4AQCA

Triazolopyridine-based inhibitor of janus kinase 2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
289
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title A Selective, Orally Bioavailable 1,2,4-Triazolo[1,5-A]Pyridine-Based Inhibitor of Janus Kinase 2 for Use in Anticancer Therapy: Discovery of Cep-33779.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 289
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aqcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqcA01
4YC6A 3ZC6A 5EOLA 4ZSGA 5TE0A 4UX9A 1BI8A 2QODA 1B39A 4KKHA 5F4NA 3FZ1A 1FQ1B 1PKGA 1YRPA 3S95A 3PP1A 1G8AA 4A9TA 4PL4A 1YXXA 2GQSA 4IEBA 2C5NA 4YSJA 5HO7A 1OL2A 5J9YA 2QHNA 4FKPA 5IA5A 2WZJA 2PVRA 2WAJA 2EB3A 2F7EE 2C5VA 3N9XA 2I0EA 3VUGA 4QTEA 4O27B 3I0QA 3IW6A 3IPHA 5JK3A 4IE9A 4AZWA 3QQHA 2AC3A 1YXUA 4LYNA 2E9VA 5D1JA 4LGHA 3R02A 3UG2A 3VWAA 3PXQA 4CMOA 4Z7GA 4QP1A 1M17A 5J7HA 2XUUA 3W1FA 3DT1A 4GFGA 3D9VA 4FTQA 3HX4A 4QYYA 4FZ6A 3PFQA 4JBOA 3Q60A 5AJQA 4AN3A 3R0TA 4GT4A 5JGBA 2C1BA 5AV0A 4EH6A 2X8IA 2UV2A 1H8FA 1V1KA 4BDAA 3DXNA 3OZ6A 3P7BA 1OKVA 4MWHA 1UWHA 3VN9A 1OL6A 4RZWA 3EHAA 3P0MA 2XJ1A 4H36A 5DPVA 2CKOA 2VO6A 4AOJA 4LQMA 4BWXA 1GZKA 1KWPA 5BVNA 1RJBA 2YCFA 3OT3A 5C4KA 4NZWB 3MBLA 3C7QA 5CAQA 5A6NA 5E8YA 5EI6A 3TNPC 4DAWA 4FNXA 2XJ0A 3MN3A 4WHZA 4F6WA 3TZ8A 4NM5A 4Z9LA 3RAIA 3TG1A 1SVGA 4QMXA 4QMLA 3WE4A 3QTUA 3ZH8A 3ACJA 5I9VA 1ZOGA 3NIZA 4X3JA 5IPJA 3HV3A 3R71A 3AT2A 3CE3A 3W18A 2CKPA 4PRJA 3PSCA 2W17A 4XV2A 2ZB1A 3BYVA 4UN0C 1OIQA 3FJQE 4G17A 4WG4A 4NW5A 3DNEA 2HCKA 2KTYA 3UBDA 4M69A 5M53A 4FTJA 2WEIA 5IQAA 4X2NA 4BCIA 2WTCA 4YPSA 4D2VA 3G9LX 4FT0A 3ENMA 2OFVA 1XBAA 2UW4A 3C4CA 3EN4A 4NKAA 4Y85A 4YHFA 4BGGA 4O96A 4U9AA 3VIDA 2PZYA 2PUNA 1PYXA 4EBWA 3U6HA 4PUZA 2ZYBA 2GFSA 2R3FA 1QL6A 4ACDA 4K11A 4B8LA 5I9YA 1YWVA 3REPA 4L45A 3EN9A 1WVYA 3ORIA 1OIRA 4CKIA 4N6ZA 5HLNA 4D0XA 3JXWA 1JSTA 3U54A 5J1WA 2YLEA 1NY3A 4R7HA 4C61A 1JBPE 1YOLA 5I9XA 3L1SA 4BDJA 1BLXA 3HRFA 3DBEA 4NFNA 1WBNA 3OFMA 4U5JA 4KBAA 4RA4A 4ORKA 2NP8A 1OPKA 4LGGA 4OAUC 1DS5A 2GCDA 4I0TA 4NCTC 3ORNA 3VUKA 4CV8A 3KXHA 3HV4A 3QD2B 4PPAA 1J7LA 4AOTA 2C0TA 4BHZA 2Y4IB 4XP2A 2UVZA 4FKQA 5DR6A 3QA8A 3R7YA 3HMPA 2ERKA 2A0CX 4YSMA 2JDRA 4CFFA 1K2PA 2ERZE 1U5RA 3W32A 1DM2A 2QLQA 3MA6A 3DLZA 2F9GA 4S30A 3UC3A 2SRCA 3E3PA 4JBPA 3Q5IA 4XG6A 2OG8A 2JKQA 1V0BA 3O51A 3HVCA 4C4HA 1YHVA 3AC8A 4BBMA 2IPXA 4JOAA 5ANIA 3D2KA 3VS5A 2ZM1A 3V51A 3HA8A 2J0MB 5F95A 2WMVA 1JSUA 3KULB 5HE2A 5E8WA 4JQEA 1KE8A 3DBCA 4J1RA 4GSBA 4AOIA 4QNYA 2GDOA 4X2KA 5T68A 3VULA 5A4TA 4L52A 2RIOA 1G5SA 2VTIA 2HZ4A 4X3FC 4DG2E 3DK3A 3O50A 4UMQA 5DOSA 4GKIA 5C8NA 4M3QA 5AA8A 5BYYA 3F3TA 3ZLWA 4EH4A 5CWZA 4RX7A 5D7AA 5B0XA 3OXIA 3DV3A 3TN8A 4G31A 1FGKA 4O21A 2QOHA 3PUPA 5JN2A 1MRUA 3DQXA 4GIHA 3OUNB 4UZHA 1A9UA 4H1MA 1JKLA 1XH4A 2F4JA 3OCGA 4X2GA 3TI1A 4O83A 1UKHA 3LCDA 3Q6WA 3FMDA 4PPCA 4RX9A 2X1NA 3CP9A 1R39A 3O8PA 1IASA 4UWCA 5BVEA 3KULA 2LAVA 4M15A 5AR5A 4IVDA 4BCPA 3ZEPA 5D9HA 5I4NA 3PXRA 3NAXA 1M52A 4XUFA 2PUIA 3VHEA 3I60A 3FE3A 1YDTE 1H4LA 4U8ZA 3VBQA 4AGUA 4N4SA 4O7RA 1CDKA 3ZMMA 3BRBA 3KXZA 2ZM3A 4KRCA 4A4LA 1OKZA 1S9JA 2CDZA 2XYUA 3IGOA 3UE4A 5BVDA 2XEYA 4RC3A 2NO3A 3ACKA 3F82A 3NW5A 3FYJX 1J1CA 4PL5A 2ETRA 4K77A 4RIOA 3GU8A 3DKFA 3MY0A 4NJDA 4EQCA 3PG1A 2B54A 3L9LA 2GNHA 3Q96A 5GINE 1PMUA 2HXQA 4V0GA 3MB7A 4IM3A 4HVIA 4TPTA 2XB7A 3B2WA 3DBFA 3BYMA 4F1MA 2GHLA 1FPUA 5FLFA 2QKWB 3UZPA 2X6DA 4CXAA 5AV3A 2P2IA 3UOHA 4BTJA 3Q04A 5IMEA 3NLBA 4FKUA 2CNVA 4QPSA 4KSPA 5AM7A 5TOZA 3DLSA 4W8EA 5LMAA 3R8VA 3UIUA 3I7BA 1V0OA 2H96A 3MFUA 2RF9A 5H8BA 3TKUA 1PHKA 4DEAA 1YDRE 2XP2A 1NW1A 3ZM9A 2C6TA 5IQDA 1H1RA 3ODZX 2CCIA 3BQCA 3ZLSA 3FBVA 5M06A 3RWQA 1GZOA 4M97A 3QHWA 2WMRA 4U41A 5CYIA 2WKMA 4BCFA 3GCPA 1XBCA 2OZAB 2HW6A 3KU2A 2GQGA 4FIGA 4N0SA 2XRWA 5HI2A 1ZY4A 5AIRA 5JT2A 2XNOA 4IAKA 3ZHPC 1ZXEA 2W96B 2WXVA 4LRKA 3VC4A 1LP4A 2JLDA 3MTLA 2VTLA 2JDVA 4F1OA 3PIXA 3O17A 4BDHA 4K33A 4BZOA 3ANRA 3VQUA 4IFGA 2J5FA 2O0UA 2W9FB 3FY0A 4IWQA 4FSMA 2F2CB 4KIKB 3L8XA 3KF4A 4YJRA 1URCA 5IU2A 3VUTA 4GUBA 2QLUA 2PHKA 4EZ5A 4YO4A 3OOGA 1H1PA 3OVVA 4C37A 4DTBA 3W2QA 4FNYA 4QMTA 2OZAA 2EXMA 1FINA 5HTIA 2HW7A 4QP9A 3RPSA 1JSVA 4OTDA 1GJOA 4V01A 3QLGA 4EKLA 5KCVA 4AAAA 3DDQA 5ANKA 3P79A 5FTGA 2J2IB 4XYFA 4WG5A 3NUSA 2BAKA 4RLLA 3WARA 1SNXA 1GZ8A 3VBYA 1PF8A 4U3YA 3UYTA 5FRIA 1Z9XA 1XHAA 4G5PA 4QMZA 4Y83A 1M14A 3WF8A 2C3KA 4ALVA 5M44A 3OC1A 2F49A 5EYKA 4RBLA 3DXPA 1L3RE 4PMMA 1YWRA 2X81A 3V01A 2OIQA 3HZTA 2R3KA 3MS9A 3R7VA 4FL1A 3O7LD 2PVJA 2W4OA 4D2WA 2Q83A 2PTKA 4CCUA 4XEYA 2H34A 2VO3A 2GS2A 2PMIA 4XRJA 4KIQA 5IEVA 4O82A 4BIEA 4ZMEA 2FYSA 4O0XA 5C26A 4E6DA 1KE5A 2GSFA 3ZUUA 1YWNA 4EYJA 1DAWA 4B8MA 2WU7A 2WMWA 1PMEA 5I9WA 3RMFA 3SLSA 4C36A 3CIKA 2YWPA 3RBWA 3FUPA 4RIWB 5L6WL 2O63A 4C62A 3WZDA 3VBWA 3ZFYA 3CXWA 3I6WA 4XBRA 5E8UA 4ZY6A 5ACBC 3F9NA 3NCZA 4FTOA 2G15A 5KX8A 5E1SA 5E1EA 4FTIA 3FV8A 3RPRA 1Y8GA 4C4EA 4EWQA 3BV2A 2C68A 3R7UA 5AR3A 2RFDA 2C1AA 3NW6A 4XP3A 4B99A 3ELJA 3VO3A 4I6HA 3QALE 4PNIA 3EQPA 3H9FA 3QF9A 5DFPA 5LARA 4NCTA 