2P4IA

Evolution of a highly selective and potent 2-(pyridin-2-yl)-1,3,5-triazine tie-2 kinase inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
280
structure length
252
Chain Sequence
VLKARIRMDAAIKRGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Evolution of a highly selective and potent 2-(pyridin-2-yl)-1,3,5-triazine Tie-2 kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 252
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2p4iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2p4iA01
4X2KA 4QMVA 3PZEA 4NCTC 5IA0A 2RG5A 5E4HA 5C26A 2JC6A 4GCJA 3RVGA 3NZ0A 4G9RA 3D2KA 4IZ5A 3EN9A 5E8ZA 3V5TA 1OVEA 4F0FA 3Q4UA 5A46A 3OBJA 3PVWA 3V3VA 3FJQE 3GFEA 1XBAA 2H9VA 2XJ2A 2Y7JA 3F2NA 3EFWA 2ITVA 3GNIB 5IA5A 3QCSA 5K3YA 3DBFA 3VUMA 4XG9A 5EQYA 4LFIA 4F0IA 4ZP5A 5HOAA 2GS6A 3TCPA 3ZC5A 5JGDA 4D9UA 3UQFA 2VX1A 3PJ1A 3I60A 4G3FA 1TQMA 4O0RA 3R21A 3WF5A 1JNKA 4JX3A 4UY9A 1W7HA 4AGWA 3SRVB 5IH5A 4D4RA 3C5UA 5AWMA 4ERWA 1Z5MA 4JXFA 5AAEA 2I6LA 4QYEA 3KKVA 4XCUA 1XH9A 5HICA 4F9WA 1U54B 4CFXA 2QU6A 3FAAA 1BL7A 1XBBA 4M97A 3EWHA 1SNUA 4ANLA 4OR5A 3LQ5A 4QYGA 3QTQA 5CT0A 5M51A 4BIBA 3RCDA 2JBOA 2YCFA 2YDJA 4UMUA 4IANA 4W8EA 4PMMA 4EQUA 3DOGA 3G6HA 3TM0A 2WMQA 3HUCA 5IPJA 2QURA 5JH6A 2QOIA 4A06A 4QTEA 1YWRA 3PSCA 4L7FA 2R3MA 4O0SA 1SM2A 1WAKA 2GNLA 3TV4A 1A9UA 1H1RA 4GIIA 5LVPA 4BGGA 3PPJA 3F5UA 3KMMA 4YJTA 1TVOA 3VUHA 3R22A 1J91A 3DBCA 4O81A 5IQEA 4TYHB 5EHLA 1BX6A 4EORA 4FZDB 3LMIA 1Q24A 4IDVA 1PMNA 5CLPA 2VO7A 3CXWA 5J7HA 4UMRA 3PZHA 2OLCA 5L8KA 4GIHA 4GKHA 4RJ7A 3G2FA 3ZZWA 1SNXA 3UYTA 3IDBA 4JAIA 4BB4A 5M09A 2UVXA 3KRRA 2BDWA 4JBVA 3R7OA 3NYXA 4E93A 4QP1A 2CCIA 4OTDA 3KN5A 4DFNA 1IA9A 3EKNA 2WQOA 1UWJA 4P2KA 3RKBA 2VO3A 1V0OA 4PTGA 4XP0A 3UVRA 4O7VA 3QLFA 3I7CA 3EZRA 3BV3A 3UG2A 4CKRA 1YDTE 2ZV8A 3AC1A 4A9RA 5GZAA 3IGOA 1H07A 1RJBA 2RFSA 4AZTA 5JGBA 2ONLA 4JL9A 5AUUA 4BFMA 2BCJA 2IPXA 1CMKE 4MNEA 3CQUA 3IG7A 3MYGA 4TYEA 5CTPA 1K2PA 2PZIA 2ITYA 4JG7A 1V0PA 2O65A 1SYKA 2HK5A 3TG1A 5J95A 3FMKA 1FQ1B 2YLFA 3FMJA 3ORKA 1VYZA 3Q53A 4OW8A 4FG7A 2W5BA 4FTLA 4U7ZA 5CX9A 3G51A 2AC3A 3KRLA 2W1CA 4BDFA 4PMSA 3B8RA 3GU4A 3K5UA 3R01A 4R7IA 3NEWA 2OJIA 4FUYA 5J87A 5LQFA 1DS5A 3DKOA 2GHMA 2YERA 4DFLA 4AZFA 3QWJA 1ZLTA 2BMCA 4BIDA 3ZUVA 2QOHA 3OD6X 3NUSA 1M2PA 5FXSA 5AP0A 4E4MA 3LXNA 4HVGA 1IEPA 4JRVA 2O64A 4CXAA 2A4LA 5H3QA 3F3UA 3MGYA 3SV0A 4IX5A 4WG4A 2WMBA 5DN3A 1UU7A 3I7BA 1FINA 1LR4A 2HYYA 3R2BA 4MD9E 5CXHA 4ACCA 5KZIA 3E8NA 3W2QA 3GC8A 5GJFA 4B0GA 4PY1A 2ZM1A 3MB6A 2PZRA 2PMIA 4FKWA 4E3CA 5HCXA 4G9CA 4H3PA 2P4IA 3JPVA 4JR7A 4UWYA 4BI0A 4HCTA 1ZYDA 2ETMA 3DU8A 1WBOA 5D9HA 3TKHA 3R7GA 2Q83A 4WIHA 3V5PA 4FIFA 5G1XA 5KMNA 4ZOGA 3UYSA 2YIRA 4FK6A 5CANA 4MXOA 4NTSA 1JAMA 3UP7A 1LUFA 5JN2A 3UIXA 5AUYA 3AT4A 2JLDA 3QQJA 3T8OA 4LL5A 4A9UA 5FG8A 4AZSA 2WQMA 3VAPA 2FVDA 3FBVA 2W05A 3DBDA 5CSVA 2RG6A 4C38A 5FEDA 3I79A 4M69A 4F99A 4C61A 3DK7A 3A7GA 4R3PA 3WF9A 3MJ2A 4Z3VA 4UV0A 3UC4A 3U9NA 4AACA 4CEGA 4J7BA 2PL0A 4RJ4A 4DG0E 4MBIA 2XKFA 4G3EA 1IA8A 5CAOA 3V01A 3JVRA 4R8QA 3W32A 4DN5A 4BICA 4RIWA 4DTKA 4CKJA 1ZOEA 1KOAA 2WFYA 2WMTA 2OKRA 3QHWA 4U6RA 4Z7HA 4B8MA 4IM2A 2WTKB 4F1TA 1OL2A 4ANSA 1Q41A 4L3PA 3F2RA 5EM5A 4YO4A 3FQSA 3AOXA 3VQUA 2ERZE 2VWVA 4KIQA 4HYIA 2YZAA 2WOTA 3CKWA 4PPAA 5FQDC 3V5LA 5EYMA 1Q8TA 4GMYA 3F69A 3S4QA 5F1ZA 3KXNA 1ZMUA 4E6QA 5EQEA 3CD3A 4HYSA 5C01A 4NKSA 4BWXA 2J5EA 2YWVA 4Y5HA 4GU6A 3OW3A 1ZYLA 3PFQA 4FG8A 4DLIA 3TKUA 3F66A 1JQHA 5AA9A 5HO7A 1OM1A 2PVLA 3OY1A 3S95A 4IE9A 3C4ZA 3DAEA 4C2VA 2PUNA 3BHYA 5DI1A 3ZDUA 2UW0A 4FYNA 5AM7A 2W5AA 4BZDA 2R4BA 3SVVA 4GYGA 4AW0A 3P7CA 4K11A 1IASA 4H3BA 5HVJA 3TN8A 2WMRA 3G6GA 1Q97A 2Z02A 4ZS4A 3FZ1A 4I5HA 2J7TA 2GNGA 3RZBA 4L68A 4ZTHA 5D1JA 2I40A 2Y8OA 3UMWA 3FEGA 3DJ5A 3L1SA 4NYEA 5FTOA 4CD0A 1OIQA 3ACKA 3GP0A 3OP5A 4AA5A 4F63A 2X4ZA 2Z7LA 2O63A 4GEOA 1F3MC 1PY5A 2C6TA 2EB3A 4ALUA 3TI1A 2W06A 1CTPE 5AP7A 3FKOA 4EKKA 5AR8A 2C0IA 2QD9A 3COIA 3DNEA 3HGKA 4FZAB 4ZSJA 5FP5A 3ZM9A 2HY81 5IA4A 3MPTA 5LMAA 3GXLA 3TTJA 3ZFXA 1GOLA 2OSCA 4RLLA 5HBHA 3LJ2A 5TE0A 3WZDA 5HU3A 3ID6C 1REKA 2EVAA 3ROYA 5DEWA 3VS7A 4FV0A 5DA3A 4LGHA 4C57A 4JDHA 1QPJA 2ZJWA 4K0YA 4FSQA 2ZB0A 4RC3A 4DEBA 5HBEA 1ZZ2A 4FE2A 2OJJA 2JIIA 4EI4A 1RW8A 3O51A 4WKQA 3W10A 3ORZA 1H1SA 1OPKA 4XG4A 4V05A 1CKIA 1IAHA 4USDA 3NIEA 3L9NA 2CSNA 2ZVAA 4WUNA 2C5XA 2XM9A 5LCKA 1R0PA 1OKYA 1LEWA 2IZSA 3HMMA 4C4IA 5J5SA 4FEUA 4E6CA 4KBAA 2X8IA 2ITOA 3V8TA 4DLJA 5HHWA 4BF2A 3TJDA 3GCPA 5CU2A 5CSXA 4D5KA 4BBEA 2JD5A 5KKRC 4UZHA 3AQVA 3PWDA 3PXFA 4IZAA 4WG3A 5JGAA 4AT4A 3LFNA 4ITIA 4EOSA 3TDWA 5HORA 3VJNA 2GHGA 4RX8A 4JIKA 5DBXA 4AGUA 2IWIA 3NW6A 4AZWA 3OOGA 2BPMA 3UOKA 3PLAE 2WB8A 2OW3A 1Q8YA 3E64A 3ZSGA 4J8NA 4CVAA 3A2CA 2VTRA 4ZMEA 3N51A 4E1ZA 4KS8A 4JQ7A 4F0GA 3LCTA 1BLXA 1XH4A 2KTYA 1JSTA 4H39A 4R5SA 2Z2WA 4WRGA 5DLSA 4E4LA 1Y8GA 4J96A 1YXTA 3CS9A 3VUTA 4QYYA 3DDQA 3HLLA 5FRIA 3R8UA 5CS6A 3UZPA 5FUTA 3E62A 4CZYB 2CGXA 2WELA 4FVRA 1PXMA 4DGOA 4FT3A 3UPZA 4NCTA 4RMZA 1KE7A 3GQIA 1Q5KA 1J3HA 3SKCA 4X0MA 4QMXA 4KIOA 1X8BA 2BAJA 4XBUA 5CEPA 