3QTIA 3OEFX 4AZEA 4ZEGA 4O1PA 3TZ9A 4ALUA 5FGKA 3EN9A 2X6DA 3EN6A 4BBEA 3DU8A 3Q60A 3IS5A 1T45A 4XV2A 5HO6A 3FLZA 3NGAA 3HMNA 3OCGA 4FT9A 2RF9A 4IH8A 3RPVA 3ZFYA 2E9OA 2VTSA 2CSNA 4CFWA 3LAUA 2BTSA 3OWKA 3PG3A 3NNXA 2CNVA 1F3MC 3O71A 2B4SB 4FSUA 2ITTA 4YHJA 5DRDA 4L00A 3VUTA 3Q2JA 3G0FA 2WMRA 4DH5A 2XNNA 4W9WA 3RCDA 4IW0A 3AD5A 2C1BA 1SZMA 3MJ1A 3FXWA 3LXNA 3P79A 4QT1A 4QMNA 3UQCA 4G5JA 3R71A 3FJQE 3R8UA 4FTRA 1YHVA 1URWA 4EH6A 2OXDA 4NM3A 3K3IA 4GIIA 3DJ6A 3FSKA 4FL2A 3V8WA 4BDKA 4RIWB 4BCKA 4AACA 4M14A 1SMHA 3RPRA 2QG7A 1ZXEA 5IH5A 2VTNA 2WIHA 3GCVA 4FX3A 2PVLA 5BX0A 4JRNA 3EL7A 3RNYA 3EHAA 5TKDA 4D0XA 2F7XE 3BPRA 5A4EA 4L43A 2J5FA 4I94A 2CNQA 4QYGA 2DQ7X 5KX8A 4C33A 1PMVA 3HV5A 5CYIA 4E1ZA 2WO6A 1NVRA 2BDJA 4E6DA 3B8QA 4ZJVA 3GC8A 4ASXA 2ZYBA 1H00A 4JG8A 4GFMA 3F3ZA 4C4JA 3ZO4A 2FSTX 3DZOA 4FKTA 4FUXA
chains in the Genus database with same CATH superfamily
5ANOA 3BHTA 4PDPA 4QYHA 3WARA 3BIZA 1G8JA 2B9JA 4ZSJA 2V0DA 5A14A 4NTSA 2QO7A 4C4GA 4LUEA 4KS7A 4FE2A 2H34A 3KXZA 3P4KA 4DHJA 3PWDA 3PRIA 2W0JA 5DPVA 3AMAA 4BGGA 2IZSA 4HPTE 2J0LA 3EQRA 4BDJA 3WZDA 1OL6A 3PYYA 4IEBA 2QU6A 2GDOA 5CS6A 1M7QA 5FP5A 3MVLA 3SHEA 3NUUA 5AP5A 4FV3A 4DCEA 3NYVA 2X9FA 4PNKA 4EEVA 3VS3A 3MGYA 4FKVA 3COHA 4O0VA 4OTRA 5AM6A 3E8EA 4GT3A 4YSJA 4JLCA 4EZ5A 3ZRMA 4NKSA 4TWNA 1XH6A 3IOKA 3UNJA 3CQWA 3OCBA 1UU9A 2IVTA 5A4CA 1OPJA 4F7NA 2ZVAA 4XX9A 4TYIA 1TFFA 5C8MA 1G3NA 2QOLA 3R8LA 4EC8A 3HDNA 1REJA 1OL1A 1Y6BA 3FL5A 4I6BA 2WMXA 3KCFA 4FICA 1GZ8A 3CTQA 4WKQA 5HCYA 5L2WA 3FMEA 4O91A 1GZKA 3Q9ZA 4R78A 3SXSA 3W1FA 3L8PA 4FEUA 3BBTB 4ALVA 5IQEA 2A4LA 3IW7A 4BC6A 3DNEA 4DFZE 4E6CA 3FAAA 5DNRA 2BILB 5JGBA 5HIDA 3ZRKA 4FSZA 5AP6A 3ZUUA 3OROA 3Q4ZA 3QZIA 3UYSA 5JRSA 4UMTA 1GOLA 1XH5A 4U8ZA 4YNOA 1IASA 3DS6A 3EQHA 3FC2A 4MAOA 5TO8A 2F9GA 2FYSA 