2QO2A

Human epha3 kinase and juxtamembrane region, dephosphorylated, apo structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
282
Chain Sequence
TYVDPHEDPTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 282
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo2A01
3QQLA 4CNHA 4WNKA 4PRJA 5EQYA 1Y6BA 2VTSA 4PP7A 2WQOA 4XLVA 5FLFA 3VBVA 4E5AX 4JBVA 4ZSAA 1XHAA 4QMVA 4BCIA 4M7IA 5LMKA 2PULA 3EYHA 2YIRA 4IBMA 4FV1A 4GH2A 3V5TA 4NW6A 2VTJA 3LFBA 3OD6X 2JD5A 5CQUA 4D2VA 3W18A 3A4OX 1M2RA 1PXKA 3ZDIA 4G17A 3DK3A 4IM0A 4BL1A 4H3QA 4AA5A 4ERKA 4GVJA 4S30A 3IO7A 3O17A 4W4WA 4YP8A 3R7VA 1J7UA 3IGGA 2WQEA 2IVUA 2UZVA 5HOAA 3FJQE 3PJ1A 5CU0A 3VBXA 4EC8A 2O5KA 4CGAA 3LE6A 1V1KA 2QOBA 3R8UA 4ZS4A 3BV3A 3T9IA 1JBPE 4CFNA 3HYHA 3I5NA 4PNKA 4YR8A 4GIIA 3C4FA 4LRMA 2ITNA 3I7CA 4FV2A 3NMUF 5ICPA 4KRCA 2BRGA 3G0EA 4U9AA 2C5YA 2P55A 3UP7A 4OLIA 3I81A 3MVMA 5E8VA 4E4NA 3ZM4A 2JDRA 4BGQA 3VO3A 3ZLSA 2HZ4A 4AP7A 2VTMA 4QQJA 5L3AA 2F57A 3KGAA 3AG9A 4FGBA 3CPBA 3EWHA 3ZZWA 3TZ7A 1KSWA 5IA3A 4EOJA 1PRYA 1Q62A 2P2IA 2XUUA 3D2IA 3LCTA 3ZRLA 1TQMA 4EQUA 3E7OA 3SG9A 4J95A 4YZMA 4BCHA 1O6KA 3KF7A 3P7BA 3PWDA 4PTGA 1SVHA 2F9GA 1LEZA 5D10A 3W32A 4GJ3A 1WCCA 5KMLA 2CGUA 2WELA 3UC4A 5AP3A 4RIXB 5DIAA 1OL6A 1BL6A 2IO6A 4TNDA 3NUAA 4X6QC 2P33A 5M08A 2CGVA 2WMBA 4BDIA 2ZDUA 2C6MA 3LFAA 3OBGA 1H0VA 2VWZA 4XP2A 5B2KA 4DN5A 3Q96A 5LVPA 4FVPA 4JAIA 4S32A 3R02A 3KEXA 2FVDA 2VX3A 4DEHA 2XK8A 3VS5A 5E91A 2R7IA 5FD2A 3ZFXA 4OAUC 4YHTA 3CQUA 4I6FA 2YJRA 2G2HA 3F3TA 5HTIA 2IWIA 3BEGA 5LVMA 5FM3A 4NK9A 3SGCA 2XA4A 5HORA 5EKNA 5AX3A 4PV0A 3UOLA 4RX7A 1PYEA 3UG2A 4U97A 3UQGA 2YCFA 3UBDA 3RAKA 4Q9SA 4QT1A 3V6SA 4C37A 5J7BA 5IQDA 3OF0A 3W2SA 4D5KA 3U55A 3SVVA 5T6KA 5AAFA 4Q5HA 5HX6A 5H8BA 2FUMA 2W1GA 3A4PA 3MW1A 4JS8A 4Y73A 3SDJA 4AG8A 2GNJA 3TT0A 4LMUA 5ETIA 3HMPA 4FG9A 4QNAA 5C01A 3F6XA 3D14A 4DTAA 4F7LA 4CVAA 1H1RA 3OEZA 5GZ9A 3P23A 2CKQA 4I5PA 5DR6A 2OICA 1B39A 2IZRA 4UZHA 2C3JA 4CZTA 4GKIA 4IAZA 4Y8DA 5L4QA 3EQBA 3PXRA 3QL8A 1OZ1A 2QR8A 4PDSA 4RIOA 3ZS5A 4BRXA 3PJCA 3PPZA 3ZUTA 3ODYX 3RGFA 4DTBA 4DC2A 3FQHA 1IASA 4XG7A 3OEFX 1XH7A 4QPMA 2QKWB 2XB7A 4UX9A 4C2VA 2RGPA 4FKVA 3G9LX 3QAME 2GU8A 4YTHA 4L68A 1BMKA 3QTIA 4JX7A 2CNVA 2OH4A 1P5EA 2XEYA 3AC3A 4FSZA 4KBCA 3HLLA 3MYGA 3HMNA 3SXFA 4EH3A 3F5GA 4C3RA 5C4KA 2OWBA 4I5CA 3OUKA 5LCJA 2X4FA 2OIDA 2JFLA 3QTZA 3MTFA 4C34A 4IB1A 3QTSA 4NYEA 2GCDA 3EL7A 4JG7A 4QP1A 4G3FA 3BU6A 4GSBA 3MFUA 3FZOA 5T3QA 3W33A 3VQHA 3TACA 5CASA 2Y4IC 5KMIA 3LCOA 3OVVA 2C6LA 4C02A 1YXSA 2QOCA 3JY0A 3O0GA 2Q83A 5JEBA 4MWHA 3KU2A 1G8SA 3LZBA 1MRYA 3TNWA 3ZRKA 3OP5A 3THBA 3T8OA 4LUDA 2BRNA 4A9SA 5CZIA 1G5SA 4C7TA 3LM0A 2W5AA 4PTEA 5AP6A 1PXOA 5AV3A 3T3UA 3D5UA 2VZ6A 4Z7HA 1H08A 5JFVA 4X3FB 4FSYA 2F49A 5DYJA 3ZZEA 1PMVA 4Z16A 1G3NA 3UMWA 3D4QA 4BWPA 1WBOA 2HY81 2QG5A 3QXOA 4WRGA 4YBJA 5FTOA 3RCJA 4AN2A 3ZO3A 2I0HA 4E26A 1YI4A 4Y83A 3R01A 3GCUA 4EK8A 2WTIA 1KE6A 4NKSA 4FIJA 1Z9XA 3EH9A 3FSFA 4E93A 4FZAB 3EQCA 4BDCA 3JR1A 3F5XA 2R3HA 4BDAA 3ZXZA 4FIHA 1GAGA 2IZUA 1AGWA 4EEVA 3AC8A 3IOKA 1ZXEA 2HYYA 1URWA 2ITPA 2QOIA 3FZRA 3OWPA 4RLKA 3BLRA 4FKRA 4FV7A 4IADA 4IC7A 2VX0A 3PG3A 4IB3A 2R3FA 3DB6A 3BV2A 4GFOA 4W9WA 4CKIA 4FSMA 4FZ7A 1YDRE 3WZJA 2Z60A 3KXHA 3ZRMA 4HYSA 3UOHA 4H1MA 4O2ZA 2ITXA 5BVKA 4IZ5A 4JDJA 1DS5A 4ERWA 3QTRA 3GBZA 3QRJA 2BZJA 3QTWA 2BZIB 3RPSA 4F08A 3UIBA 4ZJVA 1JAMA 3V5QA 2H9VA 2IVVA 2O0UA 4ZJIA 4R3CA 4TYHB 3QLFA 3V8WA 5JQ8A 3UG1A 2OBJA 4X2FA 4A4XA 4FKWA 4WRSA 3RHKA 2XP2A 2BDWA 1YHSA 1R39A 5EOLA 2QO7A 3QTXA 4CYJA 3ET7A 4TWOA 5AA9A 4UB7A 4FTOA 3TZMA 3PJ8A 4KIKB 4XG6A 3PXYA 4FTRA 4CCBA 5J9LA 2YCSA 5IA1A 5A3XA 4G1WA 1S9IA 4AWIA 1L8TA 4FT5A 4FC0A 5IPJA 1F3MC 2RFDA 1FBNA 1FPUA 3PIXA 2A2AA 5HBHA 3ZSHA 4C4EA 3QA0A 2Y4PA 1O6YA 4PPBA 1RJBA 1YDTE 2W7XA 4KD1A 3VHEA 4EK5A 3G15A 4QQTA 4C2WA 3VS7A 3QKLA 2X1NA 3I1AA 4HCTA 1M2QA 2VWIA 2HCKA 1APME 2ITQA 2PY3A 4M12A 2HZ0A 2UZOA 4QP2A 4U45A 5KO1A 3HAVA 4FR4A 5LVLA 5E8WA 4ZTLA 1AD5A 1REKA 1PXMA 3TJCA 3H9OA 4FV8A 3E62A 5AM6A 3UMXA 1ZYSA 4QTDA 2XYNA 3JVRA 1OL1A 2B9JA 1FOTA 3ORPA 3OT8A 4FT7A 3C1XA 4QYEA 5EHYA 4O7SA 1CMKE 2QURA 5L8KA 5L2SA 5B2LA 2Y8OA 1XJDA 2DS1A 2A0CX 4W4YA 4YSMA 2XCHA 5TR6A 3NVKI 4YLKA 3WE8A 4AFJA 4TZRA 3EQPA 5BVDA 3PPKA 4EOPA 4KRDA 3QUDA 3I0QA 4R7IA 3PA5A 5AUWA 4E6AA 2YHVA 2Z8CA 4F1TA 4ZTSA 3R7GA 3NUPA 4FKJA 5FEEA 1NA7A 5M4FA 1CKPA 2VU3A 2UZLA 3TIZA 4K33A 3A7HA 3LLAA 3QWJA 2OZOA 3G6HA 3BHYA 2HZNA 3GXLA 2GFCA 3BE2A 5JMSA 2DUVA 3PJ2A 1LPUA 5FQDC 4IZ7A 4ANSA 3ULIA 5AUTA 4YTFA 2UW5A 3PPJA 4LL5A 4F4PA 4BZNA 3FPMA 3O23A 4PMSA 4DEBA 5JFWA 1ZZ2A 3QA8A 2HW6A 3BHTA 4E4LA 4TW9A 4ZS0A 3MPTA 4FTNA 3EQHA 3MH0A 3P78A 4O21A 4EBVA 4QD6A 4RA5A 4YJOA 3MV5A 3NAXA 1OKWA 5E92A 4YJUA 3UVPA 3VUKA 4C4FA 2ITZA 4FV4A 5CF8A 4APCA 2Q0NA 2R3GA 4CEGA 3F3VA 3TCPA 4KIPA 4CFVA 1FINA 1OBGA 5EFQA 5A54A 5IQHA 1PF8A 5LJJA 3VC4A 2R4BA 3IW8A 2ZV2A 4NCTC 4QRCA 2WIPA 2BAJA 4EH9A 4V01A 4EYMA 3CLYA 5BQ0A 4C8BA 3P7AA 4RC3A 5B7VA 3UPXA 1Q5KA 3GOPA 2ZOQA 1PXNA 3II5A 5D11A 3OTUA 3PXZA 2ONLC 3C50A 3FZTA 1WBWA 