4AQCA

Triazolopyridine-based inhibitor of janus kinase 2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
289
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title A Selective, Orally Bioavailable 1,2,4-Triazolo[1,5-A]Pyridine-Based Inhibitor of Janus Kinase 2 for Use in Anticancer Therapy: Discovery of Cep-33779.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 289
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aqcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqcA01
4D0XA 3E3BX 1JSUA 3OWPA 1FVTA 2GNGA 3VS4A 3MH2A 3DXNA 5AM6A 5FXSA 2O5KA 3Q04A 4NW5A 2VWWA 3WIGA 4J53A 4GK2A 2OH0E 4KKEA 5CSVA 2BRNA 3NUXA 4RZWA 4ASEA 3TN8A 3PPZA 5A4EA 4DC2A 4EOPA 4ANQA 5M4IA 4GJ2A 4AZEA 4YJNA 5DVRA 5CQWA 4YJTA 3F88A 5I3OA 4ZJJA 4ASDA 3LCSA 2REIA 4M0ZA 1BX6A 2BFXA 2OSCA 2VTAA 4FKPA 3RCJA 4JL9A 3R7EA 2PMOX 3EN6A 2FO0A 3FLYA 4FZFB 1QL6A 2W0JA 5HE2A 4BDEA 5D10A 4L9IA 4YZCA 4TYGA 3VRYA 4C4EA 3FY2A 3Q9XA 4LI5A 4G17A 4IFGA 5L8JA 3EQPA 4KS7A 3WZUA 4BHNA 3FMJA 4D4YA 4Y83A 4O0VA 4TW9A 2VRXA 3EB0A 4QD6A 5DT3A 4FT7A 1H1WA 1VYWA 4HZRA 2ITUA 4FNXA 5M55A 1CTPE 5DFPA 2W17A 5D9HA 5F4NA 4BZDA 3QTZA 4KINA 4RX7A 4MVFA 5I9XA 4FGBA 3FI4A 3TUDA 3HV7A 4O0SA 5HIBA 4PMSA 3ZU7A 3TTIA 2XM8A 3MTLA 3LIJA 3LOKA 4EZ5A 2VTPA 3NUNA 4KKGA 1REKA 4E7WA 1XBAA 4GK4A 3BU6A 3QL8A 4APCA 2I40A 2XNPA 3ID6C 5E1EA 1YOLA 2C3JA 2UW5A 2ZM3A 3ETAA 3OG7A 4IZYA 4JX3A 4JQEA 4RJ4A 3UG1A 3FJQE 2GNHA 3WF9A 4JDIA 4U9AA 4E3CA 3W10A 2C3LA 2VTOA 3AC1A 2CGVA 2XZSA 3R1YA 4LV8A 1M14A 3W2CA 4C3PA 2EB2A 4I5PA 4DEDA 4BHZA 4M67A 4LUDA 5D12A 4R5YA 3RJCA 4HW7A 4J52A 4A9SA 5G6VA 4U40A 5FLFA 3PJ8A 4WBBB 1FVRA 2WIHA 5C01A 5IQGA 4ZOGA 3F3UA 2B0QA 4I5MA 2OZOA 2VWXA 3COKA 3MYGA 4FIFA 3UPZA 4APPA 4QMPA 4FKLA 4EC8A 5BQ0A 4TZRA 2OG8A 2B9IA 3DK6A 3ZYAA 3U4WA 5L2IA 1EH4A 3GC0A 3KVXA 4TY1A 3LMIA 1GZ8A 3KKVA 5FTQA 2UW0A 3WI6A 3JYAA 4DEGA 3KXNA 4L01A 4UMRA 5LMBA 3W2OA 3MW1A 3NW5A 3KCFA 5D7VA 4ASXA 5HBJA 1OUKA 2XNMA 4OT6A 4F9YA 2YN8A 2WQBA 4BIDA 4QMMA 2GQRA 1WBNA 5FGKA 1Y6AA 3AD6A 2OGVA 2V7AA 3GT8A 3QZHA 4J98A 4OTRA 2BAQA 4XRJA 4AN3A 3U87A 4QRCA 3IGOA 3TNHA 1W7HA 3Q4ZA 3RK5A 3V51A 1LEWA 4O0WA 4YZ9A 4ZS4A 4RQVA 2W5HA 4FYNA 3DB6A 3D2KA 5KMJA 3A61A 1OPJA 4RVTA 3V8WA 2XCHA 4PPCA 5AUYA 1PHKA 1TQPA 2PSQA 3HUCA 3BGZA 5CI7A 3CP9A 5J9LA 2G1TA 3EFWA 3ZDUA 3PTGA 5JQ5A 4XP0A 4LGGA 4F0GA 4Q2AA 3FEGA 4DFZE 5BUIA 3Q2JA 3PFQA 1BL7A 4JQ8A 2XIYA 1Q3DA 3QTRA 2ZB1A 4IADA 5DN3A 1ND4A 4F08A 3Q9ZA 4DF3A 3ZLXA 2GPHA 3MVJA 4FSUA 3RKBA 1Q5KA 2IJMA 1JQHA 3PUPA 5KMMA 2YIWA 4WSYA 3UMXA 3CLYA 3P86A 4G3DA 4AOIA 3EQGA 4LM5A 3R83A 2PVNA 3HMMA 4NW6A 5HZNA 2R3KA 3VS0A 1JOWB 3PVWA 3QXOA 4BBFA 1KUTA 2JDTA 2F7ZE 3DGKA 4DEIA 4EHEA 4U80A 4DGNA 5EQPA 3C4FA 4R5SA 3C0GA 3ANRA 5TKDA 2W5AA 4JBQA 2HCKA 3RPOA 4YP8A 1APME 3LJ0A 2PK9A 3VS3A 1R0EA 1PMNA 3G9LX 4C4JA 3AC2A 2IO6A 3R28A 2YJRA 4JIAA 4PX6A 4F9CA 3L9NA 4FTAA 3F9NA 3U51A 4DAWA 2RG6A 4BDJA 3ODYX 3DFCB 3B8RA 4UYNA 3HV5A 5IUIA 3RPRA 4EK3A 3RNYA 3NGAA 4FTLA 5BVKA 3ZTXA 2W1GA 3RM6A 3FHRA 4F7JA 5E8ZA 5CEOA 3CTJA 4ANNA 2C5NA 1Q99A 4WUNA 1XH7A 2R4BA 3ZBFA 3PP1A 1H8FA 4RVLA 4XG6A 2V5QA 3LFAA 2ZYBA 4ZSAA 5E1SA 3IO7A 2BDWA 3RCDA 3DZQA 3EIDA 5CU4A 1FGIA 3FZRA 5FXQA 1YWVA 3DTWA 4IXPA 3EFJA 3R7VA 4PWNA 3FMDA 3RPVA 4OTFA 3RHKA 5HVJA 1UNHA 4F64A 4HVGA 3VBWA 5KMKA 3AG9A 3TCPA 2A27A 3R7OA 4MXAA 4FMQA 4JJRA 3UIUA 3FMHA 3QA8A 2YACA 4GT5A 3KXXA 3FUPA 3F3TA 2QOKA 3LFEA 4MK0A 3F3WA 3IGGA 1SVHA 3FMLA 4EZ7A 3OFMA 4UMUA 3ZO4A 4FTQA 4PDSA 4R7BA 3CGFA 3CY2A 2X9FA 3FYKX 3HMPA 3ZC5A 2EB3A 4OLIA 3R8PA 2BIYA 5I9YA 2QG5A 2RFEA 3DXPA 4QTEA 3QU0A 4GT3A 5AP6A 3QLGA 3QZIA 1HCKA 5E8SA 5HTIA 5EQEA 4OTDA 4CZYB 4FSYA 3SRVB 3P78A 1H24A 1BUHA 3KFAA 4K6ZA 5LOHA 5M44A 3ORKA 3QD4A 2IVVA 1OKWA 1ZYSA 2V55A 5JMSA 3KREA 3RK9A 3CKXA 3BWFA 4GG7A 3RAHA 2I1MA 2J0LA 3WE8A 4MNEA 1M2RA 2YISA 1F5QA 3CD8A 4ZTSA 2XMYA 3PY0A 5EKOA 1YHWA 5ITAA 4IJ9A 3OWJA 2XCKA 1WBPA 3WOWA 3IOPA 5CAUA 3U55A 4DINA 4G1WA 2QR7A 4LMNA 4EC9A 3I4BA 3OCGA 3OVVA 3QCSA 1NVRA 2OFUA 4FSWA 1GIIA 3Q96A 4CLIA 4EOQA 3NNVA 4C61A 4HYUA 2QC6A 1Q8ZA 2WQMA 4AGWA 5C8NA 5FDPA 3QX4A 5DYJA 3WF8A 2RFSA 3NYVA 4FL1A 4G2FA 3S1HA 3MFSA 3U9NA 4OAUC 4QO9A 5EI6A 1PY5A 2HIWA 3BELA 3LCDA 4PPAA 5LCJA 2Z7SA 4IIRA 4ANBA 5AR3A 2V62A 1HCLA 3TZ9A 3VN9A 4AW5A 3PLAE 2VX0A 1RE8A 2HELA 5H8GA 2UW6A 4RX8A 5GZAA 2YABA 2X8DA 4GIIA 1OL2A 4IZAA 1F0QA 4FEQA 2J4ZA 4V05A 4CMOA 1U5QA 3ALOA 1P14A 4M14A 1H28A 4BCQA 2NPQA 3W16A 1YDTE 5CANA 5CAPA 5C9CA 5F20A 2YHVA 3A2CA 3OUKA 3DAEA 3OOGA 3OBJA 4L7FA 4EK8A 4CFWA 3R22A 5M4CA 5C4KA 4R1VA 4U0IA 4N0SA 3C0IA 4C62A 3GP0A 3NNWA 3E87A 4EH8A 5T68A 3GCUA 3BV2A 4RJ8A 2PZYA 4IAFA 3EL7A 4FT5A 4JG8A 4Z16A 3OT3A 4FKGA 3AC3A 3ORPA 2PUNA 3PY1A 3G90X 3BHVA 3ZLWA 5AIRA 4AUAA 3FZ1A 2YDJA 4O7WA 1OKVA 1R0PA 4JOAA 3ZO1A 4OTGA 2YM8A 3LXKA 4KIOA 5CT0A 4C59A 3LM5A 3UBDA 3QHRA 1H0VA 1UVRA 2W1HA 3MJ1A 3ROCA 4GCJA 2C1BA 2PVFA 3V5TA 4JDHA 3I6WA 1A48A 4EK4A 5HIEA 5HO8A 4O82A 3MSSA 5HCXA 2VTIA 2C0OA 1CKPA 2VO6A 4RA5A 5M4UA 1KOBA 3E7VA 4WBOA 1P4OA 4BCGA 4WG4A 2QOHA 3IQ7A 3IW8A 3UQFA 3D15A 4MD7E 2GTMA 3OEZA 4JIKA 