2QO2A

Human epha3 kinase and juxtamembrane region, dephosphorylated, apo structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
282
Chain Sequence
TYVDPHEDPTQTVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 282
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qo2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qo2A01
2WELA 4F9CA 1YRPA 4IEBA 2C3LA 5HVKA 4ENYA 2BMCA 5JZJA 1TVOA 4G3EA 4PDPA 3DAEA 2BDWA 4S32A 2VWIA 4AQCA 1PKDA 3E88A 3G0FA 3MW1A 5HO6A 2EU9A 4BTFA 3S00A 3QA8A 5EKOA 1YXTA 3F3TA 4RIOA 2Y6OA 3HVCA 4F7LA 3PVGA 4EWQA 2PZPA 3FYKX 4XP2A 1XQZA 5IZFA 1H1QA 3DB6A 5D12A 5CAVA 4ZTRA 4BDJA 4C4GA 4AW5A 2ZV2A 3I1AA 5DH3A 5AUXA 4L00A 4YTFA 3N9XA 1E1XA 1IR3A 3QD2B 1PXIA 4F64A 4RLKA 2BFYA 4UYAA 1XO2B 3GVUA 3HEGA 3B8QA 3D9VA 3FI3A 3GEQA 3RP9A 3G6HA 3R21A 4NEUA 2F9GA 2H8HA 4B8MA 2HXLA 2C6TA 2IVSA 2XEYA 4CV8A 4JI9A 3MY5A 3Q4TA 3CKWA 3RK9A 4BB4A 4FA2A 4AP7A 4JNWA 4EOQA 2HXQA 2CGVA 2R3PA 3KU2A 4BCMA 2XIZA 4BN1A 3F6XA 3P79A 5EYKA 4BDEA 5BX0A 4IANA 4UV0A 2EB3A 2VTLA 2HY81 3QYZA 1OIUA 4H3PA 4D55A 5HG9A 4BZOA 2PUNA 4I4EA 5H8EA 4MBLA 2RKUA 4U79A 4R3CA 1JNKA 3MWUA 4DC2A 4L42A 3VUTA 3W2OA 2BFXA 3CY2A 4C8BA 3ERKA 3E7VA 4CNHA 3OP5A 4WD5A 2VU3A 4GUBA 4QQ5A 4X3FB 4RJ6A 5AEPA 3RPRA 5A6OA 2Z7LA 2XM9A 3PXZA 3KRXA 4M0YA 3BRBA 2UZLA 3E87A 4U9AA 1FVRA 4ERKA 3C51A 5BUIA 5AWMA 4E4LA 4UEUA 3OCSA 4IIRA 4L6QA 1DS5A 4TTHB 3CXWA 3BU5A 4L7SA 3HKOA 4MHAA 2WFYA 4YJOA 3AC4A 3U6HA 2O63A 1J1BA 3OW3A 5D9HA 1H27A 4RJ5A 2JKQA 3A7HA 4QTBA 5FWKK 5BMMA 2W1CA 4BCHA 3R0TA 4JG6A 3COMA 4F9YA 1NVQA 1KE9A 2V7AA 3KCKA 1XJDA 5E1EA 3CGFA 3KMUA 3UQCA 4GJ2A 3TNQB 3U6IA 2OJGA 4AWIA 3FY0A 3GQLA 3DQXA 3SV0A 3U6JA 4GT5A 4CRLA 4E5BA 3TCPA 1YI3A 3NRMA 5D7AA 4CXAA 1YWNA 5F95A 3PXYA 2GQRA 4O7WA 3C4EA 2O5KA 3UZTA 4OBQA 3NDMA 4EK8A 3HRFA 4XV9A 3WF6A 1H01A 4DLIA 3QYWA 5EW3A 4A7CA 4A4OA 5C8KA 1SVGA 2A19B 1UNGA 2FSLX 1YDRE 3OY3A 4EYMA 2X6DA 3FXXA 5AX3A 2ITUA 4L67A 5EFQA 2IWIA 4GK4A 3TI1A 2WEIA 2ETRA 4FTNA 3A7GA 2GDOA 3OWLA 1ZYSA 2PMOX 4HYUA 4I0TA 4TNDA 4AOJA 2DS1A 3W2CA 1TQIA 5IA2A 3LFSA 4ZSGA 5DPVA 4ZAUA 4DG3E 3VUMA 4B4LA 4FTCA 5CVHA 4CCBA 5GJDA 3R9OA 5FTGA 1T46A 4DFXE 3DFAA 4EOMA 4RWIA 4B6LA 2QNJA 3LFNA 4KIPA 4G3DA 1LP4A 2XKEA 3OVVA 4JQ8A 4LOQA 5KE0A 4B8LA 2ITOA 2OH4A 4ZZMA 1WBVA 4BDDA 2RG5A 4AE9A 2Q0NA 5HBJA 5E8XA 2OKRA 4NH1A 3UO5A 4CD0A 4FKPA 4IDTA 4AZVA 3P7CA 1P5EA 3OWJA 3CEKA 3WE8A 4GIHA 5FP5A 2V62A 4AAAA 3G5DA 5AV0A 2ERZE 4QP6A 4HPTE 4LRJA 3ATSA 3RM7A 4R7HA 3S3IA 4F1OA 3O7LD 5FBOA 2G2IA 1GY3A 5LMBA 3ORTA 2HW7A 4XUFA 3E93A 4AUAA 4IAFA 3UMXA 5JRSA 5GZAA 3IGGA 2OJFE 5AUYA 2OO8X 3KQ7A 4FKIA 4HZRA 1YKRA 4D1SA 4H1JA 3G2FA 4FL3A 3SQQA 1M52A 3R83A 4G9CA 3I0OA 3P5KA 4LOPA 5I4NA 1HCLA 4FTJA 1LPUA 1FQ1B 3OOMA 2QOQA 5FDPA 4FSUA 3UP2A 4C38A 3GU7A 3KULB 3FMJA 3LW0A 1UKIA 2A1AB 5D11A 3IOPA 2GHGA 3KXZA 4U3ZA 3BLRA 1OI9A 2PUUA 4L44A 4YJUA 3FZTA 1Q8YA 2I0YA 5C1QB 3I79A 4YJSA 3EKNA 4F7JA 2ITQA 5CAOA 4IFCA 3GC9A 3HMIA 3UQGA 3WZEA 5IQBA 1V0OA 3BBTB 3NSZA 3LCDA 4RA5A 5F20A 5B2KA 5HD4A 3F7WA 2WMVA 5JH6A 2BKKA 5E8WA 3C0HA 2WQBA 3IGOA 4WO5A 2PPQA 3ZMMA 1P4FA 1OKWA 1K9AA 4QQJA 3CTJA 5HNIX 4MQ1A 3RBWA 1J7IA 1PXMA 5ETCA 2E9NA 5LVLA 4JBOA 1QL6A 3BGQA 5B2MA 5GZ8A 4RFZA 3QAME 3ZSGA 2G9XA 3IO7A 3AQVA 2W05A 1NXKA 1RJBA 3VQHA 1M7NA 2ETMA 2QU5A 3HLLA 3R8ZA 3GB2A 4TYIA 5FUTA 4FG8A 4PMTA 5HLWA 2F7XE 4TYHB 4FVQA 4L9IA 2IG7A 2OJ9A 4NM3A 2R9SA 2QODA 5A4TA 1CM8A 3MIYA 5G6VA 1JPAA 4FVPA 3F82A 4FI1A 4PNKA 3F3VA 2W1EA 1B39A 4XJ0A 3GOKA 4OTFA 5FEQA 1IA9A 2YAAA 4FOBA 2BHEA 3D7ZA 1V0BA 3P78A 3SGCA 3R00A 4K8AA 1ZZ2A 3MPAA 2OICA 3KMWA 2HWPA 2J6MA 5DHJA 3HV5A 3LFBA 5HE0A 4NKAA 3ROYA 5AA8A 5HO7A 3POZA 4O0TA 2VTNA 4RIWA 3UVRA 1JBPE 3CD8A 2DYLA 5EM5A 2Z7SA 3K5VA 3GBZA 3DBCA 3MFUA 4NTSA 4AN3A 2YFXA 2ITXA 3JXWA 4FTAA 4QMLA 4C33A 4TNBA 2E2BA 3QD3A 4GFOA 3UPXA 2QHMA 4BF2A 1O6YA 4IWOA 3RPSA 5D1JA 2W1HA 3QD4A 4TRLA 5HU9A 4CV9A 3NNXA 4BDHA 3KFAA 4MD7E 5CF4A 2JKOA 1H0WA 1T45A 5BVKA 5FXSA 5CWZA 1R39A 5I9VA 2VWYA 4YP8A 5HHWA 4H3QA 4QMVA 4CFWA 2NNWB 4C3FA 2WU7A 4Z7GA 4ACCA 3ZZWA 1YI6A 3EN7A 3QC4A 4F6SA 3KREA 1M7QA 4V01A 2R5TA 4XG7A 3CS9A 4CEGA 5LXMA 2OXDA 3LM0A 4EBVA 4BIDA 3DAJA 3U51A 4H58A 3UODA 4O7TA 4KIQA 3QZHA 3ID6C 4BTMA 1UKHA 4W4YA 4RQVA 2QI8A 3UZRA 4OTQA 4D2PA 3A60A 1ZARA 3QWJA 5KCVA 2YDJA 4FSQA 2HWOA 3E8DA 3EYGA 4NT4A 4FV0A 5HZNA 3U4UA 2WKMA 4NZWB 5A54A 5AR7A 4BI0A 3F61A 4ZOGA 3HV4A 5M4UA 5KZ0A 2JIIA 4WUNA 4YJRA 2GCDA 2HK5A 4MXOA 4EKLA 3GENA 3KXMA 5J87A 3VQUA 4E93A 3W10A 5CT7A 5IG1A 3NUYA 4OUCA 2PMIA 3HNGA 4GH2A 1YDSE 4KIKA 3BGPA 4O22A 4WNKA 3ZXTA 4ZY4A 5J79A 4IZAA 1JKLA 4NFNA 4R77A 3F9NA 3DB8A 3JVRA 2R3FA 2XA4A 3Q60A 4M84A 3E3BX 4D28A 2CNVA 1FGIA 2ZM3A 4JBPA 5I9ZA 3ZLXA 4XMOA 1G3NA 3D15A 2WMAA 2FYSA 4BKYA 5IPJA 5HI2A 1BLXA 4GSBA 2BIYA 3A4PA 4K0YA 2AC3A 5K9IA 1XWSA 5FLFA 2GNGA 4EOLA 4Q5EA 4MVFA 2WTDA 3JY0A 5J1WA 5DT4A 3QUPA 1NW1A 3NYVA 3C0IA 3I0QA 2A27A 4K9YA 5C03A 4F6WA 4F9BA 5T3QA 4FUYA 1JWHA 2W7XA 4S31A 3RWQA 3V5QA 4DEIA 1H28A 3AMAA 3D94A 1OL7A 3R8LA 1KSWA 3C4FA 5AADA 1Q41A 4YZBA 5AP3A 3SXSA 3M1SA 2R3RA 