3LQ8A 2XKCA 3OWLA 3OWPA 3IW5A 2VN9A 3M1SA 3G33A 2BR1A 5DRDA 3MWUA 4L6QA 3WF7A 3ITZA 1HCKA 1PXJA 3DA6A 4DN5A 2YIWA 4APCA 3I4BA 3UODA 3NAYA 2UW6A 4I5CA 4Y5QA 4RJ3A 3BU3A 4GYIA 2G2HA 3CTQA 4BI0A 4E4MA 4M13A 3ZO4A 2O8YA 4X3FB 4BGHA 4IX6A 2R64A 2FSLX 5EW3A 4EH3A 3I81A 3MGYA 4MHAA 2X4ZA 3JR1A 4EKKA 5DNRA 4QMSA 4ANLA 2UW8A 4FR4A 2C3JA 3RK7A 5HD4A 5E8ZA 1WAKA 5IISA 2WB8A 1JKKA 4FGRA 3S2PA 4I94A 2X9FA 5AV4A 3OWKA 2VNWA 4C33A 2ZMDA 4C4JA 4S33A 4X2FA 3OBJA 5CT7A 1ZYCA 1GAGA 1O6YA 5DI1A 5C9CA 3NYVA 3FI3A 3BYUA 4DH8A 5F20A 3COHA 3A62A 3UO4A 5LVOA 4YZ9A 2WQBA 4AZEA 4RJ7A 4YJTA 3IW4A 3NVMB 2G1TA 2FB8A 4W4XA 3CEKA 3FZOA 4ZXTA 5K0KA 4QTCA 4AT3A 2JIUA 3EQIA 3F6XA 5KBRA 4NUSA 4YR8A 5CAVA 3QAME 2WHBA 2WMUA 1YKRA 4DH7A 1ZAOA 4EOLA 3JPVA 2Q0BA 5AAFA 4RIYA 1OIYA 2OICA 3OCBA 5CEOA 5LMKA 3DTWA 1WZYA 2ITPA 3DZQA 5AR2A 5IDNA 4KB8A 4R8QA 3R8LA 1W84A 4GYGA 3TTJA 3H0YA 1Q4LA 4YLJA 5ETFA 4FIFA 2R0UA 2VTRA 4GIIA 4JXFA 3ULIA 2P3GX 1OVEA 3EYHA 4PDPA 4PMTA 5HX8A 2GQRA 3ATSA 4JBQA 3R9HA 4R78A 3BWJA 3GC9A 1XH6A 4CFVA 4E3CA 3KFAA 4TWNA 2YM8A 2VWXA 4NTTA 4Q5HA 4W4YA 3W2OA 5J5SA 4WT6A 5TKDA 3I0OA 3FHIA 1R0EA 4F7SA 5CAOA 3WF6A 5LCKA 5HO6A 3WZKA 4CGAA 3R1YA 4O0VA 3SC1A 4ZIMA 1OECA 4M14A 3TXOA 4Z16A 3JVRA 4FG8A 4GK3A 3RZFA 3FDNA 1H24A 5KE0A 2IVSA 3D7TA 3ZFXA 3D15A 4A7CA 5L6PA 3PDTA 1U59A 3CJFA 3KRJA 3ZYAA 4H3PA 3LFBA 4O81A 4HJOA 2XCHA 1WVWA 1XO2B 1U54A 3F7WA 4FVRA 2ESMA 4FYNA 4HGSA 3UMXA 3F3ZA 2WO6A 4BYIA 3GC0A 1J7IA 2QO2A 2ITUA 5IUIA 4GG5A 4U7ZA 3NUAA 3II5A 4FVQA 4LM5A 2BMCA 3F88A 3ORTA 2JGZA 1ZRZA 5T6KA 2CPKE 5DWRA 2BTSA 4CZUA 4IJPA 3EJ1A 4EONA 4IVBA 4U43A 2JBPA 3EFLA 5DVRA 5E7RA 2DQ7X 3AT4A 2VTJA 4FSQA 3I7CA 4CG8A 3Q6UA 4ANMA 5LWNA 3R28A 5HVYA 3U6IA 2UW7A 2UZDA 3V3VA 4OTPA 4KSQA 4AACA 1H00A 2GS6A 4RIXA 2DWBA 3R9NA 4CCBA 2V62A 3S4QA 2ZV8A 4D4VA 1Q8TA 4YZNA 4MXYA 1CMKE 3ALOA 4IZYA 1YVJA 1MRVA 4RJ6A 2YM4A 1ZOHA 4J97A 4M0ZA 3Q4CA 3S3IA 3O7LB 5CQWA 3WI6A 4AFEA 4FTCA 1UNHA 3QZIA 5F1ZA 3QX2A 2BILB 4BCJA 2F7ZE 2PZPA 3AOXA 3DAJA 3QZFA 2UZEA 4GFMA 4AWIA 4BKZA 2B7AA 2C6DA 5EDPA 2CGUA 3QQJA 4H05A 4B0GA 3QRIA 4YURA 2QOOA 3LM5A 3C4XA 2CN5A 2W06A 5AP2A 4AXAA 3RCDA 3MV5A 4UXQA 4A07A 3GFEA 5CU6A 4GV1A 1UV5A 3FXZA 3LMGA 2XIRA 5CNOA 4CQEA 2A4LA 5C8KA 3DQWA 4YZMA 4DGOA 4PWNA 3ATTA 3HL7A 2VTHA 3NNVA 4FIJA 3F66A 1CSNA 3FPMA 5CVFA 5HORA 1DI8A 4IAZA 3HECA 3LFCA 3ZZEA 4U97A 5IH5A 1KSWA 3AD5A 4S34A 3RKBA 4BTKA 3KREA 3MFRA 2XKFA 4DH1A 1AGWA 3P7AA 4JDHA 2YCRA 4QOXA 2HZ0A 3PY1A 4E7WA 1SVEA 3MI9A 1G8SA 2O64A 4P90A 1M2QA 2W1DA 3KC3A 4OR5A 4RGJA 3ZDIA 4DEEA 2OBJA 3KB7A 5KZ0A 5L2IA 3GB2A 4FC0A 2C6OA 4UYAA 3TIYA 4A9SA 1PW2A 5D7VA 4QP7A 4RJ8A 2C5OA 3AMAA 4MNEB 4O0YA 1PMNA 5FP5A 4V04A 3R9OA 4ASEA 4QMUA 3IDBA 5HNBA 4IXPA 3A7HA 4S32A 5JQ5A 2EWAA 3BPRA 3SXFA 4X21A 4L68A 3F7ZA 4APPA 2FA2A 3GC8A 2UZNA 3F5PA 3GU7A 4FF8A 5HVJA 4FUXA 4RX8A 1OKWA 3M42A 4E4NA 4N57A 1PXIA 4QMWA 3UTOA 4W4VA 3KRRA 5AV2A 3TJCA 3IECA 4UWYA 5JQ8A 5ETCA 4D28A 3EZVA 4XOZA 2C6KA 3UVRA 1Q8WA 5JGAA 4FMQA 4MBLA 5AAEA 4GMYA 1ZWSA 2R3OA 5CF5A 3DS6A 4KA3A 4BDEA 5KO1A 4EUUA 4YMJA 1UA2A 2PVLA 3I5NA 3QX4A 3P86A 3EKNA 1Q5KA 5IH6A 4X2JA 2CGXA 4S31A 3QUPA 4IM2A 4BFMA 4CRSA 4CFNA 5A4QA 3BI6A 5CSWA 2W1FA 2JIIA 4F7JA 2VTPA 2JEDA 5J79A 5A4EA 5GZAA 5IA3A 4BYJA 3UOJA 4O7WA 1XH9A 5EKOA 5B7VA 4LG4A 5H2UA 4O86A 4NEUA 4FIIA 4EOPA 2BRNA 4IBMA 4G6NA 3V6RA 3MVHA 3DOGA 5LJJA 4XCUA 4I0RA 2YLFA 3DPKA 3IK3A 3QTZA 3Q5ZA 5FEEA 2V7AA 2XYNA 3QCYA 5CU3A 4CT1A 2ITZA 2G9XA 3TUCA 5EW8A 4JG8A 1KOAA 4CFXA 1OL5A 3AMYA 4DFYA 4MF1A 3Q9WA 4MX9A 2KULA 3ZU7A 4FKVA 4IVCA 4F7NA 1L8TA 3D0EA 4OAVB 3QC9A 1W82A 2ZAZA 2J9MA 4NFMA 2RKUA 2IW9A 5DEYA 3P1AA 4FEQA 4FODA 3BHTA 4JR3A 4IJ9A 5HZNA 3DY7A 3PPZA 3OCTA 4R7IA 3CPBA 3IKAA 1H27A 3A7GA 2CCHA 2J0LA 2OO8X 3DBQA 5I3RA 3RPOA 3FXWA 2PZIA 3QYZA 3UO6A 4MXAA 5I5ZA 1FBNA 1W8CA 4D1SA 4F64A 4DHFA 4QQ5A 2FH9A 3KMWA 1ZLTA 3PWYA 2OKRA 3BV3A 4GCJA 4KINA 3OMVA 3R73A 1WMKA 2X7GA 4E6QA 3NVKI 1QPDA 3Q32A 3TKHA 2J4ZA 4KWPA 4L8MA 4L42A 2C6LA 4LL0A 5IUHA 2OLCA 5CX9A 3TZMA 3P9JA 3HV5A 3LJ0A 4TZRA 3MFSA 4GT5A 2B4SB 4JIKA 5JZJA 2XK8A 3PY0A 1W7HA 3V5LA 3QA0A 3NZ0A 3RGFA 2B53A 2XNMA 4F63A 2I40A 4ANOA 4RFYA 3QRUA 2X2KA 4I22A 2GHMA 4HW7A 2E9UA 4AGDA 3NUPA 3ZOSA 3QTSA 3TNIA 2CLXA 4RX5A 3R8ZA 3WBLA 3C5UA 5FG8A 2ZDUA 3MFTA 4BDCA 3I1AA 3SKCA 2BRMA 1Q3WA 2BCJA 2HWOA 2WTIA 5E8XA 5HG7A 3PSDA 4RWKA 3L8VA 4AF3A 2V22A 4BCGA 4ASZA 4C4FA 3BHHA 4ITIA 3KRWA 1EH4A 4NT4A 1YDSE 3QL8A 4OTQA 4F6SA 3G2FA 3P08A 4FI1A 4F9YA 2QCSA 4YTHA 3ZRKA 4OBQA 3TT0A 5M56A 3F5GA 3WZJA 1KE7A 2HYYA 3Q2MA 2DYLA 2QOIA 2UVYA 3BE2A 1S9IA 3SAYA 3QU0A 1JOWB 5FQDC 2JIVA 5AP5A 3HAMA 4M7IA 4DF3A 3MYGA 5CAPA 4MBIA 4G3CA 4IWOA 4PTGA 4C58A 4EI4A 4UALA 2OJIA 5CQUA 3H9OA 3SDJA 3NS9A 3PA4A 1J1BA 1RDQE 2IVVA 2RGPA 3IDCA 4Y46A 3G6HA 5D10A 1XH8A 3C0HA 1UU7A 2UW5A 4OW8A 4A4XA 3A4OX 4D2SA 4F65A 1HCLA 1JQHA 3SG9A 3GCSA 4HNIA 3K3IA 4FV1A 4ZJIA 2VWUA 3R01A 4TW9A 3A7JA 2J0KA 5BVOA 4DGLC 4M68A 1Q8UA 1JWHA 3TDVA 2BZIB 1LEWA 3FAAA 3E63A 5BMSA 2VX3A 3KVWA 4RG0A 1NVRA 5HBJA 1XH5A 3A8WA 4HPTE 1T46A 4O22A 5BQ0A 5CEQA 4M67A 5LVNA 3DKGA 