3UO5A 4OTRA 2E9UA 4FOCA 4Y73A 4CFFA 5M4FA 4C59A 1H01A 4J99A 2RFEA 4D4SA 4MCVA 5IH4A 3D2IA 3KXMA 4I6FA 2BDFA 3FL4A 2YIYA 4CZUA 4BDJA 4FTJA 4YSJA 2YDIA 3C0HA 4MXAA 5I9WA 2OH0E 4IX4A 4M69B 1CDKA 2PE0A 3OY3A 1WBVA 2ITPA 4OTGA 4AN3A 1JBPE 3R83A 3FI8A 4IC7A 4A4OA 5ICPA 1FGKA 3DY7A 3I1AA 4FIIA 2UZEA 3Q9WA 5IEYA 3NUAA 2XB7A 5GZ9A 3JXWA 4HCUA 3LFEA 3FI4A 4FNYA 4ASDA 3MFSA 3C1XA 4D28A 3RPVA 4AOJA 4I92A 2QNJA 4RJ3A 2C6MA 5C9CA 2BTRA 2J2IB 3JVSA 3SGCA 4NM0A 1PMUA 2EWAA 4NW5A 4QMUA 2VRXA 3G5DA 2VX3A 3VIDA 4E5WA 4MWIA 5HNIX 4I94A 2IZUA 5HLPA 3DK3A 3IGGA 3I0OA 5E8TA 4QMSA 4UYNA 4ZEGA 2OZAA 4RVTA 1O6KA 2BTSA 4PL3A 2OWBA 2R3PA 3OTUA 3TIZA 4AQCA 4R7BA 5K4IA 5E7RA 4JNWA 1OL5A 3KU2A 3M1SA 5E8XA 4DG2E 5EQPA 3D7ZA 5AMNA 2RL5A 1H1QA 3F2AA 4RA4A 4UN0C 4FKQA 2G1TA 1ZYJA 4ANOA 5HLWA 5AFVA 3I0QA 3RM7A 4X21A 5AV3A 3DNDA 3RTPA 4C4FA 1ZMWA 1UWHA 2HZNA 3FI2A 5I9VA 1J7UA 4YNEA 4AUAA 3OXIA 4CGAA 1R78A 1HCLA 4JDIA 4FEXA 3RPSA 1QCFA 4Y95A 3AGLA 2I1MA 4WOVA 5IH6A 3OS3A 2F2UA 3A62A 4C7TA 3DXQA 3DB8A 3FKLA 4F7LA 3DCVA 2O0UA 2FO0A 2PSQA 3A7HA 3R1YA 4AZVA 2R3NA 4WUAA 4DYMA 3LOKA 4PPBA 4EOLA 3E3PA 3MPAA 3QFVA 5AV4A 1CSNA 3OVVA 2OO8X 3WZJA 5C4LA 4Y85A 5JZJA 1JWHA 1AGWA 4I93A 4N70A 4WNPA 3ZZEA 2YISA 3LFQA 2OU7A 3NVKI 2XP2A 3HEGA 5I3RA 4O7NA 5LJJA 1WVYA 1H26A 5A4QA 4O6EA 2ITUA 2GNJA 3KL8A 3EJ1A 2QHNA 3QD3A 3BU3A 4E6AA 3ATTA 5HCZA 2OIBA 2CLQA 4YO6A 4RJ6A 2I0YA 2JKMA 3QL8A 4FIHA 3U51A 5HX8A 5JFSA 5I9ZA 1R39A 2X8EA 3V04A 2XCKA 4PPCA 4H58A 5BYYA 4MNFA 2R64A 4MQ2A 3ULZA 3U6HA 3U4WA 4TN6A 4WSQA 5LMBA 3CTHA 3QCQA 3BEGA 2X0GA 4IVDA 5M44A 1IRKA 1GIIA 3DT1A 4JQEA 1FGIA 4C4GA 2UZOA 5CVHA 2W1DA 1PW2A 2E2BA 3W8QA 4EK3A 3GI3A 5CNNA 4RVKA 4YJRA 5D7AA 4F08A 5CAQA 2WMVA 2HELA 2OJGA 5FM3A 4F9BA 2O3PA 4RIXB 3BU5A 4XX9A 4RVMA 2W1IA 4YJPA 4XP2A 4MTAA 3OXZA 4OTWA 1L3RE 1U46A 4OUCA 1P4OA 3F9NA 4BIEA 4EL9A 1JKTA 4NW6A 3NNUA 3PIYA 3TUBA 2ZM3A 5ANDA 3VBWA 4EOQA 1PF8A 4J71A 3C50A 1ND4A 2F7XE 4BDIA 2UZWE 3ZBXA 1W0XC 2OF4A 3VS1A 3ZMMA 3IW5A 4LRMA 3WF8A 4DH3A 5HVKA 2FGIA 4HNIA 3SOAA 3MFRA 2X4FA 2ZV2A 5BVFA 3DZOA 1GY3A 4BZNA 3RBWA 3QF9A 4XOZA 4BCOA 3KULB 4QTDA 3QTUA 2EXMA 3DJ6A 2B54A 2JDRA 3DTWA 1E9HA 3KCFA 3UZRA 3LQ8A 2J90A 4GFMA 5M07A 4RT7A 2X9FA 4E7WA 2PMNX 1NVQA 2WMSA 3BWFA 4XMOA 4CCUA 2OJFE 1JLUE 3JYAA 3KFAA 5M57A 3FSKA 3NIZA 4IVAA 5DT4A 4DGNA 4GVAA 4UYAA 2WOUA 2JITA 4M0ZA 4E5AX 1G3NA 1YRPA 4J53A 4QP9A 3QZGA 2XEYA 5HEZA 5L6WL 3QHRA 3ZHPC 3E5AA 4FA2A 1ZYCA 4TPTA 2CGUA 2C5VA 2XKCA 3AMBA 4ZS0A 2VWBA 4W4VA 4ZTNA 4AT3A 3LE6A 4O0YA 4FNXA 4RWKA 2JIVA 2Z60A 3KXZA 1GZKA 2A19B 4RC4A 2IN6A 3DV3A 1QPEA 1PXNA 1IG1A 5CY3A 4CLJA 4R7HA 4S2ZA 4F64A 3LFSA 5EM8A 3PXZA 3SXFA 4MXCA 2X7OA 4RX7A 3WZUA 3ZLYA 5IISA 3PSBA 4QRCA 3QQHA 3P86A 3Q5IA 3BWJA 4ONAA 4DITA 4CRSA 4YJVA 4DT9A 3MBLA 4K6ZA 2OZAB 4FIEA 4V04A 4XRLA 4F7NA 3EQGA 3HMNA 3HV7A 3PG3A 2PVNA 4TNDA 1ATPE 3LFFA 3I6UA 5HZNA 5L4QA 2G9XA 4ZK5A 1ZOHA 4NH1A 5E8UA 4O91A 3S2PA 3BELA 4EC9A 4MX9A 5ACBC 3IOPA 4TWCA 1O6YA 3O8TA 2WHBA 1OMWA 4P5ZA 1H08A 3K54A 3E92A 2BDJA 4FTOA 4EYJA 3GCVA 5CSPA 4AXAA 3D7TA 3OHTA 4O86A 2PVJA 4D2TA 2XNNA 3UTOA 3DKFA 1KE9A 4Y46A 2YZLA 4FICA 4YU2A 3MY0A 3QRUA 4RFMA 3IO7A 2C6LA 1KE5A 3NUYA 3TACA 5CSHA 3V8WA 5EM6A 1NVRA 5IMEA 5KO1A 4EEVA 4ZLOA 4KKGA 4C8BA 3RM6A 5LMKC 5AP3A 2VN9A 2OH4A 2YM4A 4LUEA 3EQRA 4AOTA 5M08A 4GW8A 5JFVA 5EW8A 2WEIA 5H2UA 3VS4A 4DH5A 1WZYA 4ZTRA 5M06A 3I4BA 2HY0A 2WD1A 3QUEA 3SAYA 4QYHA 2X7GA 4D58A 2G2FA 4IVCA 4QMYA 3QZHA 2PVYA 5BUEA 4E26A 4F6WA 4O22A 3MA6A 4F7SA 2OIQA 4U97A 3OTVA 4EH4A 5LVMA 3QUPA 2UVYA 3KEXA 5E8SA 2V0DA 3L9MA 1GZOA 2WPAA 4GFOA 5IMXA 1RQQA 2HCKA 4XJ0A 3UBDA 5AR4A 5EHOA 3PY3A 3LHJA 5CXZA 2VGOA 5EKOA 1KUTA 3UODA 2OGVA 5CYIA 3HMIA 3LM5A 3LW0A 3KN6A 3QCYA 4I41A 3Q60A 1O9UA 3OT3A 2B1PA 4GSBA 3RPYA 4IACA 5J1VA 1ZXEA 3PG1A 4GUEA 3D14A 3MS9A 3GC7A 2FA2A 2GTMA 3NRMA 5ANIA 5EH0A 4YZDA 5ETAA 4ZXTA 4PP7A 4QMWA 3VRZA 1V0BA 1M14A 3ULIA 4M66A 3DLZA 4XV9A 3BHUA 3PY0A 3KXXA 3U4UA 2YDKA 2G2HA 3TL8A 2WTJA 2XNPA 3P08A 3HA8A 2I7QA 4HVDA 2QVSE 3CPCA 3JY9A 4TZRA 3EQFA 4FGBA 4OBOA 3G0FA 3LMGA 4YHTA 5HIBA 5DMZA 4BTJA 3ZOSA 3F61A 4CYJA 4C02A 3QRKA 4O1OA 2J0MB 1PYXA 3FXZA 4RSSA 4FKGA 5BX0A 1E1VA 4I4FA 4ZTSA 1Y57A 4IX6A 3C51A 3LFBA 4EK6A 4YP8A 4BDCA 3MTFA 3F7ZA 2F57A 4ZZOA 3WIKA 2B9JA 4M12A 2QI8A 2WTDA 1NXKA 3BQRA 2EUFB 3RJCA 3H9FA 4G5JA 4B6LA 2BKZA 4D4VA 4C0TA 5BYLA 3CE3A 4DTBA 4R3CA 4HPTE 2C30A 3VN9A 4XH6A 2QC6A 3IW4A 3ORIA 4H3QA 3EMGA 2UW9A 4EBWA 4QYFA 5HGIA 4DEDA 5GINE 5J7BA 3NDMA 4G3CA 5J79A 4IAAA 2GMXA 5AV2A 4A07A 3EFLA 3BV2A 5DRBA 2GQGA 3THBA 4AW2A 3NNXA 3NCZA 2HXQA 3M2WA 4JIAA 1V1KA 4YSMA 5A4CA 5HI2A 3M11A 2GSFA 2BHEA 2C4GA 3BI6A 3ZEPA 4ARKA 1GJOA 1ERKA 3GC9A 4N4SA 5EK7A 2F2CB 4GG5A 3NW7A 3PXYA 4H1JA 5B2LA 2G15A 1VJYA 4YTHA 5GJDA 3EN4A 4L42A 2VUWA 3EN6A 3HAVA 2UZBA 3FC2A 3EYGA 3GU5A 4HGLA 2X8DA 4F09A 4F65A 3FUPA 3GEQA 5AX9A 4AA4A 4FSZA 2BZIB 4EZ3A 2VTOA 3ATSA 1BI7A 3QYWA 1YOJA 4MXXA 3RHKA 2QOCA 4EOIA 2CNVA 2J0JA 3C0IA 2XYNA 4IJ9A 3FSFA 3ZC6A 2J0LA 4WNOA 4W9WA 4G6OA 3QBNA 3U8WA 4G3GA 3ORPA 4FTIA 4JR3A 4U8ZA 4MKCA 2F9GA 3WZEA 3TZ9A 