4F9BA 3S0OA 3W8LA 5IZFA 3CGOA 4R1YA 3R02A 2XNOA 1U46A 2WMXA 3O23A 2C4GA 3Q60A 5AP1A 3HMOA 3S2PA 3RM7A 4IDTA 4RBLA 4D2RA 3UZPA 4YU2A 1ZMUA 3PXRA 3FI3A 5EM7A 2RFDA 3P9JA 5CVHA 5DEWA 2PL0A 4PTGA 2R3PA 3HVCA 4F65A 4F7SA 3MIYA 3SW7A 4AN2A 5E9EA 4I22A 3KN5A 4UALA 2GNJA 4OTWA 4XX9A 2ZV2A 5DE2A 2HAKA 2IZSA 5CU6A 4BCPA 3UE4A 3W32A 4C7TA 4RX5A 4PDPA 4ALUA 4RA4A 4FVQA 1H27A 3PJ3A 3ZFYA 2YAKA 3PRFA 1L3RE 5AUWA 2ZMCA 3A62A 2HWPA 5CNNA 3UO6A 3G33A 3EFLA 4AE6A 2VWUA 5HOAA 5LVNA 4FKJA 2VV9A 4IE9A 3VS7A 1NA7A 4BDDA 1FMKA 2W5BA 3D7TB 3E63A 3EN5A 4C0TA 2BMCA 3HYHA 3LW0A 4C36A 3LPBA 4FF8A 4GG5A 3HV6A 4IZ5A 5H8EA 4BKJA 3OF0A 4N6ZA 4NM3A 2QU5A 4IM0A 3SXRA 1O6KA 2V0DA 4NM0A 4Y5QA 2EVAA 2VWIA 3S3IA 3NUAA 5HNGA 3ANQA 3UQGA 3E5AA 4QP3A 2GHGA 2J90A 4TWOA 3KXMA 5L4QA 4O0RA 1DAWA 4XEYA 5LVMA 2VWBA 4BN1A 3MH3A 4RLLA 2VO3A 5L6PA 3U6JA 5IA2A 2GFSA 2YFXA 3LFQA 4GYIA 4AZTA 3Q5IA 2WU6A 4QPSA 4BKYA 1B6CB 1JBPE 3BLHA 4QTDA 1PYEA 3IS5A 4FZ7A 4IM3A 5AV2A 1BI8A 3RAIA 4AFEA 2X2MA 2VTJA 2X7FA 4ZLZA 1OKZA 2Y4IC 4DH7A 4R6VA 3FE3A 4ZTQA 3I0OA 3E92A 4QP9A 3GOPA 3HRBA 5HLNA 5EW8A 5JQ8A 2PE2A 3AGLA 4MD8E 4FA2A 3RPSA 4MD9E 5IH6A 2YIRA 4FIJA 2GS2A 3U6IA 2B52A 4EOJA 3KGAA 2B9FA 2PZIA 3PXZA 4ZZMA 4O0UA 3QRKA 2OJGA 2OXXA 2C69A 1YDRE 3D5UA 4YZMA 4G3EA 1YVJA 3Q4CA 4R7IA 1WBTA 2J50A 4TWCA 4ENXA 4AWIA 2SRCA 4ZLYA 1W83A 4MKCA 4WKQA 4F1TA 4XG3A 4ANSA 4AU8A 3JPVA 3NSZA 1PKDA 4JT3A 4KRDA 4NSTA 2XK9A 2ZV8A 4JLCA 5K9IA 2C68A 4W8EA 5IA3A 1DI8A 2CCHA 4KA3A 3SKCA 1VJYA 3QALE 3U54A 2FSOX 2OZAB 4TNBA 4B8MA 4PL4A 4QPMA 3BLRA 4ZAUA 4UY9A 2GTNA 3H9FA 4QQJA 4GVJA 2UVZA 2QG7A 4DA5A 4CRLA 4FEVA 2EXEA 4FICA 3LXPA 1ZZ2A 3OWLA 4OTHA 4E20A 4YZDA 4NM5A 3V5JA 1Y91A 3IW5A 3DFAA 5HTBA 3TNWA 4EJ7A 1MRVA 3RI1A 4FIEA 5FD2A 4AACA 4CNHA 3DPKA 3HDNA 3V3VA 5CEKA 3FSFA 1OBDA 2XNBA 4LOPA 2B53A 2FH9A 2GU8A 2QOIA 3GI3A 2I0VA 3CQUA 4YHFA 2KULA 2VTQA 4A06A 2F2UA 3KN6A 3VW6A 4G3GA 4BDFA 3E93A 5T3QA 2IPXA 3L9LA 4NJDA 4JVGA 3D5XA 4JI9A 4MQ1A 4FSQA 4DYMA 1WBSA 2PZ5A 4ERWA 5JGDA 2QO2A 5CQUA 2WTWA 2I0YA 2GDOA 4E6CA 4ARKA 2ITXA 3NAYA 1J91A 2C6MA 3QTXA 5HNBA 4DTKA 5BX0A 1H1RA 4BCIA 3GFWA 3Q53A 3UVPA 3E62A 3OW4A 3LZBA 3NNXA 5FM2A 4CFFA 4WG5A 4MWHA 3UQCA 1H07A 3FPQA 2OU7A 2OWBA 3BGQA 4O0XA 3UNZA 4C4IA 5C26A 4E5BA 3NCZA 1XH5A 2XF0A 3UMWA 2R2PA 4I1ZA 3BYUA 3K3JA 5KMLA 4TWNA 3R8VA 5IEXA 4M66A 1OIYA 3A8XA 5CYIA 4OTIA 3U6HA 5BUJA 4G9CA 1SNUA 2C5XA 4D5HA 4RC2A 4I41A 3MFRA 4NK9A 4G3FA 4U81A 4I3ZA 2OI4X 3FSKA 5KO1A 1P2AA 1PXOA 3T9TA 4ZTMA 3QQKA 4D5KA 5LCKA 4QQ5A 3ZUUA 4GW8A 2HZIA 2QKRA 3GCQA 4C38A 4AOJA 4E4LA 5KHXA 4BTKA 4QP1A 2UZBA 3BU3A 1O6YA 2DYLA 3RAWA 2QLQA 2ZAZA 3I5NA 4GVAA 3PSBA 2VAGA 2BHHA 5D1JA 4EHVA 4EH9A 1QMZA 1WBWA 1QCFA 4F99A 3FZPA 3TG1A 4DG0E 4CKJA 3VF9A 4WO5A 4XG2A 5I9WA 4KRCA 3D0EA 3FXXA 4DHFA 3A7IA 3TUCA 3TDWA 3FLSA 5AUVA 4DG3E 4FNYA 4RIXB 3R21A 5E8XA 4P4CA 4AE9A 4NKAA 2J6MA 4DLIA 3FAAA 5M09A 3NMUF 3QXPA 3V8SA 2CGWA 5A6OA 3IECA 1MQ4A 4CEGA 1E1VA 2PWLA 3L8XA 5DWRA 2BAKA 4MXZA 2VX1A 4FKRA 4ZY4A 3FXZA 5CF6A 1AD5A 4BFMA 2XK3A 4D2VA 3EN4A 4V04A 5JFWA 5CZHA 4ASZA 3QQGA 1OUYA 4Y73A 5CX9A 3FLWA 3MFUA 2CKPA 4Z7GA 4AP7A 2OIQA 4BY9E 5CEIA 4LRKA 3PP0A 3UVQA 4JAIA 3C5IA 1NVSA 3HA8A 3MY0A 4P90A 4WHZA 4CFXA 3L8VA 1UKHA 4I94A 5LJJA 1NT2A 5EG3A 3SRVA 3ZLSA 3LFSA 3MGYA 3EQIA 3OUNB 2WTCA 2BIKB 1YDSE 3FKLA 4N4SA 3ZONA 2YA9A 2OXYA 3GC9A 1ATPE 3WE4A 4BRXA 5DIAA 3SXSA 5AR8A 3R7UA 5EW3A 3ORXA 4PUZA 4YJPA 3K5VA 1ZYCA 1S9JA 3R71A 4ZS0A 3RVGA 3TI1A 4G6NA 4AW2A 5JT2A 3SLSA 3K3IA 3RGFA 1UWJA 2BHEA 2CPKE 4O84A 5A4QA 2ERZE 2X2KA 5EI8A 1FVVA 3DAJA 4QYEA 2C5OA 5LWNA 5B2KA 3EQHA 4YNEA 1YHVA 4ITIA 5AV1A 1YI6A 3WZDA 3AMBA 3QTSA 3TT0A 4BTMA 4R77A 3A99A 1IA9A 5M07A 2CN8A 2YM5A 4S31A 4TXCA 2JBOA 2ITTA 4FKQA 4KNBA 2ONLA 4WT6A 4ZY5A 4EOSA 2GMXA 2Z2WA 2VN9A 2DUVA 1GIHA 3EJ1A 2WMUA 3ELJA 3R73A 1KE9A 2A1AB 1XH9A 2E9VA 3LMHA 4G5PA 4EYJA 4DTAA 3ZM4A 4XHKB 4S2ZA 3IG7A 2PVYA 4IAYA 2HZNA 3SQQA 1QPJA 2XP2A 3VBQA 1REJA 5TF9A 4Z55A 5IUHA 4I6FA 4UWBA 3EYHA 5FUTA 3PE1A 4IJPA 3AD5A 3H0YA 3JXWA 5LVLA 4X2FA 5HICA 4ENYA 2C30A 5IA5A 3UG2A 4MXOA 1GY3A 4MXYA 3DLSA 5A4LA 2W05A 3FYJX 5JH6A 4LOQA 2QHNA 5G1XA 3HV3A 3ZO2A 4NM7A 4USEA 2WOUA 3QRUA 4IB0A 4EKLA 3ZMMA 2JAVA 3L9MA 5I4NA 1H0WA 3BLQA 4NH1A 2B9JA 5A46A 1WVXA 2W4OA 1BKXA 3EQRA 4XNEA 4HYHA 4E6DA 4F6WA 4RFMA 1JWHA 1PKGA 2VWYA 1UNGA 2JFMA 3PXYA 5HORA 2Z02A 3QD2B 4NFNA 1DAYA 3UIMA 4S32A 5FXRA 4V0GB 3HUBA 4JBVA 2CLQA 5K4IA 3LQ5A 3R9DA 4U3YA 3DKGA 3H4JA 3MB6A 2BALA 3K54A 4I92A 1O6LA 4DEHA 4TYHB 2ITZA 3F3ZA 4R3CA 5EM8A 4LQMA 4M12A 1R3CA 4PP9A 2VD5A 3POZA 4QOXA 3U9CA 4BI1A 4FTOA 4F7NA 5C27A 4C57A 2IWIA 3CQWA 3MTFA 1YWNA 4E4NA 1Z5MA 4UWCA 3RNIA 3MESA 1M17A 2BRBA 4RRVA 4DE4A 1OB3A 1YXUA 5IQFA 2BILB 3I5ZA 3O50A 3C4XA 3O8PA 2OXDA 4I93A 4AG8A 1JVPP 4YTCA 4BTJA 4CFMA 4CG8A 2ZB0A 3GC8A 3AOXA 3B2TA 4O38A 4U8ZA 4O21A 3VRZA 4QPAA 2G01A 3JY0A 5HCZA 5TE0A 3TACA 4B0GA 4UYAA 3C5UA 3OTUA 3NVMB 2GHLA 4BI0A 4CZUA 4I23A 2WQEA 1YI4A 3AMYA 4G3CA 5IA0A 4E26A 4HVHA 3ATTA 3PVBA 2JKQA 2HW7A 4YLJA 3TNPC 3WF7A 4BCKA 5DHJA 3L8SA 5ANJA 2X8IA 5EHYA 4ZLOA 3UZRA 2XIKA 