4E20A 5ACKA 5JGDA 4IADA 3ROYA 4L44A 3MH0A 1BI7A 3Q3BA 4L7FA 1GOLA 3NDMA 2E9NA 1YOJA 2B1PA 3MB6A 4FV9A 1OBGA 3G51A 3LAUA 4JNWA 4X6RA 4CKRA 2ITXA 3SRVB 2JDOA 4R7BA 5H8EA 4O6LA 4X0MA 4EL9A 5AWMA 3FLYA 4QP4A 3UQFA 4YNOA 3JS2A 3QTXA 4GJ3A 3ZRLA 4HOKA 3A99A 5CSXA 5L2WA 1M7NA 4G9CA 2UW0A 4I20A 3LQ5A 4FG7A 4BCQA 3RPVA 2IZSA 4A4OA 1WBOA 4NM0A 3VRYA 4EZ3A 2Z7SA 4LUDA 5CF8A 3DXQA 3G90X 3COMA 4C2VA 4P5QA 5I9ZA 3BLHA 4U81A 5CAUA 3G6GA 4HVSA 2ZV7A 2HY81 3SXSA 4FOBA 3KXMA 2IZTA 5DG5A 4I23A 1PJKA 3SRVA 3P7CA 2JKKA 2WQNA 4Q5EA 5EOBA 4DFUA 3G9NA 4QYGA 3QD4A 5EM7A 5CSVA 1JKSA 2HIWA 4ANSA 5IEYA 2Z02A 3MVJA 2V5QA 1TQIA 2OZOA 3LXPA 3SOCA 4AW0A 3CQWA 2LGCA 2PZ5A 3BGQA 2Q0NA 3ORPA 4RZVA 3PLAE 5G1XA 3UC4A 4EYMA 3N51A 3EN6A 3Q52A 4QP2A 3KK9A 5FTOA 4DYMA 3U51A 4H3QA 3QUDA 1GIIA 2VUWA 4MVFA 4JRVA 3QRTA 4EZ7A 2VWVA 1XR1A 4FKGA 2B9JA 3FKNA 4YBJA 4D9UA 2JDTA 3FSKA 1PMVA 2J7TA 3LFFA 3B8QA 3VS0A 1Q24A 3HUBA 2WGJA 3PJ2A 4FEVA 4IIRA 4ZSJA 3CTJA 3EQHA 5DYJA 3ROCA 5A3XA 4R5YA 2XJ2A 5C1QB 3QCSA 4RRVA 4E5AX 2AUHA 3O8UA 4F9CA 3NRMA 2QQ7A 4E4XA 5AP7A 1U46A 4C3RA 5IQCA 3RJCA 4AGCA 2I0VA 4LMNA 4PPBA 4FE2A 4WBBB 2YACA 4E6AA 3NUNA 4WG3A 4BY9E 4XX9A 4AE6A 1QPEA 4JX3A 2R5TA 1ZARA 1IG1A 3PPKA 2CNUA 4EOSA 2YJSA 2GS7A 3ZSIA 5IF1A 4C34A 3HA6A 2IZUA 4KS7A 5LXMA 3AC3A 4LFIA 3NYOA 3QWJA 2W9ZB 5EI8A 5IQGA 3UG1A 4GL9A 5EHYA 4EH5A 4AA5A 5AX9A 1OGUA 1Q97A 5BYZA 3D5UA 4RLKA 4IH8A 1W0XC 4UY9A 4KKEA 3PXFA 2FSTX 2W1GA 4K6ZA 4BIBA 3EYGA 3FLQA 4LRJA 5J7BA 1SYKA 3WYXA 3A7FA 4PTCA 3S00A 4FTUA 4JRNA 2BVAA 4MBJA 2X0GA 4LOOA 5AM6A 3CPCA 4CMTA 2HWPA 1UU8A 3BWFA 3DK6A 2ETMA 4IZ7A 4FNWA 2IW8A 4F08A 5HLWA 4MD8E 4E93A 2Y6MA 2QOQA 4ANBA 4JI9A 4W4WA 2CHLA 2HZNA 2UZVA 3SOAA 4BL1A 3BX5A 3EQFA 4IACA 2WNTA 5EM8A 4PDYA 3E87A 3DNDA 2YJRA 3BBWA 3FMNA 4PL3A 4FT7A 1OKYA 4XNEA 4UMUA 5CTPA 1KE6A 4ARKA 3VUIA 4W8DA 3HDNA 2PZRA 4WRSA 3TJDA 4F0GA 1URWA 5AADA 3G5DA 2V0DA 3EQRA 3POZA 1K9AA 3HNGA 3UIXA 3EWHA 4WSQA 5H3QA 1GIJA 3LOKA 3OY1A 5M09A 3WYYA 3TUDA 2OWBA 2W5AA 4YPDA 5AP6A 2QC6A 3DZOA 4RSSA 2VWIA 2IN6A 4BICA 2Y8OA 2B0QA 3ZCLA 3IW8A 4UZDA 3PJ8A 5TO8A 4AT5A 1AQ1A 2JKOA 3VUHA 2HZIA 3MPMA 2XNEA 3OROA 5KMMA 4DBNA 4RQVA 2X39A 2ETKA 3GBZA 4FV0A 4FZ7A 4F1TA 3EQDA 4P7EA 3RNYA 3TTIA 5L8JA 4F0IA 5GZ9A 4KUJA 5CI6A 4XS2A 3ORLA 3R8PA 2B52A 5CALA 2C0IA 3E3BX 4AN9A 4HGEA 4UMTA 4Q9SA 4ERKA 1P4OA 2C3IB 4C3FA 3ET7A 3BKBA 3V5QA 4W9WA 4GKHA 1Q61A 3BHUA 3FC1X 4IVAA 4BC6A 4I5HA 4QMVA 4C38A 5DHJA 4K18A 3VAPA 4PY1A 1R0PA 4MAOA 4IB5A 4BVUA 3U9CA 3NPCA 4MKCA 5EG3A 5EH0A 5A14A 4R1VA 3DFCB 4PP9A 2QO9A 5K4IA 5AUXA 5JFVA 3OHTA 5BVFA 3LW0A 2EB2A 5AMNA 4QD6A 3C9WA 5IQBA 2X8EA 3KXNA 3OBGA 4FIEA 2I6LA 4DH5A 3K2LA 3LFSA 5A9UA 3FMHA 4IWDA 4J8MA 5BX0A 4QMOA 1OIUA 3MSSA 5BPYA 2EUFB 2YCSA 1Q8ZA 3DAEA 3OY3A 3RHXA 3UOLA 3RI1A 3VUMA 2GNLA 3KMMA 1P5EA 4FTTA 2NNWB 4EH7A 4QYEA 5AP3A 2VD5A 4TWPA 3GVUA 4I3ZA 2CKEA 3CD3A 5LVLA 4XV1A 2YIYA 4NIFB 3BE9A 3AXWA 3LXNA 1ZMVA 3V5TA 1Y91A 2I0YA 4RVKA 5IH4A 4BWPA 4PQNA 5HQ0A 3AQVA 4YTCA 5I0BA 2REIA 3H3CA 4I24A 4YC3A 4YJQA 2NRUA 2PL0A 2JAVA 3VS3A 3HRBA 5HOAA 2WTKC 2X2LA 4LMUA 2J0JA 4C0TA 5L2TA 5DBXA 3ULZA 5HBEA 5AUWA 2VV9A 1W83A 4YLLA 3R9DA 4ITHA 4PDOA 4DCEA 2P0CA 4EHVA 4KIKA 5FGKA 5CZIA 4PMSA 4C3PA 1H0VA 1UWJA 2Y7JA 4FVPA 1KE9A 3P23A 3TCPA 3FI4A 1Q8YA 3LCTA 3QKKA 2X9EA 2QR8A 4AT4A 3MESA 2E9OA 1REJA 3R2YA 4LL5A 4QQCA 2NRYA 5CENA 4BDIA 4H1JA 5GHVA 5IQEA 2QU5A 3R7OA 1H26A 4TXCA 3TV4A 3UMWA 3WILA 3LMIA 2ITNA 2QO7A 3DBDA 4UMPA 3A60A 3H30A 4DTKA 2BDWA 4KS8A 4EWHA 4XLIA 4HYHA 3FQEA 1ZYJA 3DGKA 4IWPA 3MH3A 3PVBA 5EYMA 3LHJA 2OJ9A 3GCVA 1APME 4YJNA 3BQRA 3Q53A 4WSYA 1YXVA 2E9PA 3JVSA 4ANQA 4D4RA 2QNJA 4CFWA 2VU3A 4I5MA 4FKRA 3WOWA 2J6MA 4RWIA 3FYKX 4UMRA 3FPQA 4YHJA 4Y5HA 4XOYA 4BKYA 4F7LA 1IAJA 2ONLC 3IGGA 5J95A 2XCKA 4G9RA 1BMKA 2OXYA 3R9RA 3R22A 1PKDA 3SGCA 5L3AA 4V05A 1B38A 3UPZA 4DGNA 4A9RA 5HE1A 2WTDA 3LXLA 3K5UA 1FMKA 4JDJA 1SVHA 4RIWA 3C1XA 4FX3A 2Y9QA 4EC9A 4EHGA 5AUZA 3V8WA 3KA0A 3FEGA 4PF4A 3E8EA 3UP2A 5A54A 5DR9A 4HPUE 4GEOA 3GXLA 3FZPA 3ZFMA 5J9LA 3C0IA 1E1VA 3F3VA 3H0ZA 4FEWA 3QGYA 5L4QA 3AD6A 2OSCA 5E8SA 3UJGA 1OITA 4DFBA 2BHEA 5LOHA 5M51A 3NW7A 2X6EA 4HVDA 1G3NA 2WQMA 3ORXA 2BAQA 4IX3A 2CGWA 3VS2A 4ZSEA 1BUHA 5GJFA 4DT8A 2OK1A 4XG9A 2R3JA 3Q4ZA 4B4LA 5HIBA 4FT9A 4X3FA 3BHVA 5CS6A 3TV7A 1Z57A 2CN8A 4DH3A 4CLJA 5IZFA 2IO6A 3CC6A 4JG7A 4YU2A 2UZTA 3UNKA 4OBOA 4RJ5A 3HV7A 3ZXZA 5EHOA 4OTWA 2OU7A 2UW9A 1ZYSA 3GGFA 4QRCA 3DK7A 1WBPA 2XNPA 4P5ZA 3W2RA 3KXXA 3A7IA 3CTHA 3HYHA 2VNYA 4G3EA 4DEHA 3TM0A 4FL2A 2QKRA 2B9IA 3LLAA 4XG4A 5KUPA 4CTBA 1H01A 3QHRA 3BYSA 5EHLA 4AE9A 4FKTA 3O8TA 4IQ6A 4O6EA 4QQTA 3TKIA 3EN5A 4HCUA 4XG3A 1TQMA 4MH7A 4L3JA 1UU9A 4PV0A 4ZTNA 3TNWA 4C4GA 3R2BA 4HZRA 5JFSA 5CSHA 3ORKA 2PMLX 3SW4A 2OJFE 4NJ3A 3ZBXA 1RQQA 1VEBA 4MXZA 3LVPA 4U40A 3N4UA 1JAMA 2OXDA 2YM6A 2VX0A 3ETAA 3SD0A 4JT3A 3AD4A 4GG7A 2H9VA 3NR9A 4L00A 4BDDA 2IW6A 4EK4A 1Y8YA 3V5WA 3MPTA 3Q9XA 1U5QA 2Y6OA 5T3QA 4FICA 4L3LA 1VZOA 4L43A 2FGIA 2FSMX 3EFJA 3CY3A 5HCZA 4DLJA 5KMKA 5HO8A 4FZAB 2QG5A 2XK3A 4IB0A 4OTFA 4OLIA 4RVTA 3ZC5A 4DLIA 3SVVA 