3P79A 2J51A 4YUQA 4Z7GA 4F9YA 4PDPA 3NGAA 4YTIA 4DGMA 4O27B 3FLZA 3AC8A 2OXYA 1YXVA 3P23A 4MH7A 4C58A 4RPVA 2WKMA 3RCJA 2ESMA 3VC4A 2NO3A 2BFYA 3T9TA 1WVXA 4XS2A 4EOOA 1SMHA 4G3DA 5M53A 3Q32A 5E9EA 4IM3A 3UGCA 3QKLA 3R7IA 3D7TB 3LXKA 4ID7A 3EIDA 3FXWA 4FV5A 4Z9LA 4AGDA 4FOBA 1J7LA 1ZY4A 4DC2A 3UNKA 1J1CA 2BRBA 4O2PA 3G9NA 3OOMA 3C4EA 3LPBA 3ZS5A 1REJA 3MIYA 3QTIA 4QQJA 2WIHA 3R8ZA 3VHKA 4BTKA 3CP9A 3NVMB 2CHLA 3EQDA 4JBQA 4MXYA 3R8PA 4D1ZA 2AC5A 3MH1A 3CBLA 1PRYA 3Q2JA 2BIYA 3C4FA 1JSVA 4DBXA 4LMNA 3AXWA 3MTLA 2CDZA 2OXDA 4EZ5A 2XA4A 3QXPA 4O82A 4ALVA 3UNJA 3AT3A 4FX3A 4R5YA 1YDSE 3OWJA 4I21A 2PYWA 2QG5A 3HV4A 3IK3A 4IX3A 5AIRA 4E8AA 2ETKA 3CPBA 3PLSA 3EL7A 2HZ0A 4XBRA 1UKHA 4MF1A 3COKA 4U9AA 4V0GA 3CQEA 5LVOA 1B6CB 4MHAA 5IEVA 3TXOA 3DXNA 4EUTA 1Y91A 2QOFA 4ZJJA 5DWRA 5K5NA 1PHKA 5A3XA 4QQTA 2B9FA 2BIKB 4KRCA 2CNUA 2BZHB 2WAJA 2C6EA 4FV8A 4MVFA 2XK9A 3KXHA 2C47A 2X2KA 2J50A 2FB8A 2WMUA 4YNOA 5KCVA 4FC0A 3ERKA 4ORKA 4IAFA 2C3IB 1OITA 2XVDA 4I1ZA 2W0JA 4FZ6A 4LRJA 5E1EA 3W2OA 3JY0A 4JX7A 1H00A 1H0WA 3LMHA 3LFAA 3A60A 3ORXA 1MRVA 4XRJA 5CWZA 3L8VA 3P1AA 3IKAA 4IB5A 3KC3A 4DFZE 1YI6A 2A27A 2UUEA 2BAKA 3ITZA 4M8TA 4USFA 3SOCA 2O5KA 3POOA 3UPXA 2FSTX 4PMPA 4ITJA 5EOLA 5HTIA 1JPAA 5JQ8A 3LJ1A 1DI9A 1UVRA 5HO8A 5J9YA 1PXKA 4WHZA 4MQ1A 5KZ0A 3BGQA 3ZXTA 2B53A 2YFXA 4LGGA 3R7UA 5AA8A 4W4YA 3WZKA 4ASXA 2F7EE 3SXRA 3E63A 4GT5A 4L6QA 4J1RA 5EG3A 1H0VA 5TF9A 5B0XA 3TDVA 3KY2A 5K9IA 3QQFA 3WYYA 1MUOA 5IQBA 4O2ZA 4U5JA 2BAQA 3FHRA 4QP7A 3A7IA 4UWCA 5EI6A 2E9VA 3TT0A 4WBOA 3MV5A 2IVUA 4JJRA 3B8QA 2JDVA 2XCHA 4YLLA 3GCUA 4GT4A 4LV8A 4UZDA 3G90X 3DAJA 5HG9A 2UZUE 3HP5A 1MRYA 2C0OA 3NNVA 4ZY6A 3TZ8A 5D7VA 3C7QA 2XK4A 5IA1A 4L52A 3COHA 2E9NA 3P0MA 3LJ0A 2RFDA 4QMNA 4F7JA 2G01A 4L3LA 2C6IA 2YM5A 4AE9A 3F3TA 4E20A 4KUJA 2QOOA 2XNMA 4ENYA 3E8CA 5AAGA 2QKRA 2WXVA 5DG5A 5EHYA 2Q0BA 2CKPA 2ITXA 2QR7A 3FMDA 2ERKA 3LCKA 2XIZA 4IM0A 2CNQA 3HAMA 2YJSA 1B38A 1M7NA 3SW4A 4YZNA 2IJMA 3VBXA 2B52A 3DGKA 4GS6A 3AD5A 2C3KA 3S0OA 1IAJA 3ZTXA 2IZRA 1QL6A 2PY3A 3O17A 3FY0A 5IQIA 4PMTA 4UXLA 2Z7QA 3RHXA 5A14A 4GL9A 4YZCA 2I0VA 1J7IA 3TTIA 5CEOA 2UZTA 3HP2A 5IQFA 4QNYA 4BCIA 5JKGA 2XK8A 3ALOA 2PVFA 2UVZA 3EN7A 2V7OA 5T6KA 2UW4A 5F20A 3UOHA 3KREA 2VTNA 3MWUA 4G16A 3UG1A 5CEMA 2EXCX 4YR8A 2J0KA 4B7TA 4E4XA 3PTGA 4PV0A 2W7XA 2XS0A 4APCA 4PP9A 4TWNA 3DJ7A 3UVPA 4D55A 4C34A 3DXPA 3VULA 3AD6A 3OROA 4OAUC 1L8TA 4XG6A 3DBEA 2WEVA 2GDOA 3E7OA 3VS5A 4ACDA 5LARA 4DF3A 4NKAA 4CT2A 5LMKA 2UZLA 5C8KA 4NM3A 3F7WA 4CTCA 4IVBA 4WT6A 1ZAOA 4ASZA 3EQPA 3BIZA 5ANKA 3ZO3A 3ZO1A 2HAKA 2OXXA 3IECA 2P3GX 3NAXA 1H1WA 4EQMA 4IWQA 3EYHA 4KAOA 4BYJA 4FZFB 3SX9A 2Y6OA 1S9IA 4LGDA 3UMXA 2BRNA 4AZEA 1GIJA 1M17A 3AGMA 4HYHA 3W33A 5C1QB 2W5HA 2NNWB 2XKDA 4LM5A 1U5RA 2C0TA 1G5SA 2PZPA 1OGUA 2YABA 4JRNA 4S33A 2VO6A 2J5FA 1S9JA 4W4XA 3C4XA 5A4LA 4MNEB 3LFDA 4MYGA 5BMMA 4BDAA 4EHEA 5L8LA 1YWVA 3DA6A 4IFCA 2NRYA 4WBBB 3VO3A 2YM3A 3H30A 2XNOA 3T9IA 5BUIA 2PUPA 3I6WA 4DHFA 1OB3A 1OIUA 3OF0A 1G8AA 2J9MA 4FKJA 1PXIA 5FXQA 4XG7A 4Y83A 3OUNB 4LUDA 4RWJA 4YJQA 3SDJA 3CLYA 4R77A 2QLQA 1NT2A 3A99A 2CKOA 1GZ8A 4BCMA 2YAKA 2R3KA 5G6VA 3C5IA 3EL8A 1H28A 4QQ5A 4WRSA 3A7FA 5HG8A 3DZQA 4II5A 5H8EA 3QXOA 3PP1A 2YIXA 3ZFMA 3PRIA 5ETIA 4BDBA 2HOGA 3UIMA 5AEPA 4QMLA 4UXQA 5BQ0A 1JSUA 4MBJA 3C4CA 5IEXA 3CTQA 1OI9A 3QA0A 5TT7A 2RSVA 3CR0A 3HX4A 5AP6A 2YA9A 3CEKA 2VWYA 4C3FA 3RMFA 4O21A 4PDOA 4BKZA 5EOBA 4D0XA 4N0SA 5LWNA 3WBLA 2B7AA 1A06A 3OMVA 4I5PA 1H4LA 2HW7A 4YLKA 4FR4A 5D41A 5F95A 2B4SB 2KULA 2PVHA 4ZTMA 3PWYA 3AT2A 1H1PA 3BBTB 3Q04A 4RA5A 5L2QA 4QOXA 1Q3WA 3FY2A 4DEAA 5BMSA 2XNBA 1UNLA 4NSTA 5HESA 3KRWA 4UWBA 3QALE 4XV2A 3WIGA 4ZSAA 1R0EA 3FPQA 3ZU7A 4IAZA 5E8YA 3O71A 3IW7A 5GIOE 4BDHA 4USEA 1GNGA 1R3CA 4O38A 4BDKA 4B4LA 4UMQA 1MQBA 1STCE 4EJNA 4FGRA 5EM7A 4QMTA 4EH7A 2FYSA 5A4TA 3PVGA 4RJ8A 4MK0A 2UW5A 4I22A 2JKKA 2GS7A 3H9OA 4DFXE 2YACA 3HMOA 1FOTA 4OBPA 5DR2A 3RALA 3VBVA 4L01A 3MVMA 2R5TA 4RIWB 2FSMX 5KBRA 1CKJA 3ORLA 1UV5A 3KA0A 4I3ZA 4H05A 2XIXA 5JQ5A 1IR3A 3LLAA 3UO4A 1Z9XA 4I4EA 4Y5QA 3S1HA 4EK4A 2Y6MA 2WZJA 2GFCA 4KD1A 3W2SA 4KRDA 4FIJA 4KS7A 5TKDA 5IUHA 3Q5ZA 2UZDA 4ZTLA 1WBTA 2R3HA 3R9OA 3HKOA 3WF7A 4BY9E 3W16A 3IPHA 4FBXA 1OBGA 4IW0A 3EN5A 3R6XA 2UV2A 2X1NA 3P78A 4F6SA 2J4ZA 4MD7E 5D11A 1M2RA 4PDSA 5CU6A 3CGFA 2VTSA 1U4DA 3NWWA 4L8MA 1Q61A 5HE1A 3W18A 4BGHA 3IDPA 1PKGA 4S31A 3DLSA 2RKUA 3KRXA 2A0CX 4YC3A 5CQWA 3H0YA 4BN1A 2YN8A 2ZM4A 4GRBA 4YC8A 3PA5A 2C5OA 4L43A 2UW3A 1RDQE 3UZTA 4I6HA 4QMQA 3QRTA 4M14A 2ETRA 4WNMA 4GG7A 3LQ3A 2RF9A 1OUKA 3E7VA 1WBPA 3O8UA 4KABA 4W8DA 4X6RA 5AR3A 3ZSHA 4D1SA 1H27A 2BHHA 5ANJA 1W83A 3FC1X 3R9RA 3GC0A 3UDBA 3Q9YA 1YW2A 4G34A 4RRVA 2O2UA 3ODYX 2ZMCA 4H36A 4IEBA 3PA3A 3ZYAA 4JDKA 3HV3A 4XV1A 4BDEA 4EK8A 2VTHA 4G5PA 4TYIA 4ACMA 4ZMFA 3TNPC 3GB2A 3MDYA 4X3FA 3ZRLA 3HV6A 3POZA 4LQMA 4NK9A 4AU8A 4EH8A 1A48A 5CEKA 3MESA 3VQHA 4IDTA 4HGTA 4YTCA 2WU7A 4D2PA 4ZLYA 2B9IA 5JMSA 4KIKA 1FMOE 1OPJA 3TV6A 1SVHA 2JEDA 4TWPA 3GQLA 5FDXA 2C69A 3IONA 4O7YA 4BTMA 5HBJA 4FL3A 5DPVA 5T3QA 4D9TA 3U6JA 3E3BX 