2OSCA 5AP4A 3NUSA 3UIMA 4R7BA 1U46A 1JAMA 3F5PA 3SVVA 2R3GA 2ZB0A 4M66A 3RAIA 2XH5A 1OGUA 4DCAA 5GJGA 3M2WA 1Q99A 4PP9A 4YJPA 4EKKA 2PYWA 3OG7A 1PHKA 4D4YA 3EKKA 4GJ3A 5DWRA 5C01A 3FZSA 5I0BA 5GZ9A 4EH4A 4FKRA 2X2MA 4ONAA 3T8OA 3UVPA 2JAVA 5JGAA 3NW6A 4IVCA 3SG8A 4PX6A 2YCQA 3LXLA 4FKSA 4FSNA 4RRVA 3FMKA 5DR9A 2W1ZA 1BL7A 1Q5KA 4OBPA 5FGKA 4DEBA 1WBTA 3EQRA 3R63A 3W8QA 4M0ZA 1IAHA 2VTRA 4YR8A 5IU2A 4L68A 4GG5A 4MAOA 5IKWA 2JDRA 2NRUA 2JKMA 3WZKA 4CCUA 4XYFA 3AOXA 5DLSA 3BX5A 2QKWB 4RC3A 3QGYA 4O7LA 4E5AX 3HDNA 4OBOA 5AP0A 2OF2A 4ANLA 3PY0A 2IZSA 2EUFB 3MI9A 4ANOA 4RX5A 3C7QA 3ZFYA 5CAUA 1URCA 3BV3A 1I44A 3LXPA 5FBNC 2HY0A 3B2TA 4CKJA 1YOJA 3ZBXA 4IB5A 2QOHA 4JR7A 4IAZA 3D7TA 4W4WA 2OLCA 3BYSA 4KRDA 5CASA 2JFLA 1OPKA 4X2FA 5I3RA 4QYGA 2IVUA 4USDA 3QTRA 4ALUA 5ANDA 1F0QA 2W96B 3ELJA 4RC2A 4CYIA 5IMXA 1A48A 5TO8A 4EH7A 4YTCA 4O0RA 3KF7A 5ANEA 3CP9A 3IKAA 2JIVA 3SD0A 3MIAA 3OMVA 4C4JA 5AFVA 2YLEA 3FDNA 4J7BA 4DGLC 3AC1A 3IDBA 1Q61A 5F94A 4ZTMA 1FVVA 5I5ZA 4C2WA 2WB8A 3DNDA 5CAQA 2YISA 2FSMX 3QGWA 4FTRA 4AT4A 4YLJA 1RW8A 4CLIA 2WIHA 4TWPA 2UUEA 3WF8A 3MH1A 5DA3A 4BCOA 3KB7A 3OY1A 4RBLA 5CYIA 3QTSA 4CFFA 2J0KA 4RFMA 2KULA 4PTGA 3TTIA 4EQCA 4FIFA 2RF9A 4BDIA 3HECA 4IC8A 4DEAA 3E92A 2B7AA 2UW7A 4C36A 3VRZA 3MA3A 4U81A 3P23A 4ACMA 3DJ6A 5DN3A 2ZMCA 3BQCA 3TACA 3PFQA 5CSHA 4M69A 5ICPA 4FL2A 4N0SA 3EL8A 2GS6A 3DCVA 4FZDB 5DT0A 2BAJA 2CN5A 1KOAA 4KUJA 3ODYX 2H9VA 3W2PA 2XNNA 3UVQA 4BCPA 2PZIA 4TT7A 1YWRA 4DCEA 3OW4A 2F7ZE 4QP8A 5EKNA 4L01A 3GU4A 5HIBA 2YDIA 4O7YA 2UW6A 5AUVA 5LVNA 3DBFA 2CSNA 4D5HA 4NKSA 4P90A 2C0OA 3NAXA 4UMTA 4EK4A 3PP1A 4YJTA 4K18A 3O8PA 5FG8A 4DFYA 3VN9A 4O7RA 4BC6A 3R01A 4ZJJA 1V1KA 4NWMA 3B8RA 3WYYA 1QPDA 1DI9A 3ATTA 2C47A 5ETIA 4TZRA 5HCYA 4LMNA 3VBXA 1L8TA 5K4IA 5HCXA 2QLUA 2BCJA 2Z7RA 3BYOA 3DJ7A 4K11A 4BRXA 4BTKA 5AA9A 2XB7A 1SM2A 3C50A 3GGFA 4B9DA 3QKMA 4IADA 4FSZA 3W33A 2ONLA 1F3MC 4FEWA 3NCGA 2OZOA 4KNBA 2VX3A 5L8KA 5KNJA 2X8DA 3DGKA 3PG3A 4UX9A 4BY9E 4ITJA 4M68A 2RSVA 1BUHA 3R71A 4KWPA 3FLWA 1Y57A 3U9CA 4DH5A 5IH4A 2XNPA 1OPJA 1CKJA 2OIQA 3CLYA 2CKQA 1OVEA 3FQSA 4JAJA 3BI6A 3MB6A 3ULIA 3ZEWA 4RX7A 4E4NA 4RWKA 4QTAA 4EL9A 3HUCA 3CGOA 1JKTA 2Y7JA 5J5SA 2I7QA 2GS2A 4CFMA 5A6NA 4FT9A 5C4LA 4ZLYA 3KRRA 5J1VA 3F5XA 4I3ZA 3A8WA 3Q52A 4DITA 1WBNA 1BKXA 3ULZA 4ANQA 3GU6A 3PVUA 4IVBA 5AM7A 3W32A 3F88A 3QTWA 3ZEPA 4DGMA 4F6UA 2UZDA 3LJ0A 4C62A 4XOYA 4F63A 2F2CB 5CEQA 4BCQA 4ZTSA 3CTQA 4J1RA 3TJCA 2CNUA 2C3KA 4N4SA 4JOAA 3OROA 5CF8A 3SX9A 3COIA 4I6FA 3UIXA 4NJ3A 4AOTA 4R5SA 4IZ7A 4XNEA 3DXQA 1UU8A 5HEZA 3EN6A 5KX8A 3PSBA 3GU5A 5L2IA 5AR4A 3BHVA 3CY3A 5LMKC 5IA3A 3UJGA 4UXQA 4DINA 2C5XA 1ZMVA 2VTAA 3BELA 3E8EA 4IB1A 5IA5A 4EH3A 5IDNA 4X6QC 4IX3A 4GMYA 4K6ZA 5EM6A 1OL2A 4EUUA 2XRWA 4FKVA 4A07A 5L6OA 3ZU7A 4DT9A 4XH6A 5L2TA 1BX6A 5KMNA 1JQHA 4FGRA 3NLBA 1Y8GA 4GK3A 3ZDUA 3TUCA 3QU0A 5KKRC 4O27B 1MP8A 5DMZA 5FDXA 3RZFA 5HG7A 3CPCA 3GCUA 3NYOA 1TKIA 3AD5A 4EOPA 3CIKA 3NZ0A 4XG2A 3F3WA 1RE8A 3DAKA 3T3VA 2P33A 4Y73A 1OM1A 2ZYBA 2PY3A 4BCFA 3RALA 4H3BA 5AP6A 4E26A 2A4LA 4PDSA 3AD4A 3H30A 3MJ2A 3ZUUA 1FGKA 4DH8A 4BCIA 3L9LA 5CQWA 5CX9A 4JG7A 5TKDA 3G0EA 2VWXA 5FEDA 1OECA 3RJCA 2VNYA 3R8MA 2HENA 4DFZE 3R7IA 3N51A 2ZVAA 4G3GA 2OXXA 4J95A 5JQ8A 2BRMA 2C5YA 2QOOA 3QQJA 1OBDA 4OR5A 2UVYA 4FKTA 2VTOA 4L7FA 4KA3A 1MQ4A 3QCXA 3R7EA 1GIIA 3R02A 4LQMA 3L8SA 5BYZA 4C2VA 2PMNX 5CANA 3S0OA 2HCKA 3FKLA 2BAKA 3HMOA 3O23A 3LHJA 4JS8A 4QMSA 5B0XA 5C9CA 1BI8A 3L9NA 4MEDA 2FUMA 4QMUA 5TR6A 1Q24A 4YJQA 2YWVA 2UZUE 4BDFA 2W9FB 2WMTA 3QX2A 4FT7A 4QYHA 4V04A 3HMMA 1Q4LA 4ORKA 1L3RE 3QZIA 1XH5A 4I4FA 2GMXA 3NW5A 3JPVA 4AF3A 3UNZA 5DI1A 3UGCA 5E8UA 2IW6A 2R2PA 4E4MA 2XEZA 2EXCX 1HCKA 3SRVB 2QKRA 4N57A 3BLHA 4IAAA 4CTCA 3OTUA 4DA5A 2JAMA 4HOKA 4CZUA 4WKQA 1YVJA 1PYXA 2B9JA 4F9WA 5CSVA 3FMMA 3ZRKA 3ORNA 4YC6A 4EYJA 4FTUA 3IDCA 3P1AA 4I5CA 1YHWA 3QQUA 3SDJA 4FOCA 4GYIA 3WF7A 3VRYA 4EC9A 4O0VA 4GKIA 3FL5A 4AGUA 4EC8A 5AUTA 3E64A 3EB0A 2NPQA 5LVMA 2PVMA 4U40A 4FL1A 3IONA 2YJRA 3PYYA 3QRTA 4ITHA 3QX4A 3OCBA 3ROCA 4IACA 3BEGA 4FTTA 4EK3A 2ZAZA 2PUPA 2WMRA 2Z2WA 4M8TA 4MCVA 1SNUA 3QZGA 1JSVA 2C5NA 2E9UA 1G5SA 4D0WA 2OGVA 5EG3A 5EQPA 3LQ5A 2VWVA 4AW2A 3I7BA 5AV3A 3THBA 3ZSHA 5DBXA 3EMGA 2CCHA 5EDRA 3H0YA 4UMUA 5AAGA 4TY1A 4D58A 4LYNA 4E7WA 3PVBA 3FLZA 4BWPA 3NUUA 4Y72A 3PJ1A 5M06A 3UOJA 5JGBA 4I5HA 2G1TA 2HYYA 4JAIA 3N4VA 4WNPA 4O86A 4OLIA 4ARKA 3NVKI 4HGSA 3BWJA 3GXLA 3QBNA 5DGZA 3S2PA 4A9RA 3V6RA 3F5UA 5HTCA 2F49A 4KD1A 4MKCA 4I20A 3UE4A 4O7SA 3Q9ZA 3O50A 5IQGA 4A9SA 4FV4A 3K3JA 3CE3A 2X8EA 5HU3A 2JDVA 5AM6A 3FJQE 2YABA 4G3FA 2R7BA 2ACXA 2R3IA 1H24A 2CCIA 2NO3A 4FKJA 4R1VA 2QO2A 3AC2A 4CMOA 3PIZA 3ORLA 3PVWA 4HPUE 4I6BA 4L3PA 2OW3A 1U5RA 2JIUA 4X0MA 3S4QA 2LGCA 3VC4A 4XG4A 5CENA 5CEPA 1F5QA 3DKOA 3BE9A 4V0GB 5F1ZA 4DN5A 2PHKA 4RIXB 5CU6A 2WTVA 2C1BA 2X0GA 3MN3A 3TKIA 4XP0A 1WBSA 2ZM1A 5BYLA 4BCGA 4QMWA 2YIRA 2F4JA 4CYJA 4C37A 3I60A 3LE6A 4QD6A 2PU8A 3FLQA 2REIA 4BZDA 1MRYA 3LJ2A 2Y0AA 5J95A 2XK8A 5JEBA 1R3CA 5DOSA 4AACA 4BDBA 2QO7A 2XK6A 3O8UA 