3FMNA 2OK1A 4MF1A 1Z9XA 2FUMA 4A4XA 3D7TA 4HNIA 4RJ3A 3TJCA 5FRIA 3OT8A 1SM2A 3D2IA 5E8VA 4AZFA 5ANEA 4UV0A 5C8MA 4B99A 4Z9LA 4QYYA 3PVUA 2JKOA 4Z3VA 2CNVA 3R9NA 5EDPA 3KL8A 3QQLA 3ZDIA 3DLZA 5AP0A 4NTSA 1KWPA 3PZHA 5EYKA 2BROA 4NCTA 5E92A 4AS0A 5IA4A 3V01A 3OTVA 4FSZA 5AAEA 2ETKA 3PXQA 3KY2A 4NEUA 4IB5A 1F3MC 4DEBA 3NUPA 4GFOA 3F66A 4I20A 3NAXA 2V7OA 5L6WL 3PWYA 4BWPA 4M13A 5AV4A 4J8MA 3OZ6A 1ERKA 3O17A 4CSVA 2O0UA 4EBVA 4FKIA 5L2SA 2YEXA 1Q4LA 2VWZA 4XG4A 5HE1A 1OL5A 4JQ7A 4HYSA 3RZFA 3GCVA 4U97A 1Q62A 2P2IA 3DDPA 5M51A 5L8KA 1R78A 4EZ3A 5ICPA 5HE3A 3RHXA 3HDMA 4IX5A 4OGRA 5CLPA 4BBEA 3O7LB 1JSVA 3CKWA 5I9ZA 3ATSA 3W55A 4CQEA 1K2PA 4NUSA 1SVGA 2W4JA 3KRRA 2WHBA 2YCQA 3T8OA 3ZRMA 4Q9ZA 5M53A 4RLKA 4CMUA 4UZDA 4YZBA 5ETCA 3PSDA 2WO6A 4A4LA 3F5GA 3ENMA 1QPDA 1WMKA 4RG0A 3SA0A 3C4WA 4E6QA 3EKNA 2C3KA 2IG7A 2JC6A 4FGRA 3P7CA 3EN7A 4BGHA 5KBQA 2PMIA 5EQYA 3NS9A 2OZAA 2P0CA 2C6TA 3BQRA 4UX9A 3IOKA 2GS6A 3I7BA 4IWQA 4RVKA 3EQDA 3U8WA 4G5JA 4NFMA 2O65A 3QTWA 3FBVA 3I7CA 5BPYA 1MP8A 2ZJWA 3C50A 5EK7A 4FIGA 4C3RA 3V5QA 3I79A 3IPHA 4L42A 3UNKA 1R39A 3O2MA 5ETAA 3Q4TA 4TPTA 4K8AA 3NIZA 4TT7A 3LFDA 2DS1A 2ZDTA 3BRBA 4GS6A 2R0IA 3RMFA 1WVWA 4KB8A 5AV0A 2R3GA 1QPCA 1OECA 2R3QA 1I44A 4YBKA 2BRMA 2RL5A 5FEEA 2XNGA 3FXWA 1PXKA 5AV3A 4IX4A 2CKQA 3Q32A 4KKHA 2VUWA 5M08A 5IQIA 4IFCA 3IKAA 3TNQB 4FNZA 3RK7A 2P4IA 3A4OX 4WUAA 3BYMA 3CJGA 4F7LA 5BVNA 4QMYA 1JSTA 4LMUA 1A9UA 5AMNA 4RT7A 4RJ6A 5CS6A 2W1DA 4ZZNA 1XBBA 5HI2A 2OJ9A 3LXLA 5AADA 2BDFA 4OW8A 4RMZA 1TQMA 2CKOA 1YOJA 2G2HA 2PE0A 4KBCA 4BTFA 1PRYA 3DBQA 3C4EA 3DBCA 3R2YA 2RFNA 4NYEA 3P08A 4W4YA 5TOZA 2Q0NA 2XM9A 5J9YA 4ZJVA 1ZWSA 2YLEA 3MI9A 4K9YA 3K5UA 4ZMEA 3BU5A 1YXSA 3HZTA 2Z7QA 3TV7A 3ZRLA 3EOCA 5AM7A 4DFXE 3AQVA 5I9VA 3AC5A 3W2QA 2GQGA 5FDXA 2QONA 2CHLA 4YO4A 1YW2A 5HKMA 5J7HA 3NR9A 3C0HA 3KXHA 3MV5A 5IEYA 3S95A 5AUZA 4OAVB 1UNLA 3V8TA 4BDKA 1OPKA 5EFQA 2KTYA 3QCYA 3R0TA 5F95A 4BDAA 4CT2A 4E93A 1GZOA 1PW2A 3E88A 4X0MA 4EUUA 3QA0A 1KV2A 3QD3A 5A6NA 5KNJA 3QWJA 4QNAA 4YC8A 4OT5A 3HAVA 4O96A 2XK7A 5FQDC 3BEGA 3VBYA 2FGIA 2XKCA 5AP7A 2UW8A 3LE6A 4YPDA 4ACHA 5DR2A 2XUUA 5M56A 3FMEA 3HL7A 4LRMA 4UXQA 4CD0A 3GCSA 4YUQA 1URWA 4FSTA 4HZSA 3AGMA 1IEPA 1VR2A 2F49A 3DBDA 2YCSA 3Q52A 4I5CA 4X21A 1CKIA 2CJMA 4DH8A 2J5FA 3PA4A 3BE9A 4WRSA 2ETRA 5FBNC 4YBJA 2C47A 3KMMA 2C5YA 2PYWA 1LEZA 2ITWA 4O27B 2NRYA 5JKGA 4FTMA 5JK3A 1VEBA 1OZ1A 4MAOA 4XG8A 5K0XA 3GVUA 3WIKA 5CASA 4YJVA 3PSCA 5DG5A 2YWPA 2J0JA 3FC2A 4RIXA 2VZ6A 1YQJA 2XEZA 3GEQA 4FKWA 4HCVA 5J87A 4AW0A 4PRJA 4IANA 2YM3A 3SG9A 5DPVA 3IW7A 2XJ1A 4IDVA 4O0YA 4MQ2A 5HD4A 5IDPA 3V5WA 2ONLC 4P2KA 4FL3A 1J1BA 3DQWA 3TKHA 3NX8A 1IAHA 5CT7A 4GJ3A 4D2PA 2OF2A 2VTLA 4FKUA 2QOQA 1BMKA 3LMGA 4FT0A 3COMA 5FBOA 5K4JA 1KV1A 3I0QA 3BGPA 1DI9A 3SAYA 3FI8A 1H25A 1M2QA 4FTUA 3QQHA 4KIQA 5HU3A 3KF4A 2WTKB 4XP2A 2WTKC 3VUGA 3NYNA 5GJFA 4JRNA 2BAJA 3QTUA 4N6YA 2OIBA 2IZRA 3ZS5A 3O7LD 2B55A 2J5EA 2WMTA 3DT1A 3O71A 4CFUA 3W2PA 2WFYA 4QP4A 4D9TA 4OTQA 4QP6A 1PXLA 3UYTA 4IAAA 3M1SA 3QRTA 2C5VA 4I6QA 5I3RA 4XV3A 3LFCA 4R8QA 3WILA 2PHKA 4EOKA 2OW3A 2YM7A 3Q2MA 1DM2A 4HVSA 3Q4UA 1B38A 3FPMA 4C4HA 1IAJA 2YIYA 2G2IA 4H3QA 4ZTRA 5I5ZA 2WZJA 2HYYA 2VTRA 4HGSA 5HG7A 3WYXA 2BCJA 5EHOA 4IM2A 3FQEA 1AQ1A 5KX8A 4QMSA 4GSBA 4DGOA 3F69A 5BVFA 3R1SA 4QP2A 2Y4PA 5EM6A 4EBWA 4C2VA 3FL4A 4O7NA 2CN5A 3VULA 1Q24A 5GIOE 4CGAA 2PZPA 3L1SA 3OHTA 3ZZWA 4BF2A 2Q83A 2R3RA 3H9OA 4I24A 5CENA 2H6DA 4A9UA 4OBQA 3KXZA 4HPTE 2UVYA 1T46A 3OBGA 3NUSA 5CSWA 1PXIA 5DR9A 2XBJA 4F0FA 3SXFA 3H3CA 2X39A 4EI4A 3R01A 3NNUA 2WPAA 3ODZX 4MHAA 2P55A 3QX2A 4LRJA 1JNKA 4ZP5A 2JD5A 4AA0A 3QQJA 3ALNA 4AZSA 1PF8A 1QPEA 2WXVA 3H10A 3Q3BA 5LARA 2XK6A 3MWUA 4M0YA 3REPA 3ZXZA 2ACXA 5AIKA 5FM3A 4ITHA 2WB8A 4NT4A 3KK9A 3AT4A 4ANOA 5CEPA 4FV3A 2UUEA 4YJSA 4QMUA 3P7AA 1UU3A 2QOFA 3PJ1A 3OS3A 5FG8A 4X2KA 3EQBA 4L52A 5AA8A 3DKOA 3LFBA 5J5SA 2O8YA 4X3FB 3DJ7A 4X3FC 2FSTX 2JITA 1CKJA 2PMLX 3KA0A 5KKRB 4XOYA 4O7LA 4EL9A 2J7TA 1MQBA 5HU9A 2CGUA 4YLKA 3SG8A 3COHA 4FI1A 3FLNC 3QCQA 1PXJA 2Y6MA 2XNNA 3HECA 4MBIA 5DGZA 3OWKA 4BC6A 3KRWA 4K2RA 2NNWB 5BYLA 4F9WA 2WEVA 4WNPA 2XKDA 5HG5A 2QU6A 5K5NA 1HOWA 4V0GA 3KCKA 4O91A 2R7IA 2WD1A 4O2ZA 2PE1A 4XV1A 3UIXA 3EMGA 3ZFMA 1WVYA 5ETIA 2FSLX 2WMWA 5CALA 2UW4A 5L3AA 3GXLA 5KMIA 2QQ7A 4AQCA 4TYHA 4C8BA 1Q61A 2HY0A 3TWJA 2HK5A 5BMSA 4QQCA 5HIDA 3QGYA 4IQ6A 4JR3A 3QF9A 2JAMA 5DMZA 4TWPA 3MH1A 5CZIA 5CEMA 4NCTC 3HA6A 3TV4A 3GU7A 2JDVA 2GCDA 3QYZA 1OL1A 4EHZA 4AOTA 3SD0A 1Q97A 2WQNA 1SMHA 2PY3A 3MN3A 5B7VA 3PXKA 5H9BA 4IX3A 3GENA 3FY0A 5AP4A 3R2BA 4HCUA 3AXWA 1BL6A 2HWOA 4FVRA 4U41A 2I0HA 3CQEA 4RJ5A 4X2JA 4FKSA 4CFNA 3H0ZA 3OEFX 2QNJA 3UO4A 5FEDA 4FSNA 3R8MA 5CXZA 2J0IA 5J7BA 4YTIA 2ZMDA 3LCKA 5LMAA 1U4DA 4M69B 4YJOA 2QOOA 3COIA 4R78A 3FHIA 5GZ8A 2EUFB 4JS8A 3UODA 2F7EE 3V6SA 4S33A 5B2LA 2I6LA 4ZSEA 3FC1X 2BPMA 3VW8A 5IQBA 3E8EA 4FZ6A 3OY1A 4AA5A 3R63A 2B9HA 4GMYA 4O1OA 2BTSA 3RBWA 4F09A 2E9PA 2PMNX 4DBXA 3E3PA 4FT9A 4P5ZA 1UU7A 4E4XA 2XH5A 1BLXA 3OOMA 3PRIA 4YHJA 4GFGA 5D11A 2HENA 4CKIA 4DGLC 3A7FA 4ACGA 