3GCQA 4MXOA 4IC8A 4FSNA 4RC2A 2IVTA 3LJ1A 4DGGA 2FSOX 3OTUA 3PIZA 2JFLA 1OL1A 1PXMA 1I44A 4NH1A 4L53A 3E7OA 3NX8A 3QTIA 4KKGA 2WMAA 3L9NA 3RM7A 5BNJA 4JX7A 3ORMA 3NYXA 4OTGA 5FEQA 3CLYA 3Q9YA 1WFCA 2A27A 2XKDA 5IEXA 3F3UA 3PLSA 5K0XA 3HMNA 3KN5A 1TQPA 2RSVA 2WELA 3PWDA 1FMOE 5C27A 1AD5A 3UIMA 1M2PA 3JUHA 4O0WA 2WPAA 5E8VA 3LFDA 4XG7A 3AC4A 3ODYX 2UVXA 4K2RA 5GJGA 3UYSA 3IOPA 3ZO2A 4ERWA 4ZZNA 5AFVA 3PJCA 2YERA 3THBA 4MCVA 4Z55A 1A48A 3U4UA 2VWZA 2XRUA 3PIYA 1CKPA 2Z2WA 4RWLA 4TNDA 1ZZ2A 3MIAA 2WTKB 4K1BA 4O2PA 3L8PA 4ALUA 4D0WA 4QMNA 4NK9A 2F57A 4GT3A 3EH9A 5HU9A 3V5JA 4X7QA 1CTPE 2B9HA 2R2PA 1LPUA 1YOMA 2W5HA 2EVAA 4GU9A 4QYHA 4UB7A 2C30A 4C02A 5HG5A 2VTSA 3LLTA 4D5HA 1QCFA 1GNGA 3D14A 4FV6A 3AGLA 2V55A 3NEWA 1UKIA 3FMKA 4A06A 3O96A 4H3BA 3UQGA 4QTAA 3T3UA 4WNOA 3RAKA 4HCTA 3UNJA 4KBCA 4D1XA 1IAHA 2W5BA 4M66A 4F4PA 2WMXA 3FXXA 4BCMA 2GNFA 3EL8A 3QKMA 1KOBA 3MTFA 5HESA 4DEBA 3LMHA 3KVXA 5KKRB 1ZY5A 2WTWA 3E8NA 1BL6A 2ZJWA 3NIEA 3IG7A 4RJ4A 3FLWA 5AEPA 1O9UA 2AC5A 4EJNA 2UZOA 4FA2A 4EORA 4XV9A 1PXOA 4D4YA 2XK9A 4IAYA 2XK7A 4CZYB 3GI3A 4ZTQA 3SG8A 3FLZA 4ZJJA 4FKWA 1JPAA 4LOQA 1DI9A 1IA8A 3PPJA 3EL7A 5HLPA 3FI8A 2WQEA 4I93A 1W98A 4YJSA 2BIYA 2WMSA 2VTMA 3DTCA 2GTNA 5LVPA 1BYGA 1BL7A 4CRLA 5IA0A 4MQ2A 3QXOA 3LIJA 4R5SA 3MJ1A 4U42A 4YJVA 4M84A 3CSVA 3W8LA 4PTEA 5K5XA 3S0OA 1OPLA 3E62A 5FDXA 5KHWA 5DLSA 3FL4A 1J7UA 3QTRA 2GNJA 3UQCA 3C13A 1NXKA 5FTQA 4BDFA 2JKMA 5AUVA 2B9FA 2IZRA 4DEDA 4O7VA 4ZTRA 2WD1A 3AG9A 3EZRA 4LGDA 2VTAA 4GVAA 4HYSA 2A19B 3OXZA 5EM5A 2OI4X 4MNEA 2Y4PA 3WIKA 4DITA 4NM3A 4QQJA 1PXPA 4EH9A 5ICPA 5H9BA 4DTAA 4CSVA 2R3NA 3PA5A 3ZSGA 2R3PA 5HTCA 2ITOA 3VUDA 4DC2A 2ONLA 1Q99A 1WBWA 4O0RA 2PUPA 2GFCA 1ERKA 2ITWA 3RM6A 5LVMA 2BHHA 3FI2A 4ZS0A 1FVTA 4I41A 2ZB0A 4IX5A 3UDBA 1P2AA 1JKTA 2A2AA 2C6MA 4MNFA 3ZO1A 3QC4A 4IMYA 5DN3A 4O7NA 4E26A 3PXZA 1ATPE 3LFQA 2OH0E 2XM8A 2PE0A 1YQJA 4D4SA 4QTBA 4Q9ZA 4D9TA 1WBSA 5AP0A 5E8TA 2PK9A 3PE1A 2CJMA 5K3YA 4TL0A 5E9EA 5AA9A 3PSBA 3HMOA 4TY1A 5AR7A 2C6EA 4DG0E 3KGAA 4E6CA 3EQCA 5JFXA 5L6OA 3EIDA 5DRBA 3E5AA 2IWIA 4O0TA 3M2WA 4ZEGA 4BGQA 1YXSA 2PVMA 2YIXA 1K3AA 4G2FA 4XBUA 2OJGA 4ACMA 4ZLOA 2BFXA 3Q2JA 1FVVA 4BTMA 5J1VA 2PE1A 1PXKA 2GHGA 2I0HA 3FZSA 3IDPA 4ZSLA 3IW7A 3C5IA 1FGIA 4BB4A 2YAKA 1SMHA 3KK8A 3TEIA 3KL8A 2UZLA 2W4KA 3ZBFA 4BCKA 4CYJA 4RWJA 4E5BA 4EOIA 4XH6A 4EK8A 4X6QC 3IO7A 4FV5A 1KV1A 2JITA 2HELA 2YIQA 4XHKB 2Z60A 1BKXA 4TYIA 3U55A 3RK9A 1DAYA 3UPXA 4ZY4A 1GY3A 2YDKA 4FGBA 4TYHB 3TZ9A 4J52A 4WUNA 4E73A 5CVGA 4MQ1A 1YI6A 2GNIA 3GOKA 3MH2A 4KABA 4QNAA 4MYGA 4OUCA 3B2TA 4HNFA 2R9SA 4RFZA 3GFWA 4QMYA 3P5KA 4EOQA 3IOKA 5JEBA 2XK6A 2C5YA 2WIPA 3HV6A 4LUEA 3EMGA 3JY0A 4EOKA 2VTTA 3SQQA 3C51A 4FSYA 3H10A 4IDVA 4R3CA 2P55A 5A6OA 4TT7A 2G2FA 5L8KA 5HNIX 2YM3A 1A06A 2R3HA 3O71A 3PJ3A 4KRDA 4OBPA 2CSNA 4QP3A 4WIHA 5HG8A 2XIYA 2ITYA 4UWBA 4ZTSA 4CYIA 3ZUVA 1F0QA 4F99A 3FL5A 4PX6A 2O5KA 4MF0A 1H1QA 4CFMA 5HKMA 1STCE 4LV5A 3LXKA 5ANGA 2VO0A 3W2SA 4Z7HA 5IDPA 5CF6A 2ZMCA 4R3PA 3BU5A 3JY9A 2R0IA 1H07A 3BBTB 5AV1A 1QPCA 3R21A 3OTVA 4JQ8A 4R1YA 5KMOA 4IM0A 2XS0A 3QGWA 1OM1A 4FOCA 5C8MA 2GTMA 3FLSA 1E9HA 2R3RA 3QQUA 5DR2A 4ASXA 5GIPE 4JDKA 5CY3A 4FT3A 2XA4A 3ZO3A 1LEZA 3OG7A 4XMOA 4CV9A 4NKSA 2HOGA 3PZHA 3W10A 5HGIA 4GH2A 3D5XA 3DCVA 4J98A 3RK5A 3W8QA 3QZGA 5AAGA 2W1EA 2XVDA 2C0OA 4LV8A 2W1IA 3C4WA 2W0JA 5CF4A 3ZS5A 2HAKA 3FWQA 5TF9A 1OI9A 5FBNC 2EXCX 4YHTA 5DH3A 4ZTLA 3HUCA 5M57A 2HY0A 5IQIA 3LFNA 4BIDA 4O84A 5HIEA 4I6FA 4C4IA 3LCOA 1XH7A 2F7XE 2WU6A 3QXPA 2YABA 3NCGA 4YZBA 1ZYLA 3RALA 4CQGA 4C2WA 5CU2A 2QI8A 3COIA 4UEUA 2BZJA 3NNXA 4JL9A 2W05A 3G0FA 3NWWA 3SXRA 3A61A 3WZEA 4FSRA 3QQGA 4MXCA 1Q41A 4L67A 4YJOA 4U45A 4M69B 2ACXA 3O23A 2RL5A 4RFMA 3ZXTA 2YEXA 4EOMA 2QOLA 2W1HA 4FIHA 4C57A 2UZUE 3MY1A 4R6VA 2OF2A 2WTJA 1JNKA 4FKOA 4MEDA 2PU8A 3I79A 4O7SA 4B6LA 4NSTA 3TNQB 2XZSA 3F2NA 3HP2A 4IAAA 5DE2A 3FKOA 3RAHA 5M4CA 1MQ4A 3LZBA 4WKQA 4DINA 2BKZA 2B55A 2CGVA 3QBNA 4ONAA 4AG8A 2VAGA 3HEGA 3GNIB 3AC2A 3W33A 3PVUA 1YXTA 3BCEA 4G1WA 3GU5A 4FBXA 5E92A 3TL8A 3GENA 3E88A 2XBAA 4FSUA 3VS7A 2YN8A 2PVHA 4YZDA 4FTLA 4BKJA 3ID6C 4O7LA 4AN2A 4E1ZA 4GK4A 3FHRA 2BFYA 1M2RA 2Z8CA 2F2UA 5F94A 3UNZA 5ETAA 3QD3A 3KCKA 3KKVA 4CMUA 4L9IA 4UBAA 4D2TA 3R7EA 5EW9A 3FZTA 2PMOX 5AP1A 4HVHA 4JBVA 5HIDA 3LCSA 3ZEWA 3AMBA 4S2ZA 1F5QA 4KIOA 1QMZA 1M7QA 2YM7A 1E1XA 5CNNA 5EKNA 1PYEA 1H28A 4Y73A 4CEGA 5JKGA 1XQZA 5HD7A 3VBTA 4PDSA 1JVPP 3OEFX 3UOKA 4N70A 4FZDB 2OIBA 1QPJA 3KQ7A 3MJ2A 3QQLA 2Z7QA 5KMLA 1H08A 2GMXA 2R7BA 2O3PA 2QOCA 5GNKA 4IAIA 5IA1A 3DDPA 2FUMA 3TWJA 3CR0A 4ZK5A 4U3ZA 4EHEA 2GPHA 3TV6A 4QYFA 4AZTA 4GU6A 3PXYA 3QRJA 5J9ZA 4LRMA 4OTRA 3K54A 4YNEA 1VYZA 4RA5A 4JJRA 2ITQA 3W55A 2BUJA 3E8DA 4JQ7A 4AZVA 4BR3A 3MW1A 5D11A 2PE2A 4EK6A 3C0GA 1O6LA 3LJ2A 1ZYDA 2YA9A 4KD1A 4CNHA 3QUEA 5CEIA 4L01A 4I0SA 3G0EA 3U9NA 3R1NA 3DFAA 5JH6A 2ITTA 3R6XA 4FV7A 4BI2A 3HLLA 5D41A 3COKA 3KY2A 3NMUF 4O2ZA 4E5WA 4Z3VA 1OZ1A 5M4UA 2PWLA 4P2KA 2IJMA 3VS4A 4BBFA 5DIAA 2C3LA 4DBXA 3RWPA 4AGWA 2UUEA 3GCUA 3QTWA 3I6UA 3KXGA 3C4EA 4UXLA 4BCOA 