5ANKA 5EYMA 4EJ7A 3MS9A 3TTIA 3ZM9A 4D5KA 1PXIA 4F0GA 2OO8X 2V22A 3CPBA 4TKSA 5DR6A 3QL8A 4YJVA 3RHXA 3OBJA 3VF9A 4DBXA 2UZOA 4BY9E 5M44A 2X0PA 3QQHA 4HYHA 4ZZOA 2PHKA 2XBJA 4EK4A 3DGKA 3PVGA 5I5ZA 4CGAA 3NNUA 3IOPA 4O4FA 4WUNA 4JQ8A 5DVRA 5L8LA 5LMKC 2ZDUA 2PMOX 1GIIA 3MPTA 1W2FA 4M69B 4WNKA 4XBRA 3RTPA 3VBYA 4JI9A 5K4IA 3SVVA 5DR2A 3F6XA 4GS6A 3IGGA 5KKRB 2VRXA 2UW3A 1KOAA 3Q3BA 3ZZEA 2I0VA 3SRVB 4MX9A 5HTIA 2DS1A 3NCGA 3FL4A 1FOTA 3PG1A 5E8TA 4R7BA 4B9DA 3HV3A 4ITIA 5EK7A 3COKA 2QONA 4AXEA 5IISA 1PKDA 1F5QA 5IQIA 5F9EA 3KF7A 4KABA 3RWPA 3AMYA 4F1TA 2XMYA 3QRKA 4L7FA 4KIKB 4EOSA 3N4UA 4D4VA 1PXOA 1E1XA 5HOAA 1Q4LA 2KTYA 4QMWA 4QD6A 3OY1A 3ZOSA 3FLQA 3KF4A 4J8NA 3OG7A 4WIHA 5EFQA 4JRVA 5I9YA 1JAMA 3MI9A 4CZTA 2YITA 4IHPA 4B6LA 4L3JA 5BVKA 2GFCA 3D14A 3F5XA 1CTPE 3R22A 3ANQA 2PUUA 3GQIA 3NEWA 3BZ3A 4IDTA 4LRMA 3F3WA 4GV1A 4R5SA 4D9TA 3NUYA 3DPKA 3ULZA 2JDTA 2X6EA 3HV6A 3LHJA 4RVKA 5M09A 3TL8A 1WVWA 2B55A 3OY3A 1Y91A 4IVBA 3DK6A 3D7ZA 1U4DA 3I7CA 3RPSA 4GL9A 4DG2E 2XNMA 3VW6A 5HLWA 5LXMA 2W1GA 4FJVA 3UIXA 3HMIA 5CTPA 4A4LA 2X2KA 4D1SA 1TQIA 5IQFA 1Y6AA 4JG6A 3FPQA 2WEVA 4O0WA 4ZLYA 3W0MA 4WHZA 4JAIA 4BCHA 4II5A 2XIZA 4OTPA 4CKRA 3POZA 4I41A 5HVYA 4DHZA 4FZDB 4C34A 4XG8A 5JEBA 5E4HA 5D12A 4O81A 4KSQA 3K2LA 3UNZA 4XNEA 4G3GA 4HCTA 4OTDA 5E7RA 4BN1A 1E1VA 1WBWA 2BKZA 4O7TA 4GFGA 1T46A 4CG8A 2VUWA 3QCQA 3CY3A 3KULA 5ACKA 4FSQA 3MIYA 2BTRA 4DN5A 1NT2A 3UJGA 4O0YA 3QWKA 3FMLA 3QQJA 1PMUA 5CXHA 4I92A 4GU9A 5J95A 3PJ3A 4IB0A 3LQ5A 4LOPA 3H10A 1IA8A 1OM1A 1ZYSA 4EUTA 3UO5A 2WD1A 5HBEA 3FMHA 2JDOA 1P5EA 3QRUA 4X2JA 5C8KA 4D2WA 5TOZA 3FXXA 4DT9A 3DZQA 2VTJA 4L42A 4DGMA 3GEQA 4BWKA 4JOAA 3C4FA 3UOLA 1DS5A 3SLSA 2YM4A 2IF8A 2X0QA 4MBIA 4CRLA 2C4GA 3WILA 4D1ZA 3UVQA 4EH4A 1TKIA 3A7FA 4ENYA 4F7SA 5M51A 3GCQA 3O17A 3H9FA 3Q9XA 