2BZJA 4UXLA 1FOTA 3F3VA 5J8IA 4F1OA 4DH5A 5DR6A 4BZNA 3HRCA 3HEGA 4AT4A 5CVGA 5IQCA 4K18A 3ZBXA 4R3RA 2F57A 2ITYA 1WAKA 3OD6X 4GUBA 1V0PA 5HQ0A 3L9PA 3GB2A 3D7ZA 5E8YA 2GQSA 1PYXA 5DLSA 5CSPA 3NW6A 3P23A 4PQNA 2RG5A 2HXQA 4RIWB 3RZBA 4BGQA 3BV3A 3E8NA 2R3NA 5C8KA 3KMUA 2BTRA 5HEZA 4QYFA 4IZ7A 4W8DA 1J7LA 3UNJA 4LL0A 3TDVA 3GNIB 3PXFA 5IQDA 3AD4A 3IW4A 3FQSA 5BYYA 2QO7A 2YAAA 4WOVA 3LHJA 3ERKA 2PVJA 4CV9A 3PIZA 2H34A 3QQUA 5IH4A 2XIZA 3D83A 5I0BA 5JFXA 2X7GA 4FTKA 4I0RA 5AJQA 4QTCA 4LGDA 4TYJA 1UKIA 4LV5A 4IEBA 4EHGA 2I0EA 5IISA 3AT2A 3TIYA 2JDSA 2O2UA 3QZFA 4FKVA 4M84A 3MS9A 4FODA 4DTBA 3VHEA 3F5XA 4WG3A 5BUEA 4EH4A 5KE0A 1PJKA 2C3IB 3GBZA 2CSNA 3VJOA 3KC3A 2WTVA 3C7QA 3NPCA 1JKSA 2X9EA 3MPTA 3QFVA 4BDCA 5IH5A 3CSVA 2DQ7X 3ZUTA 2Z7RA 2YITA 2H9VA 2R9SA 3QC9A 3KVWA 4ZTNA 3N4UA 3FL5A 3FMKA 3QAME 4RIYB 5AUTA 3PJ2A 3BWJA 4QMZA 3D5WA 2Z8CA 4JBPA 3GOKA 3QUPA 3OMVA 1J7IA 1GOLA 4J1RA 4PNKA 2EU9A 2UV2A 1P5EA 2BFYA 5M57A 3ULZA 3LKMA 4FEXA 4AN9A 3BHHA 3RALA 2PZRA 3DS6A 4V01A 1CM8A 2HZ4A 4KSQA 4L3JA 2R3IA 1JPAA 4D4VA 1JAMA 3I60A 4G31A 3HLLA 5AA9A 4XV9A 4TYEA 5AAFA 3L8PA 2Y0AA 4IAZA 3SOAA 1U54B 3HMNA 2R64A 4OR5A 4IHPA 4ZEGA 4BICA 4TNDA 4FG9A 3VC4A 2VGOA 5CI6A 2BKZA 3HNGA 4L43A 3LCTA 3KRLA 4JRVA 4WIHA 4ID7A 4CKRA 2X4FA 1ZOHA 3RP9A 4RC3A 1OMWA 4W9XA 4GRBA 3CC6A 3DZOA 3EZVA 5HHWA 4Y85A 3U4UA 1Q41A 1H4LA 3LXNA 5AR4A 4Y72A 4DFYA 4GH2A 4FK3A 1WBOA 5CSXA 3VBVA 3MPMA 2PULA 4I0SA 5KCVA 2H96A 2UZUE 3R7YA 4C2WA 3C1XA 4I6BA 3I6UA 2YWVA 4XJ0A 1G3NA 2PUUA 2FA2A 3B2WA 4FNWA 1VYZA 4J7BA 5GIPE 4LG4A 1Y8GA 4FIIA 3VUTA 3G15A 3UOKA 1ZY5A 2VO7A 3VS5A 3BKBA 4O7RA 1AGWA 3VQUA 2OJIA 3RTPA 1RDQE 2C1AA 3JY9A 3UJGA 4JG6A 1B39A 3KB7A 3CS9A 4RWKA 4C3FA 4CYJA 5HX6A 4FTNA 3BBWA 5B2MA 4KS8A 4KIKB 1OPLA 2WTDA 5CF4A 3BQCA 1R1WA 5E91A 3F6XA 3FMMA 3TL8A 5CAQA 2CCIA 4IWOA 4ONAA 3UPXA 1NXKA 1OIQA 4RPVA 5KZIA 3FWQA 5H8BA 5DOSA 1UA2A 5ACBC 4AAAA 4BDIA 1ZY4A 5JEBA 3UDBA 3ZSIA 3R8UA 5AUXA 4DEAA 5KHWA 2ZV7A 1WFCA 2C6DA 3JS2A 2ZM1A 3MVMA 3BBTB 3EL8A 4L6QA 4IMYA 3O51A 3CTQA 2A2AA 2XB7A 4M8TA 4OBPA 4RFZA 4JBOA 4UWYA 4MTAA 4DITA 1XO2B 1Z57A 1XH4A 4U5JA 4L3PA 4D1SA 4DFBA 4M7IA 3R9OA 2QURA 1OITA 4JAJA 2QOBA 4IWPA 2ITOA 3DU8A 5J95A 2AC3A 2XEYA 3POOA 4QT1A 3VIDA 4DN5A 4K77A 1Q3WA 3EN9A 2IZUA 3DXQA 5D7AA 4XLIA 4DFUA 4PP7A 2GSFA 5J1WA 5BNJA 4B8LA 3N4VA 4I5HA 3PIXA 3UC3A 4D55A 1PMUA 4QTBA 5HO6A 4ANMA 3Q9WA 2R5TA 1XR1A 4YO6A 3TM0A 2B4SB 2XJ0A 4J99A 5TR6A 2YZAA 3VNTA 3R00A 1I09A 5CY3A 5CF5A 5M06A 1H08A 4XBUA 2UZEA 3ENHA 3IDCA 4M97A 5EH0A 2ZV9A 4XLVA 5AX3A 2HXLA 4MF0A 3IONA 4MXCA 4QMNA 3VVHA 2IZTA 1V0OA 4TKSA 5JFSA 2B1PA 1SZMA 2E9UA 2P33A 1RQQA 3QRIA 5ANOA 4BCJA 5AAGA 3MDYA 2QHMA 1XBCA 4FZDB 4DGMA 3EFKA 2ITQA 4X2NA 3DK3A 1Q8UA 1VZOA 4BR3A 2XRWA 2ZOQA 5CF8A 2P2HA 3GU4A 3MFTA 3LCOA 2IVTA 2XIRA 2XKEA 1UU8A 2A0CX 1Y57A 3W2RA 4O86A 4MBLA 4EUTA 2WEIA 2W96B 3G6HA 5C03A 2JDOA 3KMWA 5GNKA 3JUHA 4DT8A 2B54A 2W1FA 2WMQA 4L45A 3TXOA 4QTAA 2BDJA 2WELA 1XWSA 2VTHA 3MPAA 2XYUA 4FG7A 2JKKA 2VTSA 4XOZA 4BI2A 3IDBA 1M2PA 3BIZA 4YPSA 3ZSHA 3GQLA 4O7YA 1JKTA 1O9UA 4NTTA 4L8MA 1FGKA 3DKFA 4FOBA 4BKZA 3F2AA 3M2WA 5EDQA 3F5PA 3FQHA 5KZ0A 1SVEA 3CCNA 3PVGA 5DH3A 3LLTA 1M52A 5ETFA 3KRXA 3G2FA 3CR0A 4EH2A 4KBAA 3VUKA 3WF6A 1FBNA 5EOLA 4J8NA 3GFEA 1ZOGA 2ITNA 3ORIA 4XUFA 4CFVA 4W4XA 3QC4A 4F9AA 3GU5A 5EM5A 2E2BA 4PTEA 5JZJA 5F1ZA 5HLPA 4L46A 1H1SA 5CAVA 2Z60A 5M4FA 4O7ZA 3BPRA 1M7NA 2BRGA 3PG3A 4ZSJA 1M7QA 2C6OA 3CPBA 1GNGA 3EWHA 3V6RA 2R3MA 4LFIA 3F82A 3KK8A 5ANKA 4O7SA 1STCE 2R3OA 3ORLA 3QUDA 2HOGA 4G6LA 4ZK5A 3TTJA 2UZVA 2C6KA 3DQXA 4X3FA 4JG7A 3QHWA 4F6SA 3ROYA 2JGZA 4D2SA 3KQ7A 4NWMA 2OJFE 2V22A 3SV0A 2WQOA 4N70A 4CZTA 4O2PA 5HD7A 4YR8A 2PUPA 3HGKA 3LM0A 4KUJA 3OC1A 2EXCX 3BE2A 1S9IA 2YJSA 3DJ5A 4YSJA 5A54A 2C6LA 5IDNA 4FV5A 3Q6WA 4FEWA 2QCSA 3DOGA 3MBLA 4FTJA 3ZOSA 4FTTA 4FV9A 5E90A 2X6EA 4TRLA 3T3UA 1SNXA 4ALWA 1YXXA 4U44A 5A9UA 4CVAA 3R7IA 4ERKA 3W33A 2BKKA 4ZXTA 3LQ8A 4FR4A 3PG1A 1MUOA 1GZKA 1OVEA 4IB3A 4OUCA 2W1EA 5AP5A 5TO8A 3ZSGA 4J97A 3QKMA 4CMTA 4WA9A 2VO0A 3C4ZA 3UGCA 1L8TA 4EORA 2UZOA 4QMTA 2AC5A 4YSMA 4DH3A 5KBRA 3R9RA 1XHAA 4D2TA 4EONA 4BIBA 4RIOA 2W7XA 3ZEPA 1XKKA 5JZNA 5K5XA 4DFLA 3UP2A 4UEUA 4EKKA 4EOLA 5F94A 2EXMA 4U7ZA 4CYIA 4FBXA 5HBHA 3UOLA 5L2WA 4FV4A 5AR2A 2RF9A 3C51A 4P7EA 1UWHA 3WARA 4U79A 4AGUA 5JRSA 3FV8A 1OGUA 3M42A 4KBKA 2Y8OA 4M3QA 2GFCA 2CNUA 4PMMA 2O63A 4YTFA 5EW9A 4Y46A 4FK6A 4IB1A 1H1QA 4AFJA 4BWXA 4E8AA 4YTHA 3LJ1A 4M69A 5AEPA 3KULB 2H8HA 4IX6A 3A7HA 2C6EA 2X81A 4XG7A 4EOMA 4NU1A 1G8SA 4F63A 4FVPA 4D9UA 5AWMA 3JVSA 3H9RA 3LLAA 2R3FA 3BHTA 4I6HA 4G16A 2PUIA 4FL2A 4Q9SA 2PVRA 5IEVA 4DCEA 4R3PA 1ZOEA 4BYIA 2Y9QA 3P7BA 4W4VA 5KMNA 1OBGA 2PU8A 4BYJA 2OO8X 3NRMA 1YI3A 2WMVA 5K0KA 1ZLTA 4XYFA 4RQKA 3VAPA 3V5LA 3RWPA 3ZH8A 3CY3A 1FMOE 1V1KA 3LFFA 3NEWA 2R0UA 3SDJA 3UOHA 4FV8A 3VWAA 5EYMA 4HPUE 4H58A 5BYZA 4L68A 2BRHA 4Y95A 5JFVA 5LMKA 3V04A 4O7TA 5IF1A 1OL7A 3OY3A 3G0EA 4QYGA 3CJFA 2VNYA 3DDQA 3PPKA 4Y8DA 4YLLA 4BCHA 3JR1A 4L7SA 3B8QA 3VHKA 3K2LA 3NIEA 4GKIA 2G15A 4K0YA 3DKCA 2XS0A 2XNEA 4DCAA 