3KL8A 4G9CA 3RK5A 3VUMA 4HVHA 3F2RA 4DH7A 3A7IA 5BYYA 5LOHA 4L3LA 3HGKA 4KS7A 3BWFA 3SHEA 3PXFA 2ITTA 5EHLA 4O7TA 5DRBA 1ZAOA 3C51A 3LQ3A 4MD8E 3R9HA 3DJ6A 3GU5A 5HEZA 5EM6A 2XKCA 1YXUA 4I0RA 2DQ7X 3C0IA 4WO5A 2IZTA 5M51A 5AP5A 4U3ZA 1G8AA 3OCSA 3PVWA 1GZKA 2GS7A 3U6JA 2R3PA 2RF9A 1SVGA 4ZZMA 4BYJA 1V0OA 3SRVA 2WOUA 4JI9A 3RBWA 4XV9A 5CSVA 2WMVA 4O7ZA 3GC0A 2XJ0A 3QKMA 4O2PA 4DE4A 5AP4A 4Z3VA 3TZ8A 3RAWA 4D1SA 3MA6A 4YBKA 3K5VA 5L2QA 1P4OA 1PKDA 4RVKA 4F65A 2PYWA 4JG6A 4XV3A 4YHFA 3HV3A 4S34A 5IEVA 1W83A 2YACA 4RIYA 5EHOA 3ZEWA 3FKOA 3EJ1A 3F61A 3W8LA 1NVQA 3QU0A 3GFEA 5DN3A 4E8AA 5DVRA 3DOGA 5KKRB 4GU6A 4DLJA 5L2TA 2JKKA 2X8IA 3RTPA 2ESMA 2PVHA 4EWHA 5BUJA 3ANQA 3VJNA 3HECA 4D9TA 3DK6A 3OWLA 5EK7A 2VWUA 4I23A 3DB8A 2PMNX 4WOVA 3QQUA 4XP3A 3PIZA 3Q6WA 1Q41A 5FM2A 3DBQA 3O8UA 4PMTA 4FZ6A 2H6DA 3O71A 3OWKA 3TTIA 2GNLA 3OCTA 3CPCA 4RFMA 2YITA 3FLYA 4BDJA 4ZP5A 3HV5A 3R2YA 4MF0A 4DT8A 5ANIA 4CLJA 4F9CA 5AA8A 3AT2A 3DAEA 2JBOA 4GT4A 3FDNA 5EYMA 4IMYA 2GFSA 2BR1A 2YM6A 4TNBA 3MDYA 4XG4A 2G15A 5IA2A 5HI2A 3GEQA 4O7LA 2X0GA 5HE0A 4G31A 2JAVA 3DZQA 1J3HA 1JQHA 1Q8UA 5AAEA 4N4SA 4JLCA 4U43A 1AQ1A 2ERKA 3MB7A 5L2IA 3KCFA 3UZTA 2PL0A 4TYGA 2QODA 3FI8A 1XBCA 4FTUA 2ZYBA 3F3WA 4RX8A 4YO4A 3BI6A 2XNBA 3UO4A 3SV0A 3Q4ZA 3U9CA 5HIBA 3Q9XA 3NUXA 4JRVA 2RFNA 1Q8YA 2JBPA 2JIIA 1TQIA 2OXXA 3KQ7A 3FPQA 3PXQA 3QRKA 5CAVA 4MXCA 2VN9A 2UVYA 3HL7A 2YWVA 3NWWA 1TKIA 2WMQA 4YSJA 3PIYA 2PMOX 3UNJA 1OIQA 5ANJA 1XBBA 4R7BA 3O7LD 3LJ1A 4ZIMA 2OF4A 2SRCA 1R78A 5HU9A 4II5A 4XHKB 2PVNA 2XJ2A 3CE3A 5TOZA 3KCKA 4YC3A 5JRQA 3G33A 2GS6A 4DFBA 1A06A 4EJNA 5CALA 2HOGA 4FEWA 2CNUA 4IC8A 2C0IA 4NJDA 3A2CA 2YWPA 2QO9A 4TYIA 1VYZA 5TKDA 4BHZA 2VTTA 3FE3A 4DFLA 3PA3A 4K6ZA 4ANNA 4FKUA 4LGGA 2OGVA 3QQKA 3SLSA 3TNIA 3PSCA 4D5HA 3KULA 1K3AA 1XH4A 1UV5A 3WIGA 3JS2A 3JYAA 4A9UA 3NIZA 4E5BA 4E5WA 4ZK5A 3RZFA 1GIHA 1K2PA 2NO3A 4C3PA 4U5JA 4O6EA 3LMGA 4DG0E 3ZUUA 3PY1A 3EN4A 4KA3A 1JOWB 5C9CA 2OZAA 2E9VA 5FEDA 3Q3BA 4BCNA 1L3RE 4ACHA 2O65A 2XBAA 4L44A 3KF4A 2YLFA 3E7VA 4TWNA 5EW8A 5KMOA 3FL5A 4FTKA 3IW5A 3M1SA 3ZXTA 4NH1A 3JXWA 3AGMA 5HO8A 5A4CA 3R6XA 2FH9A 5DNRA 3FI3A 4E73A 2C47A 5KBRA 3NAYA 3NGAA 3UOKA 1OKYA 2QOOA 2Y6OA 4MK0A 4S2ZA 4RZVA 4BKJA 1H01A 5EH0A 3O51A 3DBEA 2X7GA 1LUFA 3NSZA 3ZM9A 3IS5A 2C3KA 4QYGA 3BGZA 3GI3A 2ITWA 3K2LA 4RGJA 2OFUA 2GTNA 4IVBA 3O50A 4PMMA 2ITVA 2WU7A 4BR3A 2JDTA 1OI9A 2C6EA 1BL7A 2Y6MA 1VYWA 2VTQA 1GZ8A 3QBNA 4MEDA 4Y85A 5JZNA 3ROYA 5IH4A 3E3BX 3UYSA 3NCZA 4F7NA 5M57A 1UNHA 3K54A 4GYGA 2F2UA 4QPAA 2QQ7A 3GGFA 3FHIA 2QOLA 2WTKC 4DGNA 2C4GA 4WA9A 3N4TA 5AIRA 3R2BA 3GC7A 4BBFA 1WBNA 3G51A 4QP6A 4QMXA 2PVFA 4D2SA 2GQRA 1WFCA 4ALVA 3PY3A 4CG8A 3DAJA 4YNEA 1CKIA 4RJ4A 4C4GA 2UW9A 5ANKA 4R5SA 4I6QA 3O8TA 2VV9A 3MFSA 3VW8A 4RG0A 3E8EA 2AYPA 4YURA 2I0VA 3PP1A 4EH5A 4R78A 3ZLWA 1QPCA 4AZSA 4BTFA 3KVXA 1ZOHA 3V04A 2R2PA 4USFA 4ZZOA 4GK4A 3P7CA 4IVAA 5H8GA 4DINA 4EK4A 3LJ0A 4R3PA 1OM1A 4E6DA 4AA0A 5DPVA 1RW8A 2PVLA 3CKXA 3FYKX 3OY1A 4RWIA 3LFDA 4XRLA 4IVCA 4OT5A 2PZPA 2QOQA 4IX6A 4GMYA 3TEIA 5FDPA 3Q60A 3FI4A 4E4MA 3HZTA 2JFMA 4FV6A 4DEGA 1UA2A 4NFMA 3HVCA 2WTDA 2OIQA 2VO7A 3PRFA 4X2NA 4RSSA 2XNMA 1SMHA 2C5NA 1Q8WA 4FKLA 5BMSA 2ONLA 3PY0A 5A6NA 3C5IA 3EKKA 4K11A 4QPSA 2R64A 3OG7A 4P90A 3TG1A 4XCUA 5L6PA 2BZHB 2OLCA 4FEVA 2QKRA 4H1JA 2UW6A 4O22A 4HGTA 4WBBB 4H3BA 4L9IA 5ACBC 3IG7A 4HNIA 4M67A 5J8IA 2FA2A 2OU7A 2R3MA 2XIZA 1YOJA 5CEMA 4J7BA 4I21A 4ZY6A 3Q9ZA 1IAJA 1H27A 3R7IA 4S33A 3QZGA 3REPA 2CNQA 1H4LA 3P79A 4FTQA 3UIMA 3DNDA 4BIDA 2YAKA 4EZ5A 4CV9A 5HU3A 4P4CA 4WUNA 2AC3A 2JKOA 4WSQA 2C3LA 4L6QA 4O0VA 4EHEA 4XG9A 5GINE 1MRVA 1ZYLA 3QZHA 2OI4X 4C4IA 4LOOA 3VBWA 4G5JA 3I6WA 4FT9A 4JIAA 3KREA 5KZIA 4M15A 3OW4A 4A4OA 3P08A 2YA9A 4GFGA 4HGSA 1LR4A 3QWKA 1JWHA 1Q8TA 1W0XC 2WU6A 2W4KA 3KRWA 4OBPA 5BVEA 3VRYA 3RM6A 3V8SA 4BFMA 2QD9A 4RC2A 2GNGA 2B9HA 3AD5A 3R8MA 4MBJA 5HHWA 2P3GX 2R3OA 4K0YA 3Q4TA 4ANBA 1YW2A 5C27A 1PY5A 3VUHA 5FXRA 3KMWA 3N51A 5M44A 2XZSA 2G2IA 1PKGA 2PZYA 2A4LA 3OROA 4ASEA 5IH5A 3PSBA 4QQ5A 4YJQA 1YXVA 3P1AA 2BKZA 2RSVA 2YFXA 4YMJA 4CSVA 4ZY5A 1H28A 5M4UA 3DBDA 3HNGA 4H58A 1NXKA 4U6RA 4Y95A 2YM7A 2C6OA 4RVMA 5CY3A 2BTRA 4OTRA 4LQMA 3TUCA 3C7QA 4NFNA 4NM7A 5AR7A 4AX8A 4RFYA 2JAMA 4NU1A 2B53A 4JDHA 1H25A 2YLEA 4GU9A 2X9EA 3DDQA 4Q2AA 5KMJA 5K3YA 4PWNA 1Y6AA 3CKWA 3T3VA 5EKOA 3ORIA 4ACDA 3L8PA 3C4CA 3CCNA 5HNBA 2GSFA 2JDOA 3FLQA 4ZTQA 2WZJA 1H00A 4FEQA 4PTCA 2PMLX 4MH7A 4DGOA 2BHEA 3GVUA 5F1ZA 3ZONA 4AN3A 5HNIX 3NUSA 4FI1A 5F95A 3E8CA 3N9XA 4BCQA 3QQFA 4FX3A 4X6RA 1RDQE 3W8QA 2V62A 2FYSA 4JNWA 4AOIA 4XMOA 3ATSA 3Q2MA 4L8MA 4BI1A 3S2PA 2OF2A 1MRUA 2UW4A 4EOLA 5I9VA 1M52A 2W1DA 2ZMCA 3ZC6A 5ETAA 3FQSA 4FSNA 5J1WA 2VD5A 4ZTHA 3SRVB 5CEQA 3W2RA 3EQGA 2PVRA 3C0HA 3L9MA 4IAYA 4L43A 2WO6A 5BYZA 4BN1A 4DH5A 4FKQA 2W99B 4RJ7A 2QOFA 2R3NA 2OJGA 4K77A 4AW1A 4FE2A 1J7IA 3E8DA 2VWBA 4IAKA 5J87A 1KE5A 3HRBA 3GQLA 4RIYB 2C6DA 3R83A 5CAOA 3B8QA 4NM0A 5DFPA 3E63A 3LFQA 5D12A 3GU8A 4AOTA 4AT5A 1YI6A 1Y8YA 5CXZA 4R7HA 3OWJA 3C4ZA 3T9TA 4M66A 5IA0A 