4NU1A 5KZ0A 3R9NA 5JK3A 5CU3A 3VF8A 1KV2A 1YWNA 3HUCA 5C03A 4LRKA 4PP7A 1QPDA 4I5MA 4DEBA 3I6WA 5CALA 2PPQA 3EYGA 1Q99A 4R7IA 4FKUA 3UMXA 4M7IA 4G3EA 5B2LA 4CTBA 2W1CA 4U9AA 1ZAOA 4KIQA 3NYXA 4FNWA 4ENXA 3LFEA 4BKYA 4S2ZA 3UOJA 3PZEA 3SGCA 5D41A 3KN6A 2R3FA 2ZMCA 4UWYA 5FWKK 4MF1A 2PMLX 4GVJA 2WQMA 1M52A 2H96A 3PLSA 4AXDA 4H3QA 4NKAA 3D5VA 3K54A 2PU8A 5L2QA 4BICA 2WTVA 3VVHA 5JFXA 4V04A 1H28A 2UZNA 5CNNA 4BZNA 4L46A 2PUPA 1UU8A 4GT5A 4PTEA 4PDOA 5AV3A 4HJOA 1Q3WA 3TZMA 4ALWA 2B0QA 4LUDA 2JLDA 5E1SA 3G6HA 4U0IA 2GNHA 3EKKA 3PE2A 4PTCA 4UXQA 2W1DA 3PDTA 4QP9A 4QMTA 2W5BA 1ZMUA 3FBVA 2UZVA 3A2CA 4QOXA 2NNWB 1Z5MA 1PYXA 3ACJA 3BQRA 3LLAA 4DHIB 4TT7A 2GPHA 1JSUA 3AD4A 2XIYA 2YM3A 1LR4A 1RJBA 3HMMA 4MWHA 3UQGA 3TZ8A 5JFSA 4DLIA 4UV0A 3TNQB 4AGUA 3U8WA 3DB6A 3R8PA 3RI1A 4BDAA 2EU9A 3E64A 4NWMA 4YZCA 2QURA 3Q52A 3S95A 5HNIX 4BF2A 2RGPA 3HAMA 2YJSA 3QQUA 5KMNA 5I9VA 4XP3A 4ACDA 4G2FA 4RIXA 3F5UA 1WFCA 1YWVA 2OZAB 3CD8A 4I6QA 4JIKA 4P7EA 1V0OA 5K9IA 2ZM3A 4U5JA 4MXOA 5D10A 5DG5A 4ANNA 4BDCA 1ZYLA 4ITHA 4H36A 4UEUA 4X2FA 5KE0A 2UZWE 3EZVA 4R6VA 3ALOA 3QCSA 1PXNA 3R83A 4J1RA 4QP4A 3FDNA 4FIHA 2G15A 2VTLA 4HNIA 4N6ZA 4V0GB 3CGOA 2XKCA 3BGZA 3PA3A 2W9FB 1YDRE 4IX3A 3MESA 4XRLA 1UKHA 3RGFA 2R7BA 5FRIA 2G9XA 1U54B 3AC5A 2X4ZA 4JX7A 3E93A 4APCA 2F2UA 5IEXA 3QD0A 3UOKA 5E9EA 1YHWA 4IVDA 2EVAA 1XH7A 4O0UA 5M06A 1FMKA 3HA6A 4C0TA 3A7HA 4XG6A 4YHFA 1XBBA 3U6IA 4MXZA 4RJ8A 4FSTA 2PZIA 4G34A 4F70A 4C36A 4OBQA 3CSVA 3QUPA 3Q6UA 2VWZA 3RCJA 3RBWA 3D5UA 1YVJA 4PMPA 4HPUE 4E6AA 3FE3A 2YHVA 4RLKA 3S00A 2RG5A 3FXZA 3KRXA 4F78A 4DTBA 4O7SA 3A8XA 2XYNA 4M0ZA 2VX1A 4S30A 2PTKA 1WVYA 4BTFA 2WU7A 5E8SA 2B7AA 4O7LA 3FI8A 1OIQA 5TF9A 3VS1A 3T9IA 4O2ZA 3ENHA 3WE8A 4CT2A 3LCKA 3ET7A 2IEWA 5HTCA 1Q62A 2BROA 3HV4A 1HCLA 4P4CA 4RPVA 2W4OA 4YLJA 3ZO1A 