5ANDA 2CDZA 3FLQA 3VS1A 4AT3A 4OBOA 4EYMA 4RIWA 4IH8A 4GEOA 4F70A 5HO7A 2C0IA 1W84A 2JBPA 1PMEA 3MVHA 4JXFA 3VBXA 2DWBA 3LVPA 4D0WA 2W9FB 4FEUA 2QVSE 2WTIA 4MX9A 4EWHA 4HVDA 4XH6A 5DBXA 4C58A 5BMMA 3G6GA 3D9VA 4PDOA 3BEAA 4H3PA 4X6RA 1IRKA 4ACMA 3NDMA 1OIRA 5IG1A 3ZFXA 1A06A 2G9XA 2JFLA 4XCUA 2QI8A 2XJ2A 4BDHA 2ITVA 2QD9A 3GGFA 2UW7A 3VUHA 2QLUA 3C4CA 3NW7A 4ZY6A 4UMPA 1ZYJA 4HYIA 4Z7HA 4K1BA 4Y5HA 1YXVA 4ZZOA 5IPJA 4LL5A 2WIPA 2X4ZA 4ZTHA 4IC7A 3VUDA 3C13A 3CTHA 4IVCA 5GHVA 4ACDA 3NUUA 4H1MA 4RZVA 5FP6A 3NYOA 4RIYA 5HG8A 1WCCA 2XVDA 4HGEA 1MRYA 3UO5A 2XYNA 3CXWA 5T6KA 2YERA 5DNRA 3F7ZA 4BCFA 5A4CA 1J7UA 5EKNA 4S34A 4DG2E 5DRBA 2P3GX 1OM1A 2UZTA 3EYGA 4FKOA 3PA5A 2WU7A 5AP3A 3PY3A 4ZMFA 1XH8A 3FI2A 1XQZA 2Y7JA 3O0GA 5FTOA 4AA4A 1J1CA 2A19B 2YIXA 2FB8A 1T45A 3MB7A 4D4RA 4KD1A 4MYGA 1GIJA 1YHSA 3O96A 5DT4A 1IASA 4A4OA 4CRSA 2UZLA 2X0GA 2YDIA 4IVAA 2W1CA 4RWLA 3R30A 1U54A 2W99B 3AC4A 1YXTA 4DLJA 4TN6A 4H36A 3P1AA 1TVOA 2QOLA 1X8BA 3KF7A 4GU6A 4NIFB 4YHTA 4X2GA 2W06A 3OXIA 5C4LA 1OI9A 3GUBA 1W8CA 3LJ2A 4LOOA 4A7CA 4GYGA 5CXHA 5HNIX 5AR7A 2XBAA 4L3LA 3WZEA 1GJOA 4YMJA 5IQAA 2WMAA 1P4FA 2XRUA 4AX8A 4C4GA 1NY3A 2OIDA 4PTCA 2R3LA 2HY81 3DBEA 3UOJA 3NWWA 4F4PA 3R9HA 4WNMA 3HP5A 1BYGA 2NRUA 3NLBA 1H26A 4J71A 4MWIA 4U3ZA 4QMQA 5GZ9A 4H05A 4B4LA 2WAJA 3HX4A 4PF4A 3FZOA 4PL3A 4XV2A 4L00A 3NCGA 2E9OA 4FV0A 4JDKA 3TZMA 4C34A 4QMOA 4DGGA 3QBNA 1ZMWA 4KSPA 4XS2A 4XRLA 5L2TA 5FEQA 5B0XA 3OCSA 4BCMA 1WBVA 2PVKA 4C37A 4CTBA 2UVXA 5LWMA 5CU0A 3HP2A 4GL9A 4JNWA 2J9MA 3AMAA 3EZRA 2NO3A 3OROA 3VS6A 1Q8YA 4KIKA 2YM6A 3OXZA 4K33A 1KOAA 5EYDA 1UU9A 3T9IA 3PYYA 3TZ7A 5GINE 4PPBA 4BB4A 3ORNA 2OFVA 4XP3A 3P79A 3PJCA 4FKTA 4L67A 2RGPA 4D58A 1Q8WA 4A9TA 4E1ZA 2HZ0A 3DB8A 3QGWA 2QO9A 3RWQA 1RW8A 4BDBA 1BI7A 3DY7A 4FT3A 3DA6A 5DT0A 4EQUA 1Y6BA 3D14A 3KEXA 5DA3A 4BZOA 3PIYA 4FE2A 3QKLA 3GU8A 3Q5ZA 4BCNA 2O3PA 3FDNA 4FTRA 4RX9A 4FZAB 3TKUA 4ZJIA 3W18A 3O8UA 5JRQA 3EHAA 3PPJA 3UVRA 2VTMA 3ITZA 3R1NA 3SHEA 3PA3A 4GUEA 5IMXA 3TKIA 2CGXA 3QZGA 3CPCA 4WNKA 5KMOA 2VGPA 4A9YA 2J0MB 3AC8A 2YLFA 2J2IB 3G51A 3S4QA 2XA4A 3UIBA 2X6DA 4HCTA 4IACA 4NL0A 1ZYDA 1MRUA 1W0XC 5CTPA 4C02A 5CEQA 4EOIA 2JLDA 3ZO3A 5AUUA 3VQHA 5F9EA 4BDGA 5J9ZA 3ACJA 5J79A 3EH9A 4KAOA 5CVFA 4YC3A 4CG9A 1SYKA 1DS5A 4RGJA 3TUBA 2GHMA 3CEKA 4Q5EA 4ACCA 4IC8A 3QKKA 1PXNA 3QD0A 2RSVA 2FSMX 4II5A 4FYOA 5L6OA 4YZNA 5CU2A 4USFA 1XJDA 3V5PA 4HGTA 3SC1A 2JDRA 3SOCA 1CDKA 2BVAA 5D41A 2WMBA 4L44A 4PMTA 4D1XA 4HGLA 2XKFA 3R1QA 4MBJA 4HVIA 3A60A 2WOTA 4XMOA 5EYCA 4WSQA 4O7VA 2F7XE 3QRJA 5KKRC 4QP7A 4CTCA 5HLWA 4EOOA 4DBNA 2PTKA 4RVMA 4BBMA 4I21A 3ZLYA 5JGBA 2CKEA 4YGAA 2IW9A 4HNFA 3DTCA 3KXGA 1FPUA 3ORMA 1H00A 5BVDA 4UN0C 3UYSA 4DFNA 4DT9A 1U5RA 4ITJA 2WKMA 3FKOA 4UZHA 1TQIA 3VJNA 3HAMA 4E5AX 2OH4A 3LFNA 4GIHA 5BVEA 1ZYLA 3WBLA 1K9AA 1OIUA 3E64A 1IR3A 3BHUA 4FTCA 5CU3A 2OBJA 4EH5A 3ZEWA 2ZM4A 4GV1A 5HTCA 3DAKA 5EDRA 2WTJA 3OXTA 1U59A 2JIIA 3JVRA 2ERKA 3CBLA 4X3JA 5HESA 4O81A 2PVMA 3UP7A 5L2QA 4EH6A 4JX7A 2IW6A 3EKKA 1TKIA 3T3VA 3QLFA 4O83A 3DNEA 2VTNA 3OP5A 4B7TA 1LUFA 1ZARA 3BCEA 5AR5A 3A7GA 3RPYA 2VU3A 1KE7A 3N9XA 4R7HA 3KRJA 3TEIA 3ZRKA 3MJ2A 2BUJA 2PVLA 4PDYA 5JSMA 3R7GA 5DEYA 1KE8A 3HMIA 5E7RA 4EWQA 3ZC6A 4EEVA 2E9NA 3D4QA 5EHLA 4PV0A 3NUYA 3M11A 1V0BA 4AZWA 3QUEA 4BVUA 3G9NA 4LUEA 4UMQA 5LVPA 4YJRA 3BX5A 2YDKA 4W4WA 4ANLA 2IW8A 4DEEA 4EH3A 3F5UA 5IUGA 3FZTA 3PLSA 1H1PA 4FC0A 4H3BA 4TTHB 4S30A 4GU9A 2QOCA 4YJUA 4USDA 5AX9A 2BR1A 5ANIA 1YRPA 4BL1A 2UZWE 4FV7A 1RJBA 4QNYA 4W9WA 5A3XA 1ZZLA 4XG9A 4FUXA 2ESMA 4ZSGA 1WZYA 4CLJA 5KUPA 2Y4IB 2IVUA 2Z7LA 3ET7A 3IDPA 3MY1A 3OW3A 4G34A 4MEDA 3Q6UA 5FP5A 5IU2A 5L8LA 3SGCA 3I1AA 1YWRA 2W1ZA 4ZIMA 5K3YA 3QTIA 4EK6A 1G5SA 4AF3A 2YZLA 2QODA 1ZRZA 1YOMA 2CMWA 1W82A 3TNIA 5HX8A 1JKLA 5LMKC 4IBMA 3WYYA 3WZKA 1ZXEA 2VTTA 4IAIA 3DK7A 4FSRA 1KE5A 3ACKA 4UBAA 4NZWB 4A07A 3S00A 1CMKE 2I7QA 4G6OA 1PXMA 4E6AA 3HV4A 3DV3A 5DI1A 4QMVA 3PDTA 4QMWA 5HVYA 2CNQA 3VUIA 5IQHA 2UZDA 4RJ7A 3UC4A 3R04A 2WMRA 3W1FA 3F2RA 3E8DA 4IAKA 4I0TA 5LVOA 4C33A 2UW9A 3N51A 3TJDA 4FOCA 4KIPA 2C0TA 2G2FA 4QMXA 3F61A 3VF8A 3ZCLA 3FZSA 4YC6A 3W2SA 3D94A 1LPUA 3HKOA 3DNDA 4J95A 3BYVA 4QQTA 2GNIA 3KULA 3R6XA 1H01A 4JR7A 4LYNA 5C1QB 2C6IA 4A9RA 4BCOA 4TL0A 2ITPA 2UZNA 4PNIA 4CV8A 4F1MA 4FTIA 4C4FA 5HE0A 5IMEA 4YNOA 4O22A 4KWPA 4E73A 2ZDUA 1LP4A 4X6QC 1PMVA 4U45A 3PWDA 2RKUA 2W1IA 5AP2A 2OLCA 1NVQA 2F2CB 2YCRA 3GC7A 3P5KA 2GNFA 3CE3A 4FX3A 4WRGA 3R8ZA 5LQFA 3CD3A 4QYHA 5TT7A 3HRFA 4WD5A 3P4KA 4PY1A 4Q5HA 4D28A 3NYXA 3PE2A 1OKYA 1E9HA 4ORKA 1PXPA 4GK3A 4TYIA 4GFMA 4FIHA 4ZSLA 3LQ3A 5BVWA 4RWIA 1IA8A 4K11A 4M68A 1LR4A 4U42A 3R8LA 3ZM9A 5J1VA 2F9GA 5E8WA 2NP8A 3E7OA 4OTPA 3ZUVA 5HVKA 2BZHB 5CNOA 2IVSA 5E4HA 4RSSA 3IK3A 4H1JA 5HBEA 4H39A 5AFVA 3BZ3A 3LAUA 5FWKK 3TV6A 3W8QA 4QMLA 2VNWA 4B9DA 1FINA 2WNTA 5I9UA 2X7OA 1JKKA 2JEDA 5IQEA 3FKNA 2UW3A 4O6LA 2AUHA 2IN6A 3BHYA 2EWAA 4EQCA 4O0TA 4G9RA 3OCBA 4FV2A 3UZTA 4FUYA 2XK4A 2CLXA 4N57A 3KU2A 2FYSA 4NKSA 5A4TA 2J51A 5E8TA 3E8CA 5GJDA 4PMPA 3MH0A 4DH1A 1Q8TA 2F4JA 2QKWB 