3NYVA 2YIWA 4JG8A 4JBPA 4J8NA 1OIUA 1KV2A 4NIFA 3DV3A 4J71A 1JSUA 4U44A 4WHZA 3HAMA 3QLGA 4AFEA 1J1CA 3CTHA 4OBOA 3FC1X 2WB8A 5IU2A 3RPYA 2WMAA 3Q4UA 5HD7A 3MBLA 3V5WA 3WZEA 2IVTA 3DT1A 4NL0A 3EIDA 2GNHA 4ZXTA 4UWCA 3DPKA 3RJCA 4O82A 2YEXA 2E9NA 4IACA 3RAHA 5GNKA 5AUXA 3L8VA 2CDZA 4MX9A 5CF5A 3TWJA 5CZHA 2XH5A 4Y72A 4NWMA 5FEQA 3TNQB 1UKHA 4QOXA 2YJSA 4GT3A 3QZIA 4BB4A 5I3RA 3VS3A 3CC6A 4RMZA 4M97A 4ZSEA 2PMIA 4ITIA 3OXTA 2I40A 2W1IA 3EZVA 4IDTA 4UYAA 3WOWA 4ACGA 1OBDA 1ZYDA 4YJPA 4EHZA 4QMMA 2G9XA 4K8AA 3D7ZA 4G34A 5IUGA 2UZNA 3BX5A 1Q99A 2JKQA 3QXPA 4WNOA 1CDKA 2R3IA 2W05A 3R9OA 5JKGA 2BKKA 4P5QA 2XRWA 4HNFA 4ZSGA 4CTCA 4FSQA 5CEKA 4ASZA 4MNEA 3D0EA 3MPAA 3BYMA 3DY7A 4BCPA 2AC5A 2R3JA 4AF3A 1CTPE 4EUTA 2PPQA 4FSRA 1JVPP 2Z7QA 3AOXA 2HW7A 1ND4A 2J0KA 2Q0BA 3QKKA 2E9OA 1IR3A 3SAYA 2DWBA 2OJIA 2YDJA 3FXWA 3HUBA 3CQWA 3DLSA 5AP0A 5LMAA 2RL5A 3QGWA 3ZLYA 4AS0A 5CANA 4O1OA 5IISA 4LM5A 4RPVA 4ZLYA 3FMHA 5H9BA 3RK7A 4DG3E 1FQ1B 4AQCA 1XH6A 2PZIA 4AZVA 3W10A 1OPLA 4FGRA 2W1FA 1ZYJA 2C5OA 3PA4A 4FYOA 2C6IA 1BUHA 3KRJA 2PSQA 4NSTA 3BBTB 3FI2A 3UP2A 2GQSA 2V0DA 1PW2A 1QL6A 4LFIA 3FZSA 5JT2A 4KSQA 3HDNA 4M84A 5C8NA 4D4VA 3NNUA 4FOCA 3A8WA 3O2MA 5IEYA 2XVDA 4AZTA 2WMRA 3LFFA 2VUWA 4FV0A 2UW7A 2WKMA 4I0TA 4IM2A 4X21A 2W06A 3BGQA 3WI6A 4EH4A 2IG7A 3BRBA 4FIEA 1UWHA 3NNWA 5GJGA 3POZA 4GRBA 3TN8A 3COKA 4OR5A 1Y57A 3KULB 4QMPA 2OJ9A 3IQ7A 4RA4A 3CQEA 4WSYA 4X2KA 4PL4A 4RWKA 3VS4A 5E8SA 3MTLA 1UU8A 4YHJA 1NT2A 4DA5A 3FSKA 3DQWA 5CSWA 3FV8A 2ZV9A 3PYYA 4YJVA 5FP6A 4KB8A 3IDPA 4DFNA 4EH2A 1HCKA 3VF8A 2UZWE 2LAVA 2OZAB 3HV7A 4QTAA 1KUTA 4EQMA 1ZLTA 4BGHA 1X8BA 3EHAA 3R1SA 3V5JA 3R21A 3PG1A 3EFKA 5HGIA 3GU4A 4I24A 1YOMA 2UZBA 4ANQA 4JR3A 4FT3A 3G0FA 4FF8A 4UY9A 3FKLA 4AGDA 2X9FA 2J90A 2EXCX 3F7ZA 3KMMA 4N57A 3FEGA 4ZTRA 4YUQA 3DKGA 4XNEA 5AX9A 1BKXA 2CCIA 4HW7A 1WBTA 3KK9A 4YZBA 1YHWA 3SC1A 3CIKA 3R9NA 3MVJA 4RQKA 4RZWA 1Z57A 2VWYA 3LXLA 4CZYB 3S4QA 3R00A 4DH1A 4CD0A 3KRRA 2RFSA 3F3ZA 4HVIA 2BROA 4BBEA 1CKJA 2GDOA 3NW5A 5FXSA 3ZLXA 1OKVA 3NS9A 1R0PA 2Y0AA 4BTKA 5AV4A 3QALE 3MA3A 4X0MA 3QFVA 3NW6A 1STCE 3D7TA 4CYIA 1MP8A 1W82A 4R1YA 3TV6A 3AQVA 3DBCA 4C3FA 4RT7A 2E9PA 4M13A 3ORMA 3HX4A 3QTQA 3ULZA 3TUDA 3MY0A 3ORKA 3MESA 5EQEA 4G3EA 5EOBA 5HIDA 4CG9A 4FKGA 4NM3A 3EQFA 3NIEA 3EFLA 4YC6A 4KIOA 4DH8A 4HJOA 4AZEA 4CTBA 1IA8A 4HCVA 4PMPA 3F82A 3BQRA 5A4LA 1YXTA 4ZAUA 3TV4A 2ACXA 1F5QA 3HP5A 4L7FA 5CU6A 3BKBA 4LOQA 3TNPC 1GZOA 4EQCA 3Q6UA 5DEWA 3QGYA 3CY2A 5HG9A 4FVRA 3R9RA 2JKMA 2ITYA 2PUUA 4L42A 3ATTA 5BVFA 1NY3A 5A14A 1W84A 4YZ9A 3O96A 2XNPA 2HY0A 2WTVA 1H24A 3Q4CA 5JSMA 2YCQA 5JRSA 3RNYA 4AOJA 4USEA 5IA4A 4O0SA 3UODA 1WVXA 1BYGA 4I20A 4C0TA 2OH0E 3VAPA 3WF5A 4D4RA 1QCFA 1SZMA 2PHKA 2O3PA 4AGCA 2Y7JA 2EWAA 4EKKA 2P2HA 1OPKA 1PJKA 4N6ZA 4ZZNA 5B2MA 1M17A 1DI8A 4CV8A 4B99A 5EQPA 3MIYA 4ALWA 4RWLA 3DK7A 2BFXA 4H36A 3VVHA 4AXAA 3S95A 3DFAA 4DEDA 4F0FA 4ORKA 5KHXA 2EVAA 1DI9A 2WIHA 2UZEA 4HOKA 4QMLA 3ZHPC 2PE1A 2OJJA 2XF0A 3VBTA 5KNJA 3B8RA 4ITJA 1PXJA 2FGIA 3EMGA 4OTDA 1WZYA 3I5ZA 4JXFA 4HPTE 5F94A 2YERA 2VO3A 1ZMUA 1PMEA 2Z7RA 3LXKA 2IJMA 3PE1A 5AV1A 4QMQA 4QP7A 2HK5A 5LWMA 4QMZA 4C61A 3QYWA 1E1XA 4JOAA 4F70A 5A46A 4FTLA 3W2CA 4D2TA 3DTCA 2B55A 3CS9A 2QG7A 2X6DA 2WQNA 4TN6A 5CAQA 5EYDA 3FUPA 1GIJA 3BBWA 4OT6A 5FWKK 4QYFA 1SM2A 3GT8A 1KOAA 5FUTA 5LWNA 2O2UA 3FZPA 2J2IB 4G3CA 4KBKA 2HENA 4IAIA 4IJ9A 4JIKA 2W9ZB 1YXXA 5CWZA 2OSCA 3R0TA 1IG1A 5JK3A 2UW0A 4U41A 4L3JA 4XBUA 4IDVA 3CJFA 3TJDA 2Z7SA 5LVOA 4AU8A 3VUDA 3A61A 3UYTA 5DMZA 2PE0A 5F20A 3WILA 3H0ZA 3DU8A 4NZWB 2BILB 2EU9A 2V7AA 3R63A 1GOLA 4DLIA 3EL8A 2OK1A 2QVSE 4IWQA 4ALUA 4J1RA 4F9BA 3KC3A 4CFMA 2W5BA 2C3IB 1T45A 4D1XA 5FP5A 3AT3A 3UPZA 4RC4A 2VTAA 5EDPA 3FKNA 4OTIA 5DT4A 4BDKA 1R3CA 3PVBA 1RQQA 3LJ2A 4O0UA 1DAYA 4A9YA 1YVJA 4AT3A 2A19B 4LYNA 1YI3A 5HESA 1PMNA 4JJRA 5CLPA 3BU5A 3ZU7A 2AUHA 3EYGA 4LV8A 4IB5A 5HCYA 2W5HA 3DLZA 4F7SA 4LRJA 4TWCA 3ACJA 3FY2A 4WBOA 4A06A 3AMAA 3PTGA 1W98A 3K3JA 4JBQA 3NUNA 2HZIA 2RG6A 2OO8X 3PUPA 4U80A 4B0GA 3K3IA 4QP4A 4W4XA 1YQJA 4FUYA 3G6GA 4YPSA 4R77A 4F6SA 1A48A 3R8PA 4X3JA 4UBAA 4OAVB 2YIQA 4S31A 5IEXA 1PYXA 2QLQA 3AC5A 2IPXA 2OXYA 3RM7A 4CMOA 3FXZA 4W4VA 2QOHA 3H30A 4RIWA 2VTPA 3TV7A 4Q9ZA 3U54A 2CLXA 2BCJA 4FSTA 1J7LA 1M2PA 2FSLX 4IJPA 4R8QA 1OVEA 4EORA 4V04A 2X8EA 5D7VA 5IMEA 5JFSA 5BYLA 3PVGA 2GS2A 5HQ0A 3DAKA 2VGPA 1UWJA 4OGRA 1FVTA 4GT5A 4H39A 3RCDA 4M14A 4C57A 3ORXA 3E93A 1OMWA 1WBPA 5EDRA 3WZDA 4PPCA 4B8LA 4XV1A 5HTBA 3UZRA 4FOBA 4JBOA 4PUZA 4XX9A 5CAUA 5LMKC 4DBXA 3DBFA 4U0IA 1BX6A 1KE9A 2J9MA 2ZJWA 4MQ2A 3D5WA 3ZCLA 5FDXA 3CP9A 4A9RA 3ENHA 5CEIA 4BTJA 3QQJA 2W1ZA 4UMPA 4NM5A 2BPMA 4J53A 4MD7E 4YJSA 2VWXA 4DEAA 4FTJA 4F99A 1FMKA 5J79A 3LMIA 4FBXA 3FL4A 4ITHA 3UC3A 3FMMA 1OGUA 5AFVA 3GP0A 1XQZA 2HXQA 4NIFB 3UNZA 4LGDA 4FZFB 4NJ3A 3SD0A 4WKQA 4XS2A 1E9HA 2ZVAA 5AV2A 3E8NA 4JQEA 3UIXA 4BCKA 3NVMB 4ARKA 4M68A 4UMTA 2GPHA 2F7ZE 1QPDA 1PXPA 1FGIA 1REJA 5DA3A 3CD8A 3KRLA 3TL8A 3L8XA 3VUIA 4KIQA 3A7JA 4FKSA 3AMBA 4BIBA 3IW4A 4AW2A 5C8KA 3VHKA 