4OTHA 2YZLA 3F69A 2ZOQA 4QMQA 4GVJA 4CD0A 3L9MA 1Y57A 3GU4A 4BN1A 3PXKA 5TT7A 2JFMA 4NWMA 2QR7A 2WEVA 3LM0A 3LFEA 4IW0A 3VF9A 4KAOA 5JRSA 3BYOA 4FYOA 5EQEA 3R30A 4A9UA 2O65A 3OW3A 3O2MA 4IANA 2OW3A 1OPJA 4GRBA 2P33A 3VW6A 5HU3A 5LMBA 1F3MC 5LMKC 3FY2A 4BHNA 4O7TA 5EM6A 4ACCA 2C6IA 3NUYA 1MRYA 3A2CA 4V0GB 3FMEA 3CS9A 4I5PA 4UV0A 5AUYA 1GZNA 1H1WA 2OH4A 4IC7A 4FTAA 3D5WA 1RW8A 4ZAUA 4RC4A 1MP8A 4H39A 2A1AB 2AYPA 3P78A 4O1PA 3PZEA 4XG8A 3L9PA 2XIZA 2XK4A 5AUTA 5M4IA 4DA5A 2BIKB 4ZJVA 4I6QA 4RQKA 2R3IA 4LI5A 5ANEA 5AUUA 4IAFA 3V8TA 3Q4UA 4ANNA 5BUEA 3E64A 4ZTMA 2JBOA 4DEIA 4WNKA 4C8BA 2RFEA 4YTFA 4F6UA 4I4FA 4RMZA 2IG7A 5K9IA 3PVGA 5CVHA 3U8WA 2WIHA 3RNIA 3MPAA 3BIZA 4J95A 3ZONA 5D12A 1IEPA 2R3MA 3LPBA 2WTVA 4P4CA 5FXSA 5CU0A 2IVUA 3M11A 1PXLA 4D2PA 2ZVAA 4O0SA 4O38A 5CI7A 4FEUA 3BELA 4GS6A 2BTRA 2YCQA 3PG3A 2X2MA 1IR3A 3OWJA 3CKWA 1UNLA 3F61A 3R7IA 1RE8A 4WNMA 4WBOA 4JLCA 4PMPA 5LQFA 5DT3A 2ZV9A 4FTKA 3EFWA 4JVGA 4DFNA 2PPQA 2VZ6A 4AZSA 3ORZA 4G3FA 1SZMA 3VW8A 3QZHA 4A9YA 3L8SA 2P2HA 5HX6A 1T45A 4QTDA 4WA9A 1Q3DA 2BROA 1YI4A 2RG5A 3E93A 4BTFA 4NW6A 4NTSA 1CKIA 3QKLA 2WOUA 5E91A 1IRKA 5FD2A 2QOBA 3LCKA 5L8LA 2XIXA 2YISA 4L46A 4NYEA 2VWBA 4EC8A 5CANA 1OMWA 3OW4A 3FZRA 4EJ7A 2R4BA 5CEMA 1I09A 3T3VA 3I5ZA 2X4FA 4R3RA 4D5KA 3OS3A 5HBHA 4HZSA 2UZBA 3VNTA 4F9AA 2FO0A 2H6DA 4BCNA 3UZTA 4HYUA 2PMNX 4O7YA 3R7GA 3QFVA 4FKSA 2PSQA 3HAVA 4U79A 2QOKA 2WMTA 4M8TA 4F9WA 5FEDA 2VWWA 3QYWA 5EDRA 2ITVA 3ZRMA 5E4HA 4AX8A 2W1ZA 1NA7A 4GW8A 3R00A 5J87A 4USFA 4QPMA 1B6CB 5FXQA 4ZSAA 4AP7A 5A46A 3GEQA 4G6LA 2FVDA 3H9RA 4ALWA 2YFXA 4U0IA 2OF4A 4MD9E 4NIFA 3NNWA 4FV4A 5IQFA 3CJGA 3KMUA 5C01A 5B2LA 2XNBA 4YJPA 5HHWA 4ZTHA 3F3WA 4KNBA 4FK6A 1OB3A 4FKJA 3VVHA 3K3JA 4QT1A 1XBBA 4UYNA 2WQOA 1ZZLA 4YZCA 3CY2A 4EH2A 3PTGA 4ENYA 4TYEA 4BRXA 3FQHA 3W2CA 2PUUA 4AU8A 5EYDA 5DEWA 4ZP5A 4EH8A 3ERKA 4EK3A 1U4DA 2HENA 2BPMA 3OCSA 3WE8A 4DT9A 4EQMA 4FT5A 2YHVA 3R63A 5EI2A 5A4CA 5ITAA 4YBKA 3BZ3A 2EXEA 4CKJA 4BZNA 4F0FA 4FEXA 3EKKA 4J96A 3EOCA 5GJDA 1IA9A 4O0UA 4WUAA 1VR2A 4CZTA 3UZRA 1ZOEA 2CNQA 4I21A 3FC2A 5DMZA 2XKEA 2VWYA 3QQKA 4XP0A 4BF2A 3NGAA 4G6OA 4E4LA 4CVAA 5KNJA 4I1ZA 2DUVA 4ACHA 3HGKA 3P4KA 4FG9A 3EQGA 2W1CA 3GOPA 4WRGA 4QPAA 2VGOA 3PRFA 4O7ZA 1R3CA 4K0YA 2X7OA 5IA2A 5CXHA 4FUYA 4XV3A 4GUEA 1P14A 3FMLA 3KRLA 2Y0AA 4FSTA 4QMMA 4G16A 3VQHA 5HTBA 4FSZA 5JFWA 3HRCA 2QG7A 2BDFA 3PRIA 3A4PA 4IZ5A 1VJYA 5KKRC 4O1OA 4OT5A 3U6JA 2VGPA 4FV3A 5BMMA 1ZMWA 4L7SA 4W9XA 4ZY5A 3KEXA 2RFNA 3R1QA 2DS1A 2PVFA 2QOFA 3A8XA 2I7QA 5I3OA 5JRQA 4IDTA 4AFJA 5EFQA 4U80A 5FM3A 5IMXA 1XKKA 2J50A 4CFUA 3VHKA 4II5A 1WBTA 5L2QA 5FUTA 3VJNA 3NSZA 5ANOA 5HG9A 3SW7A 4FTRA 3V04A 3EFKA 3GQIA 3Q9ZA 3ZLYA 3O0GA 3UGCA 1MQBA 3RCJA 3V6SA 4RIYB 3ZZWA 4TWCA 3HDMA 2X7FA 3UO5A 2W99B 3AGMA 3PVWA 3Q4TA 3RTPA 2NPQA 1FVRA 5G6VA 4MTAA 4DE4A 3DB8A 3TACA 5KMIA 3QWKA 1WVXA 3RVGA 4FKLA 4AA4A 4AS0A 3DU8A 4EOOA 4OTIA 4CG9A 2X8DA 4HCVA 3W2PA 2H8HA 2PVYA 2ZM4A 5L2SA 4WO5A 5CT0A 4E8AA 1Y6AA 3R83A 5HCYA 5ETIA 4JDIA 4RT7A 4G34A 2VTNA 2YM5A 3FKLA 4GJ2A 2BRBA 3GU6A 4AQCA 4ENXA 1GIHA 2PVKA 2ZV2A 4XLVA 4MD7E 2PULA 4IB3A 5JMSA 4D1ZA 5IQHA 4RPVA 4DEGA 4QP6A 2QONA 2QVSE 3D7TB 5KZIA 3RP9A 3LE6A 5FDPA 2OGVA 5CZHA 3R8MA 1YHSA 3MA3A 3TZ7A 4YTIA 1U54B 3D7ZA 3EQBA 4YC8A 2JD5A 5DT0A 3BGZA 5AR4A 3FMJA 2BALA 4MK0A 2QU6A 3QCQA 3QTQA 2XMYA 1CM8A 2C5XA 4Y95A 2WOTA 3T8OA 4CLIA 2R7IA 5HCXA 5BVWA 1NVSA 2YDJA 3JYAA 4TNBA 4PNKA 3E8CA 3MY5A 1VYWA 4OT6A 2GNGA 4AA0A 5K4JA 2OXXA 3VBVA 4G3GA 3VBXA 4K9YA 5H8GA 2BRHA 5HICA 3CCNA 4D2RA 1R1WA 5GZ8A 3BHYA 4CT2A 1JLUE 3BLQA 2WMBA 2I1MA 2WFYA 3D5VA 3LFAA 2Z7LA 2C47A 3OUKA 4GFOA 3T9IA 4CTCA 3G15A 3QLFA 5AR8A 4N6YA 4RIXB 1YHWA 4OGRA 4BI1A 2HXLA 3NUUA 5JZNA 5M55A 4B7TA 4WOVA 4BZDA 4ZMFA 5IUGA 4G3DA 4AZFA 2Z7RA 4YLKA 3BEGA 3NNUA 4C7TA 3AT3A 4F9BA 3CGOA 4FK3A 3F5XA 4QP8A 4FTMA 3HP5A 1SNUA 1V0PA 1YI3A 4NM7A 3SV0A 1H25A 3EN7A 4IX4A 3KF7A 3VS6A 4EHZA 4RVLA 2E2BA 1R78A 4WD5A 3MH1A 2O2UA 4IFCA 2UZWE 4EK5A 2W7XA 2J5EA 4JAJA 1HOWA 5CEKA 5K5NA 4YUQA 5DA3A 4TRLA 3WZUA 4YP8A 4EQUA 3PYYA 3R8UA 3OEZA 4HYIA 2BZKB 5F9EA 2QHMA 2W4JA 4ID7A 3IONA 2OJJA 4HVGA 5CEPA 5AP4A 1J91A 1Z5MA 5FXRA 4U6RA 4BDGA 2XH5A 3GT8A 3F2AA 3ZTXA 3V8SA 4J99A 3HKOA 3F2RA 3GUBA 3ZLXA 2C69A 3MVMA 2YWVA 1UVRA 3E7VA 3RPYA 3CQEA 2YITA 5HVKA 3LKMA 4U44A 5EDQA 3TUBA 4EOJA 3RZBA 3ZM4A 4K8AA 1OUKA 3V5PA 3VF8A 3OF0A 3TNHA 5LCJA 4JS8A 2G2IA 4HGLA 1Q62A 4BDBA 3QCXA 4WNPA 4BBEA 5BUJA 4FV2A 3C4ZA 4NU1A 2YIRA 3QRKA 4ITJA 4I4EA 5DGZA 5TR6A 1P4FA 3DKOA 5M07A 3ZSHA 5HNGA 1TVOA 3E92A 3OD6X 4XG2A 2UW3A 1OL7A 1KV2A 2JDSA 1REKA 4O91A 4C35A 1NT2A 2RG6A 3OT8A 3ZDUA 3N4VA 4USDA 1OUYA 4EBVA 4IB1A 3BEAA 4ZZOA 5J5TA 3ZUTA 5KBQA 1PXNA 3GC7A 5DT4A 1ZMUA 4XJ0A 4GK2A 4DCAA 5LWMA 5HE0A 2VX1A 1XJDA 3ANQA 4FNZA 2CKQA 3FSFA 1FOTA 1YW2A 5JSMA 3N4TA 3DJ6A 2YDIA 4YO6A 3ALNA 4M12A 3QQFA 5M4FA 2R3GA 4D55A 4EEVA 4LOPA 2R3QA 3NYNA 3FLNC 4J7BA 3MIYA 3U87A 3HMIA 3UVPA 2WMQA 5FWKK 2XM9A 4H58A 3MVLA 1XWSA 5C03A 2GU8A 3DKCA 5ANDA 1WBVA 4DFXE 3VS1A 2XBJA 3DB6A 3CKXA 4RVMA 3SX9A 3AC1A 3CD8A 2VRXA 