4FV6A 4PL5A 4BWKA 2PPQA 4BGGA 4WNOA 5JN2A 4AW1A 5CSHA 1URCA 2YIQA 5CWZA 5H3QA 4AT5A 3BI6A 5GJGA 3DBFA 2BZIB 2X2LA 3ZXTA 4AGDA 4ALVA 5DRDA 4B6LA 4D2WA 2X8EA 4GT4A 3N4TA 2FVDA 1ZMVA 4UB7A 4YJQA 4HOKA 3QTQA 3I81A 1JLUE 4MNEB 3OCTA 3DCVA 4MNFA 3WF5A 3ZZEA 4L53A 2YCFA 5JGAA 2R3JA 2X1NA 3DJ6A 5BVOA 2WGJA 2YM4A 3QCXA 1K3AA 4D1ZA 1FQ1B 2R3HA 1OL6A 3A4PA 5ANGA 1CSNA 2XIXA 1UV5A 1Y8YA 2HW6A 2LGCA 4O6EA 1GAGA 4YURA 2R7BA 2JKMA 1YKRA 3MIAA 3EQFA 3VO3A 4I4EA 2GNLA 4NIFA 2ETMA 2A4LA 4MXXA 5ACKA 2W4KA 2AYPA 3H30A 3IW6A 3ORZA 4M15A 2J0KA 2O64A 4FSMA 4CXAA 2JIVA 5H2UA 3UTOA 4EH7A 3VUMA 2OF4A 2PVHA 3VS2A 4E4MA 4IVDA 3F2NA 5HG9A 4KABA 1W98A 5HCYA 4EJNA 2W9ZB 4XBRA 3TIZA 1NW1A 3F7WA 2B7AA 1GZNA 4CT1A 3RAKA 3MY5A 4CQGA 3BYSA 2Q0BA 4MH7A 4RFYA 4GKHA 2GS7A 3G0FA 1J3HA 3MVLA 3FLZA 4IW0A 4EQMA 3MA3A 3ORTA 5LXMA 4LGHA 4O1PA 2OICA 2ZVAA 3D5VA 3II5A 4I4FA 4F6UA 4UMTA 4AGCA 2OJJA 3AT3A 3QWKA 3SW4A 4FV1A 3TZ8A 3A7JA 5IA1A 3VBTA 4RWJA 3GQIA 3A8WA 1E1XA 2JIUA 2VWVA 2VX3A 3EQCA 4FG8A 2OKRA 1IG1A 4NJ3A 3SX9A 4AZVA 4C35A 4CCUA 3ULIA 1G8AA 4BIEA 2Y6OA 3RINA 3THBA 5J5TA 4JDJA 3CIKA 5CAOA 1ZAOA 3C9WA 3GU6A 1XH6A 2BZKB 3PZEA 4X7QA 5E8UA 4AXAA 4CCBA 2XK8A 4P5QA 4ZTLA 4EK5A 3WZJA 3NZ0A 4F0IA 3O8TA 2WMSA 5EOBA 4U43A 3SVVA 5A14A 3GCPA 5HGIA 3NVKI 4U6RA 4IWDA 4E5WA 2QR8A 3QQFA 3ZHPC 4IVBA 5EI2A 3P0MA 4RC4A 3G5DA 4D4SA 3QYWA 1KE6A 2RIOA 3MA6A 5FTGA 1KSWA 3BYOA 5IKWA 2LAVA 4J96A 4MCVA 4HJOA 4QP8A 3Q9YA
chains in the Genus database with same CATH superfamily
4D0XA 3E3BX 1JSUA 3OWPA 1FVTA 2GNGA 3VS4A 3MH2A 3DXNA 5AM6A 5FXSA 1W2DA 2O5KA 3Q04A 2VWWA 4NW5A 3WIGA 4J53A 4GK2A 2OH0E 4KKEA 5CSVA 2BRNA 3NUXA 4RZWA 4ASEA 3TN8A 3PPZA 5A4EA 4DC2A 4EOPA 4ANQA 5M4IA 4F78A 4GJ2A 4AZEA 4YJNA 5DVRA 5CQWA 4YJTA 3F88A 5I3OA 4ZJJA 4ASDA 3LCSA 2REIA 4M0ZA 1BX6A 2BFXA 2OSCA 2VTAA 4FKPA 3RCJA 4JL9A 3R7EA 2PMOX 3EN6A 2FO0A 3FLYA 4FZFB 1QL6A 2W0JA 5HE2A 4BDEA 5D10A 4L9IA 4YZCA 4TYGA 3VRYA 4C4EA 3KIOC 3FY2A 3Q9XA 4LI5A 4G17A 4IFGA 5L8JA 3EQPA 4KS7A 3WZUA 4BHNA 3FMJA 4D4YA 4Y83A 4O0VA 4TW9A 2VRXA 3EB0A 4QD6A 5DT3A 4FT7A 1H1WA 1VYWA 4HZRA 2ITUA 4FNXA 5M55A 1CTPE 5DFPA 2W17A 5D9HA 5F4NA 4BZDA 3QTZA 4KINA 4RX7A 4MVFA 5I9XA 4FGBA 3FI4A 3TUDA 3HV7A 4O0SA 5HIBA 4PMSA 3ZU7A 3TTIA 2XM8A 3MTLA 3LIJA 3LOKA 4EZ5A 2VTPA 3NUNA 4KKGA 1REKA 4E7WA 1XBAA 4GK4A 3BU6A 3QL8A 4APCA 2I40A 2XNPA 3ID6C 5E1EA 1YOLA 2C3JA 2UW5A 2ZM3A 3ETAA 3OG7A 4IZYA 4JX3A 4JQEA 4RJ4A 3UG1A 3FJQE 2GNHA 3WF9A 4JDIA 4U9AA 4E3CA 3W10A 2C3LA 2VTOA 3AC1A 2CGVA 2XZSA 3R1YA 4LV8A 1M14A 3W2CA 4C3PA 2EB2A 4I5PA 4DEDA 4BHZA 4M67A 4LUDA 5D12A 4R5YA 3RJCA 4HW7A 4J52A 4A9SA 5G6VA 4U40A 5FLFA 3PJ8A 4WBBB 1FVRA 2WIHA 5C01A 5IQGA 4ZOGA 3F3UA 2B0QA 4I5MA 2OZOA 2VWXA 3COKA 3MYGA 4FIFA 3UPZA 4APPA 4QMPA 4FKLA 4EC8A 5BQ0A 4TZRA 2OG8A 2B9IA 3DK6A 3ZYAA 3U4WA 5L2IA 1EH4A 3GC0A 3KVXA 4TY1A 3LMIA 1GZ8A 3KKVA 5FTQA 2UW0A 3WI6A 3JYAA 4DEGA 3KXNA 4L01A 4UMRA 5LMBA 3W2OA 3MW1A 3NW5A 3KCFA 5D7VA 4ASXA 5HBJA 1OUKA 2XNMA 4OT6A 4F9YA 2YN8A 2WQBA 4BIDA 4QMMA 2GQRA 1WBNA 5FGKA 1Y6AA 3AD6A 2OGVA 2V7AA 3GT8A 3QZHA 4J98A 4OTRA 2BAQA 4XRJA 4AN3A 3U87A 4QRCA 3IGOA 3TNHA 1W7HA 3Q4ZA 3RK5A 3V51A 1LEWA 4O0WA 4YZ9A 4ZS4A 4RQVA 2W5HA 4FYNA 3DB6A 3D2KA 5KMJA 3A61A 1OPJA 4RVTA 3V8WA 2XCHA 4PPCA 5AUYA 1PHKA 1TQPA 4DDIA 2PSQA 3HUCA 3BGZA 5CI7A 3CP9A 5J9LA 2G1TA 3EFWA 3ZDUA 3PTGA 5JQ5A 3TMOA 4XP0A 4LGGA 4F0GA 4Q2AA 3FEGA 4DFZE 5BUIA 3Q2JA 3PFQA 1BL7A 4JQ8A 2XIYA 1Q3DA 3QTRA 2ZB1A 4IADA 5DN3A 1ND4A 4F08A 3Q9ZA 4DF3A 3ZLXA 2GPHA 3MVJA 4FSUA 3RKBA 1Q5KA 2IJMA 1JQHA 3PUPA 5KMMA 2YIWA 4WSYA 3UMXA 3CLYA 3P86A 4G3DA 4AOIA 4QEBA 3EQGA 4LM5A 1ST0A 3R83A 2PVNA 3HMMA 4NW6A 5HZNA 2R3KA 3VS0A 1JOWB 3PVWA 3QXOA 4BBFA 1KUTA 2JDTA 2F7ZE 3DGKA 4DEIA 4EHEA 4U80A 4DGNA 5EQPA 3C4FA 4R5SA 3C0GA 3ANRA 5TKDA 2W5AA 4JBQA 2HCKA 3RPOA 4YP8A 1APME 3LJ0A 2PK9A 3VS3A 1R0EA 1PMNA 3G9LX 4C4JA 3AC2A 2IO6A 3R28A 2YJRA 4JIAA 4PX6A 4F9CA 3L9NA 4FTAA 3F9NA 3U51A 4DAWA 2RG6A 4BDJA 3ODYX 3DFCB 3B8RA 4UYNA 3HV5A 5IUIA 3RPRA 4EK3A 3RNYA 3NGAA 4FTLA 5BVKA 3ZTXA 2W1GA 3RM6A 3FHRA 4F7JA 5E8ZA 5CEOA 3CTJA 4ANNA 2C5NA 1Q99A 4WUNA 1XH7A 2R4BA 3ZBFA 3PP1A 1H8FA 4RVLA 4XG6A 2V5QA 3LFAA 2ZYBA 4ZSAA 5E1SA 3IO7A 2BDWA 3RCDA 3DZQA 3EIDA 5CU4A 1FGIA 3FZRA 5FXQA 1YWVA 3DTWA 4IXPA 3EFJA 3R7VA 4PWNA 3FMDA 3RPVA 4OTFA 1XMLA 3RHKA 5HVJA 1UNHA 4F64A 4HVGA 3VBWA 5KMKA 3AG9A 3TCPA 2A27A 3R7OA 4MXAA 4FMQA 4JJRA 3UIUA 3FMHA 3QA8A 2YACA 4GT5A 3KXXA 3FUPA 3F3TA 2QOKA 3LFEA 4MK0A 3F3WA 3IGGA 1SVHA 3FMLA 4EZ7A 4DDGA 3OFMA 4UMUA 3ZO4A 4FTQA 4PDSA 4R7BA 3CGFA 3CY2A 2X9FA 3FYKX 3HMPA 3ZC5A 2EB3A 4OLIA 3R8PA 2BIYA 5I9YA 2QG5A 2RFEA 3DXPA 4QTEA 3QU0A 4GT3A 5AP6A 3QLGA 3QZIA 1HCKA 5E8SA 5HTIA 5EQEA 4OTDA 4CZYB 4FSYA 3SRVB 3P78A 1H24A 1BUHA 3KFAA 4K6ZA 5LOHA 5M44A 3ORKA 3QD4A 2IVVA 1OKWA 1ZYSA 2V55A 5JMSA 3KREA 3RK9A 3CKXA 3BWFA 4GG7A 3RAHA 2I1MA 2J0LA 3WE8A 4MNEA 1M2RA 2YISA 1F5QA 3CD8A 4ZTSA 2XMYA 3PY0A 5EKOA 1YHWA 5ITAA 4IJ9A 3OWJA 3P5JC 2XCKA 1WBPA 3WOWA 3IOPA 5CAUA 3U55A 4DINA 4G1WA 2QR7A 4LMNA 4EC9A 3I4BA 3OCGA 3OVVA 3QCSA 1NVRA 2OFUA 4FSWA 1GIIA 3Q96A 4CLIA 