4MEDA 4DCAA 3E93A 4DE4A 4RGJA 5IG1A 4R1VA 5AJQA 5IUIA 3FLNC 2VV9A 4ZAUA 2ITZA 4JAJA 3CCNA 3N4VA 4FEWA 2C6KA 2QCSA 2ZV9A 4J98A 1YHSA 4JG6A 3HDMA 3OCGA 4PRJA 4U43A 3TNWA 4CFMA 4KSPA 5HE3A 2Y9QA 3C9WA 4L00A 3PJ2A 4FV7A 3W55A 3ODZX 2QOBA 2BKKA 4O7SA 5IQHA 3L9PA 5AIKA 2ACXA 4IB3A 4TY1A 4C3RA 4O6LA 4EYMA 2W1EA 1SZMA 2VU3A 3AMYA 3LKMA 5CQUA 2W4JA 5IQGA 2P0CA 4DEGA 3CC6A 2CN5A 2ZDTA 4OTFA 3OCTA 4D2VA 2GTNA 2W99B 5IQAA 2J6MA 3F5GA 4BKJA 3DFCB 5D10A 4IZYA 2BRHA 4TWOA 2XRUA 2I0EA 4JDJA 3V5QA 4APPA 2ZMDA 4GYIA 3LXLA 4HVIA 5HTCA 4IB1A 2Y0AA 2XK6A 5AP5A 4U3YA 4FKVA 2V22A 2C6OA 4FKRA 4FT9A 5AV0A 5EW3A 3PY1A 2JDOA 3A61A 1HCKA 4MD8E 3MY5A 4K8AA 4L45A 2PU8A 2YCQA 3Q4CA 5DH3A 3S00A 5BNJA 4U41A 3D9VA 1W98A 1CM8A 4ENXA 5HX6A 3EKKA 2Y4IC 3UE4A 4U0IA 2ZV7A 5L6PA 3PE1A 4DH1A 4TNBA 5JT2A 5LOHA 1FBNA 5KHXA 5A6NA 2FH9A 3ENHA 5CAVA 4GJ2A 4YZMA 3MH2A 5KE0A 4F1OA 2BRMA 4D2RA 2JAMA 3O7LD 4QPAA 2XK7A 4AFJA 4F6UA 3DBQA 1LPUA 4QQCA 1T46A 4P4CA 4ZSEA 5LWMA 2UZVA 4BI2A 4CMUA 4RVLA 4HZRA 2PMLX 3JUHA 4FTNA 3RI1A 4JVGA 1YXSA 2BR1A 2PK9A 1QPCA 4BR3A 4I5CA 2VTQA 4FKTA 4Y8DA 3QKMA 4U81A 2F4JA 5IU2A 3LCOA 4J97A 4AN2A 4FSTA 3AMAA 1BUHA 2FSOX 5IQCA 5CALA 3C4WA 4XP3A 1XR1A 4YJNA 4Y72A 2Z7SA 3D4QA 3GCQA 3R1SA 4YGAA 1ZZLA 1H24A 4NU1A 2EB2A 3LLTA 4ERKA 4RIYA 1Q4LA 4FI1A 1YHWA 4X2GA 3T3UA 5LXMA 2XIKA 5B7VA 3BLQA 5DIAA 2QLUA 1JKKA 3UIUA 3V5WA 4C33A 5M4IA 1KV1A 1U54A 3BBWA 3A4PA 1I44A 3ZLSA 4WD5A 5EKNA 3GGFA 2H96A 3FMLA 3E87A 5L3AA 3F3VA 3NS9A 3QX4A 5IKWA 3O8PA 1Q8UA 2BZKB 3Q9ZA 4A9SA 2H34A 1OL1A 3RGFA 3I81A 4KB8A 4D4YA 2CJMA 1UU8A 1UU3A 1YVJA 3MFTA 4CSVA 1OPLA 4AG8A 2R3JA 3FMNA 3FQEA 2P33A 5A9UA 4FTTA 3FPMA 2WTWA 3GU8A 1PXPA 4KBKA 3ORNA 4M15A 2GU8A 4FSUA 2VWWA 3V6RA 3R00A 4E6DA 2VGPA 2ZYBA 1QMZA 2NRUA 2OFVA 2E9OA 5KNJA 4DINA 4BCFA 3KXGA 3S3IA 2V55A 3HZTA 4R6VA 4JG8A 5M56A 3PYYA 1JKSA 3HDNA 4PWNA 3RK7A 4FF8A 4A4LA 1YOLA 4BCQA 4IZ7A 4CG9A 1KOBA 5HNGA 3LCSA 4KIKB 3R28A 3RWQA 5I9YA 4G6LA 3O23A 4YURA 5KMLA 4HVSA 5CI6A 3Q3BA 4HZSA 4Q5EA 2YEXA 3QYZA 3VHEA 4AW1A 4EHVA 2GNIA 2X6EA 3ZLXA 3A4OX 3F3WA 4DCEA 2G2IA 5AUZA 3UP2A 1BYGA 2XIRA 3QLGA 2BUJA 4PNKA 1YXUA 3LVPA 4U45A 3JS2A 3QRIA 4I5MA 2H6DA 3SXSA 2GQRA 2C1BA 4KKEA 4BGQA 1YI3A 3EFKA 3GBZA 5F4NA 3V6SA 4EOMA 2XRWA 4EOJA 1UKIA 4RX5A 1MP8A 2WGJA 3OXTA 4EH5A 3OWKA 3R1NA 5FBOA 4CG8A 2HZIA 1DM2A 2XF0A 3VF8A 4CYIA 5F94A 3L8XA 3NYNA 4IADA 4RFZA 4BVUA 5HG7A 3TWJA 3KQ7A 5FEEA 4NL0A 2X39A 2BRGA 3QTZA 4KNBA 4GK3A 4M68A 2AUHA 5JRSA 2DWBA 3EFJA 5C4KA 3F82A 3BCEA 4FV2A 5E8VA 3EQBA 4E5BA 3R02A 1FPUA 1LEZA 4OBQA 3VS2A 1F5QA 4R1YA 5E1SA 3EH9A 3FWQA 4FTUA 4JS8A 4K2RA 4FNWA 1KE8A 2QODA 4FV4A 2WU6A 4ZY5A 5DR9A 2LAVA 2X81A 4L7SA 4BL1A 4AF3A 1EH4A 3R1QA 3O2MA 2P55A 3A8XA 3HNGA 3PJCA 4PTCA 3I5NA 4YBJA 5HCYA 4FEQA 2C1AA 4I0SA 3FYKX 5GIPE 3WARA 4L44A 4NTTA 2DYLA 3ZUTA 4FV9A 3RAWA 1GAGA 3EQHA 2PTKA 4J95A 3PVUA 3DAKA 1OUYA 4F1MA 2VO0A 2CPKE 1XWSA 1VYWA 3F6XA 4IMYA 2R3GA 4BZOA 4O7TA 4G1WA 1Y8YA 2XJ1A 5ETFA 4FSRA 4O1PA 3TNQB 3O7LB 4YJOA 4DH8A 3P7AA 1RE8A 3MA3A 2WO6A 1UU9A 2ITWA 3LZBA 5ITAA 5TR6A 5CI7A 4QP4A 4PNIA 3FQHA 5AR7A 4F4PA 3RK9A 4IQ6A 4LOQA 3KF4A 4GFGA 4I20A 3UNZA 2XBJA 3BHVA 4FTAA 2WQNA 3SG8A 2OK1A 2GFSA 4Z16A 3FLQA 4OGRA 4D2WA 4CMTA 5KHWA 4DBNA 2IVVA 3HV5A 5AX3A 3MW1A 4DFUA 4ITHA 4X2NA 5IZFA 4RIYB 4TRLA 4A7CA 2PUIA 3FXXA 3O0GA 3OG7A 4I23A 3BU6A 1KE6A 3BYVA 1PKDA 1ZARA 4LMUA 5CZIA 4FEVA 4DGGA 3PJ3A 5CSWA 3PPKA 3Q4ZA 4OTPA 5CEIA 4AX8A 3QQLA 4M67A 3QAME 1TKIA 3QKKA 4FIGA 4PF4A 4RWLA 4YZ9A 2WMXA 3G9LX 5EI2A 4IWOA 3AD4A 3U87A 2ZDUA 2B0QA 2HXLA 3H3CA 3QTXA 3W1FA 3DS6A 1VZOA 2JDTA 3AC4A 5CF5A 3ZEWA 3GU7A 2Y4PA 5AP1A 3P9JA 3NYVA 3HUBA 3RNYA 4IIRA 4RFYA 5C8NA 3RWPA 4WSYA 3SC1A 4JT3A 3UOJA 4ANBA 4BCJA 4D2SA 4EWQA 4RBLA 5FLFA 3CKXA 4QNAA 4O96A 3OCSA 5HVYA 4DEIA 4S34A 4F9AA 4DFBA 4C62A 4UEUA 1JKLA 4W9XA 2UZNA 5M4CA 2W1GA 4L67A 3RPRA 5HIEA 3NPCA 4X3FC 2ZAZA 2RIOA 4XEYA 2QO7A 4NM7A 3NAYA 1WBNA 3FE3A 4RWIA 3R7VA 3EZVA 4EOKA 5H8GA 2GPHA 5FXRA 1P2AA 4ZSLA 5AP4A 2Z8CA 3BHTA 3D5VA 4EKLA 4O84A 1NW1A 4DH7A 3DDPA 5K0KA 4CLIA 3RK5A 3D15A 3PDTA 3K3IA 3DKCA 5KKRB 1OL6A 2VTLA 4FKUA 3TNHA 3R9NA 4QT1A 5BVOA 5H8BA 3E8DA 4W4WA 5EYDA 3UQGA 4ACGA 2SRCA 4MAOA 5I9XA 4GJ3A 5A54A 4YBKA 4RX9A 3NLBA 3NCGA 5DHJA 4C35A 3LFCA 1UNGA 5E92A 4PUZA 1MQ4A 2W9FB 2PULA 2GNHA 3B2WA 4RLKA 5AUXA 3EQIA 4ANQA 1DAYA 3PXRA 4CV8A 3QC9A 4YJUA 5FTGA 3BLRA 4KINA 3OUKA 3R8VA 3DPKA 2YAAA 4UBAA 4ZZMA 3U9CA 2XKEA 3QUDA 5FGKA 2W1FA 3D0EA 3QC4A 1YDRE 3BYUA 3RINA 2R0UA 2WMWA 3PSDA 4PX6A 3GENA 2VTJA 3KK9A 3NUXA 2AYPA 4K77A 3COMA 3WE4A 4BCKA 1UNHA 2HWPA 4O7ZA 5KMMA 2JFLA 2A1AB 5AUVA 5HU9A 2W17A 5DOSA 5EW9A 5EDQA 4LOPA 1B39A 1YQJA 2OJ9A 3O96A 4LOOA 3QD4A 4KSQA 4RZWA 4AN9A 3CQWA 3W2CA 4EWHA 5ANOA 4ZIMA 1TQPA 3PVBA 4FMQA 4C3PA 1U59A 4NWMA 4B9DA 4A9TA 4NFMA 3Q6WA 4ACHA 2PMOX 1ZRZA 3QCXA 2PZ5A 4FKPA 4FT0A 3DQWA 4QP3A 3WI6A 1XKKA 4HYUA 3MH3A 3MSSA 4CFVA 1H25A 4HJOA 5M4UA 5L2SA 1WFCA 4FSNA 3ET7A 2RFNA 5DT0A 3FZOA 1F0QA 3TJCA 4N57A 3G33A 3N9XA 4V01A 4X7QA 2VNYA 2VAGA 1CKPA 3WYXA 2XM8A 2YJRA 4C37A 4AOIA 2HIWA 2WTCA 2R0IA 4TTHB 4I6QA 