2JD5A 3SOCA 2WMUA 4NFMA 4W9XA 3PJ3A 3TV6A 5BPYA 3MJ1A 3LCOA 4IQ6A 4J71A 4FKWA 4KSPA 3VBYA 3GQIA 2NRYA 4GCJA 3VULA 4KKEA 5JSMA 2XNBA 5AP1A 1H1PA 3ZOSA 4U97A 3QD0A 2JDSA 4QPAA 3EHAA 4RMZA 4UYNA 4YO4A 5AR3A 2O2UA 2W1GA 4AA4A 1JSUA 4E6DA 4JX7A 5CI6A 2XBAA 5M08A 4QMNA 4MD9E 4FV7A 3EFJA 3EIDA 3QRJA 5BUJA 3R9RA 3F69A 3EZVA 1VZOA 3OBGA 3P9JA 3SXRA 2UW9A 5KMMA 1UWJA 1R0EA 2GFSA 1OKVA 3P0MA 2V7OA 3OXZA 5DNRA 3Q32A 3A99A 4FNXA 4I5PA 3VS2A 3EQHA 1H26A 3DDQA 3LJ1A 3AC3A 4V05A 2JBPA 4RIYB 3G9LX 3NYNA 3DKFA 4ASDA 1J91A 3VS7A 2BILB 1B6CB 3P7BA 3NWWA 5I9UA 2W4JA 5T6KA 1XBBA 3HAMA 2E9OA 5J7BA 2YZLA 1ZYCA 3PDTA 2UZVA 2I0EA 4O6LA 1YHVA 3DKGA 3BYMA 4MBJA 5B7VA 2YCRA 5CU4A 4WSYA 4BBMA 2BZJA 4BIBA 3EH9A 3VBQA 4UMQA 4RC4A 4U8ZA 3ZO2A 3MBLA 4EHZA 5JZNA 2VTIA 2O0UA 5EW9A 5HE2A 3UQFA 3NNWA 2GNHA 3H0ZA 4X3FA 3NIZA 4FYNA 4MQ2A 4NCTA 3UG1A 1CMKE 1ND4A 1QPJA 3NPCA 4BDGA 1Z5MA 4FYOA 4G5PA 1YXXA 4M3QA 4FEXA 1ZYLA 2VTQA 5CF6A 5M55A 1FOTA 1Y91A 3C1XA 5HIDA 2J0JA 3LXKA 4PUZA 5LVPA 4F08A 3I81A 5CVGA 5EK7A 4AGWA 3VJOA 4IAYA 3Q9WA 4AZFA 4O81A 3E8NA 4C57A 4ALVA 1H4LA 4U80A 5HIEA 5D41A 3OOGA 4I0SA 4XV1A 1UA2A 3MYGA 2C6OA 1OL6A 5E91A 5K4JA 4Y46A 1UNHA 2BVAA 3HP5A 3GC0A 3H4JA 2B4SB 4QQTA 4FTMA 5BVNA 4I23A 3L1SA 1GIJA 3DK3A 2PWLA 2WTKC 1STCE 4MNFA 1PKGA 4RJ3A 3WF5A 3AGLA 5M53A 5I9WA 2ESMA 5I9YA 4F7SA 5JFSA 4JR3A 4ID7A 4KBAA 1XH7A 3A7IA 3ETAA 3OXTA 5BUEA 4BCKA 5TF9A 4KKGA 3RVGA 3CR0A 3L8XA 3HA6A 5IISA 2OWBA 4I24A 3LQ3A 1XH4A 2ZDUA 3ORKA 5AV1A 1MUOA 3LFEA 1V0PA 4FR4A 4P7EA 3D83A 4ITIA 4WBBB 1FPUA 4EH9A 1IASA 3BIZA 5CZIA 3BYVA 4BTJA 3QRKA 4G9RA 4ANNA 4EH2A 2YITA 1Q3DA 3DU8A 4D2RA 3D5XA 1WBWA 2UZWE 3FZPA 4FG9A 3ZM4A 4AOIA 1K2PA 5KHWA 1UV5A 1QCFA 3TTJA 1WVXA 3L8VA 4M67A 2XJ2A 3HGKA 2QURA 3FSKA 1Z9XA 2VAGA 1IA8A 3IECA 4YJNA 4FV1A 2X1NA 2XNOA 4G31A 3ZHPC 3VUDA 1SYKA 4YHTA 2DQ7X 1FINA 3E7OA 3NUAA 4ZS0A 4APPA 2I0HA 3DBQA 3FWQA 5B2LA 4HNFA 4LM5A 2W5AA 3EYHA 5L4QA 1WCCA 2QR8A 1CTPE 3BE2A 3MFSA 3PIXA 4P5QA 2P3GX 3PA5A 4ZIMA 3VBVA 4XEYA 4ACDA 3ORXA 3LFCA 2YHVA 4KS8A 1AD5A 1GZNA 3VJNA 3QL8A 5KHXA 5M07A 3SA0A 5FQDC 3R7YA 4J8MA 2BRBA 3D5WA 3MESA 2YIYA 5IQCA 1OL1A 1BI7A 1H1SA 1WVYA 2F57A 3D2IA 1SNXA 3MVMA 3A4OX 3TKHA 4O84A 3CTHA 3UOLA 4IH8A 4P2KA 4LUEA 5EOLA 4FV5A 4DEDA 3KULA 4I92A 5CEMA 4U41A 1X8BA 2GTMA 3QLGA 3FI8A 5ANJA 3UIUA 4FSMA 3REPA 4ASXA 1Q62A 3EN5A 2IW9A 4UY9A 1ZY5A 3UP7A 2HZIA 4PQNA 5K0KA 4BICA 3ZXZA 4OTIA 2GQSA 2P55A 2I6LA 3ITZA 2Y4PA 3GCPA 4GKHA 3O51A 2DWBA 3IQ7A 4DG2E 5HE1A 3QRIA 2X7GA 3UPZA 4LOOA 3DNEA 2C1AA 3QZFA 4RSSA 4F99A 4I22A 4APCA 2Q0BA 5HORA 2JKKA 2KTYA 3F66A 4D4VA 4R5YA 3D5VA 3IW4A 3TV4A 4H39A 1XKKA 4N70A 2WU6A 5H9BA 5KMIA 3O17A 3KC3A 3WOWA 4YZ9A 3UNJA 4ENXA 4YSJA 2CGWA 1ZOGA 3UC4A 1O6KA 5I9XA 3PTGA 4TYHA 3LLTA 2EWAA 2EB2A 2RFSA 3EQGA 4H1MA 1ZMUA 2BRGA 3DS6A 4WG5A 4C0TA 4QMPA 4EH5A 4RFYA 3FLSA 4DH7A 1OIYA 4OGRA 4KBKA 4OTDA 3KXGA 3BQRA 2ZM4A 1UVRA 1M2PA 2XNMA 3ORMA 4TXCA 5HCZA 3R7UA 4QP4A 4PMPA 3F5GA 3MGYA 3KF4A 5AP7A 2C5OA 2FGIA 5L8JA 3IW6A 4Y5HA 3VHKA 3FZOA 2UZEA 3O96A 1KE7A 3ET7A 4EK6A 5M51A 1G8AA 4WBOA 3FUPA 5FRIA 4ANMA 1Z57A 3ENMA 4S33A 4EWHA 3KCFA 4L46A 4NIFB 2UW3A 4X3JA 5FD2A 4MNEB 2BTRA 4H36A 4FODA 1IRKA 5DVRA 1JKKA 3FI4A 4JIAA 4EUTA 1GZOA 1H00A 4RT7A 2FH9A 4PY1A 5AP2A 1ZWSA 2W5BA 3EQDA 4Y5QA 1ZOHA 4DEHA 5LQFA 1PF8A 3KMMA 4CT2A 2JBOA 2HAKA 3NUNA 1OBGA 5DG5A 4FZ7A 2YN8A 4AE6A 5AAEA 3BHTA 4MTAA 3G6GA 4LL5A 4QQCA 4B7TA 4U0IA 4A9TA 5GJFA 2R3LA 4EK5A 5T68A 2XIKA 4C7TA 2QOFA 2OJIA 4IC7A 2BIKB 3O8TA 4QP7A 4X2JA 3Q04A 2VTJA 4DH3A 3K3IA 3RPYA 2EXEA 4BZNA 3KA0A 1REKA 3UO6A 3ZUTA 2OZAB 4BKJA 4CFNA 3AG9A 4MWIA 1UWHA 2B9IA 3R2YA 2C4GA 5TOZA 2GNIA 4D9UA 3PJCA 2J0LA 4FTQA 4FNZA 3Q4ZA 2YIWA 4C58A 4D4RA 4Z55A 3V5TA 2VN9A 2W9ZB 1U54B 4W4VA 3PRFA 1LUFA 2YCFA 4JDKA 3SC1A 3AXWA 5GNKA 3FV8A 4UALA 2Z02A 3FZ1A 3RNYA 3DA6A 3C4CA 4ZY6A 3Q6WA 3HP2A 2CPKE 4ZK5A 4KB8A 2O65A 3W18A 4TYGA 2IZTA 4JLCA 3FLNC 2CJMA 3U54A 3HAVA 5HVYA 3RCDA 4ZS4A 4DG0E 2YIQA 3NX8A 3R2BA 3VVHA 3DZQA 4QNYA 4YGAA 4M12A 5HNGA 4QMYA 4FV6A 3L9PA 4WG3A 3LMGA 4CTBA 4M13A 2UZNA 4O82A 3QQFA 1A9UA 3GNIB 1J7LA 4H05A 4HZSA 4C35A 4O83A 4RX9A 2XK3A 1VEBA 4DE4A 4PDOA 4DF3A 1JLUE 5CT0A 4KSQA 3IW5A 3NUPA 1DAWA 4X2KA 5TT7A 4II5A 5M4IA 3KXNA 5HBEA 2UW5A 2YWPA 3CCNA 4WIHA 2XCHA 3RGFA 4EH8A 5KUPA 1GNGA 3PP0A 3EQIA 4WSQA 3NNVA 4LUDA 3NCZA 4QTCA 2F7EE 4UXLA 2VUWA 2C68A 5BQ0A 1YXSA 2UZBA 5EOBA 5BNJA 4W9WA 5L8LA 3KXXA 4E5WA 4AZSA 1EH4A 1M17A 2Y4IC 4EOKA 3DFCB 3DKCA 4I21A 4UZDA 5DEWA 5IQFA 3SAYA 3W1FA 4TW9A 2XYNA 5AR8A 3O7LB 4DFLA 5JQ5A 4NK9A 4FV9A 3CQUA 3UG2A 1Q8WA 4EHEA 2FO0A 2WZJA 4KRCA 1BMKA 4AN2A 2BTSA 3GCVA 2YM3A 4WOVA 3MVLA 3DOGA 3QQKA 4GVAA 4E20A 4FIHA 3PIYA 3QKLA 1KV2A 2DUVA 4FNWA 1RQQA 3AT4A 4PTCA 1DM2A 1P4OA 3VS5A 4EJNA 4OTWA 2WAJA 4PPAA 2Y6MA 2OJJA 1YDTE 3BGZA 1JSTA 3RWPA 4IVDA 4GIIA 5L6PA 2GQGA 2IPXA 4JQEA 4L53A 5HOAA 3F2RA 3R7GA 2IJMA 2G01A 2RG6A 3D14A 3SLSA 2WMSA 4RVKA 3HV6A 5D7VA 5DR2A 3FXZA 3VS6A 1CSNA 3CKXA 2OI4X 2RFNA 3FKOA 4F1TA 3WIKA 4JG8A 5EI8A 4TPTA 3MPMA 4D0XA 4FF8A 5CALA 2C6DA 2B9HA 1BL6A 4FBXA 