4YLLA 1J91A 2VWVA 4EHGA 3NUYA 2ZDTA 3C4XA 3HA8A 2O8YA 5AUUA 3TI1A 1U54A 4HPUE 4KUJA 3RAIA 1CSNA 2KULA 3SOCA 4D0WA 4UV0A 5DLSA 5J7HA 3OCBA 3N4UA 4ZMFA 3JY9A 4FTMA 4PQNA 3SQQA 4L45A 4IXPA 1KE7A 4IFCA 2CN8A 4FNWA 3GOKA 2YM8A 4F6UA 3F3UA 1XH8A 4MNEB 4B8MA 3DXQA 3EN9A 1DAWA 2CKOA 1ATPE 1XBAA 2C1AA 3QC9A 4FTCA 5HG5A 4WT6A 5HKMA 1QPEA 4DGLC 4DT9A 3ID6C 3QQHA 2XS0A 3BEAA 3ZO2A 3UO5A 2EXEA 4I94A 2XK3A 5I9ZA 3Q52A 4MCVA 5CF6A 3UO6A 2QC6A 4JDKA 4AW5A 1U4DA 3EB0A 4MNFA 2WTKB 2XIRA 2WTJA 1IA9A 5K4IA 4K18A 4TYEA 5JH6A 2XKFA 4QNYA 3BQCA 4E4XA 1O6LA 4LI5A 3QRIA 3DXNA 4DEEA 3TXOA 1NVRA 5AP2A 2QNJA 3WYXA 3A7GA 2XK7A 4J8MA 3V3VA 1S9JA 5IQBA 3IKAA 3PZEA 3ZBXA 4QMOA 1XH5A 4J98A 4MYGA 4RJ6A 4O81A 3CJGA 5LCKA 5L6WL 3CGFA 4M8TA 4FG7A 1GZNA 2BHHA 2CHLA 5AUYA 4MQ1A 1I09A 4U3YA 2PE2A 4V05A 5CYIA 2UZUE 3C5UA 5FTQA 4BDDA 4V0GA 4TKSA 1YWVA 5F4NA 5J5SA 3VWAA 5HE1A 2UUEA 3LXNA 1WBVA 4IHPA 1OITA 4C4HA 3F2AA 3LPBA 2HELA 1JKSA 1PXIA 2BZKB 3BCEA 4CT1A 4QMTA 2FSTX 5ANOA 1JLUE 2WTWA 3R7YA 3R73A 1UVRA 3CTQA 4BDFA 3AC2A 3CGOA 3RVGA 4CFFA 2FSOX 3OFMA 4FSUA 3R9DA 3UZPA 4AW0A 5BUEA 4TT7A 4CXAA 3AMYA 3UJGA 3NX8A 4BF2A 5LXMA 1JKLA 1Q8ZA 2YM5A 2I7QA 2C6TA 4FT0A 2W9FB 3H9RA 4O0XA 3H4JA 4KBAA 2XRUA 5E8TA 1H1PA 3DQXA 3RZBA 2OG8A 3DZOA 4USDA 3AD6A 4PP9A 1JKKA 2XIYA 3UDBA 5EYKA 2PZRA 5D7AA 4CMUA 4IWOA 5M56A 2XK9A 4MVFA 4MTAA 5AJQA 5K5XA 5JQ5A 3LW0A 3QF9A 4O7RA 4EKLA 3UGCA 4IZAA 1NVSA 1A9UA 1JSTA 4BZOA 4B6LA 4O7VA 3GUBA 4Z7GA 4GKHA 5IUHA 3OMVA 4XG8A 4OTFA 5CTPA 2F7EE 4MXZA 4GK2A 2JEDA 5K0XA 3U8WA 4TYJA 4KIKA 3H0YA 4UWBA 3RALA 3RNIA 3E88A 4RBLA 1M7QA 2JC6A 3D7TB 5FTGA 3EZRA 5AMNA 3U51A 4J97A 3FMDA 2XMYA 4WD5A 5DG5A 4EJ7A 4PDPA 4D4SA 2B54A 2WGJA 4W8EA 4FL2A 3GFWA 4BICA 4YC8A 3WF8A 2QO2A 4JL9A 4DBNA 3OOMA 1OKZA 5DI1A 4FEXA 2F7XE 4NCTA 3CR0A 3U6IA 5HVKA 4WG3A 4EOOA 3LMHA 2J0MB 3AC4A 3I79A 5KHWA 4L52A 1MUOA 4XYFA 3GCSA 3RP9A 3NUUA 5DE2A 3OT3A 5GIPE 1ZY5A 4BBMA 1K9AA 4P2KA 4QQCA 4U42A 4MXAA 5LARA 5TO8A 4B7TA 4EOQA 3DJ7A 4BCMA 3GC8A 1YKRA 4BVUA 1H8FA 3FQEA 2HXLA 5AAGA 1BLXA 3FMNA 3GC9A 3EQIA 4AAAA 3O7LB 1V0BA 4U79A 5H2UA 3MH3A 3S0OA 4M69A 2H34A 4ASDA 5EI2A 1JKTA 3FC2A 5E90A 4BY9E 3MY1A 4HGEA 3PXKA 4EBWA 2RG5A 3P4KA 4O96A 5IF1A 5AP1A 4F6WA 4XOZA 2I1MA 4OTPA 4RWJA 1UU7A 4Y46A 2J51A 2XK4A 4O7WA 2CLQA 3VBQA 5T68A 2GHLA 2PVKA 4PPAA 5HIEA 3MPMA 3TTJA 3HP2A 4F9WA 4YU2A 3ZFMA 3HRFA 4IQ6A 3NR9A 3KN6A 4AUAA 4L46A 5HO6A 2PWLA 4L53A 3K5UA 3QRUA 4LOPA 4WG5A 3V01A 4R6VA 3F5UA 5JGAA 4QTBA 5K4JA 1NW1A 1Y8GA 4FG8A 2ZB0A 3Q9YA 3QHRA 2XK6A 4BHNA 4MBLA 2WMWA 3I6UA 1P4FA 3ZO1A 4C58A 5EI8A 3OTVA 4A7CA 4YLJA 4GS6A 2GNIA 4R3RA 4JQ8A 5G1XA 3RKBA 5HG7A 2CKEA 1OUKA 2VNWA 2NNWB 3COHA 5IKWA 1FVRA 2EXMA 3TDVA 1WMKA 2X2KA 1XWSA 4FNXA 4AT4A 2B4SB 5DT0A 1PHKA 3TKUA 3BELA 2W0JA 3F69A 4U81A 3WBLA 2VTOA 4C59A 4DGGA 4I92A 2WEVA 3DFCB 5LQFA 3NW7A 3E92A 3OC1A 3LFNA 3QQGA 5EM8A 2JIVA 3NLBA 4LGHA 1OUYA 5CVGA 2C68A 2CMWA 3OS3A 4FMQA 2EB3A 5DRDA 4I22A 3CSVA 3MGYA 2X7FA 2B9FA 4MBIA 2CPKE 2BUJA 1H07A 4APPA 3MY5A 2EUFB 2X2LA 5AR3A 5I9XA 2IN6A 5KE0A 3A62A 5C26A 3HRCA 2XNOA 3KA0A 4QMNA 4KKGA 3HMMA 5DBXA 4BCGA 3CBLA 3BYOA 4JX3A 4YZDA 4HYHA 5H3QA 3RWQA 1OL7A 3WE4A 4EWQA 4F1MA 4E20A 5HBJA 1PMUA 3MH2A 2ZB1A 3B2WA 1WVWA 3FMJA 3LCSA 4FK3A 4O7NA 2PTKA 4L3PA 1LP4A 4G16A 5BVWA 5JN2A 4TXCA 3SX9A 3QX4A 3FBVA 3DA6A 2WD1A 2GMXA 4OTQA 2BALA 4O38A 3DTWA 1DM2A 1XKKA 3EN6A 1SNXA 4K2RA 4DCAA 4DFZE 5J95A 5L2WA 4IZYA 5KUPA 1RE8A 5CT0A 2R3QA 2UVXA 3ZSGA 5HICA 1WVYA 3GCVA 3NRMA 4OTHA 5I0BA 3LLTA 3ZSIA 4O0TA 3BU3A 2YAAA 1B38A 2VRXA 2GHMA 1MQ4A 2QU5A 3I0OA 4E7WA 5BVNA 4YJTA 2BTSA 3TDWA 4ZMEA 4F09A 3L9PA 2R3RA 3UIUA 2X8DA 4RVTA 3EFJA 1ZARA 2J5FA 2XYUA 3KVWA 5M55A 3ACKA 2VO0A 3IGOA 4KKHA 2PVYA 1FMOE 3LHJA 5IDNA 5CEPA 4XG2A 2J5EA 3PLAE 4RIWB 4FYNA 3ROCA 4DAWA 4OTWA 4QMUA 5L8LA 3AD4A 3D94A 3NDMA 4HVSA 2V22A 5ANGA 4UN0C 2WPAA 3F5PA 5C1QB 4XBRA 1MQBA 4D2WA 5CSPA 4EOSA 4ANOA 2Y4IB 3P86A 1SNUA 1HCLA 3NCGA 5CS6A 5DGZA 4YZNA 2EB2A 2ZM4A 5DR9A 4RJ8A 5AR4A 4TL0A 5HX8A 5TF9A 4XH6A 2PU8A 2B52A 5A4QA 4BCFA 1UNLA 4G6OA 4XV2A 3KN5A 2KTYA 2RIOA 3IW6A 4EYJA 3IECA 4E6CA 3R8ZA 2B7AA 1Z5MA 2Y9QA 3ZYAA 4ONAA 4K1BA 2ZV7A 4HGLA 4YZCA 1ZYCA 2CSNA 4QP9A 1H1WA 2H96A 3NYNA 2NRYA 4KABA 4CZUA 3UNKA 4EI4A 3S1HA 5AM7A 4FNZA 4J52A 3QD0A 2XIKA 3VN9A 4AACA 3OOGA 2ZMDA 1E1VA 3OZ6A 4BDGA 4CT2A 3KKVA 1O9UA 3DS6A 1VR2A 3NEWA 5AP7A 4AE9A 1B6CB 2X81A 3L8SA 3IPHA 3LVPA 3VUTA 2XNNA 4KKEA 2IW6A 4UMUA 5HD4A 4DG2E 3KXNA 2J50A 3BZ3A 3U87A 1IEPA 5E8ZA 3UQFA 3VJOA 4AGUA 3F9NA 2BIKB 3Q5ZA 5CENA 2HWPA 1JSVA 4U8ZA 5DHJA 1BI7A 2W1CA 1JPAA 4N0SA 4D58A 5CSXA 3FLWA 1U54B 2BDFA 1QMZA 4N70A 4FL1A 4HZSA 3QD3A 2OJFE 3NNVA 4R1VA 3R22A 4UZDA 5D9HA 1GIIA 3VNTA 5CNNA 3DCVA 3W2PA 3R71A 5CEOA 2PUNA 2XKDA 3POOA 3Q9WA 3TKIA 5CVHA 2VTRA 2PZ5A 4XOYA 4DHFA 3F66A 3MVHA 3KB7A 4PNIA 3F7WA 1Q3DA 2CN5A 3ZH8A 1Q3WA 4FEUA 1GY3A 4LUEA 4G9RA 4DYMA 1KWPA 5E8YA 3PVUA 5KBQA 1F0QA 4FKTA 2QR7A 3QX2A 4IH8A 3Q32A 3QHWA 4H05A 4FL3A 1XR1A 3IW7A 4PL5A 3Q5IA 4L7SA 3PP0A 1H1SA 2WEIA 4MXOA 3EFWA 3WIKA 4GFMA 5IG1A 3COIA 