2PVNA 2XEZA 2VTOA 3K5VA 3PE2A 3POOA 3UP7A 5EQPA 4DGMA 3TIZA 4ACGA 4FKIA 1LUFA 3AC5A 5EYCA 4YGAA 4B9DA 4TN6A 3RHKA 1CKJA 4AW5A 1Y6BA 3BLRA 2G01A 2QD9A 3R1SA 2QURA 2BRGA 3CQUA 4D58A 3PJ1A 3PP0A 4ZLZA 5FM2A 2OFUA 5A4LA 3OOMA 4FTNA 3ENHA 5IKWA 2XF0A 2YAAA 4FZFB 4ZS4A 1MUOA 1KUTA 3D83A 3BU6A 3RAWA 1ND4A 5IG1A 5C4LA 4DFLA 4MWIA 4BCHA 2RFSA 5CSPA 4J71A 3WIGA 3DJ5A 5IA4A 5KHXA 3DAKA 5HEZA 4F70A 4I92A 4Y72A 2PYWA 3RINA 2PY3A 3KRXA 4DG3E 5B2KA 4BDKA 1PRYA 4IZAA 2C4GA 3S1HA 3UIBA 1WCCA 5HE3A 4TYJA 4TWOA 5BYLA 2JAMA 3OXTA 2Y4IC 2BAJA 4C59A 4ZZMA 1J3HA 4JR7A 4Q2AA 5M08A 4KIPA 2BKKA 5CASA 3R04A 4EUTA 5AX3A 5E90A 2V7OA 2ZDTA 3PA3A 4JAIA 4TYGA 1SM2A 2OIDA 5CXZA 4QMPA 4ZLYA 3SA0A 2J0IA 3VRZA 3CGFA 3WF5A 5ANJA 4DFZE 2BDJA 3QD0A 3MDYA 3HMMA 4I6BA 5EK7A 4MXXA 5KMJA 1LR4A 2J51A 3UVQA 4USEA 1X8BA 3IQ7A 5CLPA 3DJ7A 2VTQA 4G5JA 3FMMA 4YJUA 4JIAA 2YZAA 2BZHB 5KMNA 3W16A 1H0WA 3KN6A 3NUXA 4PP7A 3VJOA 3C4FA 2EU9A 2XIKA 4AW2A 1UU3A 4TKSA 3GQLA 5B2MA 5BVKA 4ZOGA 5FBOA 5CU4A 2CLQA 3SHEA 3B8RA 4NL0A 3H4JA 5GIOE 2VO7A 4IHPA 4M0YA 4BWKA 3D4QA 3LQ3A 3TDWA 3PY3A 4JG6A 1BX6A 3IS5A 4F09A 2XNGA 2CMWA 4AW1A 4FSWA 2J90A 4HGTA 4FV8A 1NVQA 3BGPA 4L3PA 1H1SA 3D94A 4KBKA 3FQSA 3CBLA 3OP5A 4J53A 1UNGA 4Y8DA 2JC6A 3U4WA 4J8NA 4ASDA 1TKIA 1O6KA 2XNNA 2R3LA 3F5UA 3EB0A 4AUAA 5BUIA 2P4IA 3GP0A 4FL3A 4R77A 3D2IA 5I9UA 5J8IA 4TYHA 4QO9A 5AIKA 5FP6A 5EQYA 1PY5A 3KCFA 3T9TA 4XRLA 2HK5A 1OBDA 3C50A 3WF9A 4TTHB
chains in the Genus database with same CATH superfamily
4YC6A 3ZC6A 5EOLA 4ZSGA 5TE0A 4UX9A 1BI8A 2QODA 1B39A 4KKHA 5F4NA 3FZ1A 1FQ1B 1PKGA 1YRPA 3S95A 3PP1A 1G8AA 4A9TA 4PL4A 1YXXA 2GQSA 4IEBA 2C5NA 4YSJA 5HO7A 1OL2A 5J9YA 2QHNA 4FKPA 5IA5A 2WZJA 2PVRA 2WAJA 2EB3A 2F7EE 2C5VA 3N9XA 2I0EA 3VUGA 4QTEA 4O27B 3I0QA 3IW6A 3IPHA 5JK3A 5BV3A 4IE9A 1XMMA 4AZWA 3QQHA 2AC3A 1YXUA 4LYNA 2E9VA 5D1JA 4LGHA 3R02A 3UG2A 3VWAA 3PXQA 4CMOA 4Z7GA 4QP1A 1M17A 5J7HA 2XUUA 3W1FA 3DT1A 4GFGA 3D9VA 1W2CA 3HX4A 4FTQA 4FZ6A 3PFQA 4QYYA 4JBOA 3Q60A 5AJQA 4FJVA 4AN3A 3R0TA 4GT4A 5JGBA 2C1BA 5AV0A 4EH6A 2X8IA 4I6LA 2UV2A 1H8FA 1V1KA 4BDAA 3DXNA 3OZ6A 3P7BA 1OKVA 4MWHA 1UWHA 3VN9A 1OL6A 4RZWA 3EHAA 3P0MA 2XJ1A 4H36A 5DPVA 2CKOA 2VO6A 4AOJA 4LQMA 4BWXA 1GZKA 1KWPA 5BVNA 1RJBA 2YCFA 3OT3A 5C4KA 4NZWB 3MBLA 3C7QA 5CAQA 5A6NA 5E8YA 5EI6A 3TNPC 4DAWA 4FNXA 2XJ0A 3MN3A 4WHZA 4F6WA 3W0RA 3TZ8A 4NM5A 4Z9LA 3RAIA 3TG1A 1SVGA 4QMXA 4QMLA 3WE4A 3QTUA 3ZH8A 3ACJA 5I9VA 1ZOGA 3NIZA 4X3JA 5IPJA 3HV3A 3R71A 3AT2A 3CE3A 3W18A 2CKPA 4PRJA 3PSCA 2W17A 4XV2A 2ZB1A 3BYVA 4UN0C 1OIQA 3FJQE 4G17A 4WG4A 4NW5A 3DNEA 2HCKA 2KTYA 3UBDA 4M69A 5M53A 4FTJA 2WEIA 5IQAA 4X2NA 4BCIA 2WTCA 4YPSA 4D2VA 3G9LX 4FT0A 3ENMA 2OFVA 1XBAA 2UW4A 3C4CA 3EN4A 4NKAA 4Y85A 4YHFA 4BGGA 4O96A 4U9AA 3VIDA 2PZYA 2PUNA 1PYXA 4EBWA 3U6HA 4PUZA 2ZYBA 2GFSA 2R3FA 1QL6A 4ACDA 4K11A 4B8LA 5I9YA 1YWVA 3REPA 4L45A 3EN9A 1WVYA 3ORIA 1OIRA 4CKIA 4N6ZA 5HLNA 4D0XA 3JXWA 1JSTA 3U54A 5J1WA 2YLEA 1NY3A 4O4DA 4R7HA 4C61A 1JBPE 1YOLA 5I9XA 3L1SA 4BDJA 1BLXA 3HRFA 3DBEA 4NFNA 1WBNA 3OFMA 4U5JA 4KBAA 4RA4A 4ORKA 2NP8A 1OPKA 4LGGA 4OAUC 1DS5A 2GCDA 4I0TA 4NCTC 3ORNA 3VUKA 4CV8A 3KIOC 3KXHA 3HV4A 3QD2B 4PPAA 1J7LA 4AOTA 2C0TA 4BHZA 2Y4IB 4XP2A 2UVZA 4FKQA 5DR6A 3QA8A 3R7YA 3HMPA 2ERKA 2A0CX 4YSMA 2JDRA 4CFFA 1K2PA 2ERZE 1U5RA 3W32A 1DM2A 2QLQA 3MA6A 3DLZA 2F9GA 4S30A 3UC3A 2SRCA 2AEGA 3E3PA 4JBPA 3Q5IA 4XG6A 2OG8A 2JKQA 1V0BA 3O51A 3HVCA 4C4HA 1YHVA 3AC8A 4BBMA 2IPXA 4JOAA 5ANIA 3D2KA 3VS5A 2ZM1A 3V51A 3HA8A 2J0MB 5F95A 2WMVA 1JSUA 3KULB 5HE2A 5E8WA 4JQEA 1KE8A 3DBCA 4J1RA 4GSBA 4AOIA 4QNYA 2GDOA 4X2KA 5T68A 3VULA 5A4TA 4AXCA 4L52A 2RIOA 1G5SA 2VTIA 2HZ4A 4X3FC 4DG2E 3DK3A 3O50A 4UMQA 5DOSA 4GKIA 5C8NA 4M3QA 5AA8A 5BYYA 3F3TA 3ZLWA 4EH4A 5CWZA 4RX7A 5D7AA 5B0XA 3OXIA 3DV3A 3TN8A 4G31A 1FGKA 4O21A 2QOHA 3PUPA 5JN2A 1MRUA 3DQXA 4GIHA 3OUNB 4UZHA 1A9UA 4H1MA 1JKLA 1XH4A 2F4JA 3OCGA 4X2GA 3TI1A 4O83A 1UKHA 3LCDA 3Q6WA 3FMDA 4PPCA 4DHZA 4RX9A 2X1NA 3CP9A 1R39A 3O8PA 1IASA 4UWCA 5BVEA 3KULA 2LAVA 4M15A 5AR5A 4IVDA 4BCPA 3ZEPA 5D9HA 5I4NA 3PXRA 3NAXA 1M52A 4XUFA 2PUIA 3VHEA 3I60A 3FE3A 1YDTE 1H4LA 4U8ZA 3VBQA 4AGUA 4N4SA 4O7RA 1CDKA 3ZMMA 3BRBA 3KXZA 2ZM3A 4KRCA 4A4LA 1OKZA 1S9JA 2CDZA 2XYUA 3IGOA 3UE4A 5BVDA 2XEYA 4RC3A 2NO3A 3ACKA 3F82A 3NW5A 3FYJX 1J1CA 4PL5A 2ETRA 4K77A 4RIOA 3GU8A 3DKFA 3MY0A 4NJDA 4DHIB 4EQCA 3PG1A 2B54A 3L9LA 2GNHA 3Q96A 5GINE 1PMUA 2HXQA 4V0GA 3MB7A 4IM3A 4HVIA 4TPTA 2XB7A 3B2WA 3DBFA 3BYMA 4F1MA 2GHLA 1FPUA 5FLFA 2QKWB 3UZPA 2X6DA 4CXAA 5AV3A 2P2IA 3UOHA 4O4FA 4BTJA 3Q04A 5IMEA 3NLBA 4FKUA 2CNVA 4QPSA 4KSPA 5AM7A 5TOZA 3DLSA 4W8EA 5LMAA 3R8VA 3UIUA 3I7BA 1V0OA 2H96A 3MFUA 2RF9A 5H8BA 3TKUA 1PHKA 4DEAA 1YDRE 2XP2A 1NW1A 3ZM9A 2C6TA 5IQDA 1H1RA 3ODZX 2CCIA 3BQCA 3ZLSA 3FBVA 5M06A 3RWQA 1GZOA 4M97A 3QHWA 2WMRA 4U41A 5CYIA 2WKMA 4BCFA 3GCPA 1XBCA 2OZAB 2HW6A 3KU2A 2GQGA 4FIGA 4N0SA 2XRWA 5HI2A 1ZY4A 5AIRA 5JT2A 2XARA 2XNOA 4IAKA 3ZHPC 1ZXEA 2W96B 2WXVA 4LRKA 3VC4A 1LP4A 2JLDA 3MTLA 2VTLA 2JDVA 4F1OA 3PIXA 3O17A 4BDHA 4K33A 4BZOA 3ANRA 3VQUA 4IFGA 2J5FA 2O0UA 