5AP5A 5J7HA 3CD3A 5FTOA 4XG3A 5DYJA 3FHRA 3PE2A 2PVJA 5ACKA 4QOXA 1S9JA 4QP3A 1H1WA 3OTVA 3OUNB 2A2AA 2HIWA 4XS2A 5KKRB 1MRVA 5CXHA 3R22A 1YI4A 1I09A 4R78A 2IN6A 4L3JA 5HO8A 2E9VA 2QD9A 4IAKA 2WIPA 3KN5A 4EEVA 4PP7A 3CQEA 2Y9QA 4M14A 5LARA 2BROA 3DTCA 1PRYA 1O9UA 2FSOX 3FE3A 5EHOA 4YNOA 4KINA 3MV5A 1O6LA 1PXNA 3Q2JA 4BWKA 5M44A 3ANQA 3MVJA 4BKZA 4HNIA 5BMSA 4NSTA 3BU3A 3NIEA 4ZZOA 3QWKA 4E6QA 4EH6A 3R6XA 4DBXA 3V01A 2J5FA 2QOKA 4IX5A 3T9TA 4FKQA 2XIYA 4PWNA 4PV0A 4HCTA 3QRUA 4X6RA 1PYEA 1KUTA 4JDJA 5IEYA 1WFCA 1XBCA 5H3QA 5JFXA 4IJ9A 3PUPA 3FZRA 4BCJA 1J7UA 4YNEA 3ODZX 5AV2A 5DT3A 1PMNA 2BR1A 3FQEA 1ZYDA 3OWPA 1Q8UA 3TNWA 4E73A 4QMTA 3TNHA 2P2HA 1SZMA 3OWKA 2B52A 3GP0A 3PA3A 3PPZA 3PXQA 4P5ZA 4DTBA 4HGEA 2PVKA 2VWZA 5BVWA 3PE1A 2B53A 1FVTA 3RAKA 4GG7A 1S9IA 2FA2A 3CJFA 4MXYA 1FBNA 3SG9A 2C3JA 2ITTA 3C0GA 1W98A 4DHFA 5KO1A 1GZ8A 3TKUA 4CFXA 4EHVA 3UO4A 2GU8A 3W2RA 4XLIA 2ONLC 1IEPA 3C13A 4O7VA 4R8QA 4ZSLA 2XMYA 4UZHA 2W4OA 5E8ZA 3R1NA 4FEQA 4CVAA 2FSTX 2C6KA 4AZTA 4Q9ZA 2R64A 4ZSEA 3I4BA 2ITNA 2PVHA 5FXRA 1WZYA 2V22A 3A2CA 3QLFA 3BWFA 3LKMA 4FK6A 3FLYA 4J98A 2RGPA 2XP2A 2V5QA 5EHLA 3V3VA 2JGZA 3RNIA 4DGGA 2C3IB 4XOZA 1OITA 4I94A 4YPSA 3ZFXA 4O0YA 2W06A 4MXCA 5GIPE 5CQUA 3NEWA 2BAQA 2R3NA 1XR1A 2ZMDA 4M15A 1GOLA 4G3CA 4FTIA 3EQPA 2IZUA 1UU7A 4BBFA 5HG5A 4PL5A 2CN8A 3QCYA 4NTTA 4BVUA 4S34A 2XIXA 2FB8A 2R3KA 3UYTA 2GNLA 2H6DA 2WMBA 5CLPA 4ZEGA 3FI2A 3HUBA 3RM6A 3UTOA 3ZO4A 4F70A 4U44A 3E3PA 4FV8A 4FK3A 3U87A 4MXZA 4PPBA 5TE0A 2XVDA 5KMKA 5CXZA 2YA9A 2WTJA 4FKUA 1W7HA 2WOTA 1G8SA 5M4CA 4BGGA 2VV9A 3FC2A 4FEUA 3BV2A 3U8WA 2QR7A 4CLJA 4GL9A 3ZYAA 5HX8A 5JFVA 2JEDA 3A8XA 1MRUA 2XCKA 3CQWA 2VTHA 1AQ1A 2SRCA 4ACHA 5HLPA 3KVXA 3CPBA 2B55A 4ZSAA 2VWUA 3ORIA 2XRUA 4HVSA 2PVYA 4RZWA 5J9LA 4BDCA 5K3YA 2PTKA 4QPSA 3E62A 3DLSA 3D0EA 1YOLA 2R3QA 4G17A 4EOIA 5ANOA 2LAVA 4YJVA 1KE6A 4C4IA 2QG5A 4F1MA 2CLXA 4GRBA 2YEXA 4YLKA 3IW8A 5EI2A 4AZEA 1NT2A 2RFDA 2QVSE 3V6SA 2ITVA 4YTIA 2UW4A 4O0UA 2QONA 5IQAA 3R9NA 3FHIA 3MS9A 4JRVA 4L52A 4RVTA 3LZBA 5IUHA 1NA7A 2B9FA 4U42A 3ZUVA 4PRJA 5IQIA 3QCQA 3N4TA 5CVFA 2Z60A 1WBPA 4LV5A 5AUWA 4K1BA 1SMHA 3HDMA 1HOWA 5BYYA 4BGHA 3MPTA 3R1QA 3RCJA 3WIGA 3II5A 3ZC6A 4F0FA 5M56A 3FL4A 1PXKA 4ZXTA 3FPMA 4IMYA 2PVNA 1APME 3O71A 4MD8E 4GVJA 3PWDA 2IW8A 1YXVA 3FC1X 4FMQA 4BI2A 3BHHA 5CF5A 2X8IA 4FICA 3VHEA 3MVHA 2UV2A 4LFIA 2WOUA 4QP9A 3ORPA 5A4CA 5CEOA 5HGIA 2CGXA 3K5UA 2JDTA 3WF9A 3HMPA 1Y8YA 2XS0A 3E5AA 3QXOA 2VO7A 3I5ZA 3QHWA 4L3LA 3RMFA 4YZMA 5I3OA 3MTFA 3TNIA 5E4HA 3P08A 5JT2A 5IQDA 3C4ZA 1H1RA 5LWNA 3OCGA 4PPCA 2WEVA 4S30A 4O0SA 5ANKA 4CRSA 2UZTA 4W8EA 4KBCA 4X21A 4AGCA 3IOKA 3JUHA 4YUQA 4WRSA 5A3XA 4RG0A 3HRCA 4J53A 4BIEA 3V04A 4GT4A 3BBWA 3NR9A 5CSWA 2C6LA 2PVLA 1CKPA 3V5JA 1VJYA 5H2UA 3EOCA 3SKCA 3B2WA 4O21A 5AIKA 1KV1A 5EM8A 1XH6A 2OBJA 5HICA 3V5WA 3TUDA 5IEVA 3KN6A 1H25A 4FIGA 2VGPA 2HOGA 2JDOA 4G6LA 4RA4A 4MWHA 2WQMA 1WMKA 2IZRA 3Q4CA 5A4LA 5HTBA 3PSCA 3IS5A 5DFPA 5AUZA 4BGQA 1YWVA 3HZTA 3KY2A 4YZDA 5CY3A 2ZB1A 1ZMWA 1H08A 3R9HA 3BU6A 2X6EA 3KK9A 4B99A 3EQFA 1K3AA 4HVHA 4JX3A 5CEKA 2ZV9A 4FKLA 4CSVA 5BVDA 2BALA 4MBIA 3SRVA 2X81A 4PMSA 4YSMA 3ZBFA 3ZM9A 1P14A 5EH0A 4TN6A 5JGDA 2BRNA 3IPHA 4G34A 2XK7A 4I0RA 3GC8A 4QMMA 4U6RA 5ANGA 5E90A 4I93A 3WZDA 5IQEA 1TQPA 1W83A 3VBTA 4ZLOA 3OF0A 4HYSA 2GHMA 4CZYB 2OF4A 5CS6A 3KKVA 3MH3A 5E7RA 3OXIA 4U45A 2VGOA 3RTPA 3HL7A 3BYUA 2O8YA 4Y95A 5C8NA 3QTUA 2PE0A 4XG9A 4D2TA 1J3HA 4AG8A 4G6NA 1XHAA 4G2FA 4F09A 1OKYA 4F0GA 5IUGA 3QTIA 4ZJIA 4Z3VA 4NU1A 4RVMA 3ZRLA 3K2LA 2WTKB 3KEXA 1FMKA 1OIRA 4L43A 3TDVA 4AT3A 2VD5A 3OBJA 3PY1A 3EFKA 4U3YA 4CMTA 3QTXA 4O2ZA 5CU2A 3LLAA 2X9FA 4UWYA 2ETKA 3ENHA 4JJRA 3R8VA 3VNTA 4FC0A 2VX0A 3A7JA 3AMBA 4R3RA 4EOSA 3W16A 4EQUA 2QU6A 2X4ZA 1W0XC 3F3UA 4DGOA 4EBWA 5ETAA 2OXYA 4IW0A 5CU3A 4IB0A 2RIOA 3AT2A 5JK3A 1W8CA 1M2RA 3LM5A 4G6OA 4TWOA 5HTIA 5BVOA 2CHLA 5FTQA 4FSTA 4CT1A 4U43A 2W5HA 4ZZNA 5FM3A 3V8TA 4BYJA 5E9EA 3KRJA 3VAPA 5IA4A 4K2RA 1Y6AA 3SOAA 5CI7A 1PY5A 3ZC5A 2A0CX 2WPAA 4FGBA 4BHNA 4AA0A 4CKRA 5A46A 4AX8A 4DFUA 3KGAA 2CLQA 3NVMB 4MK0A 4IZ5A 3TT0A 2WMXA 4I41A 2YERA 4QT1A 1GZKA 4MXAA 3WZUA 1R78A 3SW7A 3GT8A 4D2WA 4BDAA 2BDFA 2W1IA 5CEIA 3PG1A 4Z9LA 3LXNA 2RFEA 3PJ8A 3G90X 3TL8A 1XH9A 4J99A 3EQBA 4BL1A 1OKZA 2I1MA 2O64A 4XG6A 4HCUA 4F65A 3P4KA 4A9YA 4DTAA 4OT5A 4V0GA 4IWQA 3H9RA 2C30A 4KAOA 4RIXA 3F2NA 3LQ8A 2WTWA 3R1SA 1PW2A 2PVRA 4NM5A 1OUKA 4D5KA 2I40A 3NAYA 3A7FA 4GS6A 2ERKA 2G2HA 5E1SA 3ZZEA 1YQJA 2R7IA 1PJKA 1AGWA 1OPLA 2WQEA 3QQLA 4O7ZA 3JYAA 4RWLA 2C0IA 3OEFX 4YBKA 2BUJA 5IEXA 4CQGA 5FEEA 3R30A 4UWCA 2R3OA 4OW8A 3VW8A 4GT3A 4A4LA 2PZYA 3NUXA 2WD1A 3VUGA 4BI1A 4A9UA 4OAVB 4FT0A 3POOA 2OIBA 2WTCA 5J9ZA 1WBOA 2EXMA 3NGAA 4O0WA 4ZJVA 3F3ZA 3LAUA 4LL0A 4ZTNA 2BHHA 2BRHA 3MH0A 3WYXA 5EM7A 4C4EA 2WMQA 5EYMA 4F9AA 1M14A 3OD6X 4FTOA 2F2UA 1W84A 4LRMA 3Q5IA 3C4WA 3JS2A 4LRKA 4OTRA 4C34A 4NYEA 3TDWA 4RIWB 4DH1A 4X3FC 3WILA 4NCTC 2OFUA 4L8MA 1XBAA 4EZ5A 2YM5A 1YHSA 2PZRA 3UC3A 2QOLA 4AS0A 4C3PA 3N4UA 4NUSA 4C3RA 3JR1A 4FE2A 4GYGA 