4F9AA 3GU5A 1MUOA 5EW3A 4E5WA 4RVLA 1ZOHA 2QO2A 2Y6MA 5H3QA 3NNVA 4RC2A 4O82A 5JQ8A 3V6RA 2IN6A 4FV2A 3DNDA 5GNKA 3ORPA 1JPAA 2XJ0A 2IVVA 2PMNX 5CZHA 4F08A 5K0KA 3SV0A 3NPCA 1OKZA 3OWPA 4ZK5A 5AUXA 3LJ2A 3UDSA 1ZRZA 3LQ8A 4JBVA 5FBOA 1BYGA 2ITNA 3R7OA 5IA4A 4IQ6A 2ITZA 5AUWA 3ATSA 3QU0A 4QRCA 4PQNA 4NCTC 2Z7SA 5CSVA 3RK9A 1PXJA 4YJNA 5HE1A 2A19B 1W0XC 4AGCA 3N9XA 4X0MA 4JQEA 2VWXA 4CFUA 3LFNA 2GS2A 2R3QA 4LDTA 3GFWA 3NW6A 4EQMA 1W2DA 4HNFA 1ST4A 2HIWA 5E8YA 4UWCA 2RL5A 4CSVA 5FUTA 1LEZA 4AF3A 3UIUA 3C1XA 4C57A 4MXCA 3MFRA 3DT1A 2X8IA 5DA3A 3QXPA 3QTWA 2B9HA 3F61A 2VTTA 3DTWA 1VYZA 4BCOA 5HX8A 3LE6A 2GHLA 2ZB0A 2UW4A 4PRJA 2I1MA 4M0YA 2GNFA 4PMMA 4BBFA 2BR1A 4OTQA 4BCFA 4EH9A 3Q96A 1ZYJA 2P55A 5A4LA 3GU4A 2YAKA 2QOCA 3QTRA 3JYAA 4CG9A 3LFCA 5HE0A 5KZIA 3RVGA 5IUGA 5HBHA 4IXPA 4FV7A 4JR3A 3ZBFA 3VRYA 5FTQA 5DE2A 1AGWA 3ZRLA 3ZYAA 4S31A 3DBDA 1GY3A 1RQQA 2R0IA 4O7YA 5IA3A 2BDFA 3CIKA 3AD6A 4KB8A 2W1ZA 2Y4IC 4A9SA 4F6UA 3C50A 2HXQA 2GS6A 3W8LA 1SVGA 3KXNA 4IAFA 1BX6A 2QOOA 3PPZA 4JQ7A 4CEGA 2PSQA 5GIPE 1WMKA 4ZTRA 3WE4A 5CF4A 3TKIA 5ANIA 2P0CA 3GU8A 4QMYA 4TYHB 4TYJA 4EK5A 5EHLA 3DJ7A 4FKSA 4CKJA 5IH6A 4XBUA 3ZUVA 2OH0E 4DEEA 5FG8A 3IDPA 5EQPA 2IWIA 2VTRA 4FVQA 2NO3A 2OXYA 3ZDIA 1XKKA 1Q5KA 3SW7A 3C13A 3CLYA 1CSNA 3QKMA 3G0EA 3ZSHA 3LZBA 5LCKA 1OITA 4MBJA 2YIQA 4ACGA 1H1QA 4Q5EA 1PW2A 5BVEA 2RFEA 1GAGA 4FGRA 5GZAA 4RVTA 3TM0A 5CU6A 3R73A 5DN3A 2QLQA 2XF0A 4EZ7A 5JFVA 3RJCA 3U55A 3EJ1A 3KRLA 3QAME 4IADA 2GQGA 4M12A 1OPLA 3UIMA 3VUMA 4L3LA 4MD9E 3AGLA 5IG1A 2QR8A 2GCDA 2VTAA 3CR0A 4NM5A 2BUJA 2RG6A 4YC3A 2BRMA 2HW7A 3ATTA 4EBWA 4C3RA 2YIXA 4IFCA 1Y8GA 1TVOA 4FKOA 3FMNA 2C0IA 3FQEA 4MEDA 5D9HA 4ZSGA 2CCIA 2WTKC 3A8WA 4EI4A 4RC4A 3OXTA 4PMTA 2C68A 3OBGA 5JZNA 2JC6A 5CI6A 5DGZA 4I1ZA 4GKHA 4O0TA 2Y0AA 3W2QA 4ZSAA 3CTHA 