3HUCA 4L00A 3W2QA 5BX0A 3EQRA 4DFYA 5HLNA 3R30A 2XNGA 5KCVA 2C0TA 4BZDA 1V0PA 4NT4A 4OBQA 1CM8A 1ZMWA 1VEBA 3H9FA 5CF4A 4N6YA 4GW8A 4PX6A 1FVVA 5AR8A 3N4VA 2ETMA 2QCSA 4HZRA 3UQCA 3HEGA 2XNEA 4YGAA 5M06A 2NP8A 2YN8A 3FLZA 2UZTA 3TUBA 4I93A 3V5PA 4ACMA 2A27A 1ERKA 3AXWA 4LMNA 5K0KA 4IANA 2B1PA 3PSDA 4C4JA 4GIHA 3BE9A 3MFTA 4EL9A 5IH6A 4ZLOA 2BIYA 3QCSA 4V0GB 5J9YA 1URCA 1Q61A 2FSMX 5E1SA 5A4TA 2PK9A 3QTUA 5I9WA 3LFSA 3BYSA 2C0OA 3KMUA 4GJ2A 5IZFA 4JT3A 3IDBA 3ZDUA 2ZAZA 3V5LA 3A7FA 3ZFYA 4UWYA 1U5QA 4YPDA 3RINA 4LG4A 5HNGA 3TNHA 3VIDA 3TIYA 3DNEA 3Q2JA 4GL9A 5L8JA 3VW6A 2ERZE 4FTTA 3UTOA 5M4CA 4I4EA 3V6RA 4ZY4A 4BC6A 2WHBA 4YJRA 4CKRA 2GTMA 3DKCA 4MD9E 5AADA 2FB8A 2G01A 4JQ7A 1UU9A 3R1QA 3R7OA 3FWQA 3FMLA 4BWKA 4NKAA 4NTTA 3RHXA 3GU7A 4RQVA 5DWRA 3DJ5A 4NEUA 3R7EA 3U4UA 4F9AA 2QONA 3ORNA 4TPTA 3TZ9A 3WF9A 2JLDA 2R9SA 3PWYA 5EW9A 5IQCA 2O64A 3HV6A 5IQFA 3VS2A 1LEWA 2X39A 5DOSA 2W4JA 4BI2A 5I9YA 2V7OA 3G5DA 4JVGA 5HLWA 3OUNB 4X3FC 3D9VA 4O84A 3G90X 3JVSA 1ZMVA 1WAKA 4G6NA 5AV0A 3HDMA 5D41A 4EOIA 3QZFA 2ZV8A 4XUFA 5HO7A 3MVLA 2I0EA 4IWDA 3C13A 4ZEGA 4FK6A 4D1ZA 5TE0A 2W1HA 3QUEA 1OPJA 1R1WA 4GG7A 4W9XA 3W2OA 4CRLA 5M53A 2J0LA 1QPJA 5EG3A 2YCRA 3CEKA 3F88A 4G5PA 4P7EA 2G1TA 4RJ3A 4EH7A 4NTSA 4Z55A 2C6KA 4HYUA 4M3QA 2YDIA 3FMEA 1IRKA 4E3CA 4BI0A 2NRUA 1KV1A 3ZC5A 4FIIA 4D2PA 3MIAA 3WZKA 4GUBA 4O0YA 3ELJA 1VZOA 3SW4A 3R28A 4C62A 3DXPA 1IAHA 3IOPA 2XEZA 3MS9A 3U4WA 5HBEA 3EN5A 4IVDA 4BDHA 3MN3A 3CXWA 2WTCA 3WARA 4BWXA 4H3PA 2JIUA 3VS6A 4MF1A 3CD3A 4FUXA 4XG3A 2G2FA 2UV2A 4KSPA 3QRTA 4I4FA 4KWPA 1EH4A 4QMWA 3BHUA 3D2KA 3OHTA 5AEPA 3PDTA 1UNGA 4M69B 3U6HA 4WIHA 2Z02A 3VQUA 1XO2B 3GENA 4TTHB 5E8XA 2PUPA 5E7RA 2BMCA 4GV1A 4IX3A 3ANRA 4A4LA 4O0WA 4I1ZA 4O91A 2VAGA 4JDIA 3VS1A 5HCXA 3R7UA 4ZTNA 3ORZA 5BNJA 3CY3A 3BLHA 3IK3A 5CQWA 4F7JA 2YISA 1ZOGA 4KINA 5HVJA 3FYJX 2VTLA 2CKPA 3W55A 3ZTXA 4LRKA 4XEYA 3M11A 4GYIA 4C36A 5HLPA 4O7YA 3BYVA 3LQ8A 4HYIA 2DYLA 4A07A 2R7BA 3EKNA 4WUAA 5EYCA 2F2CB 3PE2A 2XKEA 2VX1A 2IW9A 5BPYA 2YM4A 3R8VA 5CSHA 4Z9LA 3Q04A 3HMIA 1JNKA 2RKUA 1XH9A 4DFXE 4EK3A 3A8XA 1TQPA 3I4BA 3ORTA 4XJ0A 4CFUA 4FKOA 2WXVA 4RJ5A 2WFYA 3BHVA 5ANDA 4ENXA 2WNTA 3NPCA 3VF9A 3HV4A 3R1YA 2XM8A 4I3ZA 4Q5EA 3ZOSA 2CJMA 2I6LA 2IVSA 4KAOA 3D5VA 1U59A 3BPRA 2QU6A 4GEOA 4I6HA 5CU2A 4G2FA 4AN9A 4FVQA 4JAJA 3A99A 5IMXA 3KXXA 3TKHA 5CNOA 5CU4A 2UVZA 5CVFA 5IDPA 4FSWA 2XBJA 3WZUA 3ZEPA 2IZSA 3O8PA 4ZSJA 2YZLA 4UXQA 4JRNA 1GJOA 3RK9A 1ZOEA 4EUUA 4ZSLA 5HE3A 4CKJA 5I5ZA 3SW7A 3JPVA 5AWMA 3EQDA 4O1PA 3LIJA 5D1JA 4O27B 4IB0A 2RFEA 4FODA 4X7QA 5DR2A 5J5TA 1PXLA 2J0JA 3C4EA 1W7HA 3C0GA 4BKYA 3DGKA 3HMOA 5DT3A 4B4LA 3TM0A 2C5VA 4D2RA 4EK6A 3BGPA 2VGOA 4FIFA 3QD2B 3GU6A 3OCGA 3HKOA 4BDEA 5KMMA 3MI9A 5A6OA 4BDBA 4YTCA 4G6LA 2B0QA 5KZ0A 2BRHA 5JZJA 3E64A 4B9DA 3ETAA 2BAQA 2VNYA 2CGWA 2QOKA 4IAAA 5F9EA 2R0UA 2QLUA 3R04A 3FLSA 3ZUVA 3AC1A 5FG8A 3QYZA 3P0MA 3S3IA 3ORLA 3UE4A 4DFUA 3KK8A 3I60A 3M42A 5DEYA 3NYOA 3IONA 4QO9A 1SYKA 4RIXA 1H26A 2JDVA 2VO6A 4DITA 3ZO4A 4EC9A 4I5HA 2P4IA 3L9NA 4WG4A 5FBNC 5C8MA 2OW3A 4FICA 2Z2WA 4RFZA 4R5YA 5BVOA 4O86A 2H8HA 2WMTA 4XLIA 3LFCA 1Q4LA 4W8DA 2UW3A 3ODZX 3ERKA 3G9NA 4XP0A 2ETKA 4EOKA 5BUIA 4QP3A 4RX5A 3WF6A 4EZ3A 3QCQA 2WAJA 3UVQA 3FMKA 2CCHA 4QMSA 4TRLA 4UYNA 5HG8A 3ALOA 3FZ1A 5H8EA 4AA4A 2I0YA 3MH1A 4AZFA 2R5TA 5GJFA 4QTCA 4NW5A 3PJ3A 4LV5A 4C35A 4RRVA 3SKCA 1ZWSA 2ZM3A 4DH3A 3L9LA 4MKCA 1KOBA 5GZAA 2HIWA 2YM3A 4YTIA 2PVMA 2O63A 4YO6A 3L1SA 3KXZA 4OW8A 4EZ7A 4AGWA 4D0XA 5L6OA 5BMMA 3W1FA 2XJ1A 1M14A 3IDCA 4JR7A 5EM5A 5HTCA 4MXYA 4F0IA 2PUIA 4CFXA 4I41A 3MFRA 4BCOA 3H10A 3QCXA 2X7OA 3LCKA 3LFEA 5FXQA 4ANMA 2YIYA 4GUEA 3E3PA 4BKZA 4HCUA 5E1EA 2OFVA 5I9UA 2IW8A 1OIYA 4ZJJA 5AUZA 3VS0A 2F4JA 4A9TA 1OIRA 5EI6A 1YRPA 3D5XA 4RLLA 3DKOA 2X2MA 1WBSA 5IUIA 3LM5A 3WYYA 5FRIA 4MAOA 4PF4A 2ZM1A 3SA0A 3BYUA 3R1NA 4I6BA 3SG8A 4FIGA 3OXIA 5JFXA 2NPQA 2V55A 3DKFA 2GHGA 3R8LA 4IIRA 4ID7A 4ZOGA 5AIKA 5J1VA 3M2WA 3GQIA 3AT4A 2WMUA 4PL3A 1HOWA 2UW8A 3BWJA 4UMQA 5K9IA 4FV9A 4L01A 5HE2A 3EOCA 1T46A 4NUSA 5HZNA 1GNGA 2C5XA 1P14A 2BRBA 5FGKA 2ITOA 1OL5A 2ETRA 2R3KA 3OBJA 4GVAA 2W96B 3PZHA 5KKRC 3W16A 2Z7LA 1J1BA 2JDSA 1ZY4A 4WNMA 3LQ5A 5ETCA 5G6VA 5IA5A 1YWNA 4IFGA 4IX5A 4FNYA 2FO0A 3ALNA 4FTIA 4YNOA 4ZTMA 4O83A 1U5RA 2CGXA 3I7BA 2GNFA 2E2BA 3SXSA 3CTJA 4IEBA 3UOJA 5CU3A 4G3DA 2J0IA 1R0EA 2C1BA 1M7NA 5A4EA 3C4WA 4D9UA 3RWPA 3DDPA 4RVLA 2LGCA 3V8TA 4EHVA 2J6MA 2WOTA 2XM9A 4WNPA 4D4YA 2W4OA 1TVOA 3KRXA 1KE8A 4PY1A 4I0SA 3VRZA 4CLIA 5J9ZA 3NZ0A 2WQMA 4CRSA 4P5ZA 3FY0A 4X3FA 5ACKA 5IQEA 2ITUA 3Q53A 4MXXA 2WMXA 2XCKA 3ITZA 4UALA 3SXRA 4F1OA 5EW3A 5LVNA 2OKRA 5C03A 5M09A 4IAFA 2X4ZA 4QYHA 3COMA 3E5AA 3MSSA 4X2JA 3RMFA 5GJDA 4DCEA 5E4HA 4QMYA 2QHMA 5LMBA 3FLNC 4LL0A 5CT7A 4ASXA 4YJNA 4FKPA 4CCUA 3KY2A 5EM7A 5JGDA 3BIZA 4OUCA 1YOLA 3NNXA 4Y5QA 4DGMA 2OIBA 4FTAA 2W1EA 1W8CA 2QHNA 4ANLA 3MJ2A 3G2FA 4J96A 1P2AA 2B9IA 1ZRZA 3C9WA 4L67A 3ZMMA 4IWPA 4EH6A 4U7ZA 4M0YA 3VULA 1H0WA 4DEIA 1OECA 3MJ1A 4FV3A 4IM3A 5HCZA 4FV5A 5ETFA 5CI7A 3LAUA 