4F0IA 3VUHA 1OIQA 5GHVA 3R9DA 4QYYA 2CDZA 4QYFA 4RIYA 4ASZA 5K5NA 1QMZA 2B0QA 4OTGA 4AA5A 4C02A 1E1VA 2X7FA 4EZ7A 3VF9A 3S95A 4QNAA 4DAWA 2J0IA 3P86A 4ZSJA 2CKEA 5EYDA 4D2VA 4QP1A 4RX8A 1XH8A 3AC8A 3HMNA 3MFTA 5E8YA 3ZLYA 3ZO3A 2CNQA 3HA8A 3BLQA 2WXVA 1PXLA 4IDVA 4JL9A 2YM6A 4DTKA 3QTZA 4G16A 5IA1A 1QPCA 3OCTA 4CFUA 3VIDA 2Z8CA 4EQMA 2ITZA 2QO9A 1TQMA 2UVZA 2P2IA 4JRNA 3QKKA 4FVRA 2RL5A 2AYPA 3R7OA 3RPVA 4QO9A 3DK7A 4AFJA 4Y85A 4PTEA 5L6WL 3TN8A 5J5TA 4Q5HA 4GU6A 2VWBA 3O2MA 5HE3A 3VS3A 5IMEA 1GIHA 2BZKB 2PVFA 3Q96A 4YPDA 4R6VA 5IUIA 3COHA 4FSYA 2YIXA 3QQHA 2HELA 4YC8A 3NMUF 4KIKB 2IVTA 4A06A 4ASEA 1WVWA 4AFEA 3Q53A 2YCSA 1B38A 4JDIA 4EONA 5M09A 3PA4A 3KL8A 5J9YA 4CG9A 3MY0A 3R7VA 4EZ3A 1CDKA 2FVDA 5L2QA 3RI1A 1PXJA 5GIOE 3VS0A 2J90A 5IQHA 3ZSIA 4O91A 5DIAA 2Q83A 1FMOE 2B1PA 4WNMA 4BCNA 2WQOA 2C5VA 5HG8A 1LEWA 4XG8A 3UMWA 5KBRA 5AAFA 3NYXA 3QUEA 4I1ZA 1ZYJA 4O96A 2GS7A 3PJ2A 4IVAA 3QXPA 4PNIA 1A06A 2JLDA 3DLZA 3QQGA 4YO6A 3C4XA 3ZH8A 2WGJA 3BCEA 4FKGA 3Q3BA 1OL5A 4ANBA 4XCUA 1Q3WA 2PMLX 4YHJA 4ZMFA 4WRGA 4CKIA 2VTSA 2J7TA 4GFGA 4EOOA 4J52A 3RK5A 4Z16A 5ITAA 5KBQA 3DXPA 4QPMA 3LCKA 3TIZA 2GHLA 4AT5A 4ALWA 2X2LA 3TUBA 4ANSA 2GFCA 3DZOA 4YURA 3FYJX 3QF9A 4QMZA 3R8PA 4XX9A 4XLVA 4X7QA 3FXWA 4PL4A 5DEYA 5FP6A 4BBEA 4EI4A 1REJA 3EN4A 2VTMA 4Q9SA 2W1FA 5EQYA 2QOCA 4E3CA 3U4WA 4LGHA 5AMNA 5H8BA 5H8GA 3R8UA 3AGMA 2YM7A 4MF0A 3G33A 1VYZA 2J51A 4GFMA 2PL0A 4XRJA 3T3UA 3ZCLA 4FKOA 2XK4A 5HKMA 3VWAA 2J4ZA 5ANIA 3W2QA 4C59A 3U55A 2UZOA 3HRBA 3EZRA 3OZ6A 4DBNA 2XBJA 3I6UA 3EN9A 2XJ1A 2QOBA 4E4XA 2C6MA 4TWNA 3BPRA 5JN2A 4JDHA 3NS9A 3VF8A 1R0PA 5HLNA 3VS1A 3EL7A 2Y4IB 5LJJA 4JVGA 3PZEA 4RPVA 1H8FA 1U5QA 5HBHA 2BPMA 2YDKA 3ALNA 3A62A 5DRBA 4YU2A 4L45A 2J50A 2VTTA 2JITA 3KRLA 3DY7A 3EFWA 3MDYA 3R1YA 3D2KA 3BZ3A 4ZP5A 1KE8A 2OH0E 4ZTLA 3LOKA 4D2SA 3ZLSA 3RHXA 1PMUA 3PPKA 2JC6A 4M97A 4NW6A 4NL0A 2J5EA 4IHPA 2P0CA 2C0TA 5A9UA 4YHFA 4OAUC 3E63A 3PWYA 4DFBA 5ACBC 3TXOA 4HGLA 3ZTXA 3D7TB 2W1DA 2QCSA 5A4EA 5L3AA 2X9EA 2XNEA 3C5UA 2PZ5A 5CU0A 3HV3A 3FMEA 4GU9A 3SXFA 3VBWA 3DQWA 3PZHA 4QP2A 3U9NA 3HV7A 4FTLA 2IO6A 3F7ZA 5AR2A 4C4HA 3VUKA 2VO0A 3LIJA 2HZNA 5C27A 3H9OA 4B0GA 5CAPA 4Y83A 2PUIA 2VWWA 3FPQA 3FBVA 3DT1A 4IXPA 2OIDA 4QMOA 5JRQA 2ITPA 2O3PA 3CC6A 2H34A 3Q2MA 4J96A 1ZLTA 4AU8A 4ERWA 4HYIA 3SHEA 4UMPA 4GV1A 5E8TA 5A14A 5CNNA 2X2KA 3PXKA 2CKOA 4K77A 3BEAA 4LG4A 5EYCA 1H07A 4IWDA 3KXHA 4FIEA 4IM0A 5L2SA 3FSFA 4FTKA 3MSSA 1NVRA 3QC9A 4MH7A 3DK6A 3RINA 3LFFA 2GNFA 3M11A 1PXOA 3MFRA 4J8NA 4IWPA 5HVJA 3TWJA 1M2QA 3KVWA 4JXFA 3OFMA 3TIYA 1CKIA 4XV2A 4AW0A 3OS3A 3TZ7A 2W4KA 2ZV7A 4R3PA 4FZ6A 4F7NA 2V55A 3RZBA 3CSVA 4M69B 4RZVA 4MX9A 2QHNA 1P2AA 5JKGA 3DTWA 2J9MA 4D4SA 3DJ5A 1J1CA 4WG4A 4E1ZA 3GOPA 3V51A 4FIIA 4NIFA 4RWJA 3RPOA 1H0VA 4MNEA 2B54A 3R73A 3V8SA 4I6QA 2ZJWA 5HQ0A 2OG8A 4WT6A 1VR2A 4KKHA 4FNYA 2GPHA 3EFLA 4OTHA 5E8SA 3TNPC 4DYMA 4USEA 3IW7A 4TKSA 1ZAOA 1OB3A 5EI6A 3ZFMA 4CMUA 4JBVA 5G1XA 4QRCA 3LMHA 2OFVA 5EQEA 3HX4A 2G15A 4LMUA 4LV8A 4YLLA 2PK9A 3GCQA 3CBLA 2R0UA 4HCVA 5AIRA 4USFA 3MY1A 2ZOQA 3FEGA 3ACJA 1W82A 4BHZA 4F4PA 5AX9A 4RJ8A 2QC6A 4E6AA 4FEVA 4DEEA 3H3CA 2P4IA 5HESA 1KWPA 1WAKA 1NVSA 5LOHA 5C26A 2OZAA 4RJ7A 5C8MA 4J97A 2X4FA 4NM7A 4G1WA 4MF1A 1ZXEA 4UBAA 4WA9A 5IDPA 4DLJA 4FG7A 5AJQA 3HYHA 2WQNA 4UMRA 1U54A 1URWA 3DXNA 3EJ1A 1IAJA 2EVAA 3OHTA 5FM2A 3UOKA 5LCJA 2HW6A 4HYHA 1GAGA 1ERKA 2I0VA 3BKBA 4FIJA 4IX6A 4X2GA 4LGGA 3V8WA 2VZ6A 2YLFA 4IM2A 2WNTA 5M57A 2C6EA 4YZNA 3LVPA 4DT8A 3JY9A 5F9EA 3MA6A 2CMWA 4RJ4A 1DAYA 3LFQA 1PMVA 3ACKA 4HVIA 1GJOA 2XNGA 1BYGA 4XV3A 4DGNA 5KMJA 4S2ZA 4QTDA 3FQHA 3TZMA 5KZIA 2UW8A 2NP8A 2C6IA 5EW8A 2BDJA 3KK8A 4QTEA 1QPEA 5K0XA 3GCSA 3VO3A 2GNJA 4WNOA 4XRLA 4YBJA 4QMXA 2J2IB 5HX6A 2CKPA 2XKFA 3FMDA 2VNWA 1VYWA 2W17A 2E9PA 3IG7A 3SW4A 3FKNA 3FMLA 3G51A 4X2NA 5LVOA 2Z7QA 3RKBA 2ZDTA 3C5IA 4GUEA 4AGDA 2Y8OA 4IX4A 3L8PA 4RQKA 4O7NA 1PXPA 1ZY4A 2UVXA 3DBDA 4MYGA 3AD6A 4RLLA 4XBUA 2ITWA 4W4XA 4N6YA 3OT3A 5FXQA 3L9MA 4EORA 4RVLA 5J8IA 3Q4UA 1OZ1A 4O2PA 4R1YA 3ZONA 3GFEA 1SVHA 3DV3A 4O6EA 5C4KA 3GFWA 3O0GA 1JOWB 4D1XA 1OMWA 4IBMA 2GSFA 4C61A 3AC5A 5AR5A 3VW6A 3PLSA 2G2FA 3GI3A 3M42A 2VO3A 3UBDA 3GUBA 3UOHA 3ZDIA 2XK9A 5IF1A 5JFWA 4HVGA 3PXRA 2XJ0A 3NNUA 4FUXA 4ZY5A 5K5XA 1Q8ZA 2XF0A 1R1WA 4FV2A 2XYUA 3TZ8A 2JFMA 5L2WA 5EHYA 1UU9A 2GTNA 2QQ7A 4RGJA 4HW7A 5BVFA 3JVSA 2HZ4A 1ZOEA 3KRWA 3H9FA 3PXFA 1UU3A 4PF4A 3UIBA 3WE4A 5LCKA 3MH2A 1JKSA 3TJDA 2XUUA 4FT3A 4AW1A 3WBLA 4JBQA 4IZYA 3NW7A 4YTHA 2X7OA 2AUHA 3EWHA 3AT3A 4NW5A 5LMKA 4BR3A 3BHUA 5BVEA 4NM0A 4Q2AA 2WMWA 2QOIA 4WHZA 5DE2A 2WTIA 3A61A 4IE9A 4FV3A 3TG1A 5IA0A 2VRXA 3LCTA 5EDPA 2QLQA 3PSDA 3FY2A 4FX3A 4KS7A 4UB7A 3V5PA 2H96A 3Q9XA 4IM3A 2VTPA 2XKCA 3FMNA 4OT6A 3G9NA 3EQCA 4IAIA 4CZTA 3LFAA 4DFNA 2VX1A 3E8CA 5LWMA 4W8DA 3LCSA 4ZTHA 5A4QA 4TWCA 5AUUA 3R28A 4DEGA 4FSWA 1YOMA 2PE2A 3LPBA 3V5LA 5EDQA 4UN0C 1KOBA 4R7IA 4QYEA 3WZJA 2XZSA 3PRIA 4IJPA 2AC5A 2PSQA 1Q8TA 2PE1A 4YC3A 1IG1A 2BZIB 3D5UA 4U7ZA 4D9TA 4LI5A 2XIRA 2BKZA 3IDPA 5KMLA 3TV7A 2YM4A 5CSXA 