2C3KA 3G9LX 5LMAA 3W0QA 3Q4TA 4C62A 4ERKA 2UZLA 4ANBA 1W83A 3AKKA 3P78A 2FA2A 5FEQA 5HU3A 4LL0A 1JLUE 4ZTNA 4KBAA 2PUNA 2X9EA 3PSBA 4QNAA 1R3CA 3RM6A 4UMUA 2A27A 3W33A 4I93A 2DWBA 4AGDA 4KINA 2PVRA 1NY3A 2OICA 5L6WL 4ZJIA 5L2TA 2JITA 1KUTA 2XNEA 2BIKB 2PVNA 4BI1A 4S32A 4EHEA 3U6HA 3NUSA 4D2RA 5BVFA 5ITAA 2X7GA 5J9ZA 3GB2A 4F64A 2BMCA 2WMTA 2JAMA 5HG8A 3A4OX 2R64A 2I0YA 1YXXA 4X3FB 5DOSA 4EK8A 4YUQA 1DAYA 4D2SA 1B39A 3LMGA 5M57A 1JOWB 3L8SA 4AOJA 3F82A 4AT4A 4E5AX 2ETRA 3FKLA 3KQ7A 2YWPA 3CD3A 4FZAB 4Q2AA 5AAEA 2OG8A 4QQTA 1YI6A 2PVKA 5AX3A 4BTKA 3IO7A 2F4JA 3IQ7A 4LOOA 5C01A 3P7BA 4I0TA 3NWWA 4I5HA 2Z2WA 2FVDA 3PVBA 4QMOA 3PJ8A 1P2AA 1I44A 1CKJA 4IWOA 4J97A 4MQ2A 4BJJB 4JL9A 2CGWA 3DOGA 3NS9A 3RP9A 3PA5A 3TN8A 3LMHA 5IQGA 3LFBA 2IZTA 4PWNA 1L3RE 4O7NA 4XRJA 3UDTA 2WTCA 2ZB1A 5HVJA 2OIBA 2VO3A 4A7CA 2FH9A 4ZSEA 2VWUA 1Q24A 1OIYA 4FODA 4IAYA 3LFDA 4QPSA 4QP6A 4R3RA 4CXAA 2CKOA 3ZEWA 3BCEA 4HGSA 3TNIA 1YXUA 3EQPA 3KY2A 3MVMA 4RJ7A 3V01A 5FXQA 2WMBA 1BI7A 2Z7LA 3BLRA 3ORZA 2G2HA 2XNPA 5HCZA 1J7IA 4MWIA 4EQUA 3C4EA 2VTMA 4NJ3A 4PL3A 3NFGB 4E4MA 3DAKA 3TWJA 1ZARA 2RFSA 2R3HA 2VGOA 3WF5A 3LXKA 5HEZA 4CMUA 2A0CX 1QPEA 3HVCA 4WOVA 3COIA 4IACA 5EKNA 3ZLWA 4OAUC 2IO6A 2QHNA 2R4BA 2EXEA 5E8UA 2AQXA 5HGIA 4O84A 2JKMA 4TWOA 3GQLA 4FNYA 2OIQA 2WEIA 1U54A 4ZTQA 5EM8A 4BYJA 4XG4A 3ODYX 4C02A 3MN3A 3UZRA 4Y46A 3E8CA 4I6HA 1F0QA 2BDWA 5E90A 3MPAA 4FIFA 2QOHA 3UE4A 2OKRA 4DGOA 4E4LA 5HBJA 3JXWA 1YOMA 5EDQA 5KMIA 5H8EA 2JIUA 2YCRA 4YPSA 2RFDA 3QWJA 4JXFA 4JT3A 3KFAA 5IDPA 5BYLA 3R1NA 3U54A 3PXRA 2LGCA 3PVUA 4RA5A 4BCMA 1UWJA 2WPAA 1IR3A 3F5PA 5HD7A 3I5ZA 4QMQA 1G8KA 4B8MA 4FT7A 5J87A 4O83A 4YZDA 1H1SA 4GYGA 3C7QA 3R6XA 3RAIA 5CI7A 3F9NA 4A9TA 2C6EA 2FGIA 3KN5A 4B8LA 3MV5A 4DFYA 4E8AA 3F5GA 3L9NA 4ZY6A 5CENA 4EBVA 3UPZA 4C58A 2PE2A 