2R0IA 5KMKA 4BGGA 4J99A 2WQBA 3VUGA 3OY3A 5CX9A 5AUVA 1I44A 4DTKA 2REIA 3JUHA 4DF3A 3RPRA 4G3GA 2A1AB 5C4LA 3LOKA 5HVYA 4TYHA 4D28A 1OB3A 3RPVA 4F64A 3RPOA 3P9JA 3QC4A 1Q97A 4IX4A 4HVDA 5CAPA 5GIOE 3ENMA 2R3LA 3F2NA 5E8UA 3OXZA 4F63A 2J7TA 3LCDA 5GHVA 4E1ZA 3MWUA 2YZAA 4GK3A 5CI6A 2GQGA 4QTEA 5AR5A 5E9EA 4CQGA 3KFAA 3GCQA 4FA2A 3GCPA 4EH8A 3QD4A 2VTNA 4C38A 5GZ8A 3SOAA 4C33A 4IW0A 5B0XA 2V5QA 4Y5HA 4EONA 1YDSE 4CMTA 1YWRA 1VJYA 3NYXA 4MWIA 5IQAA 3HA6A 3D83A 3E87A 3FAAA 4KS8A 2JITA 3KXGA 3QUPA 4D55A 5IQGA 3S00A 1Y91A 1ZZLA 3BLQA 4BTMA 5KMNA 3FHRA 1OL2A 4BYIA 1U46A 3PRIA 2OXDA 4TWPA 1SVEA 5CXHA 4PDOA 3U9NA 4UEUA 2VWWA 5I3OA 2BAKA 4O0RA 5AR2A 3VBYA 3B2TA 4IE9A 4KNBA 3A60A 1UKIA 4FZDB 4TY1A 4X2GA 4CFWA 5ANEA 2BVAA 5FBOA 4ZLZA 2YIXA 1FGKA 4XRJA 4MHAA 2BFYA 2BDJA 4AZWA 2XIXA 4RX9A 4U40A 4ACCA 4UXLA 4F9YA 2UZDA 3QCYA 2E9UA 3H3CA 4BCJA 4K9YA 5TT7A 4OTGA 3LXPA 2YDKA 5A9UA 3LKMA 2C69A 4CQEA 4HVGA 2C30A 2VTHA 2W17A 3FXXA 4QP8A 5DH3A 4AE6A 3KXMA 4PDYA 2PVJA 3RI1A 2JGZA 2X6EA 3WF7A 3AGLA 2P0CA 1UU3A 4F0GA 3PLSA 3P5KA 4GG5A 5I4NA 4O6LA 3V51A 3GB2A 3GNIB 3BHHA 4GCJA 4QYYA 1BI8A 4M0ZA 3UVRA 4E6QA 3MB6A 2BRMA 4UMRA 5ITAA 3OW3A 5M07A 5M4IA 3PFQA 1H1QA 3D15A 4ENYA 5EDQA 5JGBA 1Q24A 1YHVA 4FKIA 2HWOA 5KX8A 2VTIA 4I5MA 2J4ZA 2WMSA 3EN7A 3ZBFA 4BIEA 2YABA 5K5NA 2QI8A 4EOMA 2HAKA 5IQIA
chains in the Genus database with same CATH superfamily
3QQLA 4CNHA 4WNKA 4PRJA 5EQYA 1Y6BA 2VTSA 4PP7A 2WQOA 4XLVA 5FLFA 3VBVA 4E5AX 4JBVA 4ZSAA 1XHAA 4QMVA 4BCIA 4M7IA 5LMKA 2PULA 3EYHA 2YIRA 4IBMA 4FV1A 4GH2A 3V5TA 4NW6A 2VTJA 3LFBA 3OD6X 2JD5A 5CQUA 4D2VA 3W18A 3A4OX 1M2RA 1PXKA 3ZDIA 4G17A 3DK3A 4IM0A 4BL1A 4H3QA 4AA5A 4O4EA 4ERKA 4GVJA 4S30A 3IO7A 3O17A 4W4WA 4YP8A 3R7VA 1J7UA 3IGGA 2WQEA 2IVUA 2UZVA 5HOAA 3FJQE 3PJ1A 5CU0A 3VBXA 4EC8A 2O5KA 4CGAA 3LE6A 1V1KA 2QOBA 3R8UA 4ZS4A 3BV3A 3T9IA 1JBPE 4CFNA 3HYHA 3I5NA 4PNKA 4YR8A 4GIIA 3C4FA 4LRMA 2ITNA 3I7CA 4FV2A 3NMUF 5ICPA 4KRCA 2BRGA 3G0EA 4U9AA 2C5YA 2P55A 3UP7A 4OLIA 3I81A 3MVMA 5E8VA 4E4NA 3ZM4A 2JDRA 4BGQA 3VO3A 3ZLSA 2HZ4A 4AP7A 2VTMA 4QQJA 5L3AA 2F57A 3KGAA 3AG9A 4FGBA 3CPBA 3EWHA 3ZZWA 3TZ7A 1KSWA 5IA3A 4EOJA 1PRYA 1Q62A 2P2IA 2XUUA 3D2IA 3LCTA 3ZRLA 1TQMA 4EQUA 3E7OA 3SG9A 4J95A 4YZMA 4BCHA 1O6KA 3KF7A 3P7BA 3PWDA 4PTGA 1SVHA 2F9GA 1LEZA 5D10A 3W32A 4GJ3A 1WCCA 5KMLA 2CGUA 1G8KA 4O4CA 2WELA 3UC4A 5AP3A 4RIXB 5DIAA 1OL6A 1BL6A 2IO6A 4TNDA 3NUAA 4X6QC 2P33A 5M08A 2CGVA 2WMBA 4BDIA 2ZDUA 2C6MA 4AAYA 3LFAA 3OBGA 1H0VA 2VWZA 4XP2A 5B2KA 4DN5A 3Q96A 5LVPA 4FVPA 4JAIA 4S32A 3R02A 3KEXA 2FVDA 2VX3A 4DEHA 2XK8A 3VS5A 5E91A 2R7IA 5FD2A 3ZFXA 4OAUC 4YHTA 3CQUA 4I6FA 2YJRA 2G2HA 3F3TA 5HTIA 2IWIA 3BEGA 5LVMA 5FM3A 4NK9A 3SGCA 2XA4A 5HORA 4DHIB 5EKNA 5AX3A 4PV0A 3UOLA 4RX7A 1PYEA 3UG2A 4U97A 3UQGA 2X0QA 2YCFA 3UBDA 3RAKA 4Q9SA 4QT1A 3V6SA 4C37A 5J7BA 5IQDA 3OF0A 3W2SA 4D5KA 3U55A 3SVVA 5T6KA 5AAFA 4Q5HA 5HX6A 5H8BA 2FUMA 2W1GA 3A4PA 3MW1A 4JS8A 4Y73A 3SDJA 4AG8A 2GNJA 3TT0A 4LMUA 3UDTA 5ETIA 3HMPA 4FG9A 4QNAA 5C01A 3F6XA 3D14A 4DTAA 4F7LA 3W0MA 4CVAA 1H1RA 3OEZA 5GZ9A 3P23A 2CKQA 4I5PA 5DR6A 2OICA 1B39A 2IZRA 4UZHA 2C3JA 4CZTA 4GKIA 4IAZA 4Y8DA 5L4QA 3EQBA 3PXRA 3QL8A 1OZ1A 2QR8A 4PDSA 4RIOA 3ZS5A 4BRXA 3PJCA 3PPZA 3ZUTA 3ODYX 3RGFA 4DTBA 4DC2A 3FQHA 1IASA 4XG7A 3OEFX 1XH7A 4QPMA 2QKWB 2XB7A 4UX9A 4C2VA 2RGPA 4FKVA 3G9LX 3QAME 2GU8A 4YTHA 3BL7A 4L68A 4O4FA 1BMKA 3QTIA 4JX7A 2CNVA 2OH4A 1P5EA 2XEYA 3AC3A 4FSZA 4KBCA 3HLLA 3MYGA 3HMNA 3SXFA 4EH3A 3F5GA 4C3RA 5C4KA 2OWBA 4I5CA 3OUKA 5LCJA 2X4FA 2OIDA 2JFLA 3QTZA 3MTFA 4C34A 4IB1A 3QTSA 4NYEA 4AXCA 2GCDA 3EL7A 4JG7A 4QP1A 4G3FA 3BU6A 4GSBA 3MFUA 3FZOA 5T3QA 3W33A 3VQHA 3TACA 5CASA 2Y4IC 5KMIA 2IF8A 3LCOA 3OVVA 2C6LA 4C02A 1YXSA 2QOCA 3JY0A 3O0GA 2Q83A 5JEBA 4MWHA 3KU2A 1G8SA 3LZBA 4DDGA 1MRYA 3TNWA 3ZRKA 3OP5A 3THBA 4DHZA 3T8OA 4LUDA 2BRNA 4A9SA 5CZIA 1G5SA 4C7TA 3LM0A 2W5AA 4PTEA 5AP6A 1PXOA 5AV3A 3T3UA 3D5UA 2VZ6A 4Z7HA 1H08A 5JFVA 4X3FB 4FSYA 2F49A 5DYJA 3ZZEA 1PMVA 4Z16A 1G3NA 3UMWA 3D4QA 4BWPA 1WBOA 2HY81 2QG5A 3QXOA 4WRGA 4YBJA 5FTOA 3RCJA 4AN2A 3ZO3A 2I0HA 4E26A 1YI4A 4Y83A 3R01A 3GCUA 4EK8A 2WTIA 1KE6A 4NKSA 4FIJA 1Z9XA 3EH9A 3FSFA 4E93A 4FZAB 3EQCA 4BDCA 3JR1A 3F5XA 2R3HA 4BDAA 3ZXZA 4FIHA 1GAGA 2IZUA 1AGWA 4EEVA 3AC8A 3IOKA 1ZXEA 2HYYA 1URWA 2ITPA 2QOIA 3FZRA 3OWPA 4RLKA 3W0QA 3BLRA 4FKRA 4FV7A 4IADA 4IC7A 2VX0A 3PG3A 4IB3A 2R3FA 3DB6A 3BV2A 4GFOA 4W9WA 4CKIA 4FSMA 4FZ7A 1YDRE 3WZJA 2Z60A 3KXHA 3ZRMA 4HYSA 3UOHA 4H1MA 4O2ZA 2ITXA 5BVKA 4IZ5A 4JDJA 1DS5A 4ERWA 4QEBA 3QTRA 3GBZA 3QRJA 2BZJA 3QTWA 2BZIB 3RPSA 4F08A 3UIBA 4ZJVA 1JAMA 3V5QA 2H9VA 2IVVA 2O0UA 4ZJIA 4R3CA 4TYHB 3QLFA 3V8WA 5JQ8A 3UG1A 2OBJA 4X2FA 4A4XA 4FKWA 4WRSA 3RHKA 2XP2A 2BDWA 1YHSA 1R39A 5EOLA 2QO7A 3QTXA 4CYJA 3ET7A 4TWOA 5AA9A 5BV3A 4UB7A 4FTOA 3TZMA 3PJ8A 4KIKB 4XG6A 3PXYA 4FTRA 4CCBA 5J9LA 2YCSA 5IA1A 5A3XA 4G1WA 1S9IA 4AWIA 1L8TA 4FT5A 4FC0A 5IPJA 1F3MC 2RFDA 1FBNA 1FPUA 3PIXA 2A2AA 5HBHA 3ZSHA 4C4EA 3QA0A 2Y4PA 1O6YA 4PPBA 1RJBA 1YDTE 2W7XA 4KD1A 3VHEA 4EK5A 3G15A 