4QO9A 1Q8ZA 3CGOA 5DE2A 5BYZA 5K4JA 2IO6A 3DQXA 2XNEA 2R3RA 5CENA 3CSVA 3CD8A 5L2TA 3G0EA 3OZ6A 5HTBA 4TYGA 4MWHA 3V8SA 4L53A 5LVNA 2CGWA 2QU5A 3NNWA 4CV9A 3N4TA 4OTIA 4UMTA 4YJSA 2C5YA 3CY3A 3ZUUA 1WBWA 4FZ7A 2O8YA 1APME 4PL4A 5C8MA 3LIJA 3QTSA 4AAAA 4A4XA 3WF6A 1W82A 4HNFA 2C6DA 2XEZA 2X7FA 2ITNA 3D5WA 2OF2A 2JIUA 3MVJA 3TEIA 4NFNA 5DEYA 4BCGA 1XHAA 5HD7A 2B9HA 3R71A 4K9YA 5BVWA 2NPQA 1U5QA 3KRJA 3VBYA 4ZTQA 3R30A 2YM7A 3MVHA 1JVPP 2R3FA 4XV3A 3CJFA 4XYFA 3H4JA 3U54A 4CZTA 2VWUA 3ZCLA 2WTIA 5A4EA 4A9YA 4CFUA 3KMWA 2XH5A 1YOMA 5ANEA 3LXPA 2JFMA 1OKWA 4I6BA 4EC8A 4FTKA 4FVQA 4FTMA 4WA9A 3MVLA 3DK6A 4EUUA 1KSWA 1OIYA 3ACJA 4NJDA 3RAKA 2YHVA 1Z57A 3OFMA 4K18A 3GUBA 5JRQA 3KK8A 4ZZNA 2R3LA 5C27A 5IA2A 3QRJA 2UW7A 2FUMA 5M55A 2PVRA 4YHJA 4EZ7A 1XH8A 4NJ3A 3NR9A 4GH2A 3ENMA 3GCSA 3SQQA 5BPYA 4FVPA 3EHAA 4JQ8A 2V62A 4HOKA 1Y6BA 5AM6A 2R7BA 2YCRA 2GHLA 3KB7A 3FMEA 5HKMA 2GNFA 4DEHA 3CY2A 3Q2MA 3WOWA 4IWDA 2FSLX 2XMYA 3FKNA 3C0GA 4V0GB 4HPUE 1XH6A 3MY1A 4GVJA 3VUDA 4BWPA 5KMKA 2RGPA 3FZSA 4FV6A 4R78A 4J52A 4J8MA 4KIPA 4QMPA 3VJOA 2HZ4A 4EHZA 1BL6A 3IW8A 4U3ZA 4WO5A 1P5EA 3VW8A 3FZPA 1ZMVA 2PPQA 3FZRA 4IB0A 4P7EA 1PMVA 1YKRA 5DFPA 3SA0A 4IFGA 3R8MA 3AC5A 2BVAA 3ELJA 5FBNC 4DAWA 1H8FA 3ORMA 4N6YA 5DR6A 2A2AA 3PA4A 4LYNA 2QKWB 3V5JA 5A6OA 2I0HA 3R73A 4EONA 2VZ6A 2PZYA 5CU4A 4YHFA 2WQBA 3QZFA 2J0IA 2PVMA 3NX8A 4QTCA 3AC3A 3TKIA 4YMJA 1XBCA 4FUXA 2X6DA 3OBGA 4IAKA 4IWPA 3AC2A 3FDNA 1OIRA 5FD2A 3VS3A 2Q0NA 5CF8A 3ORTA 3ZM4A 2WIPA 1P4FA 5EFQA 3DB6A 1I09A 2IW6A 4OAVB 4Q5HA 4QMMA 4ASEA 4RZVA 3BYSA 1URCA 2YM6A 4K1BA 5T68A 3BE2A 3GOKA 4MBLA 3UJGA 1PMEA 3UIBA 4NUSA 1YI4A 3RAIA 5DYJA 4RIOA 3WE8A 4AFEA 2QONA 5CZHA 3CIKA 4D1XA 4DFYA 5IDNA 3IOKA 5L8JA 5IF1A 2V7AA 4FKOA 3OEFX 1Y6AA 3L8PA 1AQ1A 4RIXA 5BVKA 3MI9A 2ZB1A 3ETAA 2C3LA 2HW6A 2GCDA 3MN3A 4R3RA 1DAWA 2Y4IB 5GZ8A 4KBCA 5FEQA 5KX8A 4M13A 3UQCA 4NIFA 3OW4A 5CF6A 2VWXA 4K33A 5GHVA 4QD6A 1W8CA 2R2PA 5HQ0A 3SG9A 5I5ZA 3ZRMA 4G31A 3RPOA 2BILB 1ZY5A 4BDGA 4C36A 2YWPA 1T45A 4WNKA 2ITTA 4WG5A 1FVVA 3R63A 3W8LA 2CGVA 1DI8A 4TYJA 2NP8A 3ZSIA 4D5HA 4JI9A 5HE0A 4GU9A 3ZO4A 5JSMA 4O0UA 4EBVA 2VTAA 5HD4A 4BHNA 2QHMA 4Q9SA 2WNTA 3KULA 2QOLA 4CFWA 3Q96A 5CAUA 1NA7A 3GOPA 4QTAA 4XNEA 3NUNA 3PPZA 3MPMA 3QWKA 3HRCA 4FL1A 5DGZA 4BBMA 4O7RA 2W4OA 3CTJA 4X6QC 4DG3E 4C4JA 4NT4A 4EOPA 5HG5A 5KBQA 2XIYA 4LG4A 4EH2A 2YITA 3GFWA 4TKSA 1K3AA 3ALNA 5I0BA 4RC2A 3MH0A 5B2KA 2VWIA 5JFXA 5JEBA 4XLIA 3OCBA 5AV1A 4PQNA 3HA6A 2W1HA 3EB0A 4P90A 1WCCA 2CN8A 2H8HA 3FV8A 4G6NA 2ZOQA 4QPMA 2R7IA 3HYHA 1M7QA 3PXQA 3QX2A 4UX9A 4QTBA 4BC6A 3FMMA 4M84A 5HNBA 4JBOA 3K2LA 2ITQA 4C4HA 4C4EA 2JAVA 4OT6A 5BVEA 2WTKC 2QO9A 3IW6A 3UOLA 4CQGA 5AUWA 2IG7A 4FT7A 3OWPA 2BALA 4QP2A 1AD5A 2HENA 4FK3A 4C2WA 4BHZA 4GK4A 2CLXA 3MB7A 4CKIA 3QD2B 3ZFYA 4EH3A 5E90A 2PUUA 4NEUA 2JGZA 4YC6A 5EDRA 4DT8A 4U40A 3Q52A 2QO2A 2E9PA 4FSYA 3BRBA 2WQEA 3CJGA 5DT3A 4CFNA 4YLJA 2XYUA 4BDDA 4PDYA 3F3ZA 4DGLC 3QQKA 2W96B 4EJ7A 3W2RA 4F9CA 5AADA 4AS0A 4GKIA 3KVXA 3KCKA 5ANGA 2JBPA 3TZMA 4YTFA 5ETCA 2VX0A 5FM2A 5L2IA 4FODA 2HWOA 2BFXA 2Z7RA 3R2YA 2QOKA 3TIYA 3HRBA 4GUBA 3ZLWA 2PE2A 4FNZA 4DEEA 1O6LA 1NVSA 4H1MA 3NSZA 4FT5A 3ZONA 1GIHA 4YPSA 4GT3A 5EYCA 3OT8A 5TOZA 3VF9A 4EK5A 3JR1A 3AG9A 3VNTA 1M52A 4FSMA 3Q9XA 4L9IA 5ACKA 1Q8WA 1XQZA 3PJ8A 5F9EA 2C68A 3VVHA 2P2HA 2JKQA 3DFAA 5HIDA 3SHEA 3VBTA 5JK3A 3ANRA 4MXZA 2XK3A 3D83A 3FL5A 3FI3A 3NYOA 3RAHA 2VNWA 3BE9A 1FVTA 4LI5A 3VUGA 3F5PA 5H9BA 5CU3A 3VUKA 4BRXA 2JDSA 1PXJA 4BBFA 3QQGA 5LCJA 2R3OA 4TL0A 2ONLC 3PXKA 1OECA 4RG0A 3FLSA 3W2PA 2PE1A 3N4UA 2R9SA 4X3JA 5KUPA 3TV7A 2XZSA 3BQCA 3GT8A 3GVUA 4U42A 4I0RA 3DKGA 5I3OA 2UW6A 1M2QA 4XOYA 5L2WA 4E4NA 2PHKA 3R04A 1W84A 2BZJA 3K5VA 5EDPA 3EQCA 5FWKK 3QD0A 3R9DA 5IA3A 2VTTA 1VEBA 5HO6A 4EHGA 4O7LA 2OFUA 4XLVA 4AW5A 2OIDA 3ZRKA 4Q9ZA 3VBQA 4ZJVA 4FYOA 4HGSA 4ZY4A 3HRFA 4OTHA 2R3QA 3ZH8A 3OC1A 4ZSGA 4TT7A 1XH5A 5AP2A 2OICA 1ZOGA 2VTPA 4G17A 4XHKB 4B8LA 4FKIA 1YHVA 3R0TA 4HW7A 3FMHA 1XH7A 5EI8A 4XG2A 4ZJIA 4BCPA 3VS6A 2QQ7A 2REIA 4OLIA 3KVWA 4M7IA 3SW7A 2XBAA 3DTCA 4O0WA 4QMOA 3ZO2A 4FV3A 3ANQA 2W4KA 4B99A 4NIFB 2UW8A 2DQ7X 2VTIA 3VUIA 1FVRA 3D5UA 4CQEA 5CT7A 5LVLA 5K0XA 5KMJA 2X2LA 2VWZA 2VD5A 2OZOA 2QOQA 1E1XA 3QTRA 3UC3A 3H9RA 3H10A 4O0TA 4BKYA 4IXPA 3ZDIA 3D5XA 5AR5A 5CU0A 3R9HA 5AR2A 3VWAA 1PXOA 1XO2B 3HECA 5CEQA 5IDPA 3Q4TA 1JOWB 5E8WA 5EYKA 4FSWA 2WMAA 5B2MA 4EH6A 5KMIA 3TUCA 4AA0A 2C5NA 2IVTA 4AT5A 3HVCA 3TNIA 2W9ZB 5GNKA 4IAYA 3PP0A 3BHHA 4FKLA 4L46A 3VRYA 2CKEA 3IS5A 3LCDA 3F88A 4IAIA 3F5XA 3FLYA 3O50A 5IQDA 4JBPA 2GQSA 3NUUA 4BTFA 1WVWA 2QG7A 3MJ1A 3I5ZA 4S32A 4N6ZA 4CNHA 4AWIA 1KV2A 1R1WA 2P2IA 5FTQA 4O83A 4DA5A 2LGCA 4FG9A 4BCNA 3QA8A 3H0ZA 5I4NA 4AP7A 2F49A 2EXEA 3EOCA 3SRVA 3E8EA 3QTWA 5JZNA 2XUUA 4XG3A 2DUVA 5BVNA 5CNOA 2YLEA 5HLNA 4BYIA 4PL5A 4KA3A 3KMUA 4U79A 3VS0A 1KWPA 4BCHA 5CAPA 5BUJA 3P7BA 4M3QA 1SVGA 3BZ3A 1MRUA 3IDCA 1URWA 3BYMA 3BEAA 3ZBFA 1NY3A 4FTCA 5AAFA 5KMOA 3HL7A 4TXCA 4IH8A 3E88A 4EQCA 5J9ZA 3FLWA 4FKSA 2X9EA 1K9AA 2CCHA 4CCBA 5IUGA 5J1WA 5E91A 4FV1A 4S30A 