3HKOA 4D2PA 2AYPA 4FKIA 4BFMA 3HA8A 4B7TA 4JVGA 3FI4A 4ZXTA 4ZTSA 1YI3A 5M4FA 3IDCA 3LXLA 4EZ3A 2YM8A 4CKIA 2J7TA 2VWIA 4XJ0A 4WUAA 4FTCA 3MPMA 4YJQA 3ZU7A 1H25A 4NFNA 4BTJA 2YIYA 4L68A 4TY1A 1ZY5A 4F09A 4CV8A 1VJYA 3ZFXA 1YXTA 2J6MA 4BBMA 3WF7A 3TT0A 1URCA 5K3YA 3BI6A 1STCE 2IVSA 2VO0A 1FQ1B 4MVFA 4CMOA 4FVRA 3PUPA 4M8TA 4YJPA 4AXFA 4GIHA 4FYNA 4RBLA 3NW7A 1YKRA 1EH4A 3O8PA 4N70A 1SVEA 4U97A 3QRTA 4GMYA 1OGUA 2EXCX 2Z7RA 3VBQA 1UU3A 3O7LB 3SW4A 4WSYA 4K77A 5CAVA 1MQBA 4MF0A 3E8NA 4O2PA 3P5JC 1A06A 4LQMA 3PY3A 4FV1A 2UZTA 4IX4A 3WI6A 4G9CA 3QQFA 4BKZA 1SYKA 4Y85A 3BRBA 4PL4A 3V5QA 5L4QA 5F1ZA 3I6UA 4G9RA 1UNHA 1BLXA 4M15A 2WOUA 2YFXA 5BVDA 4O96A 3TV6A 4QTBA 2G01A 3F7ZA 5LOHA 1O6KA 2IZRA 1E9HA 3ORLA 1H1RA 4IBMA 3TNPC 4AOTA 1GNGA 3LOKA 5A4TA 4RT7A 2GNIA 4XV3A 2VNYA 3O8TA 5FTOA 4EOQA 5L6PA 3OS3A 4K11A 5EW9A 3RNIA 4EHZA 5J9LA 3EQBA 2VWVA 2WTIA 4X2NA 3UPXA 3ID6C 4XV9A 4BDGA 4AQCA 4DGNA 3PP0A 3OF0A 4QMSA 2BZIB 2YIWA 1J3HA 4I23A 4OBPA 3WBLA 4AU8A 3G5DA 2UZEA 4BIEA 4DH7A 2GTMA 3JY0A 4JBPA 4QMXA 4W8DA 3NYOA 2UZBA 4I20A 3VIDA 2PVFA 5J1VA 3AMBA 2ITOA 3FPMA 4ANOA 2JFLA 1XQZA 3EN7A 4L53A 2ETMA 5I0BA 3QCXA 3TUDA 3KXHA 1Q8YA 4YO4A 3FMMA 4FV6A 1W2CA 2VV9A 5AUUA 4J8MA 5ANGA 3QQKA 2XK8A 2ITVA 4JBQA 4L01A 4PDYA 2W17A 2Z7QA 2UV2A 1XH4A 5EHOA 5CVFA 1WBPA 1RE8A 5IQDA 4P5QA 5HO8A 3R9HA 2GQSA 5LVLA 3QC4A 4MNEB 1XO2B 4YJUA 2OJGA 3AG9A 3ZONA 3AT2A 3I1AA 4YGAA 4F4PA 3BLQA 1KE5A 1BI8A 4EKKA 2GU8A 2YCQA 4IFGA 4RIYA 1U5RA 3MSSA 3OOMA 4GVAA 2W1IA 1H4LA 4FT3A 2PWLA 4LGGA 2PZYA 4IWQA 3O51A 4IJPA 3MJ2A 4O4EA 3AXWA 2GHMA 5HX6A 4BDDA 3QKLA 4Z55A 2J0JA 4BCNA 5DI1A 3ZH8A 4KA3A 2GFSA 4Z7GA 1H8FA 2C6IA 2EWAA 5E92A 3VUDA 3H9RA 3QZFA 4UYAA 2XKFA 3K5UA 3L9LA 4KSPA 4O0RA 3TKHA 3II5A 4E73A 1CM8A 3N51A 5AP0A 3VAPA 4HCUA 3JR1A 3LFFA 3UNKA 2J0MB 3KCKA 