4QQTA 4C2WA 3VS7A 3QKLA 2X1NA 3I1AA 4HCTA 1M2QA 2VWIA 2HCKA 1APME 2ITQA 2PY3A 4M12A 2HZ0A 2UZOA 4QP2A 4U45A 5KO1A 3HAVA 4FR4A 5LVLA 5E8WA 4ZTLA 1AD5A 1REKA 1PXMA 3TJCA 3H9OA 4FV8A 3E62A 4DDIA 5AM6A 3UMXA 1ZYSA 4QTDA 2XYNA 3JVRA 1OL1A 2B9JA 1FOTA 3ORPA 3OT8A 4FT7A 3C1XA 4QYEA 5EHYA 4O7SA 1CMKE 2QURA 5L8KA 5L2SA 5B2LA 2Y8OA 1XJDA 2DS1A 2A0CX 4W4YA 4YSMA 2XCHA 5TR6A 3NVKI 4YLKA 3WE8A 4AFJA 4TZRA 3EQPA 5BVDA 3PPKA 4EOPA 4KRDA 3QUDA 3I0QA 4R7IA 3PA5A 5AUWA 4E6AA 2YHVA 2Z8CA 4F1TA 4ZTSA 3R7GA 3NUPA 4FKJA 5FEEA 1NA7A 5M4FA 1CKPA 2VU3A 2UZLA 3TIZA 4K33A 3A7HA 3LLAA 3QWJA 2OZOA 3G6HA 3BHYA 2HZNA 3GXLA 2GFCA 3BE2A 5JMSA 2DUVA 3PJ2A 1LPUA 5FQDC 4IZ7A 4ANSA 3ULIA 5AUTA 4YTFA 2UW5A 3PPJA 4LL5A 4F4PA 4BZNA 3FPMA 3O23A 4PMSA 4DEBA 5JFWA 1ZZ2A 3NFGB 3QA8A 2HW6A 3BHTA 4E4LA 4TW9A 4ZS0A 3MPTA 4FTNA 3EQHA 3MH0A 3P78A 4O21A 4EBVA 4QD6A 4RA5A 4YJOA 3MV5A 3NAXA 1OKWA 5E92A 4YJUA 3UVPA 3VUKA 4C4FA 2ITZA 4FV4A 5CF8A 4APCA 2Q0NA 2R3GA 4CEGA 3F3VA 3TCPA 4KIPA 4CFVA 1FINA 1OBGA 5EFQA 5A54A 5IQHA 1PF8A 5LJJA 3VC4A 2R4BA 3IW8A 2ZV2A 4NCTC 4QRCA 3AKLA 2WIPA 2BAJA 4EH9A 4V01A 4EYMA 3CLYA 5BQ0A 4C8BA 3P7AA 4RC3A 5B7VA 3UPXA 1Q5KA 3GOPA 2ZOQA 1PXNA 3II5A 5D11A 3OTUA 3PXZA 2ONLC 3C50A 3FZTA 1WBWA 3KL8A 4G9CA 3RK5A 3VUMA 4HVHA 3F2RA 4DH7A 3A7IA 5BYYA 5LOHA 4L3LA 3HGKA 4KS7A 3BWFA 3SHEA 3PXFA 2ITTA 5EHLA 4O7TA 5DRBA 1ZAOA 3C51A 4O4DA 3LQ3A 4MD8E 3R9HA 3DJ6A 3GU5A 5HEZA 5EM6A 2XKCA 1YXUA 4I0RA 2DQ7X 3C0IA 4WO5A 2IZTA 5M51A 5AP5A 4U3ZA 1G8AA 3OCSA 2AEGA 3PVWA 1GZKA 2GS7A 3U6JA 2R3PA 2RF9A 1SVGA 4ZZMA 4BYJA 1V0OA 3SRVA 2WOUA 4JI9A 3RBWA 4XV9A 5CSVA 2WMVA 4O7ZA 3GC0A 2XJ0A 3QKMA 4O2PA 4DE4A 5AP4A 4Z3VA 1TZDA 3RAWA 3TZ8A 4D1SA 3MA6A 4YBKA 3K5VA 5L2QA 1P4OA 1PKDA 4RVKA 4F65A 2PYWA 4JG6A 4XV3A 4YHFA 3HV3A 4S34A 5IEVA 1W83A 2YACA 4RIYA 5EHOA 3ZEWA 3FKOA 3EJ1A 3F61A 3W8LA 1NVQA 3QU0A 3GFEA 5DN3A 4E8AA 5DVRA 3DOGA 5KKRB 4GU6A 4DLJA 5L2TA 2JKKA 2X8IA 3RTPA 2ESMA 2PVHA 4EWHA 5BUJA 3ANQA 3VJNA 3HECA 4D9TA 3DK6A 3OWLA 5EK7A 2VWUA 4I23A 3DB8A 2PMNX 4WOVA 3QQUA 4XP3A 3PIZA 3Q6WA 1Q41A 5FM2A 3DBQA 3O8UA 4PMTA 4FZ6A 2H6DA 3O71A 3OWKA 3TTIA 2GNLA 3OCTA 3CPCA 4RFMA 2YITA 3FLYA 4BDJA 4ZP5A 3HV5A 3R2YA 4MF0A 4DT8A 5ANIA 4CLJA 4F9CA 5AA8A 3AT2A 3DAEA 2JBOA 4GT4A 3FDNA 5EYMA 4IMYA 2GFSA 2BR1A 2YM6A 4TNBA 3MDYA 4XG4A 2G15A 5IA2A 5HI2A 3GEQA 4O7LA 2X0GA 5HE0A 4G31A 2JAVA 3DZQA 1J3HA 1JQHA 1Q8UA 5AAEA 4N4SA 4JLCA 4U43A 1AQ1A 2ERKA 3MB7A 5L2IA 3KCFA 3UZTA 2PL0A 4TYGA 2QODA 3FI8A 1XBCA 4FTUA 2ZYBA 3F3WA 4RX8A 4YO4A 3BI6A 2XNBA 3UO4A 3SV0A 3Q4ZA 3U9CA 5HIBA 3Q9XA 3NUXA 4JRVA 2RFNA 1Q8YA 2JBPA 2JIIA 1TQIA 2OXXA 3KQ7A 3FPQA 3PXQA 3QRKA 5CAVA 4MXCA 2VN9A 2UVYA 3HL7A 2YWVA 3NWWA 1TKIA 2WMQA 4YSJA 3PIYA 2PMOX 3UNJA 1OIQA 5ANJA 1XBBA 4R7BA 3O7LD 3LJ1A 4ZIMA 2OF4A 2SRCA 1R78A 5HU9A 4II5A 4XHKB 2PVNA 2XJ2A 3CE3A 5TOZA 3KCKA 4YC3A 5JRQA 3G33A 2GS6A 4DFBA 1A06A 4EJNA 5CALA 2HOGA 4FEWA 2CNUA 4IC8A 2C0IA 4NJDA 3A2CA 2YWPA 2QO9A 4TYIA 1VYZA 5TKDA 4BHZA 2VTTA 3FE3A 4DFLA 3PA3A 4K6ZA 4ANNA 4FKUA 4LGGA 2OGVA 3QQKA 3SLSA 3TNIA 3PSCA 4D5HA 3KULA 1K3AA 1XH4A 1UV5A 3WIGA 3JS2A 3JYAA 4A9UA 3NIZA 4E5BA 4E5WA 4ZK5A 3RZFA 1GIHA 1K2PA 4LV7A 2NO3A 4C3PA 4U5JA 4O6EA 3LMGA 4DG0E 3ZUUA 3PY1A 3EN4A 4KA3A 1JOWB 5C9CA 2OZAA 2E9VA 5FEDA 3Q3BA 4BCNA 1L3RE 4ACHA 2O65A 2XBAA 4L44A 3KF4A 2YLFA 3E7VA 4TWNA 5EW8A 5KMOA 3FL5A 3AKJA 4FTKA 3IW5A 3M1SA 3ZXTA 4NH1A 3JXWA 3AGMA 5HO8A 5A4CA 3R6XA 2FH9A 5DNRA 3FI3A 4E73A 2C47A 5KBRA 3NAYA 3NGAA 3UOKA 1OKYA 2QOOA 2Y6OA 4MK0A 4S2ZA 4RZVA 4BKJA 1H01A 5EH0A 1OGYA 3O51A 3DBEA 2X7GA 1LUFA 3NSZA 3ZM9A 3IS5A 2C3KA 4QYGA 3BGZA 3GI3A 2ITWA 3K2LA 4RGJA 2OFUA 2GTNA 4IVBA 3O50A 4PMMA 2ITVA 2WU7A 4BR3A 2JDTA 1OI9A 2C6EA 1BL7A 2Y6MA 1VYWA 2VTQA 1GZ8A 3QBNA 4MEDA 4Y85A 5JZNA 3ROYA 5IH4A 3E3BX 3UYSA 3NCZA 4F7NA 5M57A 1UNHA 3K54A 1W2FA 4GYGA 2F2UA 4QPAA 2QQ7A 3GGFA 3FHIA 2QOLA 2WTKC 4DGNA 2C4GA 4WA9A 3N4TA 5AIRA 3R2BA 3GC7A 4BBFA 1WBNA 3G51A 4QP6A 4QMXA 2PVFA 4D2SA 2GQRA 1WFCA 4ALVA 3PY3A 4CG8A 3DAJA 4YNEA 1CKIA 4RJ4A 4C4GA 2UW9A 5ANKA 4R5SA 4I6QA 3O8TA 2VV9A 3MFSA 3VW8A 4RG0A 3E8EA 2AYPA 4YURA 2I0VA 3PP1A 4EH5A 4R78A 3ZLWA 1QPCA 4AZSA 4BTFA 3KVXA 1ZOHA 3V04A 2R2PA 4USFA 4ZZOA 4GK4A 3P7CA 4IVAA 5H8GA 4DINA 4EK4A 3LJ0A 4R3PA 1OM1A 4E6DA 4LDTA 4AA0A 5DPVA 1RW8A 2PVLA 3CKXA 3FYKX 3OY1A 4RWIA 3LFDA 4XRLA 4IVCA 4OT5A 4DHJA 2PZPA 2QOQA 4IX6A 4GMYA 3TEIA 5FDPA 3Q60A 3FI4A 4E4MA 3HZTA 2JFMA 4FV6A 4DEGA 1UA2A 4NFMA 3HVCA 2WTDA 2OIQA 2VO7A 3PRFA 4X2NA 4RSSA 2XNMA 1SMHA 2C5NA 1Q8WA 4FKLA 5BMSA 2ONLA 3PY0A 5A6NA 3BLAA 3EKKA 3C5IA 4K11A 4QPSA 2R64A 3OG7A 4P90A 3TG1A 4XCUA 5L6PA 2BZHB 2OLCA 4FEVA 2QKRA 4H1JA 2UW6A 4O22A 4HGTA 4WBBB 4H3BA 4L9IA 5ACBC 3IG7A 4HNIA 4M67A 5J8IA 2FA2A 2OU7A 2R3MA 2XIZA 1YOJA 5CEMA 4J7BA 4I21A 4ZY6A 3Q9ZA 1IAJA 1H27A 3R7IA 4S33A 3QZGA 3REPA 2CNQA 1H4LA 3P79A 4FTQA 3UIMA 3DNDA 4BIDA 2YAKA 4EZ5A 4CV9A 5HU3A 4P4CA 4WUNA 2AC3A 2JKOA 4WSQA 2C3LA 4L6QA 4O0VA 4EHEA 4XG9A 5GINE 1MRVA 1ZYLA 3QZHA 2OI4X 4C4IA 4LOOA 3VBWA 4G5JA 3I6WA 4FT9A 4JIAA 3KREA 5KZIA 4M15A 3OW4A 4A4OA 3P08A 