2JKOA 5FDPA 3BPRA 4BWKA 1ZWSA 4U44A 3V51A 3T3VA 5CF4A 3NMUF 3R8LA 4CT1A 3FYJX 1YXXA 1UA2A 2IZTA 4I24A 5I9UA 3ZXZA 4ALWA 3FHIA 3BYOA 5DVRA 5GJGA 3RP9A 2YM8A 5J8IA 2OG8A 3PE2A 3D94A 4FL2A 4M0YA 4QPSA 4RJ5A 3SD0A 2CMWA 2VTMA 3PIXA 3B2TA 5CVFA 2C3JA 1PXLA 5BVDA 2YCSA 2OI4X 3A7JA 3P4KA 4GV1A 4Q2AA 3PIZA 4UALA 4TYHA 4X3FB 1HOWA 4QP8A 3P5KA 3OEZA 1G8SA 5CVGA 2DS1A 4D0WA 4G2FA 4TW9A 3C13A 3U6IA 1VR2A 3BX5A 4RQVA 2YIWA 1YWNA 3LAUA 3BKBA 1OKVA 3A8WA 1J1BA 2GS2A 4QP6A 3G15A 4JLCA 2W1ZA 4IHPA 2IW9A 1LP4A 5DRDA 5J5TA 4ANMA 2F7ZE 3RZFA 5D12A 4LL0A 4O0XA 4UB7A 4BI1A 2YIQA 5AUTA 3HMPA 4PTEA 1P14A 4FTQA 5DNRA 3MFUA 3VW6A 2CKQA 3II5A 3QZIA 4KKHA 2V5QA 4FTRA 4UMPA 4IC8A 4LV5A 3L8SA 3OWLA 1PJKA 2IW8A 1XJDA 5CASA 3REPA 3QGYA 3R7EA 1QPDA 4CRLA 2EU9A 3U55A 4ZLZA 3TUDA 4OTQA 3LM0A 4LRKA 4NM5A 1GZNA 4KWPA 4L3JA 2PWLA 3MIAA 3QGWA 5K5XA 2XNGA 4QMZA 5FP6A 5JFWA 4JOAA 4DTAA 2QR8A 1Q62A 2X2MA 3FZTA 3K3JA 2WTVA 4GK2A 4NZWB 3SLSA 2BROA 3UO6A 4IBMA 4XUFA 4HVHA 3L9LA 1OL7A 3RNIA 5HE2A 1FMKA 1OKZA 3KF7A 4F70A 1SVEA 3UVQA 3QQUA 4Z55A 3BGPA 3KGAA 2IVSA 3IQ7A 3PRFA 4O0VA 4P5QA 3PUPA 3BGZA 4IJPA 2PVKA 2B55A 2OBJA 3QU0A 5TO8A 4AGCA 1BI8A 1WMKA 4X2FA 3R7YA 4CTBA 3Q6UA 4O7WA 4ANNA 4XG8A 3BLHA 4HCVA 5L6OA 1ZYSA 4I0TA 1TQIA 4OT5A 4YZBA 1PYEA 4EH9A 1OBDA 3GU6A 3NUPA 4RQKA 1BMKA 4MF0A 1Q99A 3ROCA 3M42A 4AE6A 4U80A 5C03A 3TZ7A 4CMOA 2R3IA 3NW5A 1WBSA 4E73A 5J9LA 1BKXA 4X2JA 4HGEA 3WILA 1Q3DA 4YPDA 2XJ0A 1OZ1A
chains in the Genus database with same CATH superfamily
4X2KA 4QMVA 3PZEA 4NCTC 5IA0A 2RG5A 5E4HA 5C26A 2JC6A 4GCJA 3RVGA 3NZ0A 4G9RA 3D2KA 4IZ5A 3EN9A 5E8ZA 3V5TA 1OVEA 4F0FA 3Q4UA 5A46A 3OBJA 3PVWA 3V3VA 3FJQE 3GFEA 1XBAA 2H9VA 2XJ2A 2Y7JA 3F2NA 3EFWA 2ITVA 3GNIB 5IA5A 3QCSA 5K3YA 3DBFA 3VUMA 4XG9A 5EQYA 4LFIA 4F0IA 4ZP5A 5HOAA 2GS6A 3TCPA 3ZC5A 5JGDA 4D9UA 3UQFA 2VX1A 3PJ1A 3I60A 4G3FA 1TQMA 4O0RA 3R21A 3WF5A 1JNKA 4JX3A 4UY9A 1W7HA 4AGWA 3SRVB 5IH5A 4D4RA 3C5UA 5AWMA 4ERWA 1Z5MA 4JXFA 5AAEA 2I6LA 4QYEA 3KKVA 4XCUA 1XH9A 5HICA 4F9WA 1U54B 4CFXA 2QU6A 3FAAA 1BL7A 1XBBA 4M97A 3EWHA 1SNUA 4ANLA 4OR5A 3LQ5A 4QYGA 3QTQA 5CT0A 4DFXE 5M51A 4BIBA 3RCDA 2JBOA 2YCFA 2YDJA 4UMUA 4IANA 4W8EA 4PMMA 4EQUA 3DOGA 3G6HA 3TM0A 2WMQA 3HUCA 5IPJA 2QURA 5JH6A 2QOIA 4A06A 4QTEA 1YWRA 3PSCA 4L7FA 2R3MA 4O0SA 1SM2A 1WAKA 2GNLA 3TV4A 1A9UA 1H1RA 4GIIA 5LVPA 4BGGA 3PPJA 3F5UA 3KMMA 4YJTA 1TVOA 3VUHA 3R22A 1J91A 3DBCA 4O81A 5IQEA 4TYHB 5EHLA 1BX6A 4EORA 4FZDB 3LMIA 1Q24A 4IDVA 1PMNA 5CLPA 2VO7A 3CXWA 5J7HA 4UMRA 3PZHA 2OLCA 5L8KA 4GIHA 4GKHA 4RJ7A 3G2FA 3ZZWA 1SNXA 3UYTA 3IDBA 4JAIA 4BB4A 5M09A 2UVXA 3KRRA 2BDWA 4JBVA 3R7OA 3NYXA 4E93A 4QP1A 2CCIA 4OTDA 3KN5A 4DFNA 1IA9A 3EKNA 2WQOA 1UWJA 4P2KA 3RKBA 2VO3A 1V0OA 4PTGA 4XP0A 3UVRA 4O7VA 3QLFA 3I7CA 3EZRA 3BV3A 3UG2A 4CKRA 1YDTE 2ZV8A 3AC1A 4A9RA 5GZAA 2IEWA 1H07A 3IGOA 1RJBA 2RFSA 4AZTA 5JGBA 2ONLA 4JL9A 5AUUA 4BFMA 2BCJA 2IPXA 1CMKE 4MNEA 3CQUA 3IG7A 3MYGA 4TYEA 5CTPA 1K2PA 2PZIA 2ITYA 4JG7A 1V0PA 2O65A 1SYKA 2HK5A 3TG1A 5J95A 3FMKA 1FQ1B 2YLFA 3FMJA 3ORKA 1VYZA 3Q53A 4OW8A 4FG7A 2W5BA 4FTLA 4U7ZA 5CX9A 3G51A 2AC3A 3KRLA 2W1CA 4BDFA 4PMSA 4I6LA 3B8RA 3GU4A 3K5UA 4AXEA 3R01A 4R7IA 3NEWA 2OJIA 4FUYA 5J87A 5LQFA 1DS5A 3DKOA 2GHMA 2YERA 4DFLA 4AZFA 3QWJA 1ZLTA 2BMCA 4BIDA 3ZUVA 2QOHA 3OD6X 3NUSA 1M2PA 5FXSA 5AP0A 4E4MA 3LXNA 4HVGA 1IEPA 4JRVA 2O64A 4CXAA 2A4LA 5H3QA 4AXCA 3W0RA 3F3UA 3MGYA 3SV0A 4IX5A 4WG4A 2WMBA 5DN3A 3O5AA 1UU7A 3I7BA 1FINA 1LR4A 2HYYA 3R2BA 4MD9E 5CXHA 4ACCA 5KZIA 3E8NA 3W2QA 3GC8A 5GJFA 4B0GA 4PY1A 2ZM1A 3MB6A 2PZRA 2PMIA 4FKWA 4E3CA 5HCXA 4G9CA 4H3PA 2P4IA 3JPVA 4JR7A 4UWYA 4BI0A 4HCTA 1ZYDA 2ETMA 3DU8A 1WBOA 5D9HA 3TKHA 3R7GA 2X0PA 2Q83A 4WIHA 3V5PA 4FIFA 5G1XA 5KMNA 2XARA 4ZOGA 3UYSA 2YIRA 4FK6A 5CANA 4MXOA 4NTSA 3AKLA 1JAMA 3UP7A 1LUFA 5JN2A 3UIXA 5AUYA 3AT4A 4F78A 2JLDA 3QQJA 3T8OA 4LL5A 4A9UA 5FG8A 4AZSA 2WQMA 3VAPA 2FVDA 3FBVA 2W05A 3DBDA 5CSVA 2RG6A 4C38A 5FEDA 3I79A 4M69A 4F99A 4C61A 3DK7A 3A7GA 4R3PA 3WF9A 3MJ2A 4Z3VA 4UV0A 3UC4A 3U9NA 4AACA 4CEGA 4J7BA 2PL0A 1ST0A 4RJ4A 4DG0E 4MBIA 2XKFA 4G3EA 1IA8A 5CAOA 3V01A 3JVRA 4R8QA 3W32A 4DN5A 4BICA 4RIWA 4DTKA 4CKJA 1ZOEA 1KOAA 2WFYA 2WMTA 2OKRA 3QHWA 4U6RA 4Z7HA 4B8MA 4IM2A 2WTKB 4F1TA 1OL2A 4ANSA 1Q41A 4L3PA 3F2RA 5EM5A 4YO4A 3FQSA 3AOXA 3VQUA 2ERZE 2VWVA 4KIQA 4HYIA 2YZAA 2WOTA 3CKWA 4PPAA 5FQDC 3V5LA 5EYMA 1Q8TA 4GMYA 3F69A 3S4QA 5F1ZA 3KXNA 1ZMUA 4E6QA 5EQEA 3CD3A 4HYSA 5C01A 4NKSA 4BWXA 2J5EA 2YWVA 4Y5HA 4GU6A 3OW3A 1ZYLA 3PFQA 4FG8A 4DLIA 3TKUA 3F66A 1JQHA 5AA9A 5HO7A 1OM1A 2PVLA 3OY1A 3S95A 4IE9A 3C4ZA 3DAEA 4C2VA 2PUNA 3BHYA 5DI1A 3ZDUA 2UW0A 4FYNA 5AM7A 2W5AA 4BZDA 2R4BA 3SVVA 4GYGA 4AW0A 3P7CA 4K11A 1IASA 4H3BA 5HVJA 3TN8A 2WMRA 3G6GA 1Q97A 2Z02A 4ZS4A 3FZ1A 4I5HA 2J7TA 2GNGA 3RZBA 4L68A 4ZTHA 3VONA 5D1JA 2I40A 2Y8OA 3UMWA 3FEGA 3DJ5A 3L1SA 4NYEA 5FTOA 4CD0A 1OIQA 3ACKA 3GP0A 3OP5A 4AA5A 4F63A 2X4ZA 2Z7LA 2O63A 4GEOA 1F3MC 1PY5A 2C6TA 2EB3A 4ALUA 3TI1A 2W06A 1CTPE 5AP7A 3FKOA 4EKKA 5AR8A 2C0IA 2QD9A 3COIA 3DNEA 3HGKA 4FZAB 4ZSJA 5FP5A 3ZM9A 2HY81 5IA4A 3MPTA 5LMAA 