2W9FB 3FY0A 4IWQA 4FSMA 2F2CB 4KIKB 3L8XA 3KF4A 4YJRA 1URCA 5IU2A 3VUTA 4GUBA 2QLUA 2PHKA 4EZ5A 4YO4A 3OOGA 1H1PA 3OVVA 4C37A 4DTBA 3W2QA 4FNYA 4QMTA 2OZAA 2EXMA 1FINA 5HTIA 2HW7A 4QP9A 3RPSA 1JSVA 4OTDA 1GJOA 4V01A 3QLGA 4EKLA 5KCVA 4AAAA 3DDQA 5ANKA 3P79A 5FTGA 2J2IB 4XYFA 4WG5A 3NUSA 2BAKA 4RLLA 3WARA 1SNXA 1GZ8A 3VBYA 1PF8A 4U3YA 3UYTA 5FRIA 1Z9XA 1XHAA 4G5PA 4QMZA 4Y83A 1M14A 3WF8A 4FRFA 2C3KA 4ALVA 5M44A 3OC1A 2F49A 5EYKA 4RBLA 3DXPA 1L3RE 4PMMA 1YWRA 2X81A 3V01A 2OIQA 3HZTA 2R3KA 3MS9A 3R7VA 4FL1A 3O7LD 2PVJA 2W4OA 4D2WA 2Q83A 2PTKA 4CCUA 4XEYA 2H34A 2VO3A 2GS2A 2PMIA 4XRJA 4KIQA 5IEVA 4O82A 4BIEA 4ZMEA 2FYSA 4O0XA 5C26A 4E6DA 1KE5A 2GSFA 3ZUUA 1YWNA 4EYJA 1DAWA 4B8MA 2WU7A 2WMWA 1PMEA 5I9WA 3RMFA 3SLSA 4C36A 3CIKA 2YWPA 3RBWA 3FUPA 4RIWB 5L6WL 2O63A 4C62A 3WZDA 3VBWA 3ZFYA 3CXWA 3I6WA 4XBRA 5E8UA 4ZY6A 5ACBC 3F9NA 3NCZA 4FTOA 2G15A 5KX8A 5E1SA 5E1EA 4FTIA 3FV8A 3RPRA 1Y8GA 4C4EA 4EWQA 3BV2A 2C68A 3R7UA 5AR3A 2RFDA 2C1AA 3NW6A 4XP3A 4B99A 3ELJA 3VO3A 4I6HA 3QALE 4PNIA 3EQPA 3H9FA 3QF9A 5DFPA 5LARA 4NCTA 3LQ8A 2XKCA 3OWLA 3OWPA 3IW5A 2VN9A 3M1SA 3G33A 2BR1A 5DRDA 3MWUA 4L6QA 3WF7A 3ITZA 1HCKA 1PXJA 3DA6A 4DN5A 2YIWA 4APCA 3I4BA 3UODA 3NAYA 2UW6A 4I5CA 4Y5QA 4RJ3A 3BU3A 4GYIA 2G2HA 3CTQA 4BI0A 4E4MA 4M13A 3ZO4A 2O8YA 4X3FB 4BGHA 4IX6A 2R64A 2FSLX 5EW3A 4EH3A 3I81A 3MGYA 4MHAA 2X4ZA 3JR1A 4EKKA 5DNRA 4QMSA 4ANLA 2UW8A 4FR4A 2C3JA 3RK7A 5HD4A 5E8ZA 1WAKA 5IISA 2WB8A 1JKKA 4FGRA 3S2PA 4I94A 2X9FA 5AV4A 3OWKA 2VNWA 4C33A 2ZMDA 4C4JA 4S33A 4X2FA 3OBJA 5CT7A 1ZYCA 1GAGA 1O6YA 5DI1A 5C9CA 3NYVA 3FI3A 3BYUA 4DH8A 5F20A 3COHA 3A62A 3UO4A 5LVOA 4YZ9A 2WQBA 4AZEA 4RJ7A 4YJTA 3IW4A 3NVMB 2G1TA 2FB8A 4W4XA 3CEKA 3FZOA 4ZXTA 5K0KA 4QTCA 4AT3A 2JIUA 3EQIA 3F6XA 5KBRA 4NUSA 4YR8A 5CAVA 3QAME 2WHBA 2WMUA 1YKRA 4DH7A 1ZAOA 4EOLA 3JPVA 2Q0BA 5AAFA 4RIYA 1OIYA 2OICA 3OCBA 5CEOA 5LMKA 3DTWA 4LV7A 1WZYA 2ITPA 3DZQA 5AR2A 5IDNA 4KB8A 4R8QA 3R8LA 1W84A 4GYGA 3TTJA 3H0YA 1Q4LA 4YLJA 5ETFA 4FIFA 2R0UA 2VTRA 4GIIA 4JXFA 3ULIA 2P3GX 1OVEA 3EYHA 4PDPA 4PMTA 5HX8A 2GQRA 3ATSA 4JBQA 3R9HA 4R78A 3BWJA 3GC9A 1XH6A 4CFVA 4E3CA 3KFAA 4TWNA 2YM8A 2VWXA 4NTTA 4Q5HA 4W4YA 3W2OA 5J5SA 4QDVA 4WT6A 5TKDA 3I0OA 3FHIA 1R0EA 4F7SA 5CAOA 3WF6A 5LCKA 5HO6A 3WZKA 4CGAA 3R1YA 4O0VA 3SC1A 4ZIMA 1OECA 4M14A 3TXOA 4Z16A 3JVRA 4FG8A 4GK3A 3RZFA 3FDNA 1H24A 5KE0A 2IVSA 3D7TA 3ZFXA 3D15A 4A7CA 5L6PA 3PDTA 1U59A 3CJFA 3KRJA 3ZYAA 4H3PA 3LFBA 4O81A 4HJOA 2XCHA 1WVWA 1XO2B 1U54A 3F7WA 4FVRA 2ESMA 4FYNA 4HGSA 3UMXA 3F3ZA 2WO6A 4BYIA 3GC0A 1J7IA 2QO2A 2ITUA 5IUIA 4GG5A 4U7ZA 3NUAA 3II5A 1G8KA 4FVQA 4LM5A 2BMCA 3F88A 3ORTA 2JGZA 1ZRZA 5T6KA 2CPKE 5DWRA 2BTSA 4CZUA 4IJPA 3EJ1A 4EONA 4IVBA 4U43A 4QEBA 2JBPA 3EFLA 5DVRA 5E7RA 2DQ7X 3AT4A 2VTJA 4FSQA 3I7CA 4CG8A 3Q6UA 4ANMA 5LWNA 3R28A 5HVYA 3U6IA 2UW7A 2UZDA 3V3VA 4OTPA 4KSQA 4AACA 1H00A 2GS6A 4RIXA 2DWBA 3R9NA 4CCBA 2V62A 3S4QA 2ZV8A 4D4VA 1Q8TA 4YZNA 4MXYA 1CMKE 3ALOA 4IZYA 1YVJA 1MRVA 4RJ6A 2YM4A 1ZOHA 4J97A 4M0ZA 3Q4CA 3S3IA 3O7LB 5CQWA 3WI6A 4AFEA 4FTCA 1UNHA 3QZIA 5F1ZA 3QX2A 1TFFA 2BILB 4BCJA 2F7ZE 2PZPA 3AOXA 3DAJA 2X0PA 2UZEA 3QZFA 4GFMA 4AWIA 2B7AA 4BKZA 3P5JC 2C6DA 5EDPA 2CGUA 3QQJA 4H05A 4B0GA 3QRIA 4YURA 2QOOA 3LM5A 3C4XA 2CN5A 2W06A 5AP2A 4AXAA 4AXDA 3RCDA 3MV5A 4UXQA 4A07A 3GFEA 5CU6A 4GV1A 1UV5A 3FXZA 3LMGA 2XIRA 5CNOA 4CQEA 2A4LA 5C8KA 3DQWA 4YZMA 4DGOA 4PWNA 3ATTA 3HL7A 2VTHA 3NNVA 4FIJA 3F66A 1CSNA 3FPMA 5CVFA 5HORA 1DI8A 4IAZA 3HECA 3LFCA 3ZZEA 4U97A 5IH5A 1KSWA 3AD5A 4S34A 3RKBA 4BTKA 3KREA 3MFRA 2XKFA 4DH1A 1AGWA 3P7AA 4JDHA 2YCRA 4QOXA 2HZ0A 3PY1A 4E7WA 1SVEA 3MI9A 1G8SA 2O64A 4P90A 1M2QA 2W1DA 3KC3A 4OR5A 4RGJA 3ZDIA 4DEEA 2OBJA 3KB7A 5KZ0A 5L2IA 3GB2A 4FC0A 2C6OA 4UYAA 3TIYA 4A9SA 1PW2A 5D7VA 4QP7A 4RJ8A 2C5OA 3AMAA 4MNEB 4O0YA 1PMNA 5FP5A 4V04A 3R9OA 4ASEA 4QMUA 3IDBA 4AAYA 5HNBA 4IXPA 3A7HA 4S32A 5JQ5A 2EWAA 3BPRA 3SXFA 4X21A 4L68A 3F7ZA 4APPA 2FA2A 3GC8A 2UZNA 3F5PA 3GU7A 4FF8A 5HVJA 4DDIA 4FUXA 4RX8A 1OKWA 3M42A 4E4NA 4N57A 1PXIA 4QMWA 3UTOA 4W4VA 3KRRA 5AV2A 3TJCA 3IECA 4UWYA 5JQ8A 3W0NA 3W0OA 5ETCA 4D28A 3EZVA 4XOZA 2C6KA 3UVRA 1Q8WA 5JGAA 4FMQA 4MBLA 5AAEA 4GMYA 1ZWSA 2R3OA 5CF5A 3DS6A 4KA3A 4BDEA 5KO1A 4EUUA 4YMJA 1UA2A 2PVLA 3I5NA 3QX4A 3P86A 3EKNA 1Q5KA 5IH6A 4X2JA 2CGXA 4S31A 3QUPA 2XAMA 4IM2A 4BFMA 4CRSA 4CFNA 5A4QA 3BI6A 5CSWA 2W1FA 2JIIA 4F7JA 2VTPA 2JEDA 5J79A 5A4EA 5GZAA 5IA3A 4BYJA 3UOJA 4O7WA 1XH9A 5EKOA 5B7VA 4LG4A 5H2UA 2NYAA 4O86A 4NEUA 4FIIA 4DHJA 4EOPA 2BRNA 4IBMA 4G6NA 3V6RA 3MVHA 3DOGA 5LJJA 4XCUA 4I0RA 2YLFA 3DPKA 3IK3A 3QTZA 3Q5ZA 3BL7A 5FEEA 2V7AA 2XYNA 3QCYA 5CU3A 4CT1A 2ITZA 2G9XA 3TUCA 5EW8A 4JG8A 1KOAA 4CFXA 1OL5A 3AMYA 4DFYA 4MF1A 3Q9WA 4MX9A 2KULA 3ZU7A 3PFYA 4FKVA 4IVCA 4F7NA 1L8TA 3D0EA 4OAVB 3QC9A 1W82A 2ZAZA 2J9MA 4NFMA 2RKUA 2IW9A 5DEYA 3P1AA 4FEQA 4FODA 3BHTA 2IEWA 4IJ9A 4JR3A 5HZNA 3DY7A 3PPZA 3OCTA 4R7IA 3CPBA 3IKAA 1H27A 3A7GA 2CCHA 2J0LA 2OO8X 3DBQA 5I3RA 3RPOA 3FXWA 2PZIA 3QYZA 3UO6A 4MXAA 5I5ZA 1FBNA 1W8CA 4D1SA 4F64A 3W0SA 4DHFA 4QQ5A 2FH9A 3KMWA 1ZLTA 3PWYA 2OKRA 