4F7LA 1PRYA 4TYGA 5I3RA 3HMOA 1XWSA 4MTAA 2O63A 4C4FA 5HZNA 2W99B 3CQUA 4FV5A 2ITYA 2R3MA 3LCOA 4O0XA 4FA2A 4C61A 2W96B 3UG2A 2G1TA 2X81A 2WMWA 4RSSA 3VBVA 3PA4A 4I6FA 4UY9A 5FTGA 4U3ZA 4FBXA 4DG0E 3B2TA 2I0EA 3BU5A 3UBDA 4D4RA 4CMTA 3EFKA 3I60A 5DT4A 4TL0A 3UVRA 4EOLA 5HNBA 3BEGA 5A46A 5BQ0A 1VZOA 2QKWB 4FEQA 3EB0A 3HNGA 5I9XA 2XRWA 3FV8A 3Q9WA 3REPA 1JKSA 4LMNA 4RWKA 3CKXA 4YJTA 4BTMA 2F57A 4AUAA 2WMVA 2C5OA 5CEPA 1FVTA 4C38A 4QP1A 3OT3A 2OJJA 4KAOA 4E93A 4IZAA 2WQNA 3E63A 2UW0A 3NVKI 4ZTMA 2QKRA 2OJIA 1OGYA 2UW5A 4X3FA 3MY0A 2CGXA 5CY3A 3D2IA 3HECA 5ETIA 5F4NA 4EYMA 3P86A 3DFCB 3CJFA 2YDJA 4C4HA 5AP1A 3FLYA 1PKGA 5H2UA 4EK3A 1WBVA 4C7TA 3KXGA 4O6LA 3U87A 1JSTA 4F9WA 3RMFA 4DC2A 5CF5A 5K4JA 1GIJA 3DK7A 3E7VA 5C8NA 5KBRA 1BUHA 5CEQA 4YLKA 2HZ4A 3ELJA 3HMPA 1JNKA 5T6KA 5ANDA 4EOMA 5HIEA 2C3LA 5BVNA 3IW4A 4TYHA 4I21A 3MFTA 3RPOA 5EW8A 3ZO2A 4OGRA 4RX7A 5C4KA 4FTAA 1V1KA 3F7WA 3QQLA 4IZ7A 3OCSA 1Q61A 5B2KA 2YZAA 4Z16A 4BR3A 4E7WA 4MUQA 5IQAA 3UP2A 3TZ7A 3VS5A 4QP8A 2OF2A 3HV7A 2ITXA 1J1CA 3EYHA 3P23A 1JKKA 3CPCA 5AUZA 3PIYA 4YP8A 3ZDUA 4AA4A 4DBNA 5LVMA 3NUAA 3VUHA 3PE1A 3I0OA 3RK5A 2P2IA 3NAXA 1GZOA 2NP8A 3FLSA 3KVXA 4IWPA 5A54A 2XIRA 4NEUA 4K18A 5AA9A 3BLAA 4O7VA 3HLLA 4JAJA 3QTSA 2AUHA 3FUPA 1MRUA 2YERA 3H4JA 4YTCA 1IRKA 1MRVA 2WMQA 1W84A 4YZMA 4QNYA 5J9YA 5JKGA 4ZLOA 1H0WA 3NUXA 2AC5A 2WELA 4PDSA 3OWJA 4RJ4A 3D7TA 3DLSA 3G6GA 4BCIA 4C59A 4HZSA 4Y5HA 3NCZA 3EQCA 4AFEA 4DAWA 4Y5QA 3RPYA 3QHWA 4JDHA 1DM2A 5HCXA 3FYKX 2FSOX 4FGBA 2XANA 3A99A 2ZOQA 3R8ZA 4BKJA 3H0YA 3EWHA 5CSXA 3KIOC 1VEBA 1OKWA 4ZLZA 3AT4A 3IW6A 5HG5A 3ZC6A 1WBOA 3R04A 4R3PA 4EWQA 3FHRA 1OI9A 3SXRA 4KWPA 3UO4A 2WKMA 3VS2A 1ZYDA 2WTJA 4GW8A 3QA0A 3G90X 5GJDA 3ZFMA 4W8EA 5E8ZA 1U59A 5CX9A 4RJ6A 2IW8A 4AAAA 4HZRA 4CCBA 4DEDA 3VO3A 3V5WA 3EH9A 5F95A 