3GXLA 3TTJA 3ZFXA 1GOLA 2OSCA 4RLLA 5HBHA 3LJ2A 5TE0A 3WZDA 5HU3A 3ID6C 1REKA 2EVAA 3ROYA 5DEWA 3VS7A 4FV0A 5DA3A 4LGHA 4C57A 4JDHA 1QPJA 2ZJWA 4K0YA 4FSQA 2ZB0A 4RC3A 4DEBA 5HBEA 1ZZ2A 4FE2A 2OJJA 2JIIA 4EI4A 1RW8A 1TFFA 3O51A 4WKQA 3W10A 3ORZA 1H1SA 1OPKA 4XG4A 4V05A 1CKIA 1IAHA 4USDA 3NIEA 3L9NA 2CSNA 2ZVAA 4WUNA 2C5XA 2XM9A 5LCKA 1R0PA 1OKYA 1LEWA 2IZSA 3HMMA 4C4IA 5J5SA 4FEUA 4E6CA 4KBAA 2X8IA 2ITOA 3V8TA 4DLJA 5HHWA 4BF2A 3TJDA 3GCPA 5CU2A 5CSXA 4D5KA 4BBEA 2JD5A 5KKRC 4UZHA 3AQVA 3PWDA 3PXFA 4IZAA 4WG3A 5JGAA 4AT4A 3LFNA 4ITIA 4EOSA 3TDWA 5HORA 3VJNA 2GHGA 4RX8A 4JIKA 5DBXA 4AGUA 2IWIA 3NW6A 4AZWA 3OOGA 2BPMA 3UOKA 3PLAE 2WB8A 2OW3A 1Q8YA 3E64A 3ZSGA 4J8NA 4CVAA 3A2CA 2VTRA 4ZMEA 3N51A 4E1ZA 3PFYA 4KS8A 4JQ7A 4F0GA 3LCTA 1BLXA 1XH4A 2KTYA 1JSTA 4H39A 4R5SA 2Z2WA 4WRGA 5DLSA 4E4LA 4O4DA 1Y8GA 4J96A 1YXTA 3CS9A 3VUTA 4QYYA 3DDQA 3HLLA 5FRIA 3R8UA 5CS6A 3UZPA 5FUTA 3E62A 4CZYB 2CGXA 2WELA 4FVRA 1PXMA 4DGOA 4FT3A 3UPZA 4NCTA 4RMZA 1KE7A 3GQIA 1Q5KA 1J3HA 3SKCA 4X0MA 4QMXA 4KIOA 1X8BA 2BAJA 4XBUA 5CEPA 3UO5A 4OTRA 2E9UA 4FOCA 4Y73A 4CFFA 5M4FA 4C59A 1H01A 4J99A 2RFEA 4D4SA 4MCVA 5IH4A 3D2IA 3KXMA 4I6FA 2BDFA 3FL4A 2YIYA 4CZUA 4BDJA 4FTJA 4YSJA 2YDIA 3C0HA 4MXAA 5I9WA 2OH0E 4IX4A 4M69B 1CDKA 2PE0A 3OY3A 1WBVA 2ITPA 4OTGA 4AN3A 1JBPE 3R83A 3FI8A 4IC7A 4A4OA 5ICPA 1FGKA 3DY7A 3I1AA 4FIIA 2UZEA 3Q9WA 5IEYA 3NUAA 2XB7A 5GZ9A 3JXWA 4HCUA 3LFEA 3FI4A 4FNYA 4ASDA 3MFSA 3C1XA 4D28A 3RPVA 4AOJA 4I92A 2QNJA 4RJ3A 2C6MA 5C9CA 2BTRA 2J2IB 3JVSA 3SGCA 4NM0A 1PMUA 2EWAA 4NW5A 4QMUA 2VRXA 3G5DA 2VX3A 3VIDA 4E5WA 4MWIA 5HNIX 4I94A 2IZUA 5HLPA 4LV7A 3DK3A 3IGGA 3I0OA 5E8TA 4QMSA 4UYNA 4ZEGA 2OZAA 4RVTA 1O6KA 2BTSA 4PL3A 2OWBA 2R3PA 3OTUA 3TIZA 4AQCA 4R7BA 3AKKA 5K4IA 5E7RA 4JNWA 1OL5A 3KU2A 3M1SA 5E8XA 4DG2E 5EQPA 3D7ZA 5AMNA 2RL5A 1H1QA 3F2AA 4RA4A 4UN0C 4FKQA 2G1TA 1ZYJA 4ANOA 5HLWA 5AFVA 3I0QA 3RM7A 4X21A 5AV3A 3DNDA 3RTPA 4C4FA 1ZMWA 1UWHA 2HZNA 3FI2A 5I9VA 1J7UA 4DHZA 4YNEA 4AUAA 3OXIA 4CGAA 1R78A 3UDSA 1HCLA 4QDVA 4JDIA 4FEXA 3RPSA 1QCFA 4Y95A 3AGLA 2I1MA 4WOVA 5IH6A 3OS3A 2F2UA 3A62A 4C7TA 3DXQA 3DB8A 3FKLA 4F7LA 3DCVA 2O0UA 2FO0A 2PSQA 3A7HA 3R1YA 4AZVA 2R3NA 4WUAA 4DYMA 3LOKA 4PPBA 4EOLA 3E3PA 3MPAA 3QFVA 5AV4A 1CSNA 3OVVA 2OO8X 3WZJA 5C4LA 4Y85A 5JZJA 1JWHA 1AGWA 4I93A 4N70A 4WNPA 3ZZEA 2YISA 3LFQA 2OU7A 3NVKI 2XP2A 3HEGA 5I3RA 4O7NA 5LJJA 1WVYA 1H26A 5A4QA 4O6EA 4BJJA 2ITUA 2GNJA 3KL8A 3EJ1A 2QHNA 3QD3A 3BU3A 4E6AA 3ATTA 5HCZA 2OIBA 2CLQA 4YO6A 4RJ6A 2I0YA 2JKMA 3QL8A 4FIHA 3U51A 5HX8A 5JFSA 5I9ZA 1R39A 2X8EA 3V04A 2XCKA 4PPCA 4H58A 5BYYA 4MNFA 2R64A 4MQ2A 3ULZA 3U6HA 3U4WA 4TN6A 4WSQA 5LMBA 3CTHA 3QCQA 3BEGA 2X0GA 4IVDA 5M44A 1IRKA 1GIIA 3DT1A 4JQEA 1FGIA 4C4GA 2UZOA 5CVHA 2W1DA 1PW2A 2E2BA 3W8QA 4EK3A 3GI3A 5CNNA 4RVKA 4YJRA 5D7AA 4F08A 5CAQA 2WMVA 2HELA 2OJGA 5FM3A 4F9BA 2O3PA 4RIXB 3BU5A 4XX9A 4RVMA 2W1IA 4YJPA 4XP2A 4MTAA 3OXZA 4OTWA 1L3RE 1U46A 4OUCA 1P4OA 3F9NA 4BIEA 4EL9A 3UDZA 1JKTA 4NW6A 3NNUA 3PIYA 3TUBA 2ZM3A 5ANDA 3VBWA 4EOQA 1PF8A 4J71A 3C50A 1ND4A 2F7XE 4BDIA 2UZWE 3ZBXA 1W0XC 2OF4A 3VS1A 3ZMMA 3IW5A 2X0OA 4LRMA 3WF8A 4DH3A 5HVKA 2FGIA 4HNIA 3SOAA 3MFRA 2X4FA 2ZV2A 5BVFA 3DZOA 1GY3A 4BZNA 3RBWA 3QF9A 4XOZA 4BCOA 3KULB 4QTDA 3QTUA 2EXMA 3DJ6A 2B54A 2JDRA 3DTWA 1E9HA 3KCFA 3UZRA 3LQ8A 2J90A 4GFMA 5M07A 4RT7A 2X9FA 4E7WA 2PMNX 1NVQA 2WMSA 3BWFA 4XMOA 4CCUA 2OJFE 1JLUE 3JYAA 3KFAA 5M57A 3FSKA 3NIZA 4IVAA 5DT4A 4DGNA 4GVAA 4UYAA 2WOUA 2JITA 4M0ZA 4E5AX 1G3NA 1ST4A 1YRPA 4J53A 4QP9A 3QZGA 2XEYA 5HEZA 5L6WL 3QHRA 3ZHPC 3E5AA 4FA2A 1ZYCA 4TPTA 2CGUA 2C5VA 2XKCA 3AMBA 4ZS0A 2VWBA 4W4VA 4ZTNA 4AT3A 3LE6A 4O0YA 4FNXA 4RWKA 2JIVA 2Z60A 3KXZA 1GZKA 2A19B 4RC4A 2IN6A 3DV3A 1QPEA 1PXNA 1IG1A 5CY3A 4CLJA 4R7HA 4S2ZA 4F64A 3LFSA 5EM8A 3PXZA 3SXFA 1XMMA 4MXCA 2X7OA 4RX7A 3WZUA 3ZLYA 5IISA 3PSBA 4QRCA 3QQHA 3P86A 3Q5IA 3BWJA 4ONAA 4DITA 4CRSA 4YJVA 2NYAA 4DT9A 3MBLA 4K6ZA 4DHJA 2OZAB 4FIEA 4V04A 4XRLA 4F7NA 3EQGA 3HMNA 3HV7A 3PG3A 2PVNA 4TNDA 1ATPE 3LFFA 3I6UA 5HZNA 5L4QA 2G9XA 4ZK5A 1ZOHA 4NH1A 5E8UA 4O91A 3S2PA 3BELA 4EC9A 4MX9A 5ACBC 3IOPA 4TWCA 1O6YA 3O8TA 2WHBA 1OMWA 4P5ZA 1H08A 3K54A 3E92A 2BDJA 4FTOA 4EYJA 3GCVA 5CSPA 4AXAA 3D7TA 3OHTA 4O86A 2PVJA 4D2TA 2XNNA 3UTOA 3DKFA 1KE9A 4Y46A 2YZLA 4FICA 4YU2A 3MY0A 3QRUA 4RFMA 3IO7A 2C6LA 1KE5A 3NUYA 3TACA 5CSHA 3V8WA 5EM6A 1NVRA 5IMEA 5KO1A 4EEVA 4ZLOA 4KKGA 4C8BA 3RM6A 5LMKC 5AP3A 2VN9A 2OH4A 2YM4A 4LUEA 3EQRA 4AOTA 5M08A 4GW8A 5JFVA 5EW8A 2WEIA 5H2UA 3VS4A 4DH5A 1WZYA 4ZTRA 5M06A 3I4BA 2HY0A 2WD1A 3QUEA 3SAYA 4QYHA 2X7GA 4D58A 2G2FA 4IVCA 4QMYA 3QZHA 2PVYA 5BUEA 4E26A 4F6WA 4O22A 3MA6A 4F7SA 2OIQA 4U97A 3OTVA 4EH4A 5LVMA 3QUPA 2UVYA 3KEXA 5E8SA 2V0DA 3L9MA 1GZOA 2WPAA 4GFOA 5IMXA 1RQQA 2HCKA 4XJ0A 3UBDA 5AR4A 5EHOA 3PY3A 3LHJA 5CXZA 2VGOA 5EKOA 1KUTA 3UODA 2OGVA 5CYIA 3HMIA 3LM5A 3LW0A 3KN6A 3QCYA 4I41A 3Q60A 1O9UA 3OT3A 2B1PA 4GSBA 3RPYA 4IACA 5J1VA 1ZXEA 3PG1A 4GUEA 3D14A 3MS9A 3GC7A 2FA2A 2GTMA 3NRMA 5ANIA 5EH0A 4YZDA 5ETAA 4ZXTA 4PP7A 4QMWA 3VRZA 1V0BA 1M14A 3ULIA 4M66A 3DLZA 4XV9A 3BHUA 