5CSPA 4PMMA 5HNBA 4BDKA 3GC7A 3R04A 3ZS5A 4O1PA 3RHKA 4I5MA 3Q5ZA 3QA0A 3QHRA 4U5JA 5D10A 4E6CA 3OC1A 1ATPE 4D1ZA 2YZAA 3P7AA 5LMAA 5JMSA 4A4XA 5IH6A 3LMIA 4AN9A 2YAKA 4EJ7A 4CGAA 2R3MA 5E92A 2UW0A 4Y8DA 4NJDA 2XM8A 4KIOA 4TYJA 1MQBA 1UNLA 4AXAA 4ZTQA 4OTPA 1ZZLA 3K54A 4PDYA 4UWBA 1E9HA 3ANRA 4CFVA 2W0JA 2QG7A 2OU7A 4XBRA 4PL3A 1RDQE 1U4DA 4O38A 2X39A 2YACA 3QUDA 3WARA 3ZO1A 3AMYA 4FZFB 2OK1A 1KE5A 2R3HA 3BHYA 5HD7A 4CQEA 4C4FA 1YXUA 1Q97A 2XKDA 4N6ZA 1JVPP 3W2SA 4ACGA 4IB3A 5IH5A 3OUKA 3H10A 4FZAB 4EOJA 4WUAA 4XHKB 3OEZA 3QTQA 5CZHA 2CGUA 2V0DA 3W55A 2WO6A 4O0XA 4XP3A 3Q6UA 3DPKA 3MTLA 5DR6A 4CG8A 2J0MB 4KABA 3OT8A 3FAAA 5F4NA 4TYEA 4AZWA 4FSRA 4G5JA 3I7CA 4JIKA 2YM8A 3ORZA 3QFVA 4K33A 3ALOA 1DI8A 4HGTA 3W8LA 2VO6A 1NY3A 3GU8A 5CNOA 3TZ9A 2R3JA 4Z7HA 4MXXA 2HZ0A 3D4QA 2IVVA 4JQ7A 4BYIA 4ZMEA 4ZLZA 4E8AA 3MB7A 3LFDA 3QCSA 2W99B 4YZCA 5DRDA 4BFMA 3PY3A 3RAHA 3F2AA 3ZLWA 3RAWA 4BWXA 4EHGA 3WI6A 3RK7A 1LR4A 4HVDA 3C9WA 3UNKA 2PULA 1LEZA 2YJSA 3TM0A 3FMHA 3TEIA 4TL0A 3QALE 1U59A 4HJOA 4GW8A 2C69A 3VUIA 1PMEA 4QMQA 5AV4A 3UDBA 3ZRMA 1OUYA 5CTPA 5KMOA 3PLAE 3CJGA 2R0IA 3I6WA 2R4BA 1SVEA 3S1HA 2ZV8A 4FT5A 4O1OA 5M4FA 3G15A 3Q9YA 4IFGA 3COKA 3DDPA 2BZHB 3VS4A 1Y6BA 1ZRZA 5E8VA 3T9IA 5GINE 4GK2A 4GEOA 3I5NA 5ETFA 4P4CA 2ITYA 3IK3A 1YW2A 4I6HA 4JT3A 4LGDA 4YMJA 2WHBA 3UZPA 4M7IA 3DBEA 3UYSA 3PPJA
chains in the Genus database with same CATH superfamily
2WELA 4F9CA 3NFFB 1YRPA 4IEBA 2C3LA 5HVKA 4ENYA 2BMCA 5JZJA 1TVOA 4G3EA 4PDPA 3DAEA 2BDWA 4S32A 2VWIA 4AQCA 1PKDA 3E88A 3G0FA 3MW1A 5HO6A 2EU9A 4BTFA 3S00A 3QA8A 5EKOA 1YXTA 3F3TA 4RIOA 2Y6OA 3HVCA 4F7LA 3PVGA 4EWQA 2PZPA 3FYKX 4XP2A 1XQZA 5IZFA 1H1QA 3DB6A 5D12A 5CAVA 3UDTA 4ZTRA 4BDJA 4C4GA 4AW5A 2ZV2A 3I1AA 1ST4A 4FRFA 5DH3A 5AUXA 4L00A 4YTFA 3N9XA 1E1XA 2A98A 1IR3A 3QD2B 1PXIA 4F64A 4RLKA 2BFYA 4UYAA 1XO2B 3GVUA 3HEGA 3B8QA 3D9VA 3FI3A 3GEQA 3RP9A 3G6HA 3R21A 4NEUA 2F9GA 2H8HA 4B8MA 2HXLA 3UDZA 2C6TA 2IVSA 2XEYA 4CV8A 4JI9A 3MY5A 3Q4TA 3CKWA 3RK9A 4BB4A 4FA2A 4AP7A 4JNWA 4EOQA 2HXQA 2CGVA 2R3PA 3KU2A 4BCMA 2XIZA 4BN1A 3F6XA 3P79A 5EYKA 4BDEA 5BX0A 4IANA 4UV0A 2EB3A 2VTLA 2HY81 3QYZA 1OIUA 4H3PA 4D55A 5HG9A 4BZOA 2PUNA 4I4EA 5H8EA 4MBLA 2RKUA 4U79A 4R3CA 1JNKA 3MWUA 4DC2A 4L42A 3VUTA 3W2OA 2BFXA 3CY2A 4C8BA 3ERKA 3E7VA 4CNHA 3OP5A 4WD5A 2VU3A 4GUBA 4QQ5A 4X3FB 4RJ6A 5AEPA 3RPRA 5A6OA 2Z7LA 2XM9A 3PXZA 3ML1A 3KRXA 4M0YA 3VONA 3BRBA 2UZLA 3E87A 4U9AA 1FVRA 4ERKA 3C51A 5BUIA 5AWMA 4E4LA 4UEUA 3OCSA 4IIRA 4L6QA 1DS5A 4TTHB 3CXWA 3BU5A 4L7SA 3HKOA 4MHAA 2WFYA 4YJOA 3AC4A 3U6HA 2O63A 1J1BA 3OW3A 5D9HA 1H27A 4RJ5A 2JKQA 3A7HA 4QTBA 5FWKK 5BMMA 2W1CA 4BCHA 3R0TA 4JG6A 3COMA 4F9YA 1NVQA 1KE9A 2V7AA 3KCKA 1XJDA 5E1EA 3CGFA 3KMUA 3UQCA 4GJ2A 3TNQB 3U6IA 2OJGA 4AWIA 3FY0A 3GQLA 3DQXA 3SV0A 3U6JA 4GT5A 4CRLA 4E5BA 3TCPA 1YI3A 3NRMA 5D7AA 4CXAA 1YWNA 5F95A 3PXYA 2GQRA 4O7WA 3C4EA 2O5KA 3UZTA 4OBQA 3NDMA 4EK8A 3HRFA 4XV9A 3WF6A 1H01A 4DLIA 3QYWA 5EW3A 4A7CA 4A4OA 5C8KA 1SVGA 2A19B 1UNGA 2FSLX 1YDRE 3OY3A 4EYMA 2X6DA 3FXXA 5AX3A 2ITUA 4L67A 5EFQA 2IWIA 4GK4A 3TI1A 2WEIA 2ETRA 4FTNA 3A7GA 2GDOA 3OWLA 1ZYSA 2PMOX 4HYUA 4I0TA 4TNDA 4AOJA 2DS1A 3W2CA 1TQIA 5IA2A 3LFSA 4ZSGA 5DPVA 4ZAUA 4DG3E 3VUMA 4B4LA 3W0SA 4FTCA 5CVHA 4CCBA 5GJDA 3R9OA 5FTGA 1T46A 4DFXE 3DFAA 4EOMA 4RWIA 4B6LA 2QNJA 3LFNA 4KIPA 4G3DA 1LP4A 2XKEA 3OVVA 4JQ8A 4LOQA 5KE0A 4B8LA 2ITOA 2OH4A 4AXFA 4ZZMA 1WBVA 4BDDA 2RG5A 4AE9A 2Q0NA 5HBJA 5E8XA 2OKRA 4NH1A 3UO5A 4CD0A 4FKPA 4IDTA 4O4BB 4AZVA 3P7CA 1P5EA 3OWJA 3CEKA 3WE8A 4GIHA 5FP5A 2V62A 4AAAA 3G5DA 5AV0A 2ERZE 4QP6A 4HPTE 4LRJA 3ATSA 3RM7A 4R7HA 3S3IA 4F1OA 3O7LD 5FBOA 2G2IA 1GY3A 5LMBA 3ORTA 2HW7A 4XUFA 3E93A 4AUAA 4IAFA 3UMXA 5JRSA 5GZAA 3IGGA 2OJFE 5AUYA 2OO8X 3KQ7A 4FKIA 4HZRA 1YKRA 4D1SA 4H1JA 3G2FA 4FL3A 3SQQA 1M52A 3R83A 4G9CA 3I0OA 3P5KA 4LOPA 5I4NA 1HCLA 4FTJA 1LPUA 1FQ1B 3OOMA 2QOQA 5FDPA 4FSUA 3UP2A 4C38A 3GU7A 3KULB 3FMJA 3LW0A 1UKIA 2A1AB 5D11A 3IOPA 2GHGA 3KXZA 4U3ZA 3BLRA 1OI9A 2PUUA 4L44A 4YJUA 3FZTA 1Q8YA 2I0YA 5C1QB 3I79A 4YJSA 3EKNA 4F7JA 2ITQA 5CAOA 4IFCA 3GC9A 3HMIA 3UQGA 3WZEA 5IQBA 1V0OA 3BBTB 3NSZA 3LCDA 4RA5A 5F20A 5B2KA 5HD4A 3F7WA 2WMVA 5JH6A 2BKKA 5E8WA 3C0HA 2WQBA 3IGOA 4WO5A 2PPQA 3ZMMA 1P4FA 1OKWA 1K9AA 4QQJA 3CTJA 5HNIX 4MQ1A 3RBWA 1J7IA 1PXMA 5ETCA 2E9NA 5LVLA 4JBOA 1QL6A 3BGQA 5B2MA 5GZ8A 4RFZA 3QAME 3ZSGA 2G9XA 3IO7A 3AQVA 2W05A 1NXKA 1RJBA 3VQHA 1M7NA 2ETMA 2QU5A 3HLLA 3R8ZA 3GB2A 4TYIA 5FUTA 4FG8A 4PMTA 5HLWA 2F7XE 4TYHB 4FVQA 4L9IA 2IG7A 2OJ9A 4NM3A 2R9SA 2QODA 5A4TA 1CM8A 3MIYA 5G6VA 1JPAA 4FVPA 3F82A 4FI1A 4PNKA 3F3VA 2W1EA 1B39A 4XJ0A 3GOKA 2X0OA 4OTFA 5FEQA 1IA9A 2YAAA 4FOBA 2BHEA 3D7ZA 1V0BA 3P78A 3SGCA 3R00A 4K8AA 1ZZ2A 3MPAA 2OICA 3KMWA 2HWPA 2J6MA 5DHJA 3HV5A 3LFBA 5HE0A 4NKAA 3ROYA 5AA8A 5HO7A 3POZA 4O0TA 2VTNA 4RIWA 3UVRA 1JBPE 3CD8A 2DYLA 5EM5A 2Z7SA 3K5VA 3GBZA 3DBCA 3MFUA 4NTSA 4AN3A 2YFXA 2ITXA 3JXWA 4FTAA 4QMLA 4C33A 4TNBA 2E2BA 3QD3A 4GFOA 3UPXA 2QHMA 4BF2A 1O6YA 4IWOA 3RPSA 5D1JA 2W1HA 3QD4A 4TRLA 5HU9A 4CV9A 3NNXA 4BDHA 