3BV3A 4GCJA 4KINA 3OMVA 3UDTA 3R73A 1WMKA 2X7GA 4E6QA 3NVKI 1QPDA 3Q32A 3TKHA 2J4ZA 4KWPA 4L8MA 4L42A 2C6LA 4LL0A 5IUHA 2OLCA 5CX9A 3TZMA 3P9JA 3HV5A 3LJ0A 4TZRA 3MFSA 4GT5A 2B4SB 4JIKA 5JZJA 2XK8A 3PY0A 1W7HA 3V5LA 3QA0A 3NZ0A 3RGFA 2B53A 2XNMA 4F63A 2I40A 4ANOA 4RFYA 3QRUA 2X2KA 4I22A 2GHMA 4HW7A 2E9UA 4AGDA 3NUPA 3ZOSA 3QTSA 3TNIA 2CLXA 4RX5A 3R8ZA 3WBLA 3C5UA 5FG8A 2ZDUA 3MFTA 4BDCA 3I1AA 3SKCA 2BRMA 1Q3WA 2BCJA 2HWOA 2WTIA 5E8XA 5HG7A 3PSDA 4RWKA 3L8VA 4AF3A 2V22A 4BCGA 4ASZA 4C4FA 3BHHA 4ITIA 3KRWA 1EH4A 4NT4A 1YDSE 3QL8A 4OTQA 4F6SA 3G2FA 3P08A 4FI1A 4F9YA 2QCSA 4YTHA 3ZRKA 4OBQA 3TT0A 5M56A 3F5GA 3WZJA 1KE7A 2HYYA 3Q2MA 2DYLA 2QOIA 2UVYA 3BE2A 1S9IA 3SAYA 3QU0A 1JOWB 5FQDC 2JIVA 5AP5A 3HAMA 4M7IA 4DF3A 3MYGA 5CAPA 4MBIA 4G3CA 4IWOA 4PTGA 4C58A 4EI4A 4UALA 2OJIA 5CQUA 3H9OA 3SDJA 3NS9A 3PA4A 1J1BA 1RDQE 2IVVA 2RGPA 3IDCA 4Y46A 3G6HA 5D10A 1XH8A 3C0HA 1UU7A 2UW5A 4OW8A 3VONA 4A4XA 3A4OX 4D2SA 4F65A 1HCLA 1JQHA 3SG9A 3GCSA 4HNIA 3K3IA 4FV1A 4ZJIA 2VWUA 3R01A 4TW9A 3A7JA 2J0KA 5BVOA 4DGLC 4M68A 1Q8UA 1JWHA 3TDVA 2BZIB 1LEWA 3FAAA 3E63A 5BMSA 2VX3A 3KVWA 4RG0A 1NVRA 5HBJA 1XH5A 3A8WA 4HPTE 1T46A 4O22A 5BQ0A 5CEQA 4M67A 5LVNA 3DKGA 4E20A 5ACKA 5JGDA 4IADA 3ROYA 4L44A 1ST4A 3MH0A 1BI7A 3Q3BA 4L7FA 1GOLA 3NDMA 2E9NA 1YOJA 2B1PA 3MB6A 4FV9A 1OBGA 3PUFC 3G51A 3LAUA 4JNWA 4X6RA 4CKRA 2ITXA 3SRVB 2JDOA 4R7BA 5H8EA 4O6LA 4X0MA 4EL9A 5AWMA 3FLYA 4QP4A 3UQFA 4YNOA 3JS2A 3QTXA 4GJ3A 3ZRLA 4HOKA 3A99A 5CSXA 5L2WA 1M7NA 4G9CA 2UW0A 4I20A 3LQ5A 4FG7A 4BCQA 3RPVA 2IZSA 4A4OA 1WBOA 4NM0A 3VRYA 4EZ3A 2Z7SA 4LUDA 5CF8A 3DXQA 3NFFB 3G90X 3COMA 4C2VA 4P5QA 5I9ZA 3BLHA 4U81A 5CAUA 3G6GA 4HVSA 2ZV7A 4DDGA 2HY81 3SXSA 4FOBA 3KXMA 2IZTA 5DG5A 4I23A 1PJKA 3SRVA 3P7CA 2JKKA 2WQNA 4Q5EA 5EOBA 4DFUA 3G9NA 4QYGA 3QD4A 5EM7A 5CSVA 1JKSA 2HIWA 4ANSA 5IEYA 2Z02A 3MVJA 2V5QA 1TQIA 2OZOA 3LXPA 3SOCA 4AW0A 2Q0NA 2LGCA 2PZ5A 3BGQA 3CQWA 3ORPA 4RZVA 3PLAE 5G1XA 3UC4A 4EYMA 3N51A 3EN6A 3Q52A 4QP2A 3KK9A 5FTOA 4DYMA 3U51A 2XALA 4H3QA 3QUDA 1GIIA 2VUWA 4MVFA 4JRVA 3QRTA 4EZ7A 2VWVA 1XR1A 4FKGA 2B9JA 3FKNA 4YBJA 4D9UA 2JDTA 3FSKA 1PMVA 2J7TA 3LFFA 3B8QA 3VS0A 1Q24A 3HUBA 2WGJA 3PJ2A 4FEVA 4IIRA 4AXFA 4BJJB 4ZSJA 3CTJA 3EQHA 5DYJA 3W0PA 3ROCA 5A3XA 4R5YA 2XJ2A 5C1QB 3QCSA 4RRVA 4E5AX 2AUHA 3O8UA 4F9CA 3NRMA 2QQ7A 4E4XA 5AP7A 1U46A 4C3RA 5IQCA 3RJCA 4AGCA 2I0VA 4LMNA 4PPBA 4FE2A 4WBBB 2YACA 4E6AA 3NUNA 4WG3A 4BY9E 4XX9A 4AE6A 1QPEA 4JX3A 2R5TA 1ZARA 1IG1A 3PPKA 2CNUA 4EOSA 2YJSA 2GS7A 3ZSIA 5IF1A 4C34A 3HA6A 2IZUA 4KS7A 5LXMA 3AC3A 4LFIA 3NYOA 3QWJA 2W9ZB 5EI8A 5IQGA 3UG1A 4GL9A 5EHYA 4EH5A 4BJJA 4AA5A 5AX9A 1OGUA 1Q97A 5BYZA 3D5UA 4RLKA 4IH8A 1W0XC 4UY9A 4KKEA 3PXFA 2FSTX 2W1GA 4K6ZA 4BIBA 3EYGA 3FLQA 4LRJA 5J7BA 1SYKA 3WYXA 3A7FA 4PTCA 3S00A 4FTUA 4JRNA 2BVAA 4MBJA 2X0GA 4LOOA 5AM6A 3CPCA 4CMTA 2HWPA 1UU8A 3BWFA 3DK6A 2ETMA 4IZ7A 4FNWA 2IW8A 4F08A 5HLWA 4MD8E 4E93A 2Y6MA 2QOQA 4ANBA 4JI9A 4W4WA 2CHLA 2HZNA 2UZVA 3SOAA 4BL1A 3BX5A 3EQFA 4IACA 2WNTA 2A98A 5EM8A 4PDYA 3E87A 3DNDA 4AQKA 2YJRA 3BBWA 3FMNA 4PL3A 4FT7A 1OKYA 4XNEA 4UMUA 5CTPA 1KE6A 4ARKA 3VUIA 4W8DA 3HDNA 2PZRA 4WRSA 3TJDA 4F0GA 1URWA 5AADA 3G5DA 2V0DA 3EQRA 3POZA 1K9AA 3HNGA 3UIXA 3EWHA 4WSQA 5H3QA 1GIJA 3LOKA 3OY1A 5M09A 3WYYA 3TUDA 2OWBA 2W5AA 4YPDA 5AP6A 2QC6A 3DZOA 4RSSA 2VWIA 2IN6A 4BICA 2Y8OA 2B0QA 3ZCLA 3IW8A 4UZDA 3PJ8A 5TO8A 4AT5A 1AQ1A 2JKOA 3VUHA 2HZIA 3MPMA 2XNEA 3OROA 5KMMA 4DBNA 3NFGB 4RQVA 2X39A 2ETKA 3GBZA 4FV0A 4FZ7A 4F1TA 3EQDA 4P7EA 3RNYA 3TTIA 5L8JA 4F0IA 5GZ9A 4KUJA 5CI6A 4XS2A 3ORLA 3R8PA 2B52A 5CALA 2C0IA 3E3BX 4AN9A 4HGEA 4UMTA 4Q9SA 4ERKA 1P4OA 2C3IB 4C3FA 3ET7A 3BKBA 3V5QA 4W9WA 4GKHA 1Q61A 3BHUA 3FC1X 4IVAA 4BC6A 4I5HA 4QMVA 4C38A 5DHJA 4K18A 3VAPA 4PY1A 1R0PA 4MAOA 4IB5A 4BVUA 3U9CA 3NPCA 4MKCA 5EG3A 5EH0A 5A14A 4R1VA 3DFCB 4PP9A 2QO9A 5K4IA 5AUXA 5JFVA 3OHTA 5BVFA 3LW0A 2EB2A 5AMNA 4QD6A 3C9WA 5IQBA 2X8EA 3KXNA 3OBGA 4FIEA 2I6LA 4DH5A 3K2LA 3LFSA 5A9UA 3FMHA 4IWDA 4J8MA 5BX0A 4QMOA 1OIUA 3MSSA 5BPYA 2EUFB 2YCSA 1Q8ZA 3DAEA 3OY3A 3RHXA 3UOLA 3RI1A 3VUMA 2GNLA 3KMMA 1P5EA 4FTTA 2NNWB 4EH7A 4QYEA 5AP3A 2VD5A 4TWPA 3GVUA 4I3ZA 2CKEA 3CD3A 5LVLA 4XV1A 2YIYA 4NIFB 3BE9A 3AXWA 3LXNA 1ZMVA 3V5TA 1Y91A 2I0YA 4RVKA 5IH4A 4BWPA 4PQNA 5HQ0A 3AQVA 4YTCA 5I0BA 2REIA 3H3CA 4I24A 4YC3A 4YJQA 2NRUA 2PL0A 2JAVA 3VS3A 3HRBA 5HOAA 2WTKC 2X2LA 4LMUA 2AQXA 2J0JA 4C0TA 5L2TA 5DBXA 3ULZA 5HBEA 5AUWA 2VV9A 1W83A 4YLLA 3R9DA 4ITHA 4PDOA 4DCEA 2P0CA 4EHVA 4KIKA 5FGKA 5CZIA 4PMSA 4C3PA 1H0VA 1UWJA 2Y7JA 4FVPA 1KE9A 3P23A 3TCPA 3FI4A 1Q8YA 3LCTA 3QKKA 2X9EA 2QR8A 4AT4A 3MESA 2E9OA 1REJA 3R2YA 4LL5A 4QQCA 2NRYA 5CENA 4BDIA 4H1JA 5GHVA 5IQEA 2QU5A 3R7OA 3TYKA 1H26A 4TXCA 3TV4A 3UMWA 3WILA 3LMIA 2ITNA 2QO7A 3DBDA 4UMPA 1TZDA 3A60A 3H30A 4DTKA 2BDWA 4KS8A 4EWHA 4XLIA 4HYHA 3FQEA 1ZYJA 3DGKA 4IWPA 3MH3A 3PVBA 5EYMA 3LHJA 2IF8A 2OJ9A 3GCVA 1APME 4YJNA 3BQRA 3Q53A 4WSYA 1YXVA 2E9PA 3JVSA 3UDZA 4ANQA 4D4RA 2QNJA 4CFWA 2VU3A 4I5MA 4FKRA 3WOWA 2J6MA 4RWIA 3FYKX 4UMRA 3FPQA 4YHJA 4Y5HA 4XOYA 4BKYA 4F7LA 1IAJA 2ONLC