3VBTA 3LM5A 2JBOA 2ZAZA 4XV1A 5M4UA 2GSFA 4QEBA 3IGOA 4FV0A 4ERWA 2R3PA 4X2GA 4FTMA 1H1PA 2YLEA 4IB5A 5FEDA 3EN5A 4GYIA 3HGKA 3ZLSA 1REKA 2GMXA 4GK4A 1UNGA 4DH1A 3OD6X 2P33A 3GCSA 2WMSA 2XK3A 4EUUA 3TUCA 3WOWA 3E7OA 1ZWSA 2QCSA 2YISA 3H30A 3L9PA 3R01A 4C8BA 3MFSA 2VN9A 2V7OA 3UC3A 4G16A 4PPBA 2QVSE 3NR9A 2BHHA 4BDBA 2XH5A 2B9IA 4Q9SA 3R7IA 3DBFA 3LKMA 3DAEA 4XS2A 2GTNA 3NZ0A 3VHEA 4ANLA 4HYUA 3OUNB 1M7NA 4JX3A 4K0YA 2C6OA 2FO0A 3GNIB 4XG3A 5CLPA 4EJNA 4NSTA 1H1WA 4L67A 5HU9A 3BYUA 4UN0C 2P3GX 4U80A 5G6VA 1OPKA 2WOTA 5CZIA 2X2MA 5FXSA 4V05A 4FTQA 1SM2A 3BV2A 3EFJA 3C4CA 1PY5A 5M53A 4U6RA 3R7UA 4P2KA 2IG7A 1RDQE 1UVRA 2HENA 2PZ5A 1KE7A 2YEXA 3O50A 4FOCA 4DHFA 3PPJA 3VJOA 4EKLA 1FINA 4JG7A 2C30A 3EOCA 3R28A 2CHLA 5DRBA 3D0EA 3MW1A 4RX5A 4Z7HA 2JIIA 4I0SA 2C0OA 5K0XA 2R2PA 4AW1A 3PIXA 4G17A 4IAIA 3FZ1A 2A2AA 1OECA 2JGZA 2ZM1A 4O1OA 2FSMX 1M2RA 3CP9A 2CGUA 5AV1A 3GCUA 3S1HA 4V01A 3AKJA 2R3JA 4C37A 5IU2A 2BZJA 4O4DA 3IECA 4YZ9A 5IKWA 2ZMDA 4YNEA 4ZJJA 5FM3A 4D2VA 4QQCA 3U9CA 4HVGA 3FLWA 3QF9A 4BZOA 5DEYA 3PVWA 2Z02A 4U41A 3ZCLA 4FIIA 2W1FA 1PMEA 4BGQA 2OGVA 4CQGA 4OTHA 5KMMA 3W0SA 4EYJA 1JKLA 4LRJA 4RZWA 5JQ5A 2F7ZE 4CZUA 5IF1A 4EQCA 3VRZA 3TNWA 3A62A 4MD7E 2X1NA 3C5UA 2R3OA 3JS2A 4C4IA 3I0QA 3RAHA 4N57A 5BPYA 4QP7A 4HYIA 3VUKA 2YM7A 5AR3A 4LV5A 2XA4A 3GCPA 2BIYA 2YZLA 3TG1A 3IG7A 4F99A 5IMEA 2IJMA 2XVDA 2WB8A 2V62A 4FYOA 3PSCA 2BPMA 4D55A 4F9CA 5M4CA 5DLSA 1ZZLA 4MYGA 3S2PA 4AP7A 4FL3A 2UVYA 2A1AB 3QGWA 5I9UA 1FMOE 3PWYA 3Q5ZA 1FGKA 2B54A 2UW7A 4EH5A 2OJ9A 4QTDA 3QD2B 2C47A 2PE0A 3PPKA 4DFLA 4H3BA 3D7TB 5AUVA 4AWIA 3TACA 4PV0A 3IPHA 5KUPA 2I40A 1ZZ2A 2YABA 3ZSIA 3G15A 3M1SA 4YURA 2BHEA 4IB1A 4L7SA 3R2YA 4AX8A 1PXLA 3LQ3A 1Z9XA 3NUPA 4FKPA 3W16A 2Q83A 2X7OA 3VS4A 2J0IA 5IEVA 3BHHA 5AUTA 4M97A 4ORKA 4BIBA 5AADA 4DFUA