3KFAA 4MD7E 5CF4A 2JKOA 1H0WA 1T45A 5BVKA 5FXSA 5CWZA 1R39A 5I9VA 2VWYA 4YP8A 5HHWA 4H3QA 4QMVA 4CFWA 2NNWB 4C3FA 2WU7A 4Z7GA 4ACCA 3ZZWA 1YI6A 3EN7A 3QC4A 4F6SA 3KREA 1M7QA 4V01A 2R5TA 4XG7A 3CS9A 4CEGA 5LXMA 2OXDA 3LM0A 4EBVA 4BIDA 3DAJA 3U51A 4H58A 3UODA 4O7TA 4KIQA 3QZHA 3ID6C 4BTMA 1UKHA 4W4YA 4RQVA 2QI8A 3UZRA 4OTQA 4D2PA 3A60A 1ZARA 3QWJA 5KCVA 2YDJA 4FSQA 2HWOA 3E8DA 3EYGA 4NT4A 4FV0A 5HZNA 2XANA 3U4UA 4JMQA 2WKMA 4NZWB 5A54A 5AR7A 4BI0A 3F61A 4ZOGA 3HV4A 5M4UA 5KZ0A 2JIIA 4WUNA 4YJRA 2GCDA 2HK5A 4MXOA 4EKLA 3GENA 3KXMA 5J87A 3VQUA 4E93A 3W10A 5CT7A 5IG1A 3NUYA 4OUCA 2PMIA 3HNGA 4GH2A 1YDSE 4KIKA 3BGPA 4O22A 4WNKA 3ZXTA 4ZY4A 5J79A 4IZAA 1JKLA 4NFNA 4R77A 3F9NA 3DB8A 3JVRA 2R3FA 2XA4A 3Q60A 4M84A 3E3BX 4D28A 2CNVA 1FGIA 2ZM3A 4JBPA 5I9ZA 3ZLXA 4XMOA 1G3NA 3D15A 2WMAA 2FYSA 4BKYA 5IPJA 5HI2A 1BLXA 4GSBA 2BIYA 3A4PA 4K0YA 2AC3A 5K9IA 1XWSA 5FLFA 2GNGA 4EOLA 4Q5EA 4MVFA 2WTDA 3JY0A 5J1WA 5DT4A 3QUPA 3PUFC 1NW1A 3NYVA 3C0IA 3I0QA 2A27A 4K9YA 5C03A 4F6WA 4F9BA 5T3QA 4FUYA 1JWHA 2W7XA 4S31A 3RWQA 3V5QA 4DEIA 1H28A 3AMAA 3D94A 1OL7A 3R8LA 1KSWA 3C4FA 5AADA 1Q41A 4YZBA 5AP3A 3SXSA 3M1SA 2R3RA 2OSCA 5AP4A 3NUSA 3UIMA 2X0PA 4R7BA 1U46A 1JAMA 3F5PA 3SVVA 2R3GA 2ZB0A 4M66A 3RAIA 2XH5A 1OGUA 4DCAA 5GJGA 3M2WA 1Q99A 4PP9A 4YJPA 4EKKA 2PYWA 3OG7A 1PHKA 4D4YA 3EKKA 4GJ3A 5DWRA 5C01A 3FZSA 5I0BA 5GZ9A 4EH4A 4FKRA 2X2MA 4ONAA 3T8OA 3UVPA 2JAVA 5JGAA 3NW6A 4IVCA 3SG8A 4PX6A 2YCQA 3LXLA 4FKSA 4FSNA 4RRVA 3FMKA 5DR9A 2W1ZA 1BL7A 1Q5KA 4OBPA 5FGKA 4DEBA 1WBTA 3EQRA 3R63A 3W8QA 4M0ZA 1IAHA 2VTRA 4YR8A 5IU2A 4L68A 4GG5A 4MAOA 5IKWA 2JDRA 2NRUA 2JKMA 3WZKA 4CCUA 4XYFA 3AOXA 5DLSA 3BX5A 2QKWB 4RC3A 3QGYA 4O7LA 4E5AX 3HDNA 4OBOA 5AP0A 2OF2A 4ANLA 3PY0A 2IZSA 2EUFB 3MI9A 4ANOA 4RX5A 3C7QA 3ZFYA 5CAUA 1URCA 3BV3A 1I44A 3LXPA 5FBNC 2HY0A 3B2TA 4CKJA 1YOJA 3ZBXA 4IB5A 2QOHA 4JR7A 4IAZA 3D7TA 4W4WA 2OLCA 3BYSA 4KRDA 5CASA 2JFLA 1OPKA 4X2FA 5I3RA 4QYGA 2IVUA 4USDA 3QTRA 4ALUA 5ANDA 1F0QA 2W96B 3ELJA 4RC2A 4CYIA 5IMXA 1A48A 5TO8A 4EH7A 4YTCA 4O0RA 3KF7A 5ANEA 3CP9A 3IKAA 2JIVA 3SD0A 3MIAA 3OMVA 4C4JA 5AFVA 2YLEA 3FDNA 4J7BA 4DGLC 3AC1A 3IDBA 1Q61A 5F94A 4ZTMA 1FVVA 5I5ZA 4I6LA 4C2WA 2WB8A 3DNDA 5CAQA 2YISA 2FSMX 3QGWA 4FTRA 4AT4A 4YLJA 1RW8A 4CLIA 2WIHA 4TWPA 2UUEA 3WF8A 3MH1A 5DA3A 4BCOA 3KB7A 3OY1A 4RBLA 5CYIA 3QTSA 4CFFA 2J0KA 4RFMA 2KULA 4PTGA 3TTIA 4EQCA 4FIFA 2RF9A 4BDIA 3HECA 4IC8A 4DEAA 3E92A 2B7AA 2UW7A 4C36A 3VRZA 3MA3A 4U81A 3P23A 4ACMA 3DJ6A 5DN3A 2ZMCA 3BQCA 3TACA 3PFQA 5CSHA 4M69A 5ICPA 4FL2A 4N0SA 3EL8A 2GS6A 3DCVA 4FZDB 5DT0A 2BAJA 2CN5A 1KOAA 4KUJA 3ODYX 2H9VA 3W2PA 2XNNA 3UVQA 4BCPA 2PZIA 4TT7A 1YWRA 4DCEA 3OW4A 2F7ZE 4QP8A 5EKNA 4L01A 3GU4A 5HIBA 2YDIA 4O7YA 2UW6A 5AUVA 5LVNA 1XMLA 3DBFA 2CSNA 4D5HA 4NKSA 4P90A 2C0OA 3NAXA 4UMTA 4EK4A 3PP1A 4YJTA 4K18A 3O8PA 5FG8A 4DFYA 3VN9A 4O7RA 4BC6A 3R01A 4ZJJA 1V1KA 4NWMA 3B8RA 3WYYA 1QPDA 1DI9A 3ATTA 2C47A 5ETIA 4TZRA 5HCYA 4LMNA 3VBXA 1L8TA 3TMOA 5K4IA 5HCXA 2QLUA 2BCJA 2Z7RA 3BYOA 3DJ7A 4K11A 4BRXA 4BTKA 5AA9A 2XB7A 1SM2A 3C50A 3GGFA 4B9DA 3QKMA 4IADA 4FSZA 2IF8A 3W33A 2ONLA 1F3MC 4FEWA 3NCGA 2OZOA 1TFFA 4KNBA 2VX3A 5L8KA 5KNJA 2X8DA 3DGKA 3PG3A 4UX9A 4BY9E 4ITJA 4M68A 2RSVA 1BUHA 3R71A 4KWPA 3FLWA 1Y57A 3U9CA 4DH5A 5IH4A 2XNPA 1OPJA 1CKJA 2OIQA 3CLYA 2CKQA 1OVEA 3FQSA 4JAJA 3BI6A 3MB6A 3ULIA 3ZEWA 4RX7A 4E4NA 4RWKA 4QTAA 4EL9A 3HUCA 3CGOA 1JKTA 2Y7JA 5J5SA 2I7QA 2GS2A 4CFMA 5A6NA 4FT9A 5C4LA 4ZLYA 3KRRA 5J1VA 3F5XA 4I3ZA 3A8WA 3Q52A 4DITA 1WBNA 1BKXA 3ULZA 4ANQA 3GU6A 3PVUA 4IVBA 5AM7A 3W32A 3F88A 3QTWA 3ZEPA 4DGMA 4F6UA 2UZDA 3LJ0A 4C62A 4XOYA 4F63A 3KIOC 2F2CB 5CEQA 4BCQA 4ZTSA 3CTQA 4J1RA 3TJCA 2CNUA 2C3KA 4N4SA 4JOAA 3OROA 5CF8A 3SX9A 3COIA 4I6FA 3UIXA 4NJ3A 4AOTA 4R5SA 4IZ7A 4XNEA 3DXQA 1UU8A 5HEZA 3EN6A 5KX8A 3PSBA 3GU5A 5L2IA 5AR4A 3BHVA 3CY3A 5LMKC 5IA3A 3UJGA 4UXQA 4DINA 2C5XA 1ZMVA 2VTAA 3BELA 3E8EA 4IB1A 5IA5A 4EH3A 5IDNA 4X6QC 4IX3A 4GMYA 4K6ZA 5EM6A 1OL2A 4EUUA 2XRWA 4FKVA 4A07A 5L6OA 3ZU7A 4DT9A 4XH6A 5L2TA 1BX6A 5KMNA 1JQHA 4FGRA 3NLBA 1Y8GA 4GK3A 3ZDUA 3TUCA 3QU0A 5KKRC 4O27B 1MP8A 5DMZA 5FDXA 3RZFA 5HG7A 3CPCA 3GCUA 3NYOA 1TKIA 3AD5A 4EOPA 3CIKA 3NZ0A 4XG2A 3F3WA 1RE8A 3DAKA 3T3VA 2P33A 4Y73A 1OM1A 2ZYBA 2PY3A 4BCFA 3RALA 4H3BA 5AP6A 4E26A 2A4LA 4PDSA 3AD4A 3H30A 3MJ2A 3ZUUA 1FGKA 4DH8A 4BCIA 3L9LA 5CQWA 5CX9A 4JG7A 5TKDA 3G0EA 2VWXA 5FEDA 1OECA 3RJCA 2VNYA 3R8MA 2HENA 4DFZE 3R7IA 3N51A 2ZVAA 4G3GA 2OXXA 4J95A 5JQ8A 2BRMA 2C5YA 2QOOA 3QQJA 1OBDA 4OR5A 2UVYA 4FKTA 2VTOA 4L7FA 4LV7A 4KA3A 1MQ4A 2AQXA 3QCXA 3R7EA 1GIIA 3R02A 4LQMA 3L8SA 5BYZA 4C2VA 2PMNX 5CANA 3S0OA 2HCKA 3FKLA 2BAKA 3HMOA 3O23A 3LHJA 4JS8A 4QMSA 5B0XA 5C9CA 4BJJB 1BI8A 3L9NA 4MEDA 2FUMA 4QMUA 5TR6A 1Q24A 4YJQA 2YWVA 2UZUE 4BDFA 3PFYA 2W9FB 2WMTA 3QX2A 4FT7A 4QYHA 3AKKA 4V04A 3HMMA 1Q4LA 4ORKA 1L3RE 3QZIA 1XH5A 4I4FA 2GMXA 3NW5A 3JPVA 4AF3A 3UNZA 5DI1A 3UGCA 5E8UA 2IW6A 2R2PA 4E4MA 2XEZA 2EXCX 1HCKA 3SRVB 2QKRA 4N57A 3BLHA 4IAAA 4CTCA 3OTUA 4DA5A 2JAMA 4HOKA 4CZUA 4WKQA 1YVJA 1PYXA 2B9JA 4F9WA 