2YA9A 4GFGA 4HGSA 1LR4A 3QWKA 1JWHA 1Q8TA 1W0XC 2WU6A 2W4KA 3KRWA 4OBPA 5BVEA 3VRYA 3RM6A 3V8SA 4BFMA 2QD9A 4RC2A 2GNGA 2B9HA 3AD5A 3R8MA 4MBJA 5HHWA 2P3GX 2R3OA 4K0YA 3Q4TA 4ANBA 1YW2A 5C27A 1PY5A 3VUHA 5FXRA 3KMWA 3N51A 5M44A 2XZSA 2G2IA 2IEWA 1PKGA 2PZYA 2A4LA 3OROA 4ASEA 5IH5A 3PSBA 4QQ5A 4YJQA 1YXVA 3P1AA 2BKZA 2RSVA 2YFXA 4YMJA 4CSVA 4ZY5A 1H28A 5M4UA 3DBDA 3HNGA 4H58A 1NXKA 4U6RA 4Y95A 2YM7A 2C6OA 4RVMA 5CY3A 2BTRA 4OTRA 4LQMA 3TUCA 3PFYA 3C7QA 4NFNA 4NM7A 5AR7A 4AX8A 4RFYA 2JAMA 4NU1A 2B53A 4JDHA 1H25A 2YLEA 4GU9A 2X9EA 3DDQA 4Q2AA 5KMJA 5K3YA 4PWNA 1Y6AA 3CKWA 3T3VA 5EKOA 3ORIA 4ACDA 3L8PA 3C4CA 3CCNA 5HNBA 2GSFA 2JDOA 3FLQA 4ZTQA 2WZJA 1H00A 4FEQA 4PTCA 2PMLX 4MH7A 4DGOA 2BHEA 3GVUA 5F1ZA 3ZONA 4AN3A 5HNIX 3NUSA 4FI1A 5F95A 3E8CA 3N9XA 4BCQA 3QQFA 4FX3A 4X6RA 1RDQE 3W8QA 2V62A 2XANA 2FYSA 4JNWA 4AOIA 4XMOA 3ATSA 3Q2MA 4L8MA 4BI1A 3S2PA 2OF2A 1MRUA 2UW4A 4EOLA 5I9VA 1M52A 2W1DA 2ZMCA 3ZC6A 5ETAA 3FQSA 4FSNA 5J1WA 2VD5A 4ZTHA 3SRVB 5CEQA 3W2RA 3EQGA 2PVRA 3C0HA 3L9MA 4IAYA 4L43A 2WO6A 5BYZA 4BN1A 4DH5A 4FKQA 2W99B 4RJ7A 2QOFA 2R3NA 2OJGA 4K77A 4AW1A 4FE2A 1J7IA 3E8DA 2VWBA 4IAKA 5J87A 1KE5A 3HRBA 3GQLA 4RIYB 2C6DA 3R83A 4AXFA 5CAOA 3B8QA 4NM0A 5DFPA 3E63A 3LFQA 5D12A 3GU8A 4AOTA 4AT5A 1YI6A 1Y8YA 5CXZA 4R7HA 3OWJA 3C4ZA 3T9TA 4M66A 5IA0A 3NYVA 2YIWA 4JG8A 4JBPA 4J8NA 1OIUA 1KV2A 4NIFA 3DV3A 4J71A 1JSUA 4U44A 4WHZA 3HAMA 3QLGA 4F78A 4AFEA 1J1CA 3CTHA 1TFFA 4OBOA 3FC1X 2WB8A 5IU2A 3RPYA 2WMAA 3Q4UA 5HD7A 3MBLA 3V5WA 3WZEA 2IVTA 3DT1A 4NL0A 3EIDA 2GNHA 4ZXTA 4UWCA 3DPKA 3RJCA 4O82A 2YEXA 2E9NA 4IACA 3RAHA 5GNKA 5AUXA 3L8VA 2CDZA 4MX9A 5CF5A 3TWJA 5CZHA 2XH5A 4Y72A 4NWMA 5FEQA 3TNQB 1UKHA 4QOXA 2YJSA 4GT3A 3QZIA 4BB4A 5I3RA 3VS3A 3CC6A 4RMZA 4M97A 4ZSEA 2PMIA 4ITIA 3OXTA 2I40A 2W1IA 3EZVA 4IDTA 4UYAA 3WOWA 4ACGA 1OBDA 1ZYDA 2XALA 4YJPA 4EHZA 4QMMA 2G9XA 4K8AA 3D7ZA 4G34A 5IUGA 2UZNA 3BX5A 1Q99A 2JKQA 3QXPA 4WNOA 1CDKA 2R3IA 2W05A 3R9OA 5JKGA 2BKKA 4P5QA 2XRWA 4HNFA 4ZSGA 4CTCA 4FSQA 5CEKA 4ASZA 4MNEA 3D0EA 3MPAA 3BYMA 3DY7A 4BCPA 2AC5A 2R3JA 4AF3A 1CTPE 4EUTA 2PPQA 4FSRA 1JVPP 2Z7QA 3AOXA 2HW7A 1ND4A 2J0KA 2Q0BA 3QKKA 2E9OA 1IR3A 3SAYA 2DWBA 2OJIA 2YDJA 3FXWA 3HUBA 3CQWA 3DLSA 5AP0A 5LMAA 2RL5A 3QGWA 3ZLYA 4AS0A 5CANA 4O1OA 1G8JA 5IISA 4LM5A 4RPVA 4ZLYA 3FMHA 5H9BA 3RK7A 4DG3E 1FQ1B 4AQCA 1XH6A 2PZIA 4AZVA 3W10A 1OPLA 4FGRA 2W1FA 1ZYJA 2C5OA 3PA4A 4FYOA 2C6IA 1BUHA 3KRJA 2PSQA 4NSTA 3BBTB 3FI2A 3UP2A 2GQSA 2V0DA 1PW2A 1QL6A 4LFIA 3FZSA 5JT2A 4KSQA 3HDNA 4M84A 5C8NA 4D4VA 3NNUA 4FOCA 3A8WA 3O2MA 5IEYA 2XVDA 4AZTA 2WMRA 3LFFA 2VUWA 4FV0A 2UW7A 2WKMA 4I0TA 4IM2A 4X21A 2W06A 3BGQA 3WI6A 4EH4A 2IG7A 3BRBA 4FIEA 1UWHA 3NNWA 5GJGA 3TYKA 3POZA 4GRBA 3TN8A 3COKA 4OR5A 1Y57A 3KULB 4QMPA 2OJ9A 3IQ7A 4RA4A 3CQEA 4WSYA 4X2KA 4PL4A 4RWKA 3VS4A 5E8SA 3MTLA 1UU8A 4YHJA 1NT2A 4DA5A 3FSKA 3DQWA 5CSWA 3FV8A 2ZV9A 3PYYA 4YJVA 5FP6A 4KB8A 3IDPA 4DFNA 4EH2A 1HCKA 3VF8A 2UZWE 2LAVA 2OZAB 3HV7A 4QTAA 1KUTA 4EQMA 1ZLTA 4BGHA 1X8BA 3EHAA 3R1SA 3V5JA 3R21A 3PG1A 3EFKA 5HGIA 3GU4A 4I24A 1YOMA 2UZBA 4ANQA 4JR3A 4FT3A 3G0FA 4FF8A 4UY9A 3FKLA 4AGDA 2X9FA 2J90A 2EXCX 3F7ZA 3KMMA 4N57A 3FEGA 4ZTRA 4YUQA 3DKGA 4XNEA 5AX9A 1BKXA 2CCIA 4HW7A 1WBTA 3KK9A 4YZBA 1YHWA 3SC1A 3CIKA 3R9NA 3MVJA 4RQKA 4RZWA 1Z57A 2VWYA 3LXLA 4CZYB 3S4QA 3R00A 4DH1A 4CD0A 3KRRA 2RFSA 3F3ZA 4HVIA 2BROA 4BBEA 1CKJA 2GDOA 3NW5A 5FXSA 3ZLXA 1OKVA 3NS9A 1R0PA 2Y0AA 4BTKA 5AV4A 3QALE 3MA3A 4X0MA 3QFVA 3NW6A 1STCE 3D7TA 4CYIA 1MP8A 1W82A 4R1YA 3TV6A 3AQVA 3DBCA 4C3FA 4RT7A 2E9PA 4M13A 3ORMA 3HX4A 3QTQA 3ULZA 3TUDA 3MY0A 3ORKA 3MESA 5EQEA 4G3EA 5EOBA 5HIDA 4CG9A 4FKGA 4NM3A 3EQFA 3NIEA 3EFLA 4YC6A 4KIOA 4DH8A 4HJOA 4AZEA 4CTBA 1IA8A 4HCVA 4PMPA 3F82A 3BQRA 5A4LA 1YXTA 4ZAUA 3TV4A 2ACXA 1F5QA 3HP5A 4L7FA 5CU6A 3BKBA 4LOQA 3TNPC 1GZOA 4EQCA 3Q6UA 5DEWA 3QGYA 3CY2A 5HG9A 4FVRA 3R9RA 2JKMA 2ITYA 2PUUA 4L42A 3ATTA 5BVFA 1NY3A 5A14A 1W84A 4YZ9A 3O96A 2XNPA 2HY0A 3UDZA 2WTVA 1H24A 3Q4CA 5JSMA 4AXDA 2YCQA 5JRSA 3RNYA 4AOJA 4USEA 5IA4A 4O0SA 3UODA 1WVXA 1BYGA 4I20A 4C0TA 2OH0E 3VAPA 3WF5A 4D4RA 1QCFA 1SZMA 2PHKA 2O3PA 4AGCA 2Y7JA 2EWAA 4EKKA 2P2HA 1OPKA 1PJKA 4N6ZA 4ZZNA 5B2MA 1M17A 1DI8A 4CV8A 4B99A 5EQPA 3MIYA 4ALWA 4RWLA 3DK7A 2BFXA 4H36A 3VVHA 4AXAA 3S95A 3DFAA 4DEDA 4F0FA 4ORKA 5KHXA 2EVAA 1DI9A 2WIHA 2UZEA 4HOKA 4QMLA 3W0RA 3ZHPC 2PE1A 2OJJA 2XF0A 3VBTA 5KNJA 3B8RA 4ITJA 1PXJA 2FGIA 3EMGA 4OTDA 1WZYA 3I5ZA 4JXFA 4HPTE 5F94A 2YERA 2VO3A 1ZMUA 1PMEA 2Z7RA 3LXKA 2IJMA 3PE1A 5AV1A 4QMQA 4QP7A 2HK5A 4MUQA 5LWMA 4QMZA 4C61A 3QYWA 1E1XA 4JOAA 4F70A 5A46A 4FTLA 3W2CA 4D2TA 3DTCA 2B55A 3CS9A 2QG7A 2X6DA 4FJVA 2WQNA 4TN6A 5CAQA 5EYDA 3FUPA 1GIJA 3BBWA 4OT6A 5FWKK 4QYFA 1SM2A 3GT8A 1KOAA 5FUTA 5LWNA 2O2UA 3FZPA 2J2IB 4G3CA 4KBKA 2HENA 4IAIA 4IJ9A 4JIKA 2W9ZB 1YXXA 5CWZA 2OSCA 3R0TA 1IG1A 5JK3A 2UW0A 4U41A 4L3JA 4XBUA 4IDVA 3CJFA 3TJDA 2Z7SA 5LVOA 4AU8A 3VUDA 3A61A 3UYTA 5DMZA 2PE0A 5F20A 3WILA 3H0ZA 3DU8A 4NZWB 2BILB 2EU9A 2V7AA 3R63A 1GOLA 4DLIA 3EL8A 2OK1A 2QVSE 4IWQA 4ALUA 4J1RA