4EOQA 3NNVA 4C61A 4HYUA 2QC6A 1Q8ZA 2WQMA 4AGWA 5C8NA 5FDPA 3QX4A 5DYJA 3WF8A 2RFSA 3NYVA 3W0SA 4FL1A 4G2FA 3S1HA 3MFSA 3U9NA 4OAUC 4QO9A 5EI6A 1PY5A 2HIWA 3BELA 3LCDA 4PPAA 5LCJA 2Z7SA 4IIRA 4ANBA 4AXCA 5AR3A 2V62A 1HCLA 3TZ9A 3VN9A 4AW5A 3PLAE 2VX0A 1RE8A 2HELA 5H8GA 2UW6A 4RX8A 5GZAA 2YABA 2X8DA 4GIIA 1OL2A 4IZAA 1F0QA 4FEQA 2J4ZA 4V05A 4CMOA 1U5QA 3ALOA 1P14A 4M14A 1H28A 4BCQA 2NPQA 3W16A 1YDTE 5CANA 5CAPA 5C9CA 5F20A 2YHVA 3A2CA 3OUKA 3DAEA 3W0RA 3OOGA 3OBJA 4L7FA 4EK8A 4CFWA 3R22A 5M4CA 2XAOA 5C4KA 4R1VA 4U0IA 4N0SA 3C0IA 4C62A 3GP0A 3NNWA 3E87A 4EH8A 5T68A 3GCUA 3BV2A 4RJ8A 2PZYA 4IAFA 3EL7A 4FT5A 4JG8A 4Z16A 3OT3A 4FKGA 3AC3A 3ORPA 2PUNA 3PY1A 3G90X 3BHVA 3ZLWA 5AIRA 4AUAA 3FZ1A 2YDJA 4O7WA 1OKVA 1R0PA 4JOAA 3ZO1A 4OTGA 2YM8A 3LXKA 4KIOA 5CT0A 4C59A 3LM5A 3UBDA 3QHRA 1H0VA 1UVRA 2W1HA 3MJ1A 3ROCA 4GCJA 2C1BA 2PVFA 3V5TA 4JDHA 3I6WA 1A48A 4EK4A 5HIEA 5HO8A 4O82A 3MSSA 5HCXA 2VTIA 2C0OA 1CKPA 2VO6A 4RA5A 5M4UA 1KOBA 3E7VA 4WBOA 1P4OA 4BCGA 4WG4A 1ST4A 2QOHA 3IQ7A 3IW8A 3BLAA 3UQFA 3D15A 4MD7E 2GTMA 3OEZA 4JIKA 4F9BA 3S0OA 3W8LA 5IZFA 3CGOA 4R1YA 3R02A 2XNOA 1U46A 2WMXA 3O23A 2C4GA 3Q60A 5AP1A 3HMOA 3S2PA 2X0QA 4IDTA 3RM7A 4RBLA 4D2RA 3UZPA 4YU2A 1ZMUA 3PXRA 3FI3A 5EM7A 2RFDA 3P9JA 5CVHA 5DEWA 2PL0A 4PTGA 2R3PA 3HVCA 4F65A 4F7SA 3MIYA 3SW7A 4AN2A 5E9EA 4I22A 3KN5A 4UALA 2GNJA 4OTWA 4XX9A 2ZV2A 5DE2A 2HAKA 2IZSA 5CU6A 4BCPA 3UE4A 3W32A 4C7TA 4RX5A 4PDPA 4ALUA 4RA4A 4FVQA 1H27A 3PJ3A 3ZFYA 2YAKA 3PRFA 1L3RE 5AUWA 2ZMCA 3A62A 2HWPA 5CNNA 3UO6A 3G33A 3EFLA 4AE6A 2VWUA 5HOAA 5LVNA 4FKJA 2VV9A 4IE9A 3VS7A 1NA7A 4BDDA 1FMKA 2W5BA 3D7TB 3E63A 3EN5A 4C0TA 2BMCA 3HYHA 3LW0A 4C36A 3LPBA 4FF8A 4GG5A 3HV6A 4IZ5A 5H8EA 4BKJA 3OF0A 4N6ZA 4NM3A 2QU5A 4IM0A 3SXRA 1O6KA 2V0DA 4NM0A 4Y5QA 2EVAA 2VWIA 3S3IA 3NUAA 5HNGA 3ANQA 3UQGA 3E5AA 4QP3A 2GHGA 2J90A 4TWOA 3KXMA 5L4QA 4O0RA 1DAWA 4XEYA 5LVMA 2VWBA 4BN1A 3MH3A 4RLLA 2VO3A 5L6PA 3U6JA 5IA2A 2GFSA 2YFXA 3LFQA 4GYIA 4AZTA 3Q5IA 2WU6A 4QPSA 4BKYA 1B6CB 1JBPE 3BLHA 4QTDA 1PYEA 3IS5A 4FZ7A 4IM3A 5AV2A 1BI8A 3RAIA 4AFEA 2X2MA 2VTJA 2X7FA 4ZLZA 1OKZA 2Y4IC 4DH7A 4R6VA 3FE3A 4ZTQA 3I0OA 3E92A 4QP9A 3GOPA 3HRBA 5HLNA 5EW8A 5JQ8A 2PE2A 3AGLA 4MD8E 4FA2A 3RPSA 4MD9E 5IH6A 2YIRA 4FIJA 2GS2A 3U6IA 2B52A 4EOJA 3KGAA 2B9FA 2PZIA 3PXZA 2X0PA 4O0UA 3QRKA 4ZZMA 2OJGA 2OXXA 2C69A 1YDRE 3D5UA 4YZMA 4G3EA 1YVJA 3Q4CA 4R7IA 1WBTA 2J50A 4TWCA 4ENXA 4AWIA 2SRCA 4ZLYA 1W83A 4MKCA 4WKQA 4F1TA 4XG3A 4ANSA 4AU8A 3JPVA 4DHZA 3NSZA 1PKDA 4JT3A 4KRDA 4NSTA 2XK9A 2ZV8A 4JLCA 5K9IA 2C68A 4W8EA 5IA3A 1DI8A 2CCHA 4KA3A 3SKCA 1VJYA 3QALE 3U54A 3NFFB 2FSOX 2OZAB 4TNBA 4B8MA 4PL4A 4QPMA 3BLRA 4O4FA 4UY9A 4ZAUA 2GTNA 3H9FA 4QQJA 4GVJA 2UVZA 2QG7A 4DA5A 4CRLA 4FEVA 2EXEA 4FICA 3LXPA 1ZZ2A 3OWLA 4OTHA 4E20A 4YZDA 4NM5A 3V5JA 1Y91A 3IW5A 3DFAA 5HTBA 3TNWA 4EJ7A 1MRVA 3RI1A 4FIEA 5FD2A 4AACA 4CNHA 3DPKA 3HDNA 3V3VA 5CEKA 3FSFA 4DHJA 1OBDA 2XNBA 4LOPA 2B53A 2FH9A 2GU8A 2QOIA 3GI3A 2I0VA 3CQUA 4YHFA 2KULA 2VTQA 4A06A 2F2UA 3KN6A 3VW6A 4G3GA 4BDFA 3E93A 5T3QA 2IPXA 3L9LA 4NJDA 4JVGA 3D5XA 4JI9A 4MQ1A 4FSQA 4DYMA 1WBSA 2PZ5A 4ERWA 5JGDA 2QO2A 5CQUA 2WTWA 2I0YA 2GDOA 4E6CA 4ARKA 2ITXA 3NAYA 1J91A 2C6MA 3QTXA 5HNBA 4DTKA 5BX0A 1H1RA 4BCIA 3GFWA 3Q53A 3UVPA 3E62A 3OW4A 3LZBA 3NNXA 5FM2A 4CFFA 4WG5A 4MWHA 3UQCA 1H07A 3FPQA 2OU7A 2OWBA 3BGQA 4O0XA 3UNZA 4C4IA 5C26A 4E5BA 3NCZA 1XH5A 2XF0A 3UMWA 2R2PA 4I1ZA 3BYUA 3K3JA 1VLRA 5KMLA 4TWNA 3R8VA 5IEXA 4M66A 1OIYA 3A8XA 5CYIA 4OTIA 3VONA 3U6HA 5BUJA 4G9CA 1SNUA 2C5XA 4D5HA 4RC2A 4I41A 3MFRA 4NK9A 4G3FA 4U81A 4I3ZA 2OI4X 3FSKA 5KO1A 1P2AA 1PXOA 3T9TA 4ZTMA 3QQKA 4D5KA 5LCKA 4QQ5A 3ZUUA 4GW8A 2HZIA 2QKRA 3GCQA 4C38A 4AOJA 4E4LA 5KHXA 4BTKA 4QP1A 3W0PA 2UZBA 3BU3A 1O6YA 2DYLA 3RAWA 2QLQA 2ZAZA 3I5NA 4GVAA 3PSBA 2VAGA 2BHHA 5D1JA 4EHVA 4EH9A 1QMZA 1WBWA 1QCFA 4F99A 3FZPA 3TG1A 4DG0E 4CKJA 3VF9A 4WO5A 4XG2A 5I9WA 4KRCA 3D0EA 3FXXA 4DHFA 3A7IA 3TUCA 3TDWA 3FLSA 5AUVA 4DG3E 4FNYA 4RIXB 3R21A 5E8XA 4P4CA 4AE9A 4NKAA 2J6MA 4DLIA 3FAAA 5M09A 3NMUF 3QXPA 3V8SA 2CGWA 5A6OA 3IECA 1MQ4A 4CEGA 1E1VA 2PWLA 3L8XA 5DWRA 2BAKA 4MXZA 2VX1A 4FKRA 4ZY4A 3FXZA 5CF6A 1AD5A 4BFMA 2XK3A 4D2VA 3EN4A 4V04A 5JFWA 5CZHA 4ASZA 3QQGA 1OUYA 4Y73A 5CX9A 3FLWA 3MFUA 2CKPA 4Z7GA 4AP7A 2OIQA 4BY9E 5CEIA 4LRKA 3PP0A 3UVQA 4JAIA 3C5IA 1NVSA 3HA8A 3MY0A 4P90A 4WHZA 4CFXA 4FJVA 3L8VA 1UKHA 4I94A 5LJJA 1NT2A 5EG3A 3SRVA 3ZLSA 3LFSA 3MGYA 3EQIA 3OUNB 2WTCA 2BIKB 1YDSE 3FKLA 4N4SA 3ZONA 2YA9A 2OXYA 3GC9A 1ATPE 3WE4A 4BRXA 5DIAA 3SXSA 5AR8A 3R7UA 4QDEA 5EW3A 3ORXA 4PUZA 4YJPA 3K5VA 1ZYCA 1S9JA 3R71A 4ZS0A 3RVGA 3TI1A 4G6NA 4AW2A 5JT2A 3SLSA 3K3IA 3RGFA 1UWJA 2BHEA 2CPKE 4O84A 5A4QA 2ERZE 2X2KA 5EI8A 1FVVA 3DAJA 4QYEA 2C5OA 5LWNA 5B2KA 3EQHA 4YNEA 1YHVA 4ITIA 5AV1A 1YI6A 3WZDA 3AMBA 3QTSA 3TT0A 4BTMA 4R77A 3A99A 1IA9A 5M07A 2CN8A 2YM5A 4S31A 4TXCA 2JBOA 2ITTA 4FKQA 4KNBA 2ONLA 4WT6A 4ZY5A 4EOSA 2GMXA 2Z2WA 2VN9A 2DUVA 1GIHA 3EJ1A 2WMUA 3ELJA 3R73A 1KE9A 2A1AB 1XH9A 2E9VA 3LMHA 4G5PA 4EYJA 4DTAA 3ZM4A 4XHKB 4S2ZA 3IG7A 2PVYA 4IAYA 2HZNA 3SQQA 