3PY0A 2XAOA 3KXXA 3U4UA 2YDKA 2G2HA 3TL8A 2WTJA 2XNPA 3P08A 3HA8A 2I7QA 4HVDA 2QVSE 3CPCA 3JY9A 4TZRA 3EQFA 4FGBA 4OBOA 3G0FA 3LMGA 4YHTA 5HIBA 5DMZA 4BTJA 3ZOSA 3F61A 4CYJA 4C02A 3QRKA 4O1OA 2J0MB 1PYXA 3FXZA 4RSSA 4FKGA 4LDTA 5BX0A 1E1VA 4I4FA 4ZTSA 1Y57A 4IX6A 3C51A 2AQXA 3LFBA 4EK6A 4YP8A 4BDCA 3MTFA 3F7ZA 2F57A 4ZZOA 3WIKA 2B9JA 4M12A 2QI8A 2WTDA 1NXKA 3BQRA 2EUFB 3RJCA 3H9FA 4G5JA 4B6LA 2BKZA 4D4VA 4C0TA 5BYLA 3CE3A 4DTBA 4R3CA 4HPTE 2C30A 3VN9A 4XH6A 2QC6A 3IW4A 3ORIA 4H3QA 3EMGA 2UW9A 4EBWA 4QYFA 5HGIA 4DEDA 5GINE 5J7BA 3NDMA 4G3CA 5J79A 4IAAA 2GMXA 5AV2A 4A07A 3EFLA 3BV2A 5DRBA 2GQGA 3THBA 4AW2A 3NNXA 3NCZA 2HXQA 3M2WA 4JIAA 1V1KA 4YSMA 5A4CA 5HI2A 3M11A 2GSFA 2BHEA 2C4GA 3BI6A 3ZEPA 4ARKA 1GJOA 1ERKA 3GC9A 4N4SA 5EK7A 2F2CB 4GG5A 3NW7A 3PXYA 4H1JA 5B2LA 2G15A 1VJYA 4YTHA 5GJDA 3EN4A 4L42A 2VUWA 3EN6A 3HAVA 2UZBA 3FC2A 3EYGA 3GU5A 4HGLA 2X8DA 4F09A 2XAMA 4F65A 3FUPA 3GEQA 5AX9A 4AA4A 4FSZA 2BZIB 4EZ3A 2VTOA 3ATSA 1BI7A 3QYWA 1YOJA 4MXXA 3RHKA 2QOCA 4EOIA 2CNVA 2J0JA 3C0IA 2XYNA 4IJ9A 3FSFA 3ZC6A 2J0LA 4WNOA 4W9WA 4G6OA 3QBNA 3U8WA 4G3GA 3ORPA 4FTIA 4JR3A 4U8ZA 4MKCA 2F9GA 3WZEA 3TZ9A 3P79A 2J51A 4YUQA 4Z7GA 4F9YA 4PDPA 3NGAA 4YTIA 4DGMA 4O27B 3FLZA 3AC8A 2OXYA 1YXVA 3W0OA 3P23A 4MH7A 4C58A 4RPVA 2WKMA 3RCJA 2ESMA 3VC4A 2NO3A 2BFYA 3T9TA 1WVXA 4XS2A 4EOOA 1SMHA 4G3DA 5M53A 3Q32A 3UDTA 5E9EA 4IM3A 3UGCA 3PUFC 3QKLA 3R7IA 3D7TB 3LXKA 4ID7A 3EIDA 3FXWA 4FV5A 4Z9LA 4AGDA 4FOBA 1J7LA 1ZY4A 4DC2A 3UNKA 1J1CA 2BRBA 4O2PA 3G9NA 3OOMA 3C4EA 3LPBA 3ZS5A 1REJA 3MIYA 3QTIA 4QQJA 2WIHA 3R8ZA 3VHKA 4BTKA 3CP9A 3NVMB 2CHLA 3EQDA 4JBQA 4MXYA 3R8PA 4D1ZA 2AC5A 3MH1A 3CBLA 1PRYA 3Q2JA 2BIYA 3C4FA 1JSVA 4DBXA 4LMNA 3AXWA 3MTLA 2CDZA 2OXDA 4EZ5A 2XA4A 3QXPA 4O82A 4ALVA 3UNJA 3AT3A 4FX3A 4R5YA 1YDSE 3OWJA 4I21A 2PYWA 2QG5A 3HV4A 3IK3A 4IX3A 5AIRA 4E8AA 2ETKA 3CPBA 3PLSA 3EL7A 4QEBA 2HZ0A 4XBRA 1UKHA 4MF1A 3COKA 4U9AA 4V0GA 3CQEA 5LVOA 1B6CB 4MHAA 5IEVA 3TXOA 3DXNA 4EUTA 1Y91A 2QOFA 4ZJJA 5DWRA 5K5NA 1PHKA 5A3XA 4QQTA 2B9FA 2BIKB 4KRCA 2CNUA 2BZHB 2WAJA 2C6EA 4FV8A 4MVFA 2XK9A 3KXHA 2C47A 2X2KA 2J50A 2FB8A 2WMUA 4YNOA 5KCVA 4FC0A 3ERKA 4ORKA 4IAFA 2C3IB 1OITA 2XVDA 3W0QA 4I1ZA 2W0JA 4FZ6A 4LRJA 5E1EA 3W2OA 3JY0A 4JX7A 1H00A 1H0WA 3LMHA 3LFAA 3A60A 3ORXA 1MRVA 4XRJA 5CWZA 3L8VA 3P1AA 3IKAA 4IB5A 3KC3A 4DFZE 1YI6A 2A27A 2UUEA 2BAKA 3ITZA 4M8TA 4USFA 3SOCA 2O5KA 3POOA 3UPXA 2FSTX 4PMPA 4ITJA 5EOLA 5HTIA 3NFGB 1JPAA 5JQ8A 3LJ1A 1DI9A 1UVRA 5HO8A 5J9YA 1PXKA 4WHZA 4MQ1A 5KZ0A 3BGQA 3ZXTA 2B53A 2YFXA 4LGGA 3R7UA 5AA8A 4W4YA 3WZKA 4ASXA 2F7EE 3SXRA 3E63A 4GT5A 4L6QA 4J1RA 5EG3A 1H0VA 5TF9A 5B0XA 3TDVA 3KY2A 5K9IA 3QQFA 3WYYA 1MUOA 5IQBA 4O2ZA 4U5JA 2BAQA 3FHRA 4QP7A 3A7IA 4UWCA 5EI6A 2E9VA 3TT0A 4WBOA 3MV5A 2IVUA 4JJRA 3B8QA 2JDVA 2XCHA 4YLLA 3GCUA 4GT4A 4LV8A 4UZDA 3G90X 3DAJA 5HG9A 1W2DA 2UZUE 3HP5A 1MRYA 2C0OA 3NNVA 4ZY6A 3TZ8A 5D7VA 3C7QA 2XK4A 5IA1A 4L52A 3COHA 2E9NA 4O4EA 3P0MA 3LJ0A 2RFDA 4QMNA 4F7JA 2G01A 4L3LA 2C6IA 2YM5A 4AE9A 3F3TA 4E20A 4KUJA 2QOOA 2XNMA 4ENYA 3E8CA 5AAGA 2QKRA 2WXVA 5DG5A 5EHYA 2Q0BA 2CKPA 2ITXA 2QR7A 3FMDA 2ERKA 3LCKA 2XIZA 4IM0A 2CNQA 3HAMA 3W0NA 2YJSA 1B38A 1M7NA 3SW4A 4YZNA 2IJMA 3VBXA 2B52A 3DGKA 4GS6A 3AD5A 2C3KA 3S0OA 1IAJA 3ZTXA 2IZRA 1QL6A 2PY3A 3O17A 3FY0A 5IQIA 4PMTA 4UXLA 2Z7QA 3RHXA 5A14A 4GL9A 4YZCA 2I0VA 1J7IA 3TTIA 5CEOA 2UZTA 3HP2A 5IQFA 4QNYA 4BCIA 5JKGA 2XK8A 3ALOA 2PVFA 2UVZA 3W0MA 3EN7A 2V7OA 5T6KA 2UW4A 5F20A 3UOHA 3KREA 2VTNA 3MWUA 4G16A 3UG1A 5CEMA 2EXCX 4YR8A 2J0KA 4B7TA 4E4XA 2X0QA 3PTGA 4PV0A 2W7XA 2XS0A 4APCA 4PP9A 4TWNA 3DJ7A 3UVPA 4D55A 4C34A 3DXPA 3VULA 3AD6A 3OROA 4OAUC 1L8TA 4XG6A 3DBEA 2WEVA 2GDOA 3E7OA 3VS5A 4ACDA 5LARA 4DF3A 4NKAA 4CT2A 5LMKA 2UZLA 5C8KA 1G8KA 4NM3A 3F7WA 4CTCA 4IVBA 4WT6A 1ZAOA 4ASZA 3EQPA 3BIZA 5ANKA 3ZO3A 3ZO1A 2HAKA 2OXXA 3IECA 2P3GX 3NAXA 1H1WA 4EQMA 4IWQA 3EYHA 4KAOA 4BYJA 4FZFB 3SX9A 2Y6OA 1S9IA 4LGDA 3UMXA 2BRNA 4AZEA 1GIJA 1M17A 3AGMA 4HYHA 3W33A 5C1QB 2W5HA 2NNWB 2XKDA 4LM5A 1U5RA 2C0TA 1G5SA 2PZPA 1OGUA 2YABA 4JRNA 4S33A 2VO6A 2J5FA 1S9JA 4W4XA 3C4XA 5A4LA 4MNEB 3LFDA 4MYGA 5BMMA 4BDAA 4EHEA 5L8LA 1YWVA 3DA6A 4IFCA 2NRYA 4WBBB 3VO3A 2YM3A 3H30A 2XNOA 3T9IA 5BUIA 2PUPA 3I6WA 4DHFA 1OB3A 1OIUA 3OF0A 1G8AA 2J9MA 4FKJA 1PXIA 5FXQA 4XG7A 4Y83A 3OUNB 4LUDA 4RWJA 4YJQA 3SDJA 3CLYA 4R77A 2QLQA 1NT2A 3A99A 2CKOA 1GZ8A 4BCMA 2YAKA 2R3KA 5G6VA 3C5IA 3EL8A 3P5JC 1H28A 4QQ5A 4WRSA 3A7FA 5HG8A 3DZQA 4II5A 5H8EA 3QXOA 3PP1A 2YIXA 3ZFMA 3PRIA 5ETIA 4BDBA 2HOGA 3UIMA 5AEPA 4QMLA 4UXQA 5BQ0A 1JSUA 4MBJA 3C4CA 5IEXA 3CTQA 1OI9A 3QA0A 5TT7A 2RSVA 3CR0A 3HX4A 5AP6A 2YA9A 3CEKA 2VWYA 4C3FA 3RMFA 4O21A 4PDOA 4BKZA 5EOBA 4D0XA 4N0SA 5LWNA 3WBLA 2B7AA 1A06A 3OMVA 4I5PA 1H4LA 2HW7A 4YLKA 4FR4A 5D41A 5F95A 2B4SB 2KULA 2PVHA 4ZTMA 3PWYA 3AT2A 1H1PA 3BBTB 3Q04A 4RA5A 5L2QA 4QOXA 1Q3WA 3FY2A 4DEAA 5BMSA 2XNBA 1UNLA 4NSTA 2XANA 3BL9A 5HESA 3KRWA 4UWBA 3QALE 4XV2A 3WIGA 4ZSAA 1R0EA 3FPQA 3ZU7A 4IAZA 5E8YA 3TMOA 3O71A 3IW7A 5GIOE 4BDHA 4USEA 1GNGA 1R3CA 4O38A 4BDKA 4B4LA 4UMQA 1MQBA 1STCE