5CSVA 3FMMA 3ZRKA 3ORNA 4YC6A 4EYJA 4FTUA 3IDCA 3P1AA 4I5CA 1YHWA 3QQUA 3SDJA 4FOCA 4GYIA 3WF7A 3VRYA 4EC9A 4O0VA 4GKIA 3FL5A 4AGUA 4EC8A 5AUTA 3E64A 3EB0A 2NPQA 5LVMA 2PVMA 4U40A 4FL1A 3IONA 2YJRA 3PYYA 3QRTA 4ITHA 3QX4A 3OCBA 3ROCA 4IACA 3BEGA 4FTTA 4EK3A 2ZAZA 2PUPA 2WMRA 2Z2WA 4M8TA 4MCVA 1SNUA 3QZGA 1JSVA 2C5NA 2E9UA 1G5SA 4D0WA 2OGVA 5EG3A 5EQPA 3LQ5A 2VWVA 4AW2A 3I7BA 5AV3A 3THBA 3ZSHA 5DBXA 3EMGA 2CCHA 5EDRA 3H0YA 4UMUA 5AAGA 4TY1A 4D58A 4LYNA 4E7WA 3PVBA 3FLZA 4BWPA 1G8KA 3NUUA 4Y72A 3PJ1A 5M06A 3UOJA 5JGBA 4I5HA 2G1TA 2HYYA 4JAIA 3N4VA 4WNPA 4O86A 4OLIA 4ARKA 3NVKI 4HGSA 3BWJA 3GXLA 3QBNA 5DGZA 3S2PA 4A9RA 3V6RA 3F5UA 5HTCA 2F49A 4KD1A 4MKCA 4I20A 3UE4A 4O7SA 3Q9ZA 3O50A 5IQGA 4A9SA 4FV4A 3K3JA 3CE3A 2X8EA 5HU3A 2JDVA 5AM6A 3FJQE 2YABA 4G3FA 2R7BA 2ACXA 2R3IA 1H24A 2CCIA 2NO3A 4FKJA 4R1VA 2QO2A 3AC2A 4CMOA 3PIZA 3ORLA 3PVWA 4HPUE 4I6BA 4L3PA 2OW3A 1U5RA 2JIUA 4X0MA 3S4QA 2LGCA 3VC4A 4XG4A 5CENA 5CEPA 1F5QA 3DKOA 3BE9A 4V0GB 5F1ZA 4DN5A 2PHKA 4RIXB 5CU6A 4AQKA 2WTVA 2C1BA 2X0GA 3MN3A 3TKIA 4XP0A 1WBSA 2ZM1A 5BYLA 4BCGA 4QMWA 2YIRA 2F4JA 4CYJA 4C37A 3I60A 3LE6A 3O5AA 4QD6A 2PU8A 3FLQA 2REIA 4BZDA 1MRYA 3LJ2A 2Y0AA 5J95A 2XK8A 5JEBA 1R3CA 5DOSA 4AACA 4BDBA 2QO7A 2XK6A 3O8UA 2JD5A 3SOCA 2WMUA 4NFMA 4W9XA 3PJ3A 3TV6A 5BPYA 3MJ1A 3LCOA 4IQ6A 4J71A 4FKWA 4KSPA 3VBYA 3GQIA 2NRYA 4GCJA 3VULA 4KKEA 5JSMA 2XNBA 5AP1A 1H1PA 3ZOSA 4U97A 3QD0A 2JDSA 4QPAA 3EHAA 4RMZA 4UYNA 4YO4A 3BLAA 5AR3A 2O2UA 2W1GA 4AA4A 1JSUA 4E6DA 4JX7A 5CI6A 2XBAA 5M08A 4QMNA 4MD9E 4FV7A 3EFJA 3EIDA 3QRJA 5BUJA 3R9RA 4AXEA 3F69A 3EZVA 1VZOA 3OBGA 3P9JA 3SXRA 2UW9A 5KMMA 1UWJA 1R0EA 2GFSA 1OKVA 3P0MA 2V7OA 3OXZA 5DNRA 3Q32A 3A99A 4FNXA 4I5PA 3VS2A 3EQHA 1H26A 3DDQA 3LJ1A 3AC3A 4V05A 2JBPA 4RIYB 3G9LX 3NYNA 3DKFA 4ASDA 1J91A 3VS7A 2BILB 1B6CB 3P7BA 3NWWA 5I9UA 2W4JA 5T6KA 1XBBA 3HAMA 2E9OA 5J7BA 2YZLA 1ZYCA 3PDTA 2UZVA 2I0EA 4O6LA 1YHVA 3DKGA 3BYMA 4MBJA 5B7VA 2YCRA 5CU4A 4WSYA 4BBMA 2BZJA 4BIBA 3EH9A 3VBQA 4UMQA 4RC4A 4U8ZA 3ZO2A 3MBLA 4EHZA 5JZNA 2VTIA 2O0UA 5EW9A 5HE2A 3UQFA 3NNWA 2GNHA 3H0ZA 4X3FA 3NIZA 4FYNA 4MQ2A 4NCTA 3UG1A 1CMKE 1ND4A 1QPJA 3NPCA 4BDGA 1Z5MA 4FYOA 4G5PA 1YXXA 4M3QA 2XARA 4FEXA 1ZYLA 2VTQA 5CF6A 2AEGA 5M55A 1FOTA 1Y91A 3C1XA 5HIDA 2J0JA 3LXKA 4PUZA 5LVPA 4F08A 3I81A 5CVGA 5EK7A 4AGWA 3VJOA 4IAYA 2XALA 3Q9WA 4AZFA 4O81A 3E8NA 4C57A 4ALVA 1H4LA 4U80A 5HIEA 5D41A 3OOGA 4I0SA 4XV1A 1UA2A 3MYGA 2C6OA 1OL6A 5E91A 5K4JA 4Y46A 1UNHA 2BVAA 3HP5A 3GC0A 3H4JA 2B4SB 4QQTA 4FTMA 5BVNA 4I23A 3L1SA 1GIJA 3NFGB 3DK3A 2PWLA 2WTKC 1STCE 4MNFA 1PKGA 4RJ3A 3WF5A 3AGLA 5M53A 5I9WA 2ESMA 5I9YA 4F7SA 5JFSA 4JR3A 4ID7A 4KBAA 1XH7A 3A7IA 3ETAA 3OXTA 5BUEA 4BCKA 5TF9A 4KKGA 3RVGA 3CR0A 3L8XA 3HA6A 5IISA 2OWBA 4I24A 3LQ3A 1XH4A 2ZDUA 3ORKA 5AV1A 1MUOA 3LFEA 1V0PA 4FR4A 4P7EA 3D83A 4ITIA 4WBBB 1FPUA 4EH9A 1IASA 3BIZA 5CZIA 3BYVA 4BTJA 3QRKA 4G9RA 4ANNA 4EH2A 2YITA 1Q3DA 3DU8A 4D2RA 3D5XA 1WBWA 2UZWE 3FZPA 4FG9A 3ZM4A 4AOIA 1K2PA 5KHWA 1UV5A 1QCFA 3TTJA 1WVXA 3L8VA 4M67A 2XJ2A 3HGKA 3BL7A 4QEBA 3W0PA 2QURA 3FSKA 1Z9XA 2VAGA 1IA8A 3IECA 4YJNA 4FV1A 2X1NA 2XNOA 4G31A 3ZHPC 3VUDA 3W0RA 1SYKA 4YHTA 2DQ7X 1FINA 3E7OA 3NUAA 4ZS0A 4APPA 2I0HA 3DBQA 3FWQA 5B2LA 4HNFA 4LM5A 2W5AA 3EYHA 5L4QA 1WCCA 2QR8A 1CTPE 3BE2A 3MFSA 3PIXA 4P5QA 2P3GX 3PA5A 4ZIMA 3VBVA 4XEYA 4ACDA 3ORXA 3LFCA 2YHVA 4KS8A 1AD5A 1GZNA 3VJNA 3QL8A 5KHXA 5M07A 3SA0A 5FQDC 3R7YA 4J8MA 2BRBA 3D5WA 3MESA 2YIYA 5IQCA 1OL1A 1BI7A 1H1SA 1WVYA 2F57A 3D2IA 1SNXA 3MVMA 3A4OX 3TKHA 4O84A 3CTHA 3UOLA 4IH8A 4P2KA 4LUEA 5EOLA 4FV5A 4DEDA 3KULA 4I92A 5CEMA 4U41A 1X8BA 2GTMA 3QLGA 3FI8A 5ANJA 3UIUA 4FSMA 3REPA 4ASXA 1Q62A 3EN5A 2IW9A 4UY9A 1ZY5A 3UP7A 2HZIA 4PQNA 5K0KA 4BICA 3ZXZA 4OTIA 2GQSA 2P55A 2I6LA 3ITZA 2Y4PA 3GCPA 4QDEA 4GKHA 3O51A 2DWBA 4LDTA 3IQ7A 4DG2E 5HE1A 1VLRA 3QRIA 2X7GA 3UPZA 4LOOA 3DNEA 2C1AA 3QZFA 4RSSA 4F99A 4I22A 4APCA 2Q0BA 5HORA 2JKKA 2KTYA 3F66A 4D4VA 4R5YA 3D5VA 3IW4A 3TV4A 4H39A 1XKKA 4N70A 2WU6A 5H9BA 3W0MA 5KMIA 3O17A 3KC3A 3WOWA 4YZ9A 3UNJA 4ENXA 4YSJA 2CGWA 1ZOGA 3UC4A 1O6KA 5I9XA 3PTGA 4TYHA 3LLTA 2EWAA 2EB2A 2RFSA 3EQGA 4MUQA 4H1MA 1ZMUA 2BRGA 3DS6A 4WG5A 4C0TA 4QMPA 4EH5A 4RFYA 3FLSA 4DH7A 1OIYA 4OGRA 4KBKA 4OTDA 3KXGA 3BQRA 2ZM4A 1UVRA 1M2PA 2XNMA 3ORMA 4TXCA 5HCZA 3R7UA 4QP4A 4PMPA 3F5GA 3AKJA 3MGYA 3KF4A 5AP7A 2C5OA 2FGIA 5L8JA 3IW6A 4Y5HA 3VHKA 3FZOA 2UZEA 3O96A 1KE7A 3ET7A 4EK6A 5M51A 1G8AA 4WBOA 3FUPA 5FRIA 4ANMA 1Z57A 3ENMA 4S33A 4EWHA 3KCFA 4L46A 4NIFB 2UW3A 4X3JA 5FD2A 4MNEB 2BTRA 4H36A 4FODA 1IRKA 5DVRA 1JKKA 3FI4A 4JIAA 4EUTA 1GZOA 1H00A 4RT7A 2FH9A 4PY1A 5AP2A 1ZWSA 2W5BA 3EQDA 4Y5QA 1ZOHA 4DEHA 5LQFA 1PF8A 3KMMA 4CT2A 2JBOA 2HAKA 3NUNA 1OBGA 5DG5A 4FZ7A 2YN8A 4AE6A 5AAEA 3BHTA 4MTAA 3G6GA 4LL5A 4QQCA 4B7TA 4U0IA 4A9TA 5GJFA 2R3LA 4EK5A 5T68A 2XIKA 4C7TA 2QOFA 2OJIA 4IC7A 2BIKB 3O8TA 4QP7A 4X2JA 3Q04A 2VTJA 4DH3A 3K3IA 3RPYA 2EXEA 4BZNA 3KA0A 1REKA 3UO6A 4AXDA 3ZUTA 2OZAB 4BKJA 1TZDA 3AG9A 4MWIA 1UWHA 2B9IA 3R2YA 2C4GA 5TOZA 2GNIA 4CFNA 4D9UA 4DHIB 3PJCA 2J0LA