1QPJA 2XP2A 3VBQA 1REJA 5TF9A 4Z55A 5IUHA 4I6FA 4UWBA 3EYHA 4MUQA 5FUTA 3PE1A 4IJPA 3AD5A 3H0YA 3JXWA 5LVLA 4X2FA 5HICA 4ENYA 3PFYA 2C30A 5IA5A 3UG2A 4MXOA 1GY3A 4MXYA 3DLSA 5A4LA 2W05A 3FYJX 5JH6A 4LOQA 2QHNA 5G1XA 3HV3A 3ZO2A 4NM7A 4USEA 2WOUA 3QRUA 4IB0A 4EKLA 3ZMMA 2JAVA 3L9MA 5I4NA 1H0WA 3BLQA 4NH1A 2B9JA 5A46A 1WVXA 2W4OA 1BKXA 3EQRA 4XNEA 4HYHA 4E6DA 4F6WA 4RFMA 1JWHA 1PKGA 2VWYA 1UNGA 2JFMA 3PXYA 5HORA 2Z02A 3QD2B 4NFNA 1DAYA 3UIMA 4S32A 5FXRA 4V0GB 3HUBA 4JBVA 2CLQA 5K4IA 3LQ5A 3R9DA 4U3YA 3DKGA 3H4JA 3MB6A 2BALA 3K54A 4I92A 1O6LA 4DEHA 4TYHB 2ITZA 3F3ZA 4R3CA 5EM8A 4LQMA 4M12A 1R3CA 4PP9A 2VD5A 3POZA 4QOXA 3U9CA 4BI1A 4AXFA 4FTOA 4F7NA 5C27A 4C57A 2IWIA 3CQWA 3MTFA 1YWNA 4E4NA 1Z5MA 4UWCA 3RNIA 3MESA 1M17A 2BRBA 4RRVA 4DE4A 1OB3A 1YXUA 5IQFA 2BILB 3I5ZA 3O50A 3C4XA 3O8PA 2OXDA 4I93A 4AG8A 3AKLA 1JVPP 4YTCA 4BTJA 4CFMA 4CG8A 2ZB0A 3GC8A 3AOXA 3B2TA 4O38A 4U8ZA 4O21A 3VRZA 4QPAA 2G01A 3JY0A 5HCZA 5TE0A 3TACA 4B0GA 4UYAA 3C5UA 3OTUA 3NVMB 2GHLA 4BI0A 4CZUA 4I23A 2WQEA 1YI4A 3AMYA 4G3CA 5IA0A 4E26A 4HVHA 3ATTA 3PVBA 2JKQA 2HW7A 4YLJA 3TNPC 3WF7A 4BCKA 5DHJA 3L8SA 5ANJA 2X8IA 5EHYA 4ZLOA 3UZRA 2XIKA 3FMNA 2OK1A 4MF1A 1Z9XA 3W0QA 2FUMA 3W0NA 4A4XA 3D7TA 4HNIA 4RJ3A 3TJCA 5FRIA 3OT8A 1SM2A 3D2IA 5E8VA 4AZFA 5ANEA 4UV0A 5C8MA 4B99A 4Z9LA 4QYYA 3PVUA 2JKOA 4Z3VA 2CNVA 3R9NA 5EDPA 3KL8A 3QQLA 3ZDIA 3DLZA 5AP0A 4NTSA 4AAYA 1KWPA 3PZHA 5EYKA 2BROA 4NCTA 5E92A 4AS0A 5IA4A 3V01A 3OTVA 4FSZA 5AAEA 2ETKA 3PXQA 3KY2A 4NEUA 4IB5A 1F3MC 4DEBA 3NUPA 4GFOA 3F66A 4I20A 3NAXA 2V7OA 5L6WL 3PWYA 4BWPA 4M13A 5AV4A 4J8MA 3OZ6A 1ERKA 3O17A 4CSVA 2O0UA 4EBVA 4FKIA 5L2SA 2YEXA 1Q4LA 2VWZA 4XG4A 5HE1A 1OL5A 4JQ7A 4HYSA 4BJJB 3RZFA 3GCVA 4U97A 1Q62A 2P2IA 3DDPA 5M51A 5L8KA 1R78A 4EZ3A 5ICPA 5HE3A 3RHXA 3HDMA 4IX5A 4OGRA 5CLPA 4BBEA 3O7LB 1JSVA 3CKWA 5I9ZA 3ATSA 3W55A 4CQEA 1K2PA 4NUSA 1SVGA 2W4JA 3KRRA 2WHBA 2YCQA 3T8OA 3ZRMA 4Q9ZA 5M53A 4RLKA 4CMUA 4UZDA 4YZBA 5ETCA 3PSDA 2WO6A 4A4LA 3F5GA 3ENMA 1QPDA 1WMKA 4RG0A 3SA0A 3C4WA 4E6QA 3EKNA 2C3KA 2IG7A 2JC6A 4FGRA 3P7CA 3EN7A 4BGHA 5KBQA 2PMIA 5EQYA 3NS9A 2OZAA 2P0CA 2C6TA 3BQRA 4UX9A 3IOKA 2GS6A 3I7BA 4IWQA 4RVKA 3EQDA 3U8WA 4G5JA 4NFMA 2O65A 3QTWA 3FBVA 3I7CA 5BPYA 1MP8A 2ZJWA 3C50A 5EK7A 4FIGA 4C3RA 3V5QA 3I79A 3IPHA 4L42A 3UNKA 1R39A 3O2MA 5ETAA 3Q4TA 4TPTA 4K8AA 3NIZA 4TT7A 2XANA 3LFDA 2DS1A 2ZDTA 3BRBA 4GS6A 2R0IA 3RMFA 1WVWA 4KB8A 5AV0A 2R3GA 1QPCA 1OECA 2R3QA 1I44A 4YBKA 2BRMA 2RL5A 5FEEA 2XNGA 3FXWA 1PXKA 5AV3A 4IX4A 2CKQA 3Q32A 4KKHA 2VUWA 5M08A 5IQIA 4IFCA 3IKAA 3TNQB 4FNZA 3RK7A 2P4IA 3A4OX 4WUAA 3BYMA 3CJGA 4F7LA 5BVNA 4QMYA 1JSTA 4LMUA 1A9UA 5AMNA 4RT7A 4RJ6A 5CS6A 2W1DA 4ZZNA 1XBBA 5HI2A 2OJ9A 3LXLA 5AADA 2BDFA 4OW8A 4RMZA 1TQMA 2CKOA 1YOJA 2G2HA 2PE0A 4KBCA 4BTFA 1PRYA 3DBQA 3C4EA 3DBCA 3R2YA 2RFNA 4NYEA 3AKKA 3P08A 4W4YA 5TOZA 2Q0NA 2XM9A 5J9YA 4ZJVA 1ZWSA 2YLEA 3MI9A 4K9YA 3K5UA 4ZMEA 4QDVA 3BU5A 1YXSA 3HZTA 2Z7QA 3TV7A 3ZRLA 3EOCA 5AM7A 4DFXE 3AQVA 5I9VA 3AC5A 3W2QA 2GQGA 5FDXA 2QONA 2CHLA 4YO4A 1YW2A 5HKMA 5J7HA 3NR9A 3C0HA 3KXHA 3MV5A 5IEYA 3S95A 5AUZA 4OAVB 1UNLA 3V8TA 4BDKA 1OPKA 5EFQA 2KTYA 3QCYA 3R0TA 5F95A 4BDAA 4CT2A 4E93A 1GZOA 1PW2A 3E88A 4X0MA 4EUUA 3QA0A 1KV2A 3QD3A 5A6NA 5KNJA 3QWJA 4QNAA 4YC8A 4OT5A 3HAVA 4O96A 2XK7A 5FQDC 3BEGA 3VBYA 2FGIA 2XKCA 5AP7A 2UW8A 3LE6A 4YPDA 4ACHA 5DR2A 2XUUA 5M56A 3FMEA 3HL7A 4LRMA 4UXQA 4CD0A 3GCSA 4YUQA 1URWA 4FSTA 4HZSA 3AGMA 1IEPA 1VR2A 2F49A 3DBDA 2YCSA 3Q52A 4I5CA 4X21A 1CKIA 2CJMA 4DH8A 2J5FA 3PA4A 3BE9A 4WRSA 2ETRA 5FBNC 4YBJA 3ML1A 2C47A 3KMMA 2C5YA 2PYWA 1LEZA 2ITWA 4O27B 2NRYA 5JKGA 4FTMA 5JK3A 1VEBA 1OZ1A 4MAOA 4XG8A 5K0XA 3GVUA 3WIKA 5CASA 4YJVA 3PSCA 5DG5A 1G8JA 2YWPA 2J0JA 3FC2A 4RIXA 2VZ6A 1YQJA 2XEZA 3GEQA 4FKWA 4HCVA 5J87A 4AW0A 4PRJA 4IANA 4FRFA 2YM3A 3SG9A 5DPVA 3IW7A 2XJ1A 4IDVA 4O0YA 4MQ2A 5HD4A 5IDPA 3V5WA 2ONLC 4P2KA 4FL3A 1J1BA 3DQWA 3TKHA 3NX8A 1IAHA 5CT7A 4GJ3A 4D2PA 2OF2A 2VTLA 4FKUA 2QOQA 1BMKA 3LMGA 4FT0A 3COMA 5FBOA 5K4JA 1KV1A 3I0QA 3BGPA 1DI9A 3SAYA 3FI8A 1H25A 1M2QA 4FTUA 3QQHA 4KIQA 5HU3A 3KF4A 2WTKB 4XP2A 2WTKC 3VUGA 3NYNA 5GJFA 4JRNA 2BAJA 3QTUA 4N6YA 3W0OA 2OIBA 2IZRA 3ZS5A 3O7LD 2B55A 2J5EA 2WMTA 3DT1A 3O71A 4CFUA 3W2PA 2WFYA 4QP4A 4D9TA 4OTQA 4QP6A 1PXLA 3UYTA 4IAAA 3M1SA 3QRTA 2C5VA 4I6QA 5I3RA 4XV3A 3LFCA 4R8QA 3WILA 2PHKA 4EOKA 2OW3A 2YM7A 3Q2MA 1DM2A 4HVSA 3Q4UA 1B38A 3FPMA 4C4HA 1IAJA 2YIYA 2G2IA 4H3QA 4ZTRA 5I5ZA 2WZJA 2HYYA 2VTRA 4HGSA 5HG7A 3WYXA 2BCJA 5EHOA 4IM2A 3FQEA 1AQ1A 5KX8A 4QMSA 4GSBA 4DGOA 3F69A 5BVFA 3R1SA 4QP2A 2Y4PA 5EM6A 4EBWA 4C2VA 3FL4A 4O7NA 2CN5A 3VULA 1Q24A 5GIOE 4CGAA 2PZPA 3L1SA 3OHTA 3ZZWA 4BF2A 2Q83A 2R3RA 3H9OA 3O5AA 4I24A 5CENA 2H6DA 4A9UA 4OBQA 3KXZA 4HPTE 2UVYA 1T46A 3OBGA 3NUSA 5CSWA 1PXIA 5DR9A 2XBJA 4F0FA 3SXFA 3H3CA 2X39A 4EI4A 4AQKA 1G8KA 3R01A 3NNUA 2WPAA 3ODZX 4MHAA 2P55A 3QX2A 4LRJA 1JNKA 4ZP5A 2JD5A 4AA0A 3QQJA 3ALNA 4AZSA 1PF8A 1QPEA 2WXVA 3H10A 3Q3BA 5LARA 2XK6A 3MWUA 4M0YA 3REPA 3ZXZA 2ACXA 5AIKA 5FM3A 4ITHA 2WB8A